(data stored in SCRATCH3701 zone)

EMBL: CP000562

ID   CP000562; SV 1; circular; genomic DNA; STD; PRO; 2478101 BP.
XX
AC   CP000562; AASI01000000-AASI01000029;
XX
PR   Project:PRJNA16330;
XX
DT   17-FEB-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Methanoculleus marisnigri JR1, complete genome.
XX
KW   .
XX
OS   Methanoculleus marisnigri JR1
OC   Archaea; Euryarchaeota; Stenosarchaea group; Methanomicrobia;
OC   Methanomicrobiales; Methanomicrobiaceae; Methanoculleus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2478101
RX   PUBMED; 21304656.
RA   Anderson I.J., Sieprawska-Lupa M., Lapidus A., Nolan M., Copeland A.,
RA   Glavina Del Rio T., Tice H., Dalin E., Barry K., Saunders E., Han C.,
RA   Brettin T., Detter J.C., Bruce D., Mikhailova N., Pitluck S., Hauser L.,
RA   Land M., Lucas S., Richardson P., Whitman W.B., Kyrpides N.C.;
RT   "Complete genome sequence of Methanoculleus marisnigri Romesser et al. 1981
RT   type strain JR1";
RL   Stand Genomic Sci 1(2):189-196(2009).
XX
RN   [2]
RP   1-2478101
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Saunders E., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Anderson I., Sieprawska-Lupa M.,
RA   Whitman W., Woese C., Richardson P.;
RT   "Complete sequence of Methanoculleus marisnigri JR1";
RL   Unpublished.
XX
RN   [3]
RP   1-2478101
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Saunders E., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Anderson I., Sieprawska-Lupa M.,
RA   Whitman W., Woese C., Richardson P.;
RT   ;
RL   Submitted (12-FEB-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 688bde03f45650bbb1826f0225435ed2.
DR   BioSample; SAMN02598365.
DR   EnsemblGenomes-Gn; EBG00001194183.
DR   EnsemblGenomes-Gn; EBG00001194184.
DR   EnsemblGenomes-Gn; EBG00001194185.
DR   EnsemblGenomes-Gn; EBG00001194186.
DR   EnsemblGenomes-Gn; EBG00001194187.
DR   EnsemblGenomes-Gn; EBG00001194188.
DR   EnsemblGenomes-Gn; EBG00001194189.
DR   EnsemblGenomes-Gn; EBG00001194190.
DR   EnsemblGenomes-Gn; EBG00001194191.
DR   EnsemblGenomes-Gn; EBG00001194192.
DR   EnsemblGenomes-Gn; EBG00001194193.
DR   EnsemblGenomes-Gn; EBG00001194194.
DR   EnsemblGenomes-Gn; EBG00001194195.
DR   EnsemblGenomes-Gn; EBG00001194196.
DR   EnsemblGenomes-Gn; EBG00001194197.
DR   EnsemblGenomes-Gn; EBG00001194198.
DR   EnsemblGenomes-Gn; EBG00001194199.
DR   EnsemblGenomes-Gn; EBG00001194200.
DR   EnsemblGenomes-Gn; EBG00001194201.
DR   EnsemblGenomes-Gn; EBG00001194202.
DR   EnsemblGenomes-Gn; EBG00001194203.
DR   EnsemblGenomes-Gn; EBG00001194204.
DR   EnsemblGenomes-Gn; EBG00001194205.
DR   EnsemblGenomes-Gn; EBG00001194206.
DR   EnsemblGenomes-Gn; EBG00001194207.
DR   EnsemblGenomes-Gn; EBG00001194208.
DR   EnsemblGenomes-Gn; EBG00001194209.
DR   EnsemblGenomes-Gn; EBG00001194210.
DR   EnsemblGenomes-Gn; EBG00001194211.
DR   EnsemblGenomes-Gn; EBG00001194212.
DR   EnsemblGenomes-Gn; EBG00001194213.
DR   EnsemblGenomes-Gn; EBG00001194214.
DR   EnsemblGenomes-Gn; EBG00001194215.
DR   EnsemblGenomes-Gn; EBG00001194216.
DR   EnsemblGenomes-Gn; EBG00001194217.
DR   EnsemblGenomes-Gn; EBG00001194218.
DR   EnsemblGenomes-Gn; EBG00001194219.
DR   EnsemblGenomes-Gn; EBG00001194220.
DR   EnsemblGenomes-Gn; EBG00001194222.
DR   EnsemblGenomes-Gn; EBG00001194223.
DR   EnsemblGenomes-Gn; EBG00001194224.
DR   EnsemblGenomes-Gn; EBG00001194225.
DR   EnsemblGenomes-Gn; EBG00001194226.
DR   EnsemblGenomes-Gn; EBG00001194227.
DR   EnsemblGenomes-Gn; EBG00001194228.
DR   EnsemblGenomes-Gn; EBG00001194229.
DR   EnsemblGenomes-Gn; EBG00001194230.
DR   EnsemblGenomes-Gn; EBG00001194231.
DR   EnsemblGenomes-Gn; EBG00001194232.
DR   EnsemblGenomes-Gn; EBG00001194233.
DR   EnsemblGenomes-Gn; EBG00001194234.
DR   EnsemblGenomes-Gn; EBG00001194235.
DR   EnsemblGenomes-Gn; EBG00001194236.
DR   EnsemblGenomes-Gn; EBG00001194237.
DR   EnsemblGenomes-Gn; EBG00001194238.
DR   EnsemblGenomes-Gn; EBG00001194239.
DR   EnsemblGenomes-Gn; Memar_R0001.
DR   EnsemblGenomes-Gn; Memar_R0002.
DR   EnsemblGenomes-Gn; Memar_R0003.
DR   EnsemblGenomes-Gn; Memar_R0004.
DR   EnsemblGenomes-Gn; Memar_R0005.
DR   EnsemblGenomes-Gn; Memar_R0006.
DR   EnsemblGenomes-Gn; Memar_R0007.
DR   EnsemblGenomes-Gn; Memar_R0008.
DR   EnsemblGenomes-Gn; Memar_R0009.
DR   EnsemblGenomes-Gn; Memar_R0010.
DR   EnsemblGenomes-Gn; Memar_R0011.
DR   EnsemblGenomes-Gn; Memar_R0012.
DR   EnsemblGenomes-Gn; Memar_R0013.
DR   EnsemblGenomes-Gn; Memar_R0014.
DR   EnsemblGenomes-Gn; Memar_R0015.
DR   EnsemblGenomes-Gn; Memar_R0016.
DR   EnsemblGenomes-Gn; Memar_R0017.
DR   EnsemblGenomes-Gn; Memar_R0018.
DR   EnsemblGenomes-Gn; Memar_R0019.
DR   EnsemblGenomes-Gn; Memar_R0020.
DR   EnsemblGenomes-Gn; Memar_R0021.
DR   EnsemblGenomes-Gn; Memar_R0022.
DR   EnsemblGenomes-Gn; Memar_R0023.
DR   EnsemblGenomes-Gn; Memar_R0024.
DR   EnsemblGenomes-Gn; Memar_R0025.
DR   EnsemblGenomes-Gn; Memar_R0026.
DR   EnsemblGenomes-Gn; Memar_R0027.
DR   EnsemblGenomes-Gn; Memar_R0028.
DR   EnsemblGenomes-Gn; Memar_R0029.
DR   EnsemblGenomes-Gn; Memar_R0030.
DR   EnsemblGenomes-Gn; Memar_R0031.
DR   EnsemblGenomes-Gn; Memar_R0032.
DR   EnsemblGenomes-Gn; Memar_R0033.
DR   EnsemblGenomes-Gn; Memar_R0034.
DR   EnsemblGenomes-Gn; Memar_R0035.
DR   EnsemblGenomes-Gn; Memar_R0036.
DR   EnsemblGenomes-Gn; Memar_R0037.
DR   EnsemblGenomes-Gn; Memar_R0038.
DR   EnsemblGenomes-Gn; Memar_R0039.
DR   EnsemblGenomes-Gn; Memar_R0040.
DR   EnsemblGenomes-Gn; Memar_R0041.
DR   EnsemblGenomes-Gn; Memar_R0042.
DR   EnsemblGenomes-Gn; Memar_R0043.
DR   EnsemblGenomes-Gn; Memar_R0044.
DR   EnsemblGenomes-Gn; Memar_R0045.
DR   EnsemblGenomes-Gn; Memar_R0046.
DR   EnsemblGenomes-Gn; Memar_R0047.
DR   EnsemblGenomes-Gn; Memar_R0048.
DR   EnsemblGenomes-Gn; Memar_R0049.
DR   EnsemblGenomes-Gn; Memar_R0050.
DR   EnsemblGenomes-Gn; Memar_R0051.
DR   EnsemblGenomes-Gn; Memar_R0052.
DR   EnsemblGenomes-Gn; Memar_R0053.
DR   EnsemblGenomes-Tr; EBT00001772397.
DR   EnsemblGenomes-Tr; EBT00001772398.
DR   EnsemblGenomes-Tr; EBT00001772399.
DR   EnsemblGenomes-Tr; EBT00001772400.
DR   EnsemblGenomes-Tr; EBT00001772401.
DR   EnsemblGenomes-Tr; EBT00001772402.
DR   EnsemblGenomes-Tr; EBT00001772403.
DR   EnsemblGenomes-Tr; EBT00001772404.
DR   EnsemblGenomes-Tr; EBT00001772405.
DR   EnsemblGenomes-Tr; EBT00001772406.
DR   EnsemblGenomes-Tr; EBT00001772407.
DR   EnsemblGenomes-Tr; EBT00001772408.
DR   EnsemblGenomes-Tr; EBT00001772409.
DR   EnsemblGenomes-Tr; EBT00001772410.
DR   EnsemblGenomes-Tr; EBT00001772411.
DR   EnsemblGenomes-Tr; EBT00001772412.
DR   EnsemblGenomes-Tr; EBT00001772413.
DR   EnsemblGenomes-Tr; EBT00001772414.
DR   EnsemblGenomes-Tr; EBT00001772415.
DR   EnsemblGenomes-Tr; EBT00001772416.
DR   EnsemblGenomes-Tr; EBT00001772417.
DR   EnsemblGenomes-Tr; EBT00001772418.
DR   EnsemblGenomes-Tr; EBT00001772419.
DR   EnsemblGenomes-Tr; EBT00001772420.
DR   EnsemblGenomes-Tr; EBT00001772421.
DR   EnsemblGenomes-Tr; EBT00001772422.
DR   EnsemblGenomes-Tr; EBT00001772423.
DR   EnsemblGenomes-Tr; EBT00001772424.
DR   EnsemblGenomes-Tr; EBT00001772425.
DR   EnsemblGenomes-Tr; EBT00001772426.
DR   EnsemblGenomes-Tr; EBT00001772427.
DR   EnsemblGenomes-Tr; EBT00001772428.
DR   EnsemblGenomes-Tr; EBT00001772429.
DR   EnsemblGenomes-Tr; EBT00001772430.
DR   EnsemblGenomes-Tr; EBT00001772431.
DR   EnsemblGenomes-Tr; EBT00001772432.
DR   EnsemblGenomes-Tr; EBT00001772433.
DR   EnsemblGenomes-Tr; EBT00001772434.
DR   EnsemblGenomes-Tr; EBT00001772435.
DR   EnsemblGenomes-Tr; EBT00001772437.
DR   EnsemblGenomes-Tr; EBT00001772438.
DR   EnsemblGenomes-Tr; EBT00001772439.
DR   EnsemblGenomes-Tr; EBT00001772440.
DR   EnsemblGenomes-Tr; EBT00001772441.
DR   EnsemblGenomes-Tr; EBT00001772442.
DR   EnsemblGenomes-Tr; EBT00001772443.
DR   EnsemblGenomes-Tr; EBT00001772444.
DR   EnsemblGenomes-Tr; EBT00001772445.
DR   EnsemblGenomes-Tr; EBT00001772446.
DR   EnsemblGenomes-Tr; EBT00001772447.
DR   EnsemblGenomes-Tr; EBT00001772448.
DR   EnsemblGenomes-Tr; EBT00001772449.
DR   EnsemblGenomes-Tr; EBT00001772450.
DR   EnsemblGenomes-Tr; EBT00001772451.
DR   EnsemblGenomes-Tr; EBT00001772452.
DR   EnsemblGenomes-Tr; EBT00001772453.
DR   EnsemblGenomes-Tr; Memar_R0001-1.
DR   EnsemblGenomes-Tr; Memar_R0002-1.
DR   EnsemblGenomes-Tr; Memar_R0003-1.
DR   EnsemblGenomes-Tr; Memar_R0004-1.
DR   EnsemblGenomes-Tr; Memar_R0005-1.
DR   EnsemblGenomes-Tr; Memar_R0006-1.
DR   EnsemblGenomes-Tr; Memar_R0007-1.
DR   EnsemblGenomes-Tr; Memar_R0008-1.
DR   EnsemblGenomes-Tr; Memar_R0009-1.
DR   EnsemblGenomes-Tr; Memar_R0010-1.
DR   EnsemblGenomes-Tr; Memar_R0011-1.
DR   EnsemblGenomes-Tr; Memar_R0012-1.
DR   EnsemblGenomes-Tr; Memar_R0013-1.
DR   EnsemblGenomes-Tr; Memar_R0014-1.
DR   EnsemblGenomes-Tr; Memar_R0015-1.
DR   EnsemblGenomes-Tr; Memar_R0016-1.
DR   EnsemblGenomes-Tr; Memar_R0017-1.
DR   EnsemblGenomes-Tr; Memar_R0018-1.
DR   EnsemblGenomes-Tr; Memar_R0019-1.
DR   EnsemblGenomes-Tr; Memar_R0020-1.
DR   EnsemblGenomes-Tr; Memar_R0021-1.
DR   EnsemblGenomes-Tr; Memar_R0022-1.
DR   EnsemblGenomes-Tr; Memar_R0023-1.
DR   EnsemblGenomes-Tr; Memar_R0024-1.
DR   EnsemblGenomes-Tr; Memar_R0025-1.
DR   EnsemblGenomes-Tr; Memar_R0026-1.
DR   EnsemblGenomes-Tr; Memar_R0027-1.
DR   EnsemblGenomes-Tr; Memar_R0028-1.
DR   EnsemblGenomes-Tr; Memar_R0029-1.
DR   EnsemblGenomes-Tr; Memar_R0030-1.
DR   EnsemblGenomes-Tr; Memar_R0031-1.
DR   EnsemblGenomes-Tr; Memar_R0032-1.
DR   EnsemblGenomes-Tr; Memar_R0033-1.
DR   EnsemblGenomes-Tr; Memar_R0034-1.
DR   EnsemblGenomes-Tr; Memar_R0035-1.
DR   EnsemblGenomes-Tr; Memar_R0036-1.
DR   EnsemblGenomes-Tr; Memar_R0037-1.
DR   EnsemblGenomes-Tr; Memar_R0038-1.
DR   EnsemblGenomes-Tr; Memar_R0039-1.
DR   EnsemblGenomes-Tr; Memar_R0040-1.
DR   EnsemblGenomes-Tr; Memar_R0041-1.
DR   EnsemblGenomes-Tr; Memar_R0042-1.
DR   EnsemblGenomes-Tr; Memar_R0043-1.
DR   EnsemblGenomes-Tr; Memar_R0044-1.
DR   EnsemblGenomes-Tr; Memar_R0045-1.
DR   EnsemblGenomes-Tr; Memar_R0046-1.
DR   EnsemblGenomes-Tr; Memar_R0047-1.
DR   EnsemblGenomes-Tr; Memar_R0048-1.
DR   EnsemblGenomes-Tr; Memar_R0049-1.
DR   EnsemblGenomes-Tr; Memar_R0050-1.
DR   EnsemblGenomes-Tr; Memar_R0051-1.
DR   EnsemblGenomes-Tr; Memar_R0052-1.
DR   EnsemblGenomes-Tr; Memar_R0053-1.
DR   EuropePMC; PMC2222616; 18042280.
DR   EuropePMC; PMC2394919; 18378655.
DR   EuropePMC; PMC2686161; 19495416.
DR   EuropePMC; PMC3027613; 21297863.
DR   EuropePMC; PMC3035220; 21304656.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01133; sR3.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000562.
DR   SILVA-SSU; CP000562.
DR   StrainInfo; 267484; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001178
CC   Source DNA and archaea available from William Whitman
CC   (whitman@uga.edu)
CC   Contacts: William Whitman (whitman@uga.edu)
CC             Iain J. Anderson (IJAnderson@lbl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2478101
FT                   /organism="Methanoculleus marisnigri JR1"
FT                   /strain="JR1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:368407"
FT   gene            469..1752
FT                   /locus_tag="Memar_0001"
FT   CDS_pept        469..1752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0001"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: mhu:Mhun_2471 AAA ATPase,
FT                   central region"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55936"
FT                   /db_xref="GOA:A3CRD6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CRD6"
FT                   /protein_id="ABN55936.1"
FT                   /translation="MSDDKTSPMGLFKKYLTNRRIFKNREVLRHNYRPQILPHRKPQID
FT                   EIASILAPALTNETPSNILIYGKTGTGKTASVRYVGTELENASALAGTKCKIVHLNCEV
FT                   IDTQYRVLAQIANGLDNADEHPSDSTRSHIPMTGWPTDQVYMELKNQLESSGGVMVIIL
FT                   DEIDKLVKKSGDDTLYNLTRINSDLKFAKVSIIGISNDLRFTDFLDPRVLSSLSEEEIV
FT                   FPPYNAPQLCDILQQRAEMAFVEGALDETVIPLCAALAAQEHGDARRALDLLRVSGELA
FT                   DRENASGVAEKHVRMAQEKIETDSMVECISTLPTQSKAVLYAMLILEQMGKRIFTSGEV
FT                   TVVYREIARIIDLDVLTHRRITDLISELNMLGVINTRVISRGRYGRTKEMWFDAATSKI
FT                   EEVVTRDPRLDDERLKKLDVNRLRAMFR"
FT   gene            1757..2248
FT                   /locus_tag="Memar_0002"
FT   CDS_pept        1757..2248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0002"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   mhu:Mhun_2472 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55937"
FT                   /db_xref="GOA:A3CRD7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRD7"
FT                   /protein_id="ABN55937.1"
FT                   /translation="MDEKDRILLHLLEENCRTPVSELAVLAEMSEQDVKDRIGRLEVAG
FT                   AIRRYGAVVDWERAGDGNVAAVLELKVSPERDFGYDRIAERITRFPQVRSLRLMTGAYD
FT                   LQILVTGPSMHEIARFVSEQIAPMDRIRETATHIIMKTYKENGTTFAEREEVERLPYSF
FT                   "
FT   gene            2259..3419
FT                   /locus_tag="Memar_0003"
FT   CDS_pept        2259..3419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0003"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mhu:Mhun_2473 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55938"
FT                   /db_xref="GOA:A3CRD8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRD8"
FT                   /protein_id="ABN55938.1"
FT                   /translation="MRDFVSKRARAIPPSGIRKFFDIAQTMEDVISLGVGEPDFVTPWC
FT                   VCEASIYSIEQGSTAYTSNKGTPRLRAAISRYLDTRFSTHYDPEAEIIVTCGVSEAADI
FT                   AIRAVTDPGDEILVAEPCYVSYNPCVSLAGGTPVPVLCRAEDEFRLTADALAESITPRT
FT                   KALIANFPNNPTGGVMEEADWHAIADLLVDHDLLLISDEVYAELTYDGDHFSPARIPEL
FT                   RERTITLNGFSKAFAMTGWRIGYLCAPPEIAAAALKIHQYVALCAPVMGQIAAYEALRN
FT                   GEAEKDAMVREYRLRRNLFVDGLNKLGLVCHVPKGAFYAFPSVESTGMTDVEFAEGLLR
FT                   EQHVAVVPGSALGPSGAGHVRCAYAVSRDDLKEALSRMGAFLGSVK"
FT   gene            3712..3990
FT                   /locus_tag="Memar_0004"
FT   CDS_pept        3712..3990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55939"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRD9"
FT                   /protein_id="ABN55939.1"
FT                   /translation="MRQPVIPLRRKFHWKQRGQDPVGDRVGADPQKPGLIYNDLCRWKP
FT                   EIYANIAVQRRRYSTCTLHLPGHLPRLLPGRGPLVRTLQGLLKPGCL"
FT   gene            4036..5076
FT                   /locus_tag="Memar_0005"
FT   CDS_pept        4036..5076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0005"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   mhu:Mhun_2319 adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55940"
FT                   /db_xref="GOA:A3CRE0"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRE0"
FT                   /protein_id="ABN55940.1"
FT                   /translation="MYHSILLDRTMSCTIIVGGFFGDEGKGKIVAHIAHQDRPSIISRG
FT                   GVGPNAGHTVCIGEKEYGVRMVPSGFVYPEATLMIGSGVLVDPRVFLREVDLVGVRDRI
FT                   FVDGRCGVIEEDHIARDKASDHLSKKIGSTGTGCGPANADRVLRTSRQAKDVPELAGFI
FT                   TDVAEDVNRALDSDEVVLLEGTQGFGISLYFGTYPFVTSKDTSASQIAADNGVGPTRVD
FT                   DVIVVFKAYPTRVGEGPFSTEMSAARSHELGIEEFGTVTHRQRRIGTWDGKMARYSAMI
FT                   NGCTQAAITGIDRVDPACFGATEYDQLTKAARDFITQAEKDIGKPVTLISTGPEMSQII
FT                   DLRSEL"
FT   gene            5073..5258
FT                   /locus_tag="Memar_0006"
FT   CDS_pept        5073..5258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0006"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   mhu:Mhun_2320 protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55941"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRE1"
FT                   /protein_id="ABN55941.1"
FT                   /translation="MRKNLMEILCCPVCKGELELTVTEESGEEVLEGTLRCAACSVDYP
FT                   ISEGIPNLLPQTACED"
FT   gene            5267..5791
FT                   /locus_tag="Memar_0007"
FT   CDS_pept        5267..5791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55942"
FT                   /db_xref="GOA:A3CRE2"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRE2"
FT                   /protein_id="ABN55942.1"
FT                   /translation="MTEIHLNRRGINSIEVPDEVEATPGSDLVLRIINHGSPLHITLAS
FT                   PNSSAFTGFFHENLYVSRSEEFSIPIRENGYPGTFNIEVIAGYGTRKAEFRVVVRERAA
FT                   PEPEPVEVPATPAVPATSMRWRSSVPVLLLAAAALVLYVLWLVYRVDLLNAAAFAVLLI
FT                   GVVLAWLRQRS"
FT   gene            5770..6690
FT                   /locus_tag="Memar_0008"
FT   CDS_pept        5770..6690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0008"
FT                   /product="adenosylcobinamide-phosphate synthase"
FT                   /EC_number="6.3.1.10"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: mhu:Mhun_2321
FT                   cobalamin biosynthesis protein CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55943"
FT                   /db_xref="GOA:A3CRE3"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRE3"
FT                   /protein_id="ABN55943.1"
FT                   /translation="MAAAAVVVAASLLVDRLVGDPHSRYHPVAILGRFIGWWGVPARYP
FT                   PGIQRVAGVAGAVLTVALFAAPFALVQFAAPWYLYLLLAPFLLKTCLAWRALEEHAAAV
FT                   VQALDDGGIDAGRCEVGMMVSRDTARLDPEHVLSAAYESMTENLVDSIVSPLFYFGLFG
FT                   LTGAAAFRAVNTLDAMLGYRDERLRLGWFPARADDIANFVPARLTGLILLAYFAAKGRF
FT                   GPAWAALRRDAKKRPGFNGGIPMAVIAGGVGVRLEKPGAYTIGDPERTLAEAGAGIVRA
FT                   VRAATIIFAILEIAALFLLWSMSYT"
FT   gene            6696..7592
FT                   /locus_tag="Memar_0009"
FT   CDS_pept        6696..7592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0009"
FT                   /product="pyridoxal phosphate synthase yaaD subunit"
FT                   /note="TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; KEGG: mhu:Mhun_2322
FT                   vitamin B6 biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55944"
FT                   /db_xref="GOA:A3CRE4"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRE4"
FT                   /protein_id="ABN55944.1"
FT                   /translation="MKLEELRFGTELIKRGFASMQKGGVIMDVVNAEQAQLAEEAGAVA
FT                   VMALERVPADIRAAGGVARMADPQKIVEIIDAVSIPVMGKARIGHFVEAQMLEALGVDM
FT                   VDESEVLTPADEQFHIDKTGFGVPFVCGARNLGEALRRINEGAAMIRTKGEAGTGNVVE
FT                   AVRHMRAIMGGIRALKGLSSQELVDCARDIEAPVELVIECAQRGRLPVVNFSAGGIATP
FT                   ADAALMMQLGADGVFVGSGIFKSTNPEATARAIVEAVNHYDDAKVIAEVSRGLGAAMKG
FT                   LDVHLLREDEVLQTRGR"
FT   gene            7582..8160
FT                   /locus_tag="Memar_0010"
FT   CDS_pept        7582..8160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0010"
FT                   /product="pyridoxal phosphate synthase yaaE subunit"
FT                   /note="PFAM: SNO glutamine amidotransferase; KEGG:
FT                   mhu:Mhun_2323 SNO glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55945"
FT                   /db_xref="GOA:A3CRE5"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CRE5"
FT                   /protein_id="ABN55945.1"
FT                   /translation="MGVKVGVLALQGDVAEHIAAFREALAERPGSSVAPIRRAEDLADL
FT                   DALAIPGGESTTISRLMGKNGLYEPVAEFEGGVFATCAGMVLSADRVDDPRVRPLSLIP
FT                   MHVARNAFGRQVDSRETMLEVAGLAEPFRAVFIRAPVATEAGDGVEVLARIPEGIVAVR
FT                   HGRHMAFAFHPELGGDLRLHRVFLEGLEV"
FT   gene            complement(8169..8531)
FT                   /locus_tag="Memar_0011"
FT   CDS_pept        complement(8169..8531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0011"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: mhu:Mhun_0873
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55946"
FT                   /db_xref="GOA:A3CRE6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRE6"
FT                   /protein_id="ABN55946.1"
FT                   /translation="MALPEGIEEALCRCGGIAGLMERLPGNEALERESALFRALADPLR
FT                   LKILAMLAVQPLCVCVIREVLGIADSKLSYHLAVLKKAGLVAGEAQGNWIIYSLTDLGG
FT                   AVWARRIGTAKDREKE"
FT   gene            8792..9724
FT                   /locus_tag="Memar_0012"
FT   CDS_pept        8792..9724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0012"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   mtp:Mthe_1418 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55947"
FT                   /db_xref="GOA:A3CRE7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRE7"
FT                   /protein_id="ABN55947.1"
FT                   /translation="MTERVTESVDIASVLKTYAPTIVLLAVIVGLTAWSFSTGMSAKEG
FT                   APAVTLMVAVLLVVVGLAAGMLGGIIGAGGCSVMLPILHFYLGYPVPIAIGTTLFAVIF
FT                   TAISGGYGHLIRKNLDVKTTLWLGGFGIIGVVIGSYVFNLLSDQTALLGLILGIAFLLP
FT                   AVRMIFEGVAHRKKSQPEGNVIPGSEGRKGLLGFVVGILTGLVGLGGGYALVPGLIYLF
FT                   NAPVYVTMGTSLATIIPLAVVGGGIKLAEGYVAIGAALLLAAGTIVGAQLGAAVIKKFH
FT                   PATLKLIFGVYFLYVSVKFILAYFGIAIF"
FT   gene            complement(9940..10323)
FT                   /locus_tag="Memar_0013"
FT   CDS_pept        complement(9940..10323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0013"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: mhu:Mhun_0873
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55948"
FT                   /db_xref="GOA:A3CRE8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRE8"
FT                   /protein_id="ABN55948.1"
FT                   /translation="MTEDEIYRGASLSLPPDVEESLCQCGGIAGLVEQLPEEGILERES
FT                   ALFRALADPFRLKILAMLAVQPLCVCVIKIVLGIADSKLSYHLSVLKTAGLIVGEAQGN
FT                   WIIYRLTGEGSAWAQQIAGNARS"
FT   gene            10499..10744
FT                   /locus_tag="Memar_0014"
FT   CDS_pept        10499..10744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55949"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRE9"
FT                   /protein_id="ABN55949.1"
FT                   /translation="MTSTSTLFETRTFIGWRYHNISNNVETMERSTMTDDTSKNRKEGT
FT                   AGRIKNLFAPESDCGCGGGCCGNVKIVPKKTDEKKE"
FT   gene            10842..11747
FT                   /locus_tag="Memar_0015"
FT   CDS_pept        10842..11747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0015"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: mhu:Mhun_0864 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55950"
FT                   /db_xref="GOA:A3CRF0"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRF0"
FT                   /protein_id="ABN55950.1"
FT                   /translation="MDAASNLITAGEFFVVIAGELVLLFVGITFLVGLLQAYIPEERIR
FT                   SVLAGRRQGAGNVLSAGFGALTPFCSCSTIPILLGLLDIGVPFGVCMSFLLASPLLNPV
FT                   ILALLVALVGIVPTAIYAALTFTAAIVIGWLLGRLGYARYVKDVMVEGRPEPCGCNSSH
FT                   GTRIRGAFSFAVRLFQQVFPYLILGAGIGAFIYGFIPGDLIVSLAGPDNPLAIPVAAVI
FT                   GIPMYIRAETLIPVSAVLLEKGMGIGAVMALIIGGAGASIPEVTLLAAIFERRLVAAFV
FT                   AVILGVAVLAGAAFQVLAAI"
FT   gene            11805..12884
FT                   /locus_tag="Memar_0016"
FT   CDS_pept        11805..12884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0016"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: mhu:Mhun_0862 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55951"
FT                   /db_xref="GOA:A3CRF1"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRF1"
FT                   /protein_id="ABN55951.1"
FT                   /translation="MIEILIGALASGLAAVLDYLSAHVLTCLVPAFFIAGAIAAFVKKD
FT                   AILKYFSPDAPRHISYGIASVSGTVLAVCSCTILPIFAGILKKGSGIGPATTFLFAGPA
FT                   INILAIIYTAWVLGFDLGIARAVSAVLLAIVIGLAMALIFRSTDVETLKRKAMAPSVAG
FT                   ACEEEKPRWVTPAFFALLVGVLVFGASPLDWTLRLSIVYILTLAIAILLIYYFDRDEVT
FT                   DWGMETWDLTKKIFPILIAGTFLVGIIAFFLPPETFQPYFGNNSLGANFLAAVVGMILY
FT                   MPTLLEVPIIGTTFGYTSGHMAAGPALALLLAGPTISLPSVLVISRIVGAKKTAAYVGL
FT                   VVVFATIAGFLYGNGMLLI"
FT   gene            12895..13164
FT                   /locus_tag="Memar_0017"
FT   CDS_pept        12895..13164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55952"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRF2"
FT                   /protein_id="ABN55952.1"
FT                   /translation="METEKREKPCCAAEALRRVRRIEVGGVVVGLAMLDDILADTVARN
FT                   LSGETAIGDELIKQVKIYNYIPKGAEPLYRAALLCEYQNEVKKQ"
FT   gene            13161..13394
FT                   /locus_tag="Memar_0018"
FT   CDS_pept        13161..13394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0018"
FT                   /product="redox-active disulfide protein 2"
FT                   /note="TIGRFAM: redox-active disulfide protein 2; KEGG:
FT                   mtp:Mthe_0691 redox-active disulfide protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55953"
FT                   /db_xref="GOA:A3CRF3"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRF3"
FT                   /protein_id="ABN55953.1"
FT                   /translation="MKIEVLGTGCAKCKRLAKNVEAAIKDLGIEAELVKVDDITEIMDR
FT                   GVMLTPALAVDGELKVSGRVADVKEIKEILQG"
FT   gene            13428..13670
FT                   /locus_tag="Memar_0019"
FT   CDS_pept        13428..13670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0019"
FT                   /product="redox-active disulfide protein 2"
FT                   /note="TIGRFAM: redox-active disulfide protein 2; KEGG:
FT                   mma:MM0737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55954"
FT                   /db_xref="GOA:A3CRF4"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRF4"
FT                   /protein_id="ABN55954.1"
FT                   /translation="MVLVEIFGTGCARCKRMNRNVEIAVGDLEIDAEIRKIESLDAMIE
FT                   RGVMLTPALYVDGEAKVVGHVPCVEDIKQILLGEK"
FT   gene            13672..14526
FT                   /locus_tag="Memar_0020"
FT   CDS_pept        13672..14526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55955"
FT                   /db_xref="InterPro:IPR014958"
FT                   /db_xref="InterPro:IPR021219"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRF5"
FT                   /protein_id="ABN55955.1"
FT                   /translation="MTEQNTPRCACESGIEPEGGTKRIIFACAGASKAGQLTNEAAVRL
FT                   TKEGYGKIACTASLAVSTPSITKKVEAADEVVVIDGCPVGCARQIAEKAGITPDQEIVV
FT                   TDLGIEKGGGLDLSEEDVETVVSAAWEGKGRTEEEKGRRPSGGCGCGCGGSMDTLVIEW
FT                   RHIGRDIENTCERCGATGRAVMDVVEQIRPILEEEGIAVRVVETVLENEAITESNSILF
FT                   NGVALEILIEGMEVTSTPCASCSCITGQDDVECRAVEYNGERYESIPPELIARAALKAL
FT                   GLE"
FT   gene            14670..15635
FT                   /locus_tag="Memar_0021"
FT   CDS_pept        14670..15635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0021"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: mhu:Mhun_0242 daunorubicin resistance ABC
FT                   transporter ATP-binding subunit; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55956"
FT                   /db_xref="GOA:A3CRF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRF6"
FT                   /protein_id="ABN55956.1"
FT                   /translation="MIKENRDDPSAGGPNVIEVENLTKTFGAVTAVDCVSFHVRRGEIF
FT                   GFLGPNGAGKTTTTRMLTGVVPMDGGSVRIFGHDILKEPVQAKQRFGVVPETSNAYVEL
FT                   TAWQNLMLMGDLYGLDRAHSERRSRELLETLGLYGRRDQKVRGYSKGMKQRLVLAMALL
FT                   HEPELLFLDEPTSGLDVQSTQMILVLLRELNTDGTTIFLTTHNMEEVNRLCDRIGIIRA
FT                   GKIVAIDAPERLKTAIDRMHRLEVSFDRPVPADALAGLDGVAEAYRTGDKWRIVTEDPD
FT                   LVIRSLVAFSGDCSVAILTLNTLAPSLDEVFLRLTGEEQP"
FT   gene            15632..16387
FT                   /locus_tag="Memar_0022"
FT   CDS_pept        15632..16387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0022"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mhu:Mhun_0243
FT                   ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55957"
FT                   /db_xref="GOA:A3CRF7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRF7"
FT                   /protein_id="ABN55957.1"
FT                   /translation="MNPAAYGEQARRAWAIARKDIRVYYLKGPVLIFGIFMPVFLFLAF
FT                   FLGGRDLPLAFLLSGLVGMTLFFTATAVSPAIFPWEGQARTLERLAACPVTIEAIVLGD
FT                   MIASVLFGIGVTAVTILLALGLGLPLLHGIVLGIAVLIAACCFSAIGVLLAVPPTNVPS
FT                   NIMMLSTLLKFPLVFISGIFVPLEQMPAWGLMLAACSPLTYFTDVVRYAFSGAHHFPVV
FT                   VDIAALTLFALVFTAAAMYLHRRSMPRRI"
FT   gene            16441..16833
FT                   /locus_tag="Memar_0023"
FT   CDS_pept        16441..16833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55958"
FT                   /db_xref="InterPro:IPR021219"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRF8"
FT                   /protein_id="ABN55958.1"
FT                   /translation="MKKELVIEWKHAEGNIEKTPEEFEETGMTLAAVLAEIRMLLEMEG
FT                   VGVRVVETVLPDDAAAESESLLFNGIPVEQLLEGVEVTATACACASCESCGGDAECRTL
FT                   RYNGEEYEAIPPELIGRAAAKALEME"
FT   gene            17082..18164
FT                   /locus_tag="Memar_0024"
FT   CDS_pept        17082..18164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0024"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: mac:MA4536
FT                   ABC transporter, solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55959"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRF9"
FT                   /protein_id="ABN55959.1"
FT                   /translation="MVAITRRCHLLLTLLCICGVLLCTSAACTTVRGTDSPAENRTITD
FT                   MAGRTVAVPSEIESIACTSPPSTMLVYMVAPDRLAGWNFAPEEGYIPERYMALPVVGGW
FT                   FRKETGNYETFISMHPDIVVEGYTTDGGAAHVTVAERQQKMGSIPVVAVEDTTNATRYS
FT                   GPIRFMGGLLGEEEQAEAMIAFYEGVLATVTERVASIPDDERVAVYYAEGPKGLMTDPS
FT                   GSPHAELIDLCGGRNVAECAITPGMGMTEVSMEQVIAWNPDVVLVHDPGFYATVRTDPL
FT                   WQEIAAVKTDRVYLIPQTAFCWFDRPPGINRIVGIPWTAKVLYPNLFADMDLESLVREY
FT                   HETFIHVSLSDDRIREILNP"
FT   sig_peptide     17082..17165
FT                   /locus_tag="Memar_0024"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.455 at
FT                   residue 28"
FT   gene            18172..18813
FT                   /locus_tag="Memar_0025"
FT   CDS_pept        18172..18813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0025"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: putative RNA methylase; Methyltransferase type
FT                   11; Methyltransferase type 12; KEGG: mmp:MMP1179 SAM (and
FT                   some other nucleotide) binding motif:generic
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55960"
FT                   /db_xref="GOA:A3CRG0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRG0"
FT                   /protein_id="ABN55960.1"
FT                   /translation="MGYVPGRFDRDGAEDMDRIAKTIFAPIYPVIAQQIIERCGISRGR
FT                   CLDIGSGPGSLGIALAQASALAVTLLDSSPEMIAIAGGNVREAGLSGRVALLSGDVHEI
FT                   PLPDRSVDLAVSRGSLFFWEDLPRAFSEIHRVLAPGGTAYVGGGFGTAELRDTIAATME
FT                   RANPDWRSFRDRNLGADNRERVAGILAALGFRHRLVSDDSGFWVVMEKEG"
FT   gene            18816..20552
FT                   /locus_tag="Memar_0026"
FT   CDS_pept        18816..20552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0026"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: mmp:MMP1180
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55961"
FT                   /db_xref="GOA:A3CRG1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRG1"
FT                   /protein_id="ABN55961.1"
FT                   /translation="MRCSICENRCAVPPGGVGRCRMYTNEDGAIVERFPDRYIAAMPIA
FT                   IETMPMCHYHPRGTFLQASGIGCTFSCGGCISETIAFHAEAVSGALRHIPPGALVKRAL
FT                   KEGCRGIAFCLNDPTAMHRTFLGVARAAHDAGLLVGCATNGYYTEESLRDIAPAIDFAN
FT                   IGLKGASDARYRACGALSAEPAFRTVKTLHEAGVHVEVSCIHARGCDDEIRAAAARVAG
FT                   ISPDIPFLVMRFIPFGDEPPEREPTIAESERICDDLRRTLRYVYLFNSPGTGYLDTACP
FT                   SCGKTVVRREFFGPMGARTIAIPPDARCSCGCSLPVTGSVAETLYAEPGMMGGYRFTRA
FT                   LEMVHAVLVCLGVESDADLARIWAGVIRDDYIRDLHGKIQTIDGYLDLVRELGERAGRT
FT                   GAAERLAGYIGDRVAAVSSAVEGCRRPRVYYSMGSPLFALNADRFEMDLVEAAGGDPVN
FT                   RGIVRAGKPGVNITPEEFAAFNPEYIFISGFLSAPASDYIAACRRMGLSADAVEHSRVY
FT                   TLPPGWDFGNPRWVLGLSAIAGTLHPERAVFDLAAEQDRFYRTFYGTDAAAITGNRSFY
FT                   RP"
FT   gene            complement(20549..21382)
FT                   /locus_tag="Memar_0027"
FT   CDS_pept        complement(20549..21382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0027"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mbu:Mbur_0496 ABC Fe3+-siderophore transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55962"
FT                   /db_xref="GOA:A3CRG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRG2"
FT                   /protein_id="ABN55962.1"
FT                   /translation="MILNVNNASFSYDGITKQFEEISLSLRQGEVLSLLGRNGTGKSTL
FT                   IKCILNILRLQGGEVEINGRRVADMRPEEVARQVGYVPQAHQAVFPFSALDFVLMGRAP
FT                   HISAFSVPGEEDYEKAEEAFERIGITHLREKSISEMSGGESQMVMIARALAQEPSLLIL
FT                   DEPTSHLDIGNQMKTIATIDQLAADGIAILMCTHFPDHAFLISHSAAILNKGRLIAQGR
FT                   AEDVITKENLREAYGIDICVHYIKEAGRTVCIPMNPCGCRGGGRANTAGTKPHGT"
FT   gene            complement(21379..22443)
FT                   /locus_tag="Memar_0028"
FT   CDS_pept        complement(21379..22443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0028"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: mhu:Mhun_2017 transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55963"
FT                   /db_xref="GOA:A3CRG3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRG3"
FT                   /protein_id="ABN55963.1"
FT                   /translation="MPAGKAIYLLPVALFFFSLFFGRYMMDPVETFRILIIGSANACFG
FT                   GASSLLSTVSGHPVLLPSFEQTWGASEQVVVFRIRLPRLIAAMLIGGGLAIAGASFQGL
FT                   FRNPLVSPDILGVSAGAGFGAAVGILLSGNPWVIQVSAFFFGILAVAVTYGIGRAVGKG
FT                   STLVLVLGGIIVGSLFSAFISLTKYVADPYDTLPAIVFWLMGSLSTVSNADVIAVAPPI
FT                   LLCALCLYLVRWRINLLAVGEEEARALGVDTKRMTVVLIIASTVITASAVCISGIIGWV
FT                   GLVVPHIGRMLVGPDFRKLIPVSAVIGASFILIVDDIARTLTAAEIPLGILTSLIGAPF
FT                   FAYLLTRKKVGWIS"
FT   gene            22929..24014
FT                   /locus_tag="Memar_0029"
FT   CDS_pept        22929..24014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0029"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   mta:Moth_1422 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55964"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRG4"
FT                   /protein_id="ABN55964.1"
FT                   /translation="MKKDARHLVLAIVAVCAVLTLAFVLAAPGTAGEESAATVRTITDM
FT                   DNRTVTIPSEVRTVVITCCGGAAQELAALGVGDRVVAQPQQCTTERLYTVVPGYRTTPD
FT                   VGSFDNANVEEILKLNPDIVIGSYYAETGNARIEAAGIPVVRVLTGRAGVEELKQEFRM
FT                   LGQVFGREERAERLVAYWDETLARIEAKIADLPEGERKRVYYMMSTPLKTEGHSAWGND
FT                   MIRAAGGINVAGGIDQKVIRGGYEISAEELVRWDPEVIYVASNMKDYSSPAGAFVANPQ
FT                   FATVTAVRDGAVYPCPVGTFWWDRPAPESPLGILWLAQKLYPDRFADVDLADETKKFFR
FT                   EFYDYDLTDQEVESILHPTPI"
FT   sig_peptide     22929..23009
FT                   /locus_tag="Memar_0029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.921 at
FT                   residue 27"
FT   gene            24032..25138
FT                   /locus_tag="Memar_0030"
FT   CDS_pept        24032..25138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0030"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: O-methyltransferase, family 2;
FT                   Methyltransferase type 12; KEGG: mta:Moth_1421
FT                   O-methyltransferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55965"
FT                   /db_xref="GOA:A3CRG5"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRG5"
FT                   /protein_id="ABN55965.1"
FT                   /translation="MTRQTIQLRQVMPAVEGVARLDAALSGYQSYQVISAALELRFFDW
FT                   LSERGPTARNDVTAIGINGMFTRGFLTALADMGYITFEENVCANTPIAEELLVSTSPTY
FT                   QGDLILAAGRETSSWSHLAATLRDGMETPKTGPRPTHDHLRAVAQRCTRGELQHVVGLI
FT                   GQHSGFRNARSMLDVGGGHGLYAVALCQENPNLQATVFDLPHVVPLTREYIGKYGMGGR
FT                   ISARGGDILVDDPGRGYDLIIVSHLLYTFRDRLTDVLGKITESLAPGGLLVLNHLFCSP
FT                   GCTISPGSGTAELDRALMSAGHPLCHPEGLEAVLKRLGYIDITSSPHETGMGYGVLFCA
FT                   TKDGGETVHCRDGSSSSGCSCGPGGCGN"
FT   gene            25138..25977
FT                   /locus_tag="Memar_0031"
FT   CDS_pept        25138..25977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55966"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="InterPro:IPR025251"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRG6"
FT                   /protein_id="ABN55966.1"
FT                   /translation="MGDSTVLDATVRILKERLGERMDDVRVDRAVVGVFFTGVKLSTGH
FT                   GGICATPIKSIPEAVCCPSSAKALPHSGRLRERRIEAYLADALGDRPMRKALGIAAVSA
FT                   LSALCDDVCPGPDHPVVRGVDAVDLLTIQESGNVVVVGALTPYLRALKQAGQPFRVLEM
FT                   DPRTLKPDELPFYTPVEETDMVVPWADTLVITGTTLINGTLDHLLELARPEATVVVLGP
FT                   SVSILPDALFSRGVEIVGGNQVTDPDRLLDILAEGGSGYHFFGKGADRIAVRRSQEP"
FT   gene            25986..26852
FT                   /locus_tag="Memar_0032"
FT   CDS_pept        25986..26852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0032"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   mba:Mbar_A3567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55967"
FT                   /db_xref="GOA:A3CRG7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRG7"
FT                   /protein_id="ABN55967.1"
FT                   /translation="MTQDNNVKCWIDCWKASAQHSKIVSDDLQATQWDERADRFVQNMD
FT                   EERHRKRVGDVFAILEEAGFSPEGARVLDIGCGPGTLSLPLARAGADVTALDISTRMLD
FT                   HLRETAQNEGLRVNAVECSWWSADIDRLGFREKFDLVIASMTPGIRDVETFDRMMACSR
FT                   QFCYYSRFVGRVGTDGARREIFRKILGEEPDNPGPDMLYPFMYLYVLGYRPLVRLSHVS
FT                   RTQERDWAEAAEETINDLRCTRDVSSDVEEKIREYYKNASPDGKYRSETESCSGMMVWS
FT                   VTAGDGV"
FT   gene            27204..28259
FT                   /locus_tag="Memar_0033"
FT   CDS_pept        27204..28259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0033"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   swo:Swol_1679 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55968"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRG8"
FT                   /protein_id="ABN55968.1"
FT                   /translation="MKETSTVLKAFITLSFIALLAFTCGCTGQGQATDSGTTVVTDMAG
FT                   REVVVPKNIDSIVTIGSVPVQNSFMFAMGQGGKIANDLPESFIKGGRHKYQYVFEPNLK
FT                   NKPTIQTTTGDFNLEELMKINPDVAFTMSMPSVDKLEKNGIPVVYLSWTDAEDVKDLLL
FT                   LLGEVFGEQEKAGRYVRYFDEATARPGKAVASLPDDQRPRVLCCSYKGMSVGHKIAEWY
FT                   IEKAGGIAVAKEAHVAESLQLDLEQLLAWDPDVLILSSHDEIPLVYNDTRLSGVSAVKN
FT                   GKVYATPVGAHYWIQRTSETPLMVLWVAKTIYPEQFKDFDMEAEVIAFYKEFYNCDITR
FT                   EQAAEILSGTA"
FT   sig_peptide     27204..27302
FT                   /locus_tag="Memar_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.803 at
FT                   residue 33"
FT   gene            complement(28607..29296)
FT                   /locus_tag="Memar_0034"
FT   CDS_pept        complement(28607..29296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0034"
FT                   /product="nucleotide kinase-like protein"
FT                   /note="KEGG: mhu:Mhun_2012 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55969"
FT                   /db_xref="GOA:A3CRG9"
FT                   /db_xref="InterPro:IPR004948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRG9"
FT                   /protein_id="ABN55969.1"
FT                   /translation="MNHRAPVFIITGGQGQCKTTFLHLVLGLIVGLNVRVRGVIAPGHL
FT                   RDGRRSGFTLVDLATGEHEELCSIDPDPRCEAHGRFYFRPEGLVFGRRALAPPDPRETD
FT                   LMVIDEVGRFELQGAVWAEQLDHLLAHPHPPMVWTVRRRLLDTVVERWKITNAVVVDVG
FT                   AASVMATAEAVMDAVWEWREAQAFSPVPAPPVPGDRIAAPPQCADAAAGAPRSTPVILR
FT                   RCYGPDE"
FT   gene            29525..30196
FT                   /locus_tag="Memar_0035"
FT   CDS_pept        29525..30196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swo:Swol_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55970"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRH0"
FT                   /protein_id="ABN55970.1"
FT                   /translation="MNQERACSACRKNLAPRERGAEPAPPGEETLSNLDLIERVCLTTT
FT                   ETDPLALACTIMRHPQVSLHGPEHHFLVPAVLLAAYYNHRGSPEKKEPALRQARKRAEA
FT                   VQPAFCGTHGTCGAAIGTGIFMSLITHSGPLKKEEWSLSNQMTARSLTAIAVSGGPRCC
FT                   KRDSWLAIGEAVKFLAEKCGIRLPVTEHIACEYATVNRDCTGYECPFYPGEESGPRPPS
FT                   V"
FT   gene            30235..30720
FT                   /locus_tag="Memar_0036"
FT   CDS_pept        30235..30720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0036"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: mba:Mbar_A3616 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55971"
FT                   /db_xref="GOA:A3CRH1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRH1"
FT                   /protein_id="ABN55971.1"
FT                   /translation="MAEKNVVLHTTMGDITIRLYDDMPVTAGNFEKLAKSGFYDGTIFH
FT                   RVIANFMIQGGDPTGTGTGGPGYTITDEFVKGHSNQRGTIAMANTGRPNSGGSQFFINL
FT                   VNNDFLDWDNPRTPSAHPVFGEVVGGMDIVDKIAKVKTGSADKPKVPVRIEKAEVLE"
FT   gene            30731..31201
FT                   /locus_tag="Memar_0037"
FT   CDS_pept        30731..31201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0037"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; KEGG: mhu:Mhun_1116
FT                   ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55972"
FT                   /db_xref="GOA:A3CRH2"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRH2"
FT                   /protein_id="ABN55972.1"
FT                   /translation="MRHSDAGRRDPGVIEERIGYTFKDRALLERALTRLAYTLEAGIPP
FT                   ETHMDALATLGDAVINVAVVEAVVAGGAHDKGAISNRKMNLVNMTRLRGLAEDLDLADY
FT                   VRWGKGEAAQRVWTSGRVLAECLEALVGAVYLDGGMDAAAGVLRRLGLTAKA"
FT   gene            complement(31185..32483)
FT                   /locus_tag="Memar_0038"
FT   CDS_pept        complement(31185..32483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0038"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mhu:Mhun_1720 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55973"
FT                   /db_xref="GOA:A3CRH3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRH3"
FT                   /protein_id="ABN55973.1"
FT                   /translation="MPETPTIFGLPAEKGRWGLVALGLVVNLCLGSIYSWSVFVAPLAA
FT                   HFTATLGREVTAAEVLLPFSVFLAFFAIAMPLAGKYIERYGPRRVTVVGGLLTGLGWLL
FT                   ASTATSVEALYVVYGMIGGLGVGIAYGAPVAVAARWFPDRRGLAVGLALLGFGFSAFVT
FT                   ANAAGALIAAYGVMATFRIFGAALIAVLVLSALPLRFPPEGWRPAGWTAPAPGVGTVPV
FT                   CECDRRGMLRTGTFYGLFACYFVGCLAGLMAISIAKPVGTELAGVDAGLATLLVGFFAV
FT                   FNGLGRPAFGGLADRMSAQKTAMLTFALIAAASVLMWLAPGVPAYIVAFAVLWGCLGGW
FT                   LAIAPAATASYFGTCDYPRCYGVVFLAYGAGAIVGPQLAGFIRTATGTYLGVFPWVAAL
FT                   AAVGFAVAWLLMRPPAGVPAPGEEREEGVTPSP"
FT   gene            complement(32489..34378)
FT                   /locus_tag="Memar_0039"
FT   CDS_pept        complement(32489..34378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0039"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="TIGRFAM: acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: mbu:Mbur_1137 acetate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55974"
FT                   /db_xref="GOA:A3CRH4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRH4"
FT                   /protein_id="ABN55974.1"
FT                   /translation="MAETFAVKLEEKCYYPDPRCKATAWTPDYTRAYSEFLRDPEGFWD
FT                   RVARELDWFEPWDRVREWNYPYAKWFINGKLNITTSCLDRHVAGGRKDKPAIVWHGESG
FT                   EKRILSYEALHREVMRFANGLSSLGVEKGDRVCIYMPLVPEQVVAMLACARIGAVHSVV
FT                   FGGFGPDALAMRINDAKAKVLVTADVGYRRGKTVPLRELASEALAHAPGVERVVVLRRE
FT                   TPAVELDPDREVDYADLMARAAPDCPAEPMDSEDPLFILYTSGSTGAPKGIVHTCGGYA
FT                   VGTYYTTRHVFDVKENDVYWCTADTGWITGHSYIVYGPLEVGTTVVLAEGTPDYPDPGA
FT                   YWRLVQDLGVTIFYTAPTAIRMFMRVGEEWPAKYDLSTLRVLGSVGEPLNPEAFEWYYR
FT                   AIGGGRCPIVDTWWQTETGMHMVTTMIGEAMKPGFAGKPIPGAVVDVVDRTGKPVPPGT
FT                   GGFLVIREPWPAMLRTVHGNDERYCAYWNTIPGCYTAGDLAVKDEDGYIMVLGRADDLI
FT                   VVAGHNIGTAEVESALVSHDAVAEAAVIGKPDPLKGNVIKAFVTLCVGVSPGDGLTDDL
FT                   ARHVRKSLGPVAVPAEIEFMDRLPKTRSGKIMRRVLKARELGMDPGDISTLEE"
FT   gene            complement(34686..39425)
FT                   /locus_tag="Memar_0040"
FT   CDS_pept        complement(34686..39425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0040"
FT                   /product="cobaltochelatase CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="PFAM: CobN/magnesium chelatase; KEGG: mac:MA0383
FT                   protoporphyrin IX magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55975"
FT                   /db_xref="GOA:A3CRH5"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRH5"
FT                   /protein_id="ABN55975.1"
FT                   /translation="MRVKRKNQLYSLCALITIALLLIAPVAGEDAADPEESGSTLNVTG
FT                   GLDTPDPVETTPAPQATGTEVEEEPPFSGKEEPQFEPSDAGNATQTPAPTTTAGDTFPI
FT                   EDTITRSGEENATGEMRGGGAENRFAIVTNDSQRRTAIAGVTGSTPSNVSLFSEEALLH
FT                   DFSEDLFIFAASIGNDTVAHINSTLNPNATVITCHLPEGVAFGIPADEVLRQYWLYGGE
FT                   ANLEQLLLALDNRFYGANHDLADPIPPPGRPGIAYVFSRTSEVASMTSVSGNSTIRSMM
FT                   DISVYLGRSNEDLSFNLDGNDVILLSNLDAPVIEAIRDTVEDARDNGSVVIACGPLVES
FT                   YNLHTVDPSDPAVAEIVAYLEYPSDTNFENLARHIGVTYCGITADVAPPQERPVYGIYH
FT                   PDAPNIFASSAEYLDWYGASGRYDATCPTVGIITGEYKYMDRDGPMIDALVRSFEEEGV
FT                   NVIVATYHYKDPVRIGYFLDNNGAVLIDTAVLISKGSRLDYADPERGIANLQYLNVPVL
FT                   NAVRLFYDVNETTWRESPHGVGPEQAYQLVMAELDGVIEPIVVAGKEPDPVTAELYYKP
FT                   FEDQVAWLTERTLGWVNLHRTANAEKKIVIPYYSAEGGRATVGADIDYYLNAQASLASL
FT                   LGAMRDRGYGLGTGQLPDADELADLMATQGYNIGTWAQEELDSRVGAGNVILIPESQYL
FT                   AWFNELPATKRQEMIDIWGEPPGEIMVYEDGGVRSLVIPTIQFGNVLLVPDPMWGWNQD
FT                   TDVMYHDGSIPPTHQCLAFYYYMDRVYGADAIFSIFSGIEMMPGKESGLAADDWGALLM
FT                   GDMPHVHVLPMDAEGIFDRRRANMAIVDFLTPTIVPSGLYGPLADLDETITNYRTVVDE
FT                   AVKAEYRSEIVATVEELDLDTDLGADLTTLEGNVAAFDAFVDDLDEYLQELKTTFMPYG
FT                   SHTLGEVPAGEQLVTMIDGMLGAPFADHVSAAGGSEENRLELLAEVILNGASPADAQVT
FT                   FLGATHADVTADLNRALDYRNRIEGCNIEIPRILDALEAKYIPPGPNGDPIRNPDALPT
FT                   GRNLCTFDDRIIPTRAAWTVGQALGDELLAAHIASHGTYPDKVAFLLWSIETSRHQGTM
FT                   EAEILYLLGVRPVWNNNGRVDDVELIPSAELGRPRIDVLVVTSGSYRDMYAGKLLLIDK
FT                   AVRLAAAADDGATPNYVREHTATIYQDLINRGYDAETARELAASRIFCPPPDSYTPGIE
FT                   HAIGATDTWSSTEELADLYINRMGYVYGSTIWGEQYADVFRANLGDVDSAVFSRTSNVY
FT                   GTLEHPMVAAYFGGLNLAVKSVSGISPDMYINNQRDAQNQKLETLQHFVSRDLRSRYLN
FT                   PEWIKGMMEQGFDGARYMEAFVENMWIWDVTMPDLITEEMWDSVYKTYAEDQYDLGLKE
FT                   FLDARNPYAYQSIAARMLDAARKGYWNPDAEVLQHLAQEFQQSVEFHGVTCCHHTCGNL
FT                   QLEAYIQSQIPASQAPDSSSSGKRPSSRSSSSALPTFTPIPSGTGDQVTNTTDASGIGK
FT                   TVDKMAGDVAKAAQEVSGHVMREVQDAVDNPTTSTPLIPVVLVILVVGAIAAGFWLKRR
FT                   "
FT   sig_peptide     complement(39339..39425)
FT                   /locus_tag="Memar_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.806 at
FT                   residue 29"
FT   gene            complement(39568..39909)
FT                   /locus_tag="Memar_0041"
FT   CDS_pept        complement(39568..39909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtp:Mthe_1158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55976"
FT                   /db_xref="GOA:A3CRH6"
FT                   /db_xref="InterPro:IPR018676"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRH6"
FT                   /protein_id="ABN55976.1"
FT                   /translation="MRRRRIILDDEDEDPLSGVANLFDVAMVFAVALLVALVVAYNVPE
FT                   LLDDEADLTVVKNPGQPNMQIIIKEGKTLKVLNMTEELAGGQGSRMGTAYRLESGEIIY
FT                   VPDDGDENN"
FT   gene            complement(39906..40526)
FT                   /locus_tag="Memar_0042"
FT   CDS_pept        complement(39906..40526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0042"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   mac:MA4641 MotA/TolQ/ExbB proton channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55977"
FT                   /db_xref="GOA:A3CRH7"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRH7"
FT                   /protein_id="ABN55977.1"
FT                   /translation="MMDLPTLIMETMFTLSGALLYPAIILLLVFVVWTLTALGQFISEY
FT                   SGRTRNLEQLRDGCRETRALVQARSYGEAAETLATSGSNPLLRSFTGDLAKLLDDDRFS
FT                   IESEKLLQDYEIRIAAELERLKILTRTAPMLGLMGTLIPLGPALMGLSAGNVETLASNL
FT                   VIAFSTTVLGLFAGGIAYTIMLTKRRWYLQDLSDMEYVVRMVA"
FT   gene            complement(40523..41239)
FT                   /locus_tag="Memar_0043"
FT   CDS_pept        complement(40523..41239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0043"
FT                   /product="transporter-like protein"
FT                   /note="KEGG: mac:MA4640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55978"
FT                   /db_xref="GOA:A3CRH8"
FT                   /db_xref="InterPro:IPR017199"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRH8"
FT                   /protein_id="ABN55978.1"
FT                   /translation="MSNVVNFLTAGVFGGTTLLALKSGVGCGLSGLRRRETLFLAFVYA
FT                   LTALIIGAIAGSIPVNATEQVVGLGVVMHLIIGLALVYFGIRTKKAWLSDRKDISRRTF
FT                   LLMSLPCPACLAATFLSCLVFTSTTGVSGVAAGGVIGGVFFAGIAGGGAATSWITRKAG
FT                   MDNPSTLGNVMLFLGLFYLLCLLLVPAYLQAQDAPAFGIATDPSGMLLALVLMTALIVF
FT                   GALADRIRHTAERGGR"
FT   gene            complement(41423..43447)
FT                   /locus_tag="Memar_0044"
FT   CDS_pept        complement(41423..43447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0044"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: mac:MA3879 inorganic pyrophosphatase; TIGRFAM:
FT                   V-type H(+)-translocating pyrophosphatase; PFAM: Inorganic
FT                   H+ pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55979"
FT                   /db_xref="GOA:A3CRH9"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRH9"
FT                   /protein_id="ABN55979.1"
FT                   /translation="MDLVYLAPIGAVLALLFAGYSYMSIRREGTGTELMQKIAAAIHEG
FT                   AMVYLNRQYRAIAIFVIVLAVVLGVWINPLTAACFVLGAALSATAGYIGMFTATAANVR
FT                   TTNAARRGIADAFKVSFASGSVMGMAVVGLGLLGLSIAYVVISTVTGLPQAEVLTIVTG
FT                   FGLGASSIALFARVGGGIFTKAADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGDV
FT                   AGMGADLYESYVGSIIAAMVLGVAVAATAFPNAEIMNVILLPLLIAAVGIVASIIGSLF
FT                   VRTNKTESSAIHLAFNKGLLAAMIVTVAATYFLVTRLLGAEYIGVFYAAVAGLVAGFAI
FT                   GLITEFYTSFDRSPTLAIVKSSETGAATTIITGFAKGMESTIWPVLIISVAIFISYQVA
FT                   GLYGIAIAAVGMLATLGISLSVDAYGPVADNAGGIAEMSHQKPEVREITDTLDAVGNTT
FT                   AAIGKGFAIGSAALTALALFAAYTQAVGLSVIDVSVPNVFIGVLIGAMLPFLFCSITMM
FT                   AVGKAAYSIVHEVRRQFKEITGLMEGTAEPDYASCIAISTNSALREMILPGVLAVAAPL
FT                   AVGLVLGPEALGGLLVGSLAAGFLLAVTMANAGGAWDNAKKYIEQGHLGGKGSDAHKAA
FT                   VVGDTVGDPFKDTSGPAINILLKLMSMVALVFAPLILVV"
FT   gene            complement(43536..44939)
FT                   /locus_tag="Memar_0045"
FT   CDS_pept        complement(43536..44939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0045"
FT                   /product="DNA polymerase II small subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; metallophosphoesterase; DNA polymerase
FT                   epsilon subunit B; KEGG: mhu:Mhun_2412 DNA-directed DNA
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55980"
FT                   /db_xref="GOA:A3CRI0"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR011149"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRI0"
FT                   /protein_id="ABN55980.1"
FT                   /translation="MLANAEIVRRFLELKRQVHPDVVSYIREQNDPTLIDRTAAGVPAG
FT                   IPVILPEHIPGLKKVRDGTRFLVDPELEVIMGSAGTTGSVSGHEDAVHYFRNRYNCLSS
FT                   MIRSRMTTMPIEALVKSPHRYRDEECSIIGMVADVRTTAKGHRLVEVEDPTGAIRVLFN
FT                   KGKDDSFAEAERILPDEVLAVKGKLSSDGGLFFAENLFRPDVPINNAPFKSDRPGKAVL
FT                   ISDVHVGSDTFLEDGWNRFADWLQDSDASYLLIAGDLVDGIGIYPGQENELTIKNIYEQ
FT                   YDIFAGMLRDLPSRIRIVAAPGNHDVVRMAEPQPAIPPEFTAKFPENCTLVENPCLLNL
FT                   QGVRVLMYHGRSIDDMIGLIPGASYERPGEIMDEMLKRRLLAAPYGMRTPIAAMKTDRL
FT                   VIDPLPEILLTGHVHICGITRYRGVLGVNAGTWQAQTAFQKQMNIHPTPARAFVVDLQT
FT                   LQPEVIDFS"
FT   gene            45156..45824
FT                   /locus_tag="Memar_0046"
FT   CDS_pept        45156..45824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0046"
FT                   /product="peptidase S26B, signal peptidase"
FT                   /note="TIGRFAM: peptidase S26B, signal peptidase; KEGG:
FT                   mhu:Mhun_2411 peptidase S26B, signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55981"
FT                   /db_xref="GOA:A3CRI1"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRI1"
FT                   /protein_id="ABN55981.1"
FT                   /translation="MSDTTWLQRAASALAAFRESDRPLVSLTRDLLWVVAVVGGIALLL
FT                   YLVAGTWPAVVTIESESMVPNMNVGDLVLVVDEDRFGNLVTWAEGQRTGQSSFGDYGNV
FT                   IVYRPNGADSVNPIIHRAMTYVDTAAVVESGLGAYYDDPHGGYITRGDNNPYTDQPNLR
FT                   ISGIGVIEPVKKEWIVGKALVAVPLVGYLPLHLAEFAVVVILVILVHDFVLARKKEKEE
FT                   "
FT   gene            45850..46938
FT                   /locus_tag="Memar_0047"
FT   CDS_pept        45850..46938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0047"
FT                   /product="FO synthase subunit 2"
FT                   /EC_number="2.5.1.-"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mhu:Mhun_2410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55982"
FT                   /db_xref="GOA:A3CRI2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019940"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRI2"
FT                   /protein_id="ABN55982.1"
FT                   /translation="MPYSLHTLLDDTLAGHRLTEEEAVRLLATRDRGVWEIAAAADELR
FT                   ERKVGNVVTYVRNQNIHVTNICKNLCGFCGFGRRADDPEAFYDDTDAIREKARAAAARN
FT                   VTEICLLSGVHPDYTLDSYVDLISCVREEAPGTDIHTASPDEIAWAAKQSGVSTKEAIE
FT                   RLIDAGLGTLQGTAAEILVDDVRRVICPAKCDTATWVRIIKEAHRLGLRSTATIMYGSS
FT                   ESAGDRARHLAILREIQDETGGFTELVPLSFLHENTAIYQKGLAPAGATGREDLLLFAV
FT                   ARLFLDNFDHIQISWGKVGTKMAELGLLSGGDDLGGTMFCDDVSTDAGGEGADYLDPAE
FT                   MQRIAEDLGRTLRQRTTTYELV"
FT   gene            47667..48770
FT                   /locus_tag="Memar_0048"
FT   CDS_pept        47667..48770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0048"
FT                   /product="FO synthase subunit 2"
FT                   /EC_number="2.5.1.-"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mhu:Mhun_2970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55983"
FT                   /db_xref="GOA:A3CRI3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019940"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CRI3"
FT                   /protein_id="ABN55983.1"
FT                   /translation="MKCMPPPLREILDDVLAGHRLTEEEAVRLLATRDRGVWEIAAAAN
FT                   ELRERKVGNVVTYVRNQNINVTNLCVNACGFCGFSRKPGDADAFFYGETAVRGKAREAR
FT                   ERGVTEVCTVSGLHPEFDVQSYAEIYSWIRDEVPGVHIHASNPMEVAYAARRSGISTRE
FT                   VMELMRGAGLSTLCGTAAEILVDDVRRVICPDKIDTGSWARIIREAHGLGIRSTATIMY
FT                   GHCESEADRARHLNILREIQDETHGFTEFVPLSFIHKNTPLYRAGLARAGATGREDLLM
FT                   FAVARLFLDNFDHIQASWVKVGTKMAEMALLSGADDLGGTLFEESISREAGARDTDYLD
FT                   PAEMRRMAEDLGRVLRQRTTTYALLPG"
FT   gene            48888..49049
FT                   /locus_tag="Memar_0049"
FT   CDS_pept        48888..49049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0049"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55984"
FT                   /db_xref="GOA:A3CRI4"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CRI4"
FT                   /protein_id="ABN55984.1"
FT                   /translation="MLGGGLVGLAILFFVLALIFAILGARGVAGMSMSVAKWLVIIFIV
FT                   LAIISLLL"
FT   sig_peptide     48888..48998
FT                   /locus_tag="Memar_0049"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.859) with cleavage site probability 0.313 at
FT                   residue 37"
FT   gene            complement(49126..49677)
FT                   /locus_tag="Memar_0050"
FT   CDS_pept        complement(49126..49677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0050"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mhu:Mhun_2991 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55985"
FT                   /db_xref="GOA:A3CRI5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRI5"
FT                   /protein_id="ABN55985.1"
FT                   /translation="MNVLGISGSMRKNGNTATLVTTILDGVREAGIETEYLTLADMDIQ
FT                   PCTGCEACKDAKWCVTEDDDWGLVAEKMIDCEVLILGAPTYYYDINGQTKNLIDRTYSL
FT                   YHDRRLSGRRAVAVAVCADRGCERSLETIEGFLNTHEFSYLGYVCGKGYAPGDIRKDEQ
FT                   AMKKARAVANSIVRYLRPED"
FT   gene            complement(49674..50129)
FT                   /locus_tag="Memar_0051"
FT   CDS_pept        complement(49674..50129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0051"
FT                   /product="protein of unknown function DUF123"
FT                   /note="PFAM: protein of unknown function DUF123; KEGG:
FT                   mma:MM0793 endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55986"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRI6"
FT                   /protein_id="ABN55986.1"
FT                   /translation="MDKGVYALVLENTGCVVRVGALGERKFSAGSHVYVGSARGSGGLA
FT                   RVLRHLRLARRRDRPPRWHIDYLLLDPHFLPAAVVTAVTDRDCECDLARAVSGEYVPGF
FT                   GCSDCACPSHLFYRSGDPVPEVAAAFRSLGLDARITRIKNEGNQHRV"
FT   gene            complement(50122..50724)
FT                   /locus_tag="Memar_0052"
FT   CDS_pept        complement(50122..50724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0052"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mhu:Mhun_2460 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55987"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRI7"
FT                   /protein_id="ABN55987.1"
FT                   /translation="MPVRWIASNATYANSFVYGNILIDAGVLPMAVEPYAAAIDTIVIT
FT                   HAHYDHIAHIKEIARLCSGAAVCIHEADAPGLLDDARSLSMVFGAHAPGIVPDTVLADG
FT                   DRIGNLCVIHTPGHTPGGICLYNEAEKLLFSGDTVFTGGSFGRYDFPGGDRTALAASIE
FT                   RLSALEVEGLYPGHGEPVARGGGRHIAAAREALRLYG"
FT   gene            50759..52039
FT                   /locus_tag="Memar_0053"
FT   CDS_pept        50759..52039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0053"
FT                   /product="hydroxymethylpyrimidine synthase"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   mhu:Mhun_2459 thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55988"
FT                   /db_xref="GOA:A3CRI8"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRI8"
FT                   /protein_id="ABN55988.1"
FT                   /translation="MHTLISACLRGVPPEVETIAREEDLPPHAAARAVARGRIVIPANP
FT                   ARPHRLCAIGEGCRVRVNVNVGTSGTRCDEDLEAEKAKAALREGADALMDLSTGGDLVR
FT                   IRQRILELDAPVGTVPVYEAVRRAGSAADVDADLLFKVIREHCRQGVDFLTLHCGVNRD
FT                   ALASLKADPRTMGVVSRGGAFHVAMMAATGEENPLYAEYDYLLEILSEHDVVVSLGDGM
FT                   RPGALVDAGRLAKSTEYLTLGHLAKRALAAGVQRMIEGPGHIPADQVGYNVRMIKELTD
FT                   GAPLYLLGPLVTDVAPGYDHVVGAIGGAIACMNGADFLCMVSPAEHLALPDVRDIVEGT
FT                   RVAKIAAHVGSLSRAAAHTKNREIRMAEARRALDWEKQFEAALAPEEARRIHERDGEIE
FT                   TCSMCGDLCAVKMVRDILPVPEERMEP"
FT   gene            complement(52047..52487)
FT                   /locus_tag="Memar_0054"
FT   CDS_pept        complement(52047..52487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0054"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: mhu:Mhun_0874 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55989"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRI9"
FT                   /protein_id="ABN55989.1"
FT                   /translation="MKQRVLFIGTNNAARTQMAEGYLRARYSDRYEACSAGIAPTALDP
FT                   LAAKVMDEIGVDIAGQRAKDLTLFDGKEMDYAVVLCAGGVCPMFPWAKETIHVDFPDPG
FT                   RATGTPDKVLAAYRRSRDAVTAWLDGRFEHSKSMKEVEKSIR"
FT   gene            complement(52570..52962)
FT                   /locus_tag="Memar_0055"
FT   CDS_pept        complement(52570..52962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0055"
FT                   /product="Phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /note="PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; KEGG: mhu:Mhun_2474
FT                   phosphoribosylaminoimidazole carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55990"
FT                   /db_xref="GOA:A3CRJ0"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRJ0"
FT                   /protein_id="ABN55990.1"
FT                   /translation="MADVTVICGSASDGPVAEKVFETLNQHGVSYDYKVISAHRDPERL
FT                   DEYVKASTARVFIAIAGLSAALPGVIASKTKRPVIGVPVSGTLMGLDALLSIAQMPKGV
FT                   PVACVGVDNGVNAALLAIRILEAGRA"
FT   gene            53098..54228
FT                   /locus_tag="Memar_0056"
FT   CDS_pept        53098..54228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0056"
FT                   /product="phosphoserine aminotransferase apoenzyme /
FT                   L-aspartate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.52"
FT                   /EC_number="2.6.1.1"
FT                   /note="PFAM: aminotransferase, class V; KEGG: mhu:Mhun_2475
FT                   serine--glyoxylate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55991"
FT                   /db_xref="GOA:A3CRJ1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRJ1"
FT                   /protein_id="ABN55991.1"
FT                   /translation="MEHEPLLMIPGPVPIPQRVRAAMTRQAINHRGPEFGAAYADTVRT
FT                   LKTLFGTANELYIISGSGSAGMEAGVANFARDKRIVSLVNGKFGDRFAKISARYGTVTT
FT                   LESGWGTPLDLAALERELEAGAEVVTMVHNETSAGIRNPAPEVGKLARKHDALFIMDGV
FT                   TSIGGDDVRMDEWGVDIAVVGSQKCLAAPAGLAAIAVGERAWDRISEKRPFYLDMAAYR
FT                   KSGSGTPMETPYTPAVPLFLALCEACKIIEEEGIDARIARHRRMTEAVRAAAKGWGVEL
FT                   FPELDEYHAYSNTVTAMRLPKGVTDKDLRGTVKQFGIEIAGGQDHLKGKIFRIGTMGGV
FT                   GAQEILATLAAVQFALKKSNVAAGDGVEAAAGVLLG"
FT   gene            54225..54686
FT                   /locus_tag="Memar_0057"
FT   CDS_pept        54225..54686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0057"
FT                   /product="riboflavin synthase alpha chain"
FT                   /EC_number="2.5.1.9"
FT                   /note="TIGRFAM: riboflavin synthase; PFAM:
FT                   6,7-dimethyl-8-ribityllumazine synthase; KEGG:
FT                   mhu:Mhun_2476 riboflavin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55992"
FT                   /db_xref="GOA:A3CRJ2"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR006399"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRJ2"
FT                   /protein_id="ABN55992.1"
FT                   /translation="MKIGIADTTFARVDMGGIAIDEIRKHASVGLERYVVPGIKDLPVA
FT                   CKKLIEERGCDLVMALGMPGGAEKDKVCAHEASQGLILCQLMTNKHVIEVFVHEDEARN
FT                   AKELAWLMEQRTREHAVNAVRLALRPKDLEKLAGTGQRQGFEDVGPARP"
FT   gene            54744..55151
FT                   /locus_tag="Memar_0058"
FT   CDS_pept        54744..55151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0058"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="PFAM: 6,7-dimethyl-8-ribityllumazine synthase; KEGG:
FT                   mhu:Mhun_2477 6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55993"
FT                   /db_xref="GOA:A3CRJ3"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CRJ3"
FT                   /protein_id="ABN55993.1"
FT                   /translation="MTVKLGFVVAEFNRDITYMMEIEAREHAGFLDAEVADTIYVPGAY
FT                   DMPLAIKKLLERGEIDAVVTIGCVIEGATQHDEIVVQHAARKIIDLSLEFGKPVALGIS
FT                   GPGMTRMEATERIDYAKRAVESAVKMVQRLE"
FT   gene            55148..56278
FT                   /locus_tag="Memar_0059"
FT   CDS_pept        55148..56278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0059"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mhu:Mhun_2478 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55994"
FT                   /db_xref="GOA:A3CRJ4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRJ4"
FT                   /protein_id="ABN55994.1"
FT                   /translation="MRGLSEKVAAIAPSATIEISNAARRMAQGGVDVISLSIGEPDFDT
FT                   PAHIKDACIDALRRGETHYAPSAGIPALTAAIAEKVARENNVAAKPDEVIVTCGAKDAI
FT                   YEAMEAVLNPTDEVLILDPAWVSYEPCVELAGAVARHHPLSTETFQVEDTLLEALGPRT
FT                   KMIVVNSPSNPSGAVLNADSLRLVADICRDHDLYALSDEIYEKLVYGKEHVSLASLDGM
FT                   AERTITINGFSKAYAMTGWRIGYAVAPRPILRQMEKVQQHTISHPTTFAMFGALAALRG
FT                   SQDCVEAMRREFERRRDYLIPALRDLGYATAPADGAFYAYVKVDGDDMAIARSWLHDAH
FT                   VAVTPGTAFYTPGWLRLSYATAMENLEKAVERIARV"
FT   gene            complement(56275..57963)
FT                   /locus_tag="Memar_0060"
FT   CDS_pept        complement(56275..57963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0060"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_3; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   ter:Tery_3996 tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55995"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRJ5"
FT                   /protein_id="ABN55995.1"
FT                   /translation="MELPWKSVEAWCKKGRAYAEQGQYDRAVECYDQAIRQNTGAGDAW
FT                   YHKGLALAAARRHREALECFDQVVRIDPTCGRFWLARGQTLYDLGECREAIGSCGQAVK
FT                   LAPDSANAWFIRGHALRKIGLSPEAIECYDRVVALEPNRIDAWLARGTALAAERRYEAA
FT                   IECYDRVVALEPKNANAWYARGTIETLLSRYEDAIASYGQAVAIDPNHAETWYNRGCAL
FT                   SALKRYDEAIGCFDRAIALRPDDAETWYNRGRALQNLERYEEALDCYERAFRINPDYPG
FT                   IWNHKATVLKKLKRYDLSLACFDRALRVNAVDAEIWHQKGLLYFTLKRYGDAIECLSQA
FT                   LKLQPGHTDAEYYRGESYYALGNCEAAIDCYRAVVRLNPENAVAWNNCGNALYHLKHYE
FT                   EALVCYERALEIDPENRRVWNNKASVLSVLSHYDKALVCYDQELLAHPENADAWYNKGV
FT                   ALFVLGRYSEAVTCYAHVLEIDPARAEVWNTMGNALVILERSEEALECYDLALAASPDD
FT                   IEALNGKAVALINLDRPAEAAKYYERLQRLPAWQRERNSGKRKGL"
FT   gene            58163..58834
FT                   /locus_tag="Memar_0061"
FT   CDS_pept        58163..58834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0061"
FT                   /product="DNA replication and repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: mhu:Mhun_2739
FT                   DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55996"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRJ6"
FT                   /protein_id="ABN55996.1"
FT                   /translation="MRKRMRDTPNRDRPRERLAARGPEALTDAELLALLLGRGTKGRDV
FT                   WQVAGDVERCLKRAEGCPSYDDLLGIDGVGSAKACEIMACFELGRRYFGDDGVSGHRIA
FT                   RPEDVLPLVTEWRDKKQEYFFCITLNGAGAVIERRIVTVGILNQSLVHPREVFSDAITD
FT                   RAASVILVHNHPSGTLEPSAQDLAITRQLVEAGSILGIRVLDHIIVTKNGCASLKELGH
FT                   L"
FT   gene            59141..59797
FT                   /locus_tag="Memar_0062"
FT   CDS_pept        59141..59797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55997"
FT                   /db_xref="GOA:A3CRJ7"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRJ7"
FT                   /protein_id="ABN55997.1"
FT                   /translation="MDTGFLRVLFDPGRFFEARMQDRPSLKIPALIAVVMGLIGAVSVI
FT                   PMTDITMAMLPAEMQGLGLLMTIISAGVAFVGGLLGWIIYGFVFHLVSMVFKGQGPLER
FT                   TMEFTGYGLLPQVFGGIIGTYFSFQLLSGLNIPPMTSPEQMVEFSEELVSVLATDPLAQ
FT                   IAGIVTILFTIWSANIWVFGMKHARNLSTRDAVLTVGIPVGLYILYLLIKLAGWL"
FT   gene            59799..60941
FT                   /locus_tag="Memar_0063"
FT   CDS_pept        59799..60941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55998"
FT                   /db_xref="GOA:A3CRJ8"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRJ8"
FT                   /protein_id="ABN55998.1"
FT                   /translation="MKPLNVLIISLLCAAIALVAPVSAAPADLTVVSSSLDPMVLMKGD
FT                   TGTLTVVIQNNGAEPVAIRNARLYGSGVVPLSDPYPSVGELGAGNSKTFTFTVRADGGE
FT                   GTFYPQFVLDFRDAGSLRYPVPVQVEDTPLSASVIEKPDAFSASRTADITVRVGNPRPN
FT                   AASGVQVIPQGSDFTVTPTGGFIGALAPDASGTVTFNLTPTAETDVTFQVVWRNGINTH
FT                   TADLVLPVAFGEDKKQADPVITNVEVTPIAGGYRIVGDVMNAGLESARSVLVTPGSPAT
FT                   PIDPFRVYVVGTLDPDDISSFEVTFTTDGTVEEIPVVVEYRDADGNRYTSTRMVGLGNT
FT                   AAAPLDEQREDGGFPVVGFIVVVLVALGIAGAVYYSWKRT"
FT   sig_peptide     59799..59873
FT                   /locus_tag="Memar_0063"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            60947..61615
FT                   /locus_tag="Memar_0064"
FT   CDS_pept        60947..61615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0064"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mhu:Mhun_2931 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABN55999"
FT                   /db_xref="GOA:A3CRJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRJ9"
FT                   /protein_id="ABN55999.1"
FT                   /translation="MPVISFENVTKVYPLPAGDVVALAGVDLAIEKGEFVLIMGPSGSG
FT                   KSTLLNIMGSLDVPTSGEVTIAEKRIGGMDDDDLTLLRRDHIGFVFQQFNLIPLLSIVE
FT                   NVEYPLILKGRQNGTRERAEEVLQAVGIEKTHFTHKPGEISGGQQQRVAIARALVNDPA
FT                   FLLCDEPTGNLDSKTGTAIMTLLDRMNREEGKTVVMVTHDPRMTEYADRTIRLVDGRIA
FT                   "
FT   gene            61612..62757
FT                   /locus_tag="Memar_0065"
FT   CDS_pept        61612..62757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0065"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mhu:Mhun_2932 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56000"
FT                   /db_xref="GOA:A3CRK0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRK0"
FT                   /protein_id="ABN56000.1"
FT                   /translation="MTFFDLARRNVTRHWLRSSLAVIGIVIGVIAIASLGIMGNSIGLM
FT                   FGDMVSDVGDTLIVSPATGVGGGKLTERQVDDIARAVGSNVVIPFSSTADRIFVGEKES
FT                   VAMIYAIPAGDIAGLLDVESGAYLKETGAGCLIGSELAANSRENGLKLGARVRMGDETL
FT                   RVVGVLKERGMGFDINPDYAIIVPYSWYSSHYDEDDYDQVIVKVRDVNDIDAVKESIEQ
FT                   RMNRREDVVNVMDTRGILESIFEATGSITVFLAGIGAISLLVAGVSILNVMLMSVTERI
FT                   KEIGVLRSIGTRRGEVMRMFIYEALVLGLAGAVLGGVLSFCAGYLVTAIFVGNADYLFD
FT                   PTSLLYIVFGMAFGVITSVASGLYPAWKAAHLNPIQALRHE"
FT   gene            complement(62762..62977)
FT                   /locus_tag="Memar_0066"
FT   CDS_pept        complement(62762..62977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56001"
FT                   /db_xref="GOA:A3CRK1"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRK1"
FT                   /protein_id="ABN56001.1"
FT                   /translation="MAGGRCIIPLIRAFSICAGGTAVVSLTPVALLFAEGEREYLALLP
FT                   GAPRGINDLIGELRGDIEREKEKCSG"
FT   gene            complement(63009..63683)
FT                   /locus_tag="Memar_0067"
FT   CDS_pept        complement(63009..63683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56002"
FT                   /db_xref="InterPro:IPR021338"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRK2"
FT                   /protein_id="ABN56002.1"
FT                   /translation="MAATLLFVILLAVAVILLALLLALYLVPVTVSTVADCSRERARAT
FT                   ATVAWGIAEARVRVGDDEQVLEILLVGRRVMTRDLGELAAAEPEEEKKEEERKPVQSVR
FT                   DYLDAAGDLWPHLWRILETVYRSLRLETLRGDIILGLESPADTGVVYGYCTAARYALWP
FT                   AEAIDFVMTPVFDREVFEGTFILRLQIRRPLLILIAVARALLKKPVRERLRQVSGRGAP
FT                   GA"
FT   sig_peptide     complement(63588..63683)
FT                   /locus_tag="Memar_0067"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.617 at
FT                   residue 32"
FT   gene            complement(63705..64151)
FT                   /locus_tag="Memar_0068"
FT   CDS_pept        complement(63705..64151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56003"
FT                   /db_xref="InterPro:IPR014229"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRK3"
FT                   /protein_id="ABN56003.1"
FT                   /translation="MLQITVDQLARTLCASAVLGAPIEAGERVIIPVAEFGLGFGAGEG
FT                   SGEKKEGSPAGGSGSASGGGGGISAVALIIITRGVPGPEGVQVVSLKKKSEIAEVISTI
FT                   GEAVGPHVERVLEKGSEMLQQHKGGRTSPAPEGKEIPIGGEGEA"
FT   gene            complement(64263..64847)
FT                   /locus_tag="Memar_0069"
FT   CDS_pept        complement(64263..64847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0069"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /note="PFAM: membrane-bound metal-dependent hydrolase;
FT                   KEGG: mta:Moth_0187 membrane-bound metal-dependent
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56004"
FT                   /db_xref="GOA:A3CRK4"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRK4"
FT                   /protein_id="ABN56004.1"
FT                   /translation="MYLLAHAMVGLLIGVVLAAIAGDRRVLAFAVLGAVLPDLIDKPLG
FT                   HIVLAGTLGYGRIYFHGLTVLFLVVVAGLILYRYRRRIDLFAVAAGMASHQFFDGMWRH
FT                   PVEWFWPFLGPLRHHGYPEDYFWESVLRELAQPSEWLFFILIAGLFAYIYRRELATALT
FT                   WLTNPSFRLALVAALGLAVLAALAVGWRLLP"
FT   sig_peptide     complement(64782..64847)
FT                   /locus_tag="Memar_0069"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.925) with cleavage site probability 0.576 at
FT                   residue 22"
FT   gene            64988..66346
FT                   /locus_tag="Memar_0070"
FT   CDS_pept        64988..66346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0070"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: mhu:Mhun_0558 tryptophan synthase, beta
FT                   chain-like; TIGRFAM: pyridoxal-phosphate dependent
FT                   TrpB-like enzyme; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56005"
FT                   /db_xref="GOA:A3CRK5"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRK5"
FT                   /protein_id="ABN56005.1"
FT                   /translation="MQTKILLDEEEMPKRWYNIQADLPTPMDPPLHPATGKPAVPDDLR
FT                   HIFPMELIRQEMSTERYIDIPGEVRDILTLWRPSPLYRARRLEAALKTPAKIYYKWEGV
FT                   SPPGSHKPNTAIPQAYYNREEGIERLATETGAGQWGSSLAFATSLFDMECTVYMVRSSY
FT                   EQKPYRKSMMQVYGAECIPSPSEKTRSGKAVLDKDPNTPGSLGIAISEAVEDAAAHENT
FT                   NYALGSVLNHVCLHQTIIGQEAQQQLAAVDAYPDVVIGCVGGGTNFAGLSFPFAGAKIT
FT                   GKHPETDIIAVEPSACPTLTKGLYAYDFGDVAGLTPLMRMFTLGHDFVPPAIHAGGLRY
FT                   HGASPLVSRLVQDGIVRPVAYRQNEVFEAAVMFARTEGIVVAPEAAHAVKAAVDEALRC
FT                   RETGDAKTILFNNSGHGNFDFSSYEAYFAGKLVDYEYPAELIKESLARLPVTG"
FT   gene            66603..67856
FT                   /locus_tag="Memar_0071"
FT   CDS_pept        66603..67856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0071"
FT                   /product="anthranilate synthase, component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="PFAM: Anthranilate synthase component I and
FT                   chorismate binding protein; Anthranilate synthase component
FT                   I domain protein; KEGG: gsu:GSU2383 anthranilate synthase
FT                   component I"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56006"
FT                   /db_xref="GOA:A3CRK6"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRK6"
FT                   /protein_id="ABN56006.1"
FT                   /translation="MASDGTLTVSGDPRIREVAAGIEAADPLDAVRSFMGGFRVAPSRL
FT                   ERFSGGLAGYFAYDLVSSLYPVPGPEGAEEPVARFMLARECLALDHRRERLAVVANLLV
FT                   TGGTDAEAEFSRARAAIAKQIARICAFSSSSPDEPCRSGAPASSCTPDEFSDAVLRIKE
FT                   HIAAGDIFQAVLSRRLACCIEGDPFAVYRRLRATNPSPYMYYLDFGDLAVAGSSPEMLV
FT                   RVEDGRVTTVPIAGTRPRGRTPAEDRQLAAELLADEKERAEHVMLVDLARNDVGAVSAF
FT                   GSVSVKDFMTVERFSHVQHIVSTVTGTLREGCDRFDALRSCFPAGTVSGAPKVRAMQII
FT                   GEAEGLRRGIYAGAVGYIGFSGTMDLAIAIRTVLVQDGVASVQVGAGIVADSDPGREWI
FT                   ETENKGRAMLAALSAEVE"
FT   gene            67856..68434
FT                   /locus_tag="Memar_0072"
FT   CDS_pept        67856..68434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0072"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   neu:NE0014 panthranilate synthase component II (glutamine
FT                   amido-transferase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56007"
FT                   /db_xref="GOA:A3CRK7"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRK7"
FT                   /protein_id="ABN56007.1"
FT                   /translation="MRVLVIDSYDSFTFNLCQQIGVLGAEPVVVKSDTPFERLRSESFD
FT                   RVVLSPGPGHPRDSALYREVLDSISRTVLTLGVCLGHQAIGLVFGARIARADRLMHGKR
FT                   SLVRHDGAGIYAGVPDPLVATRYHSLVIDPASVPDCLAVTATSDDGAIMGVRHREFPIE
FT                   GVQFHPESILTPEGARLVANFLFGPGGAA"
FT   gene            68431..69447
FT                   /locus_tag="Memar_0073"
FT   CDS_pept        68431..69447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0073"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="TIGRFAM: anthranilate phosphoribosyltransferase;
FT                   PFAM: glycosyl transferase, family 3; KEGG: mta:Moth_1340
FT                   anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56008"
FT                   /db_xref="GOA:A3CRK8"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CRK8"
FT                   /protein_id="ABN56008.1"
FT                   /translation="MIREAIARVSSGTDLTPAEAGGVMAEIMHGAATPAQIGGFLTALR
FT                   MKGETVAEIAAFARAMRAAAVPVALPAPGARVDTCGTGGDGAGTFNISTAAAFVAAGAG
FT                   VPVVKHGNRGVSSRCGSADVLEALGVSVAIPPDRVGEVLAAAGIAFLFAPAYHPAMQYA
FT                   RIARQEIGIRTVFNLLGPLTNPAGAGAHLLGVYDPCLTLPVARVLGDLGAERAMVVHGA
FT                   GLDEIATAGPTTVAELRGGEVTTYTLDCTEFGVPRSSVAALRGGGPEENAATLLAVLAG
FT                   EEGPARDIVLLNAGAAIYLGGKADGIAGGIAHAEASLDSGAALDRLRRLVEATGGAA"
FT   gene            69444..70199
FT                   /locus_tag="Memar_0074"
FT   CDS_pept        69444..70199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0074"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   mhu:Mhun_1788 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56009"
FT                   /db_xref="GOA:A3CRK9"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRK9"
FT                   /protein_id="ABN56009.1"
FT                   /translation="MILDDIVRSTRERLRDLDQSVVDPDPLPRRSLAAAIRTSSERHAV
FT                   IAEVKYASPSRGRIHEGCTPEAIAREFVAAGAAGLSVLTEPTYFSGSIENLARVRRAVS
FT                   VPVLRKDFIVDERQLGETRALGADAVLLIARVLGNRLPAFVDSALALGLEPLVEVHDRD
FT                   EMERALATNATLIGINNRNLATMTIDLSTTVRLAGAARDAGRVVVSESGIMWPYDVRSL
FT                   SRHCDAFLIGSALMSARDRRKRLEGFVFA"
FT   gene            70196..70771
FT                   /locus_tag="Memar_0075"
FT   CDS_pept        70196..70771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0075"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI); KEGG: mhu:Mhun_1789
FT                   N-(5'phosphoribosyl)anthranilate isomerase (PRAI)"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56010"
FT                   /db_xref="GOA:A3CRL0"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRL0"
FT                   /protein_id="ABN56010.1"
FT                   /translation="MKICGTTSVRDALLAVAAGADAIGVVLASPSPRSVTPEAASEIFA
FT                   AVSAFVTRVAVTSTDRPEDLAAILSSRPDVVQVAGDLEVPRDAGVRVIRMLAPGDALRD
FT                   DCDAVIVDNSHGTGRTFNPGYARECVAASPVPVILAGGLTPGNVAEAILAVRPYAVDVC
FT                   SGVEAAPGIKDERLVRAFVKICRMMDNP"
FT   gene            70768..71940
FT                   /locus_tag="Memar_0076"
FT   CDS_pept        70768..71940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0076"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   KEGG: mhu:Mhun_1790 tryptophan synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56011"
FT                   /db_xref="GOA:A3CRL1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRL1"
FT                   /protein_id="ABN56011.1"
FT                   /translation="MKAGRYGVYGGQYVPETLMSALIELEETYGRIREDPGFSRRLSWY
FT                   LREYAGRETPLTYCGNLSRDLGCRVYLKREDLLHGGAHKLNNTLGQALMAKFMGKRRLI
FT                   AETGAGQHGVATAIAGAALGLPVEVYMGEVDTRRQALNVFRMELLGARVVPVASGTRTL
FT                   KDAINAAMRDWVANLRETHYLLGSCVGPHPFPRIVRDFQSVIGEETRRQILEREGRLPD
FT                   TVVACVGGGSNAIGIFYPFVGDDVALVGVEAGGEGLDSGRHGASLSAGSVGVFQGALSY
FT                   LLQDGDGQALETHSVAAGLDHPSVGPEHAMLKDSGRVRYEAVTDAEALHAFRRLSRTEG
FT                   IIPALESAHAVAYALRAADDLDKDGILVVNLSGRGDKDVADVANLHGGVA"
FT   gene            71937..72749
FT                   /locus_tag="Memar_0077"
FT   CDS_pept        71937..72749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0077"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: sth:STH1415 tryptophan synthase alpha subunit;
FT                   TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56012"
FT                   /db_xref="GOA:A3CRL2"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRL2"
FT                   /protein_id="ABN56012.1"
FT                   /translation="MSRIDALFARSPAFIGFTVAGDPGIEASLRVAKAMIEAGVDLLEI
FT                   AIPYSDPVADGPVIERAHVRALRAGTTTDDVFALVRRIREHAPALPLVLFTYHNIIHRR
FT                   GPDRFFSEAAAAGADGVLIVDLPVEESGEVAPCAARYGIDRIALIAPTTSPERQHAILS
FT                   GASGFVYLISLEGVTGERDRLPPGIAGLVGAVREKTGLPLAVGFGVSRPEHVRTVVAAG
FT                   ANGVIVGSALVRLIEEHAGDEAGMQDALRAAIAALRRGLVPDPEPDIP"
FT   gene            72980..74083
FT                   /locus_tag="Memar_0078"
FT   CDS_pept        72980..74083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0078"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: mhu:Mhun_0557
FT                   ATP-NAD/AcoX kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56013"
FT                   /db_xref="GOA:A3CRL3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR011386"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR039065"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRL3"
FT                   /protein_id="ABN56013.1"
FT                   /translation="MKKTVGFLVNPVAGMGGAVGLAGTDGQAAEALRRGAVPHSADRAV
FT                   QALSALRGQDIAWCTCSAPMGEDVLAAAGIDHYTVLYRPAVPTGAADTKAASRAFLAAG
FT                   VDLVVFCGGDGTAKDVFDAVGREVPILGIPAGVKMYSAVFAVNPAAAADLIRRAGAVPC
FT                   RDSEVMDVDEEAYRSGRLTARLYGYACVPYVAERTQGGKQVFEQQDEERAKDDIAAFIA
FT                   EIMIPDTLYIIGAGSTTARIMERLGLLPTLLGVDAVRNGEVLACNADERTLLALLDTYP
FT                   RAKIVASPIGAQGFVLGRGNQQISPAVIRKAGLRNLIVVATPGKLAATPLLYVDSGDPM
FT                   LDREVGDSLQVVSGYRIAQRKRVVQTN"
FT   sig_peptide     72980..73066
FT                   /locus_tag="Memar_0078"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.836) with cleavage site probability 0.404 at
FT                   residue 29"
FT   gene            complement(73919..75697)
FT                   /locus_tag="Memar_0079"
FT   CDS_pept        complement(73919..75697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0079"
FT                   /product="Na+/Pi-cotransporter"
FT                   /note="PFAM: Na+/Pi-cotransporter; KEGG: sat:SYN_00468
FT                   sodium-dependent phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56014"
FT                   /db_xref="GOA:A3CRL4"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRL4"
FT                   /protein_id="ABN56014.1"
FT                   /translation="MVPWELVFAIIPGLILFFYGIENFSREILAVAKGSFANLLGRLTS
FT                   RPVIGALIGAVVTALVQSSAATTIITIGLVNAGTLSFLQSLGIIIGSNIGTTVTAQLVA
FT                   FKMTALGQVLIPAGFLVGIFGRRYRFLGKPLFYFGLVLFSLNLISTGLTPFQNDPEIIA
FT                   LVTEYSALPLAVLIGFLFTAAVQSSSVTTGLVVVLAQQGLLTLPQAIPILLGANIGSTT
FT                   TTLIASARMNLYSRRAAAAHFIFNLGGVLLILPFLVPFADIVTAIGGTEAQMVANAHLI
FT                   FNLIAAAVFLLFIGRFGQVVERAVPGSEPEILMRTRHLEEGIPDDTQAGFEVIRKELRH
FT                   AHEVTLDLFRAAMTYLATSKEADYQMVERLKSLNNYLDARIEQALRAISKRQLSDGEAT
FT                   EVVFLVRMSNEIERLGDLGADLGEFFRRMSGNGNGAPAVLVKKTDGVYRILDENIVGLG
FT                   LLFPKILNATVAELRGRDVELQHAINERYREQLVSLKREGAFADSRYLEVLSIIEAANA
FT                   KVRDLRKLAEQYSREKTAGTPSVGLDDPLSLRNPVAGDDLERVPDLPVEHRVPRVDVEE
FT                   GSCGELPRRGDHDQVP"
FT   gene            complement(75780..76304)
FT                   /locus_tag="Memar_0080"
FT   CDS_pept        complement(75780..76304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56015"
FT                   /db_xref="GOA:A3CRL5"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRL5"
FT                   /protein_id="ABN56015.1"
FT                   /translation="MVGLYARFAAPPGRSAYLTLGLSPVLLLFCILSLAGAVLFAVAVR
FT                   EEGGRWWAAIPLAVLLLALAVFGPVHQSSGASLLATVLLAPGVLILLGALPLEKGSTAW
FT                   FGAIEAGFISLPGLLWAYGLFLAPPLPENIIIHSPSLYEFAGAAYVYAGLGLLGVLLLV
FT                   LARQRSAAQHQ"
FT   gene            complement(76371..76937)
FT                   /locus_tag="Memar_0081"
FT   CDS_pept        complement(76371..76937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56016"
FT                   /db_xref="GOA:A3CRL6"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRL6"
FT                   /protein_id="ABN56016.1"
FT                   /translation="MSGKIVASLPRSRFSPAIPPLAAVVACVIWAGTARTASGIIGPAP
FT                   PFVLPVFVLVMVTLAVAGAATPLPLISGAVPVRRARQAMLVAVAASVPFVFALLINPGQ
FT                   WERGDALPLVADSVPVFGWLLDGIMTVLPLTAGTPVYSLLFSAFGVFGFYLECVLVATV
FT                   IYAVLRLTAAPAPGLREERHTEEEG"
FT   sig_peptide     complement(76827..76937)
FT                   /locus_tag="Memar_0081"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.887) with cleavage site probability 0.703 at
FT                   residue 37"
FT   gene            complement(77121..77330)
FT                   /locus_tag="Memar_0082"
FT   CDS_pept        complement(77121..77330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56017"
FT                   /db_xref="GOA:A3CRL7"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRL7"
FT                   /protein_id="ABN56017.1"
FT                   /translation="MAITNCNYLSLLWKLLLVLAVVVLAVNFYQDIILHGRPGALARYL
FT                   FFILLFGSIIVQIVSTRCREKQPG"
FT   gene            complement(77334..77558)
FT                   /locus_tag="Memar_0083"
FT   CDS_pept        complement(77334..77558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56018"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRL8"
FT                   /protein_id="ABN56018.1"
FT                   /translation="MKSAVYALAPLILFSWAVLLGVPFAGLLLLAWFCLSTYFGVWIFH
FT                   EKSKDRAVFVALATGVVLAYYLHRAVGIV"
FT   sig_peptide     complement(77481..77558)
FT                   /locus_tag="Memar_0083"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.845) with cleavage site probability 0.371 at
FT                   residue 26"
FT   gene            complement(78157..78678)
FT                   /locus_tag="Memar_0084"
FT   CDS_pept        complement(78157..78678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56019"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRL9"
FT                   /protein_id="ABN56019.1"
FT                   /translation="MHLFFETVIRLSEKVMCSIILTLGLAILLGYGLVSYAAEDIVVNA
FT                   TTSGGKILFQDNDSHGVYLLGRAWADFGSNATFSNVTPSIETGTGRSVFLVTCDNARGN
FT                   ELSRTRTAVFTLTVWNPAGVPHSTTREFRGICSETLSVDCTPFEPGEGRFEVTTTIRER
FT                   QLNLPAVFGR"
FT   sig_peptide     complement(78565..78678)
FT                   /locus_tag="Memar_0084"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.981 at
FT                   residue 38"
FT   gene            complement(78699..79205)
FT                   /locus_tag="Memar_0085"
FT   CDS_pept        complement(78699..79205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56020"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRM0"
FT                   /protein_id="ABN56020.1"
FT                   /translation="MKTRNGSITAWAVLALVVLASVGAVSAAQAQSQESIEVGTEDTGD
FT                   IGILAVEELGVMYTDGDADTASVTTYGPITVPPGYNTFKAKYYNSNDEDNDGQGALYRL
FT                   TVYDAQGMAHTKQIKVDWATSGTIEVSFDSRGTGDAYYELWCETHDWLDTTKATDIGTG
FT                   DLDYV"
FT   sig_peptide     complement(79113..79205)
FT                   /locus_tag="Memar_0085"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.652 at
FT                   residue 31"
FT   gene            complement(79554..80522)
FT                   /locus_tag="Memar_0086"
FT   CDS_pept        complement(79554..80522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0086"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mac:MA4359
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56021"
FT                   /db_xref="GOA:A3CRM1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRM1"
FT                   /protein_id="ABN56021.1"
FT                   /translation="MTAERVFTVAQKEFTDQITGWRFLVILALFLAIALVGTYSGVVSY
FT                   ERELDRYSQQLAAMDNQNDGSAGMMPAKPPVEGVYSSMFLTLVSYGGLLAIAVGSGLVS
FT                   GEKESRSLKSLLSHPVYRDEIINGKALGGVALLALVVGSVLAISTALLLVFSIVPAPGD
FT                   LWMILTYAGVILLFLITFFSIALALSTLCRESGSALLLSVVVFILLVFLAPYATTHIGM
FT                   ALMTEEPDPAAYGGDISSEEFQAAITAYYGQFDLIQSIGNLASPQMATNALIQGIGNAP
FT                   TSGATLEDTLGKIWSSVVALILYPTVFFAVAYTRFMRMDIR"
FT   gene            complement(81016..81792)
FT                   /locus_tag="Memar_0087"
FT   CDS_pept        complement(81016..81792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56022"
FT                   /db_xref="GOA:A3CRM2"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRM2"
FT                   /protein_id="ABN56022.1"
FT                   /translation="MTKTTLRIVIALAIICCTGAMIVTVHLPDGYPHPEVGNATPEGSP
FT                   LGSDLPGGISRNATPNEVPDEMQEVRNMTPERLSQGLYVYPFVRQALEEANMTPEVLPE
FT                   ELTEEIEQLQRSYEDRKFGISRWEFDSENKLAIIYAYSILDEKKVKAIQGRQAGGWTFK
FT                   VIHDLDYENERKQAAAELMQFQNDHPELEISGFIITSPAHVEMWVRNRTPENEALNGTV
FT                   MYGRTIELIGGAPREELMMREELKRNEPASREPEAL"
FT   sig_peptide     complement(81715..81792)
FT                   /locus_tag="Memar_0087"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.954) with cleavage site probability 0.894 at
FT                   residue 26"
FT   gene            complement(81807..82415)
FT                   /locus_tag="Memar_0088"
FT   CDS_pept        complement(81807..82415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56023"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRM3"
FT                   /protein_id="ABN56023.1"
FT                   /translation="MTQEKRSLNRADTQIPAANQHIRRDGDCHSSAGAYLPFMIGYYRH
FT                   GLSDCGGGMGPWGSADCLPNVVIRYARTRTCLAHLQTLAGCYWMERDGCPEHCYIEGTF
FT                   NLDFYMVSLINNSRGFGHAICAEFLGGDMQTFSRWKFYQFDNLDIWPGNWQMPYGTETE
FT                   DTKVKIYEITGIFNCGLPDHDLVPLVTFLIKENGDVTKG"
FT   gene            complement(82962..83222)
FT                   /locus_tag="Memar_0089"
FT   CDS_pept        complement(82962..83222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56024"
FT                   /db_xref="GOA:A3CRM4"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRM4"
FT                   /protein_id="ABN56024.1"
FT                   /translation="MTAERVFTVAQKEFTDQITGWRFLVILALFLAIALVGTYSGVGSY
FT                   ERDLDRYSQQLAAMDDRLDGPERMMPVKPPVEGVYSSMLRS"
FT   gene            83594..84277
FT                   /locus_tag="Memar_0090"
FT   CDS_pept        83594..84277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afu:AF1575 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56025"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRM5"
FT                   /protein_id="ABN56025.1"
FT                   /translation="MRRPILAVIVGVIAVYACMHFSILPEAPDVTRIENITHLESPAYN
FT                   PAVLDLWEIAVESTGVENESARLLRLETNIAGDGAIRVIWLYFYGDKNGEQHGYEAYVG
FT                   PGGTVSAKSQKFNFSVQGVHPLELLREVDAIALEDIPFRDRGMRLLVSVNAYGDHYNET
FT                   RGRLYEVSDGAFRPVKEVTFGPDVRWYTITITPHRSPGSPPPPEEVLIAFTRQDLAAAE
FT                   SVVYG"
FT   gene            complement(84319..85053)
FT                   /locus_tag="Memar_0091"
FT   CDS_pept        complement(84319..85053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56026"
FT                   /db_xref="GOA:A3CRM6"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRM6"
FT                   /protein_id="ABN56026.1"
FT                   /translation="MRNQLPLARTALLLLVLLHIIAPGSAAGTISSEGEFPETIPDDPA
FT                   PLYIWNVPLKLILLDFVFMTAPLLFLPVQFLISVAVWLVLGQRRISRKNVLEHDTRRAA
FT                   YLCIRENPGINHASLSHRLGVNIGTLRYHLATLCETGQIVAERDHGFLRYYANGRAARE
FT                   GEGYPINGTRKQILDLLARNPGIARKEVASALGISGASVTWHTGLLIRDGAIRSERDGR
FT                   MVRYFPRRDIVFRADRSADPTG"
FT   sig_peptide     complement(84970..85053)
FT                   /locus_tag="Memar_0091"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.498 at
FT                   residue 28"
FT   gene            complement(85094..85447)
FT                   /locus_tag="Memar_0092"
FT   CDS_pept        complement(85094..85447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA1552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56027"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRM7"
FT                   /protein_id="ABN56027.1"
FT                   /translation="MCNIAPEEDIPENDMGIRAIYLIQQGETHYHNTYAPPGSSTLFVN
FT                   LDWFIPQQSLTLKIISPSGSTYAYYHDTDLDGHKDAQIRTWIPSPKAGTWQFQVYGEIV
FT                   RGTQDYTFEATAE"
FT   gene            86001..87398
FT                   /locus_tag="Memar_0093"
FT   CDS_pept        86001..87398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0093"
FT                   /product="Peptidase M12B, propeptide"
FT                   /note="PFAM: Peptidase M12B, propeptide; KEGG:
FT                   mbu:Mbur_1712 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56028"
FT                   /db_xref="GOA:A3CRM8"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRM8"
FT                   /protein_id="ABN56028.1"
FT                   /translation="MLFPYLKVCLSGLREKKLEEKCMNGKIGMQVFSLLLALMLVSMVV
FT                   VSTVSAQDVCRDGTAYFSSIQLSDKGGKVHLTNLPPAQEYELVTVNPSLFAVDAGSGRP
FT                   VAVDILGKEYLLDLKQVPAPIAEDAKCIVVNESGTFTADFPWIQCYSGTLTEDPESYAF
FT                   FTVGDGVILGTIRHGNNSYTIDQVGTTEVGGVRKIVHAIYNGSTVIDVKSPFAYDLQVP
FT                   VSLEEVEKLEESEKMLRAQNPQIDPRSVTTVTLCTAHDWQFRNAFPSPNYEMANMIAQM
FT                   GSAFSPSDIGVGFQINAFCDIGTVLGSTTNPYDLLQAFGENIKPDRDYSDSDIAVLFTG
FT                   KELDGDTIGITYDVPGSSGHAYAVVQMVNAGSTYQATFSQRCVNTAHEIGHVFGGKHQD
FT                   STGSPSYARAYHWKDWGIWDRYTAIWTPFMGDEAMLEFSSDTNHGDASHDNARRIYELK
FT                   GTVAGYR"
FT   sig_peptide     86001..86156
FT                   /locus_tag="Memar_0093"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.706) with cleavage site probability 0.667 at
FT                   residue 52"
FT   gene            87382..87837
FT                   /locus_tag="Memar_0094"
FT   CDS_pept        87382..87837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56029"
FT                   /db_xref="GOA:A3CRM9"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRM9"
FT                   /protein_id="ABN56029.1"
FT                   /translation="MQDIGEPGSVVMKKTSIGVVLAVVGIAAICMLVISTFSPQEGELL
FT                   PFAPTSPFLVSNQDNVSHRVHVSVSGVNGTLDNTLLSSENFTLAGGAHVHSSAMADQIG
FT                   EYLYSVSVDGNPPHNAVRKLSPTAGVIIEVISGQEVEIVPVDFHIAL"
FT   gene            88426..89589
FT                   /locus_tag="Memar_0095"
FT   CDS_pept        88426..89589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tko:TK1839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56030"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRN0"
FT                   /protein_id="ABN56030.1"
FT                   /translation="MLVDGKTHAARKRAISLALLSLVVLTAVSGCLSIDAVADPHALSV
FT                   TRTDAAGTEIWHTVFDGGGDEYGTVIVPVSDGGLLVGGSVKQSPGSDEHALLLKIAEDG
FT                   RIEWNRSFPARYGVEAVASHPDGSFTAGTGDGSLFRVAGDGTPVWSSRVSGSVPGISGL
FT                   PDGGIVAAGSKHERDVWVAVVNDTGSLLREETYPDLGRGRALEVASASDGGCIVAGTTD
FT                   SHPLWVMRLDGEGNVIWTRTFEEGPEFIGVMLHRVYSVREKPDGSVELLYKVGRALKGE
FT                   DAGRSVTVDRTLARDGSDVSVTEFYMPCPVVRASGGGYACAALESSEGAGYTMGNHLGS
FT                   PIHVMKCDERGEIVRVSAGTEAEVEIVTDILQTPDGGFAVLGGSTRI"
FT   sig_peptide     88426..88542
FT                   /locus_tag="Memar_0095"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.354 at
FT                   residue 39"
FT   gene            89676..90095
FT                   /locus_tag="Memar_0096"
FT   CDS_pept        89676..90095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0096"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mac:MA1863
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56031"
FT                   /db_xref="GOA:A3CRN1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRN1"
FT                   /protein_id="ABN56031.1"
FT                   /translation="MAARHEHLFEVFDRLIAIKNECSSEIFSECGLSRLTVKQVTYLKT
FT                   IDEHGDVTFSSLAEITRNSKPTVTEMVNRFVRMECAYRQKSPDDGRVTYIRLTEKGRML
FT                   ANAERNALNRMIERVVRTLDENEVDLLVEILKKVG"
FT   gene            90152..92533
FT                   /locus_tag="Memar_0097"
FT   CDS_pept        90152..92533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0097"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: mac:MA1862 endopeptidase La; TIGRFAM:
FT                   ATP-dependent protease La; PFAM: AAA ATPase, central domain
FT                   protein; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: peptidase S16, lon domain
FT                   protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56032"
FT                   /db_xref="GOA:A3CRN2"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRN2"
FT                   /protein_id="ABN56032.1"
FT                   /translation="MHSPEPDTSKEYIVIPLFETVVYPETRTKLQVETAIGEALIAAKS
FT                   DGSASAVGLTAKSGAETPEDPADALYSTGNLLMIAHVQPADDGYLVFAHATSRVKAVTL
FT                   SERDGLLYAACEPLPDIPDLDEDARAKTLADVKAAVHEISGNFQGSEQFTRPVDRMESV
FT                   DQIMGFVMPFMPVDVEQKQALLETVSVRERHAAFLDLLVNMNENINLRIEVARKASEKV
FT                   GKANREAMLREQLRVIQEELNGCEGSSGEENYRERIERSTMPEEVRKKALAELKKLESG
FT                   GSQHHESQGIRNYLDLLLDLPWTVEKRSIDIEEARRVLESNHNGLEKVKERIVQHLAVM
FT                   KLKEEKQGSILLLTGPPGTGKTSLGRSVADALGREYVRISLGGVKDEAEIRGHRRTYVG
FT                   SLPGRIIQGMKRAGAKNPVFILDEVDKLAVSYSGDPASALLEVLDPEQNSTFSDHYLEV
FT                   PYDLSDVLFIATANSLATIPAPLLDRMELIEISGYTKNEKFAIAKDHLLPETLEEHGLT
FT                   AAHLRVEDEAVSAIIDRYTREAGVRALKKQLARIARYVSAKVVSGTVDLPVVVTAEMLP
FT                   EILGRETVRPDMARKENQPGVVTGLAWTPVGGDILFIEGTFMPGKGKLTLTGQLGDVMK
FT                   ESAQISLSLIRSRLAATTTGFDFFASDVHIHVPAGATPKDGPSAGVTLFTALASLVTGR
FT                   TVDPTVAMTGEVTLSGAVLPVGGIKEKVLAAHRAGIRTVILPRENERDLEDVPEDVRRD
FT                   LAFVTVETIEDVLREALGVELHGPVLPYAGKNRCVPMHDL"
FT   gene            92740..93498
FT                   /locus_tag="Memar_0098"
FT   CDS_pept        92740..93498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0098"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afu:AF1575 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56033"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRN3"
FT                   /protein_id="ABN56033.1"
FT                   /translation="MNQTHIGAIALTCCIAFFAGALFTCVLVHNPEPPAPTLRQNIYGL
FT                   PLSEMWAIVQDRTGVENSTAVLGDFRLVIDGHGAVEQLSFEFYGDDTGLPHWYRVAASS
FT                   TGRVTWNSLEVDRVPPGEHPLTLFTEIERIPYRELAGENGILIVGVSSQSGGLGYDASY
FT                   GDLYALRQGEFIPLKHVGFNTTEPWYTIDVSHGVKDGSGLVGTYYCTIFTLRDLVKAER
FT                   VYYPDGRFFWPPPGSLPADTDELPGLGAAS"
FT   sig_peptide     92740..92814
FT                   /locus_tag="Memar_0098"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.923 at
FT                   residue 25"
FT   gene            93498..93935
FT                   /locus_tag="Memar_0099"
FT   CDS_pept        93498..93935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56034"
FT                   /db_xref="GOA:A3CRN4"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRN4"
FT                   /protein_id="ABN56034.1"
FT                   /translation="MPDDPLRRQDGHMKPDRERLIIVGTLAFVGVILLVATVVFGVTTF
FT                   VTLITGVDGLPQELDVRVVGEEELQNASVIHLTDRDLQQHPVLATAIREAGSESNVPAS
FT                   APVPMTGVECLVLTESCGVYTANAPILEYDGVYYATRVLIH"
FT   gene            93959..94405
FT                   /locus_tag="Memar_0100"
FT   CDS_pept        93959..94405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56035"
FT                   /db_xref="GOA:A3CRN5"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRN5"
FT                   /protein_id="ABN56035.1"
FT                   /translation="MEEGKKPGNRLRTAGFVVVFGLAGIVAVVLGFMLADALLIYAMEG
FT                   SGGQPMLYVMERTDVQPEWGMVVPLTEKDFADHPALDAVIRGDERNPSGWEWGMSDRRF
FT                   IGGTNVSYAESRALQDTYGPDRETWVYPHLEYEGAYYLVVTTWS"
FT   gene            94711..95985
FT                   /locus_tag="Memar_0101"
FT   CDS_pept        94711..95985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56036"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRN6"
FT                   /protein_id="ABN56036.1"
FT                   /translation="MLFPYLKVCPSCLREEENEMNGKIEMRAFSVLLALLLVSVVVVST
FT                   ASAQTGIDAIAEEELADSVIITPDFSSQDIVVSPSLGEDDLITLVFPESWIKDRNSADY
FT                   SDRVELVDAHVLLKNECFDEKTGLRYFSPVQVTEAQSLSVLRIPKKMFELSLAMNDGSI
FT                   SFPMKYFTAYPDMQTMLSEVRVATPSEPEVYSPENARSASYVSPPLHGEWAQYNVNSQY
FT                   AGRPVHLEGLIKPGSFTNNGHEGAIYHEREIYLDGGDAIEYIFYYDEDYYGDKVWLGAA
FT                   IYDNSDSFQGCPTIKWFDATSRHWYDYDFTISSAGTYYIWFRDCTTGSWKEHIYYDNDD
FT                   PSASINRICGSAEIYADVPVQYSFEAITDRMIDEYVRTNDGLTKLPGEVFSWAAYTGED
FT                   RTYCFMNAWIASGRITTYHECDSTL"
FT   gene            96059..96835
FT                   /locus_tag="Memar_0102"
FT   CDS_pept        96059..96835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0102"
FT                   /product="Outer membrane lipoprotein-sorting protein-like
FT                   protein"
FT                   /note="KEGG: mac:MA4325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56037"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRN7"
FT                   /protein_id="ABN56037.1"
FT                   /translation="MAVCVTAGCSIIPATPEPLPPDEALPPEEALPPGPEVAAKFAETY
FT                   DSLQDFSATVTTVSDRGTFCELVWFKKPDRFRVNYLEGHPNNPEHHPAKEGDLVVFDGE
FT                   TQWHYVNATGEVLYVSARMRNYTFSEEYATGAFDALGLIRNLLADHECSLSGVRTEDGK
FT                   MIYVLEVANTTRIADTPDPRRYPVYAVNAGVEKDSWILRRADFFNARGETVLIVEYHNV
FT                   TWNTGIPESLFQYSPLEEAIVKPMRTVAITPPYTGP"
FT   gene            97127..98221
FT                   /locus_tag="Memar_0103"
FT   CDS_pept        97127..98221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56038"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRN8"
FT                   /protein_id="ABN56038.1"
FT                   /translation="MNGTTRTLTLLLALLLAAVPAAGADLGPNQHLIPELKVNESIETI
FT                   AISGVLSLQPEWDGSVTTGIPFGSIMVHTADARTLIFDSDGNQLLSISDELSAKVPTPA
FT                   GVEKPCTWVHQLPNDSRVYHHDNATFIFGKAGNLILTVINEHPPPVEDPITINITSPAE
FT                   GETVWIDVVPPRVAVVGEVHAPTGLHNVVVRSGTGEVSCGNRPEFACSVPVSAGENTIT
FT                   VVAGTHGRRAEKAVNVTVRIGLPPPPAIAVSGRVTDAGGNPVPGALVRFESVFTLDDEP
FT                   LAGTNVTGEDGGYLVEGVFGYRQTITVEKEGYAPLREEFLFENPTNNLDLELEPSSRTV
FT                   PGFDSAVGVLSLLGVFLLIGRRGW"
FT   sig_peptide     97127..97198
FT                   /locus_tag="Memar_0103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.737 at
FT                   residue 24"
FT   gene            98223..98483
FT                   /locus_tag="Memar_0104"
FT   CDS_pept        98223..98483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56039"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRN9"
FT                   /protein_id="ABN56039.1"
FT                   /translation="MTESGSVIPALLLTAAVTALAAGFAAFAPVAEVTVTPHEQIAPQD
FT                   RAPVHIDFFTEKRDAPVEGVDILLLDPALRTRGLRYRGYPG"
FT   sig_peptide     98223..98288
FT                   /locus_tag="Memar_0104"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.840 at
FT                   residue 22"
FT   gene            98509..99036
FT                   /locus_tag="Memar_0105"
FT   CDS_pept        98509..99036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56040"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRP0"
FT                   /protein_id="ABN56040.1"
FT                   /translation="MHIAGQPCTADLEESLHGTGSFTGTLSGDGRAHLTISGDVLRGYF
FT                   EIGGVAYWVESTGRYDAESPGKVLHYVHSSADVKGLSGCYLTLYNISNGDLEDSGYPAD
FT                   WTKADFLSGGHEVVPLTDTDLVDLPKVNETLRTGFMEVPLSYNETMRIVKGYRGKIAEY
FT                   RGNYYVIDFFES"
FT   gene            complement(99051..99536)
FT                   /locus_tag="Memar_0106"
FT   CDS_pept        complement(99051..99536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0106"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mhu:Mhun_0501 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56041"
FT                   /db_xref="GOA:A3CRP1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR016472"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRP1"
FT                   /protein_id="ABN56041.1"
FT                   /translation="MLSRKIFEADFADALQEELARQDMSIRDLAERAGIPPATLYKLTS
FT                   GRADPRLSTVRRIVNVLEPREKSFIAVIAARFLLDEIDNRDLPIGGKQYHIRGYAADSL
FT                   EECIIAAVRADKEGALGIICAPILAPIVEKIADCPVAIIKPQQQTLIEAIETIAKRV"
FT   gene            99640..100419
FT                   /locus_tag="Memar_0107"
FT   CDS_pept        99640..100419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0107"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mhu:Mhun_2981 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56042"
FT                   /db_xref="GOA:A3CRP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRP2"
FT                   /protein_id="ABN56042.1"
FT                   /translation="MDPSPIREITILPGRNRHGEPERFDAITIRSGDTISIVGPTGSGK
FT                   SAFINDIEVFARNDTATGRTVLVNGEYPPEEFVRDPAHKPVALITQNTRCLADLAVAEF
FT                   LSMHVRSRRIADDGLVERTIALANEFTGEEIRSGARMTALSGGQTRSLLVADAVLIAAA
FT                   PVLLLDEVENAGIFKERVIEVLRAGGKAVVFVTHDPLVSLLSARRIVMRDGAVERVIEP
FT                   LDRENEALREALRLDGILRRMREQIRAGDLITGPVGA"
FT   gene            100416..101123
FT                   /locus_tag="Memar_0108"
FT   CDS_pept        100416..101123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0108"
FT                   /product="cobalamin synthesis protein, P47K"
FT                   /note="PFAM: cobalamin synthesis protein, P47K; SMART: AAA
FT                   ATPase; KEGG: mhu:Mhun_2980 cobalamin synthesis protein,
FT                   P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56043"
FT                   /db_xref="GOA:A3CRP3"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRP3"
FT                   /protein_id="ABN56043.1"
FT                   /translation="MRLAVVAGPPSAGKTAVVRQTIRSLLDRYRIAYLKIDVVRAFEDE
FT                   ELAAEFSIPARKVCSGDLCPDHAGVMVMRDAIAWAEGEGADLLLVESAGLCLRCSPYTT
FT                   QALGIVVLSAVSGTNTPLKMAAMLALADIAVVTRIDLVSQAEKEVFRERIREVNPDLDI
FT                   VETNAVQGTGMRYLLRAIEGCPPITDPDTIVLRGAPPLGVCTLCIGKTEIGWQNHFGVV
FT                   RRLEGADYLFRGD"
FT   gene            101128..101745
FT                   /locus_tag="Memar_0109"
FT   CDS_pept        101128..101745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0109"
FT                   /product="Fe-S cluster domain protein"
FT                   /note="PFAM: Fe-S cluster domain protein; KEGG:
FT                   mhu:Mhun_2979 putative Fe-S cluster"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56044"
FT                   /db_xref="GOA:A3CRP4"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRP4"
FT                   /protein_id="ABN56044.1"
FT                   /translation="MAWNPPGKDCGACGAPTCEAFLARVRRGEKALPDCVFYPTGTAPS
FT                   RFEGEARHSGRDVLGGEYDFILDPLPGEVSARKIVLPFRPDLVEKWGIAAGDIVVGRPA
FT                   GAGCPVQHVLSVIRASPVSGLLTCLVVGPEVSRGGEFKDVEAYHIVGFEGIARTVRREP
FT                   VFGMRQRFLPGYCMMNLTHTGVVNMILARSSGLHVRVEDIRL"
FT   gene            101742..102983
FT                   /locus_tag="Memar_0110"
FT   CDS_pept        101742..102983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0110"
FT                   /product="protein of unknown function DUF39"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF39; KEGG:
FT                   mhu:Mhun_2978 protein of unknown function DUF39"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56045"
FT                   /db_xref="InterPro:IPR002708"
FT                   /db_xref="InterPro:IPR017677"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRP5"
FT                   /protein_id="ABN56045.1"
FT                   /translation="MKTIAEIDEKIRNGSAVVYTAAEFKRLIREGADITAAEVDVVTTG
FT                   TSGVMSGTAAILSVPVAEPGTFERAERAWLNGVPCMPGPCPNERLGILDLIVSGTAHAG
FT                   ASYGGGHLFREIVEGREIEVVVEAADRSIEARVTLDDFSYARLFTTRSAFRNYTAYVNT
FT                   KPTRMKTIFSVTGLQGPCREVSVSGCGEINPLQNDPARLAIRDGTPVFLNGSAGIVTGE
FT                   GTRSTPSRPNLTVIADMAGMQPRYMGGFATSAGPECITSLGVAIPVLDDRQVAALRVLD
FT                   EEIPLPVADINTRTVLGAGTYADVWQRPDREVAYYPEWCEGCSACAAAVICPTGAFTRE
FT                   TGIDRDRCLGCTACMASCPNNALEAGEGSIRVRGRRVPITLRQSGRTLAEDLCRDVKER
FT                   ILDARFTFTGGGGR"
FT   gene            102980..104272
FT                   /locus_tag="Memar_0111"
FT   CDS_pept        102980..104272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0111"
FT                   /product="cysteate synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: mhu:Mhun_2977
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56046"
FT                   /db_xref="GOA:A3CRP6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR022401"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CRP6"
FT                   /protein_id="ABN56046.1"
FT                   /translation="MREKYLLHCPGCGRLFPDNYTLDCPLGCNALLRTVYAEHRLTLRD
FT                   LPGIFRYSSWLPIEGHLRIDAGPVSYASEGLARELGLSNLTVTFSGYWPERGGRMETCS
FT                   FKELEAQPTVLRLGEKGAGVLQISSAGNTGRAFCQVSALTGAPVVVVVPASAADRLWTT
FT                   VPAPNVCLITVEGDYSDSIAFGREVCSLPGIVPEGGAKNVARRDGMGTVMLDAALFAGR
FT                   LPDAYFQAIGSGTGGIAAWEAAERLVADGRFGSRLPTLHLSQNLPFVPMVRAWEAGRRE
FT                   IVPEVDMPDAEASIVRVSADVLTNRHPPWEVRGGVYDALAASGGRMYAVANDDTRSAGR
FT                   LFEATEEIDLDPAAAVAVASLIRAAEEGFIGPDDHILLNVTGGGYARAAEDLDRYPVEP
FT                   YLRVRAGEAFAGDVRDAVRGWLAEQEVVVRA"
FT   gene            104265..105386
FT                   /locus_tag="Memar_0112"
FT   CDS_pept        104265..105386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0112"
FT                   /product="sulfopyruvate decarboxylase subunit beta /
FT                   sulfopyruvate decarboxylase subunit alpha"
FT                   /EC_number="4.1.1.79"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: mhu:Mhun_2976 thiamine pyrophosphate
FT                   enzyme-like TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56047"
FT                   /db_xref="GOA:A3CRP7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR022494"
FT                   /db_xref="InterPro:IPR022502"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRP7"
FT                   /protein_id="ABN56047.1"
FT                   /translation="MREGCVLDRLSALGVDTVASLPCDRTQEFCALIPERFHAVNLTRE
FT                   EDGVGISAGLAMAGGRPVLHMQSSGLGNSLNAIMSLTVTFGLPLPVLASWRGVYREAIP
FT                   AQVPFNRAVPDVLRALGIPHTIIRDPSDEGLIDEVVQDAYDSMRPHVGLILPSFWEGTE
FT                   EACPVEQPPPPRARESALEYRRTFREPVMARNDAIRAIADSLDGEAGVANIGVPSKELY
FT                   AARDRDLNFYMLGSYTQATPIGLGLSLATDRDVVVLDGDGSLLGTAVLPVVAAESPSNL
FT                   TVVCLDNGAFGSTGNQPTPASGLVDMELLARAAGIRRTCMVQDEEELADAWENRVRGPN
FT                   FIHVVLKPGNAAVPNIPLTPAGIRERFVRALRG"
FT   gene            105543..105773
FT                   /locus_tag="Memar_0113"
FT   CDS_pept        105543..105773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56048"
FT                   /db_xref="GOA:A3CRP8"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRP8"
FT                   /protein_id="ABN56048.1"
FT                   /translation="MQRRVSMDTLLTGLLAAMLLLLLFYDPIRGLHPALDPLFMLSGQA
FT                   IGLVFSVLMVFCIVGLVLMIGRRLYGFCRGG"
FT   gene            105839..106117
FT                   /locus_tag="Memar_0114"
FT   CDS_pept        105839..106117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56049"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRP9"
FT                   /protein_id="ABN56049.1"
FT                   /translation="MRASLLIHCGDQGSLFPVTTPGSVDERDRKRISPNVQVTTYMERN
FT                   HIALLLAVGIAAGLYGAVTYQWILMLVIVAVVALILVASDVAGRIGA"
FT   gene            106192..106920
FT                   /locus_tag="Memar_0115"
FT   CDS_pept        106192..106920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0115"
FT                   /product="protein of unknown function DUF422"
FT                   /note="PFAM: protein of unknown function DUF422; KEGG:
FT                   rxy:Rxyl_2204 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56050"
FT                   /db_xref="InterPro:IPR007354"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRQ0"
FT                   /protein_id="ABN56050.1"
FT                   /translation="MRITRAALLLTAFALFLAAYLVVRFDDPVPSAVPVVFLVGLALPS
FT                   YLALVRWLGPARGIALLLLSLLPLVVEAYAVATGIPYGEFTYSADLGYRAFGLVPWTVA
FT                   FAYLPMLLGAVTLAAAAAGTSWSRLVPAGVLVLLLVDLVVDPAVVHAGLWVWLAGGAYY
FT                   GVPASNFAGWVLTGTAYIALFRLVAGARPIPGTVAASLLLVLAFWTGYLARNGLAVPAL
FT                   LGAALALATLPVILRDGSPR"
FT   sig_peptide     106192..106251
FT                   /locus_tag="Memar_0115"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.532 at
FT                   residue 20"
FT   gene            107007..108482
FT                   /locus_tag="Memar_0116"
FT   CDS_pept        107007..108482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0116"
FT                   /product="Phytoene dehydrogenase-related protein"
FT                   /note="TIGRFAM: Phytoene dehydrogenase-related protein;
FT                   PFAM: amine oxidase; FAD dependent oxidoreductase; KEGG:
FT                   mth:MTH1807 phytoene dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56051"
FT                   /db_xref="GOA:A3CRQ1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRQ1"
FT                   /protein_id="ABN56051.1"
FT                   /translation="MRAVIVGAGFGGLSVAALLAKGGFDVTVVEKNERPGGRASIHRDG
FT                   GFTFDMGPSWYLMPDVYDRFFAEFGRSPGDYFPLARLDPSYRVFFGTDRVADVSADLEK
FT                   NYDLFESFEPGGAGKLRGYLAGAEETYRTTMDDLLYRDYRSILDFFDRRLLSRGRKLHP
FT                   FENLESFVKKRFASDEARKIVQYSIGFLGGSPENTPSFYHIMTHIDMNMGVWYPEGGMR
FT                   AVVEALVSLGREFGVEYRYNEPATAIDVERGLARRVVTPLGAHETDIVVVNADYPFTEL
FT                   SLLPEGSRSYSASYWKKKVLAPSTFVAYLGVDRVVEGLAHHNVFLEPDWEEGFETIFDP
FT                   KKAAWPENPSFYVNVPSRTDTTAAPSGTDTLFVLAPLAPGIEDTPELRERFYDLLMSRM
FT                   EEILGENIRDSVVSRRIFALSDFSNRYNAYRGTALGLSHTLRQTALWRPAHQSKRVRNL
FT                   YYTGQYTHPGIGVPMTLISSQIVARELTDRYRR"
FT   sig_peptide     107007..107069
FT                   /locus_tag="Memar_0116"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.815) with cleavage site probability 0.626 at
FT                   residue 21"
FT   gene            108491..109315
FT                   /locus_tag="Memar_0117"
FT   CDS_pept        108491..109315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0117"
FT                   /product="Squalene/phytoene synthase"
FT                   /note="PFAM: Squalene/phytoene synthase; KEGG: mth:MTH1808
FT                   phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56052"
FT                   /db_xref="GOA:A3CRQ2"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRQ2"
FT                   /protein_id="ABN56052.1"
FT                   /translation="MIDRTIYNIFRRGSRTYFYSTLFFPPAVREDVFSLYSFVRTADDY
FT                   VDAVPQEIEEFYAFADRYAAAEAGEATGDVVVESFVDLAGRKGFDPAWTTAFLRSMESD
FT                   IIVGSYRTIRDLEGYLYGSSEVIGLMMARILDLPPESYAAAQNLGRAMQYVNFIRDIAE
FT                   DLALGRTYFPLEEMEAFGLDDLSAAAASRDPGGFAAFLRFQLRRYREWQEAAEAGFGHI
FT                   PRRYRIPIRTASDMYRWTARTIERDPAVVHRRKVKPSVIRIVSGAATNTLKA"
FT   gene            109322..110176
FT                   /locus_tag="Memar_0118"
FT   CDS_pept        109322..110176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0118"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: mth:MTH1809
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56053"
FT                   /db_xref="GOA:A3CRQ3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRQ3"
FT                   /protein_id="ABN56053.1"
FT                   /translation="MPPRLLSLAWRVSRFRFWIYTGGTYVVGYALGMDSWTAFFDPAYV
FT                   LFLLYFFFPANLFIYGVNDWWDQDTDRFNPKKDVKEYRISDADGRSLLLLLALAGAVSL
FT                   ALLFVLDTVGRALLLAFLFLSYFYSAPPLRFKEVPVLDFSSNMLYVVPGILGYYLASGA
FT                   LPPLALVIAGYLHISAMHLFSAIPDIGWDAAAGMTTTAVVLGRRRSLLLCLVFWSGLAA
FT                   LVIWLAGFAPLSLLVLIYPAVPLALLLRESLSIDRVYWYLPFVNTGLGGLVFLLATLRT
FT                   VAG"
FT   gene            110375..111091
FT                   /locus_tag="Memar_0119"
FT   CDS_pept        110375..111091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56054"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRQ4"
FT                   /protein_id="ABN56054.1"
FT                   /translation="MKVDFVFKAFTAIFAMIVILFLLSAFTETVLPGNFYRISITDLPG
FT                   PAVNGTTTVMVPLPANATGEPVIPEGAFSGDRVVGWQAEIRETPYGKMLAFTTTGEYAP
FT                   DISVSFEVVQTEDELQRLPLHQRPTNLTAWEMKREPRLLVPVLATPDNMSVAEFSRVSS
FT                   GTYTSVVFLDGFVPSPEDAAVVTFSLDYRGVGGTKRLMRENTWTTMVNTAVVSTESGFV
FT                   PVPADYRVIAGGIGFL"
FT   sig_peptide     110375..110458
FT                   /locus_tag="Memar_0119"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.962 at
FT                   residue 28"
FT   gene            111250..111690
FT                   /locus_tag="Memar_0120"
FT   CDS_pept        111250..111690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56055"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRQ5"
FT                   /protein_id="ABN56055.1"
FT                   /translation="MKRRSLTWLFFSLSAALLAALLLLHAPGAGAVQDPVEVSAPAKEP
FT                   GRAGNLTVIPATGDSKLPQAVPIPSSWRDIEPERCEPTEEDWAFVRDAATDLSEEEKTR
FT                   FVTEIRKIFAGESALPREEQDVLKRRLGYYLVEATGGAGTPP"
FT   sig_peptide     111250..111345
FT                   /locus_tag="Memar_0120"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.977 at
FT                   residue 32"
FT   gene            complement(111726..112643)
FT                   /locus_tag="Memar_0121"
FT   CDS_pept        complement(111726..112643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0121"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: mhu:Mhun_1778
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56056"
FT                   /db_xref="GOA:A3CRQ6"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRQ6"
FT                   /protein_id="ABN56056.1"
FT                   /translation="MDFLIVADQIFILVLLIAAGYVAVSAKIVDPRATRGLSGLLINIT
FT                   IPALIVASMQVPFTPERLAGAETLVLATGMLYVFSFALAWAVSKAMRVPAAEEGVLQFA
FT                   IVFGNVGFMGFPVALTLFGEESLFYVAIFNLFFNVLVFSVGIAMLTEGRGKGFDPKLLL
FT                   NPGIAASVVGLALFLGSVEIPSPFIDSIELLGGVTTPLAMIIVGAMLATFPAREMVGNW
FT                   RIWAASAVLLLAVPAAYCYLLAPVFADTYINGIMITMAAMPAAANTVIFAEQYGADSRL
FT                   ASQIVFVSTIGSLVTIPLIATVML"
FT   gene            113145..113888
FT                   /locus_tag="Memar_0122"
FT   CDS_pept        113145..113888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA0505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56057"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRQ7"
FT                   /protein_id="ABN56057.1"
FT                   /translation="MNGKTGLQAFPMLLALLLVSVVMVPASAYYYCCAEWVNNYPPPSD
FT                   LEHNDENAQGFYYQLGGDSSWWGDFIYGDGQALERHWKDPSKSGNGIDYIYTDDTHFAF
FT                   FSGHGAPEGFAFSSSQDDTFLSYSDALWGNTQMDWITIDACTVLRENSHTNWYNAFGGL
FT                   HSMTGFHTECHDVSDRGSNFVHRMVGTWTTQPIITAWFIAAKDTEPSTTYAAALAREGC
FT                   WSDYVYGHGSQGTPGTSFLYGTYQC"
FT   sig_peptide     113145..113231
FT                   /locus_tag="Memar_0122"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.949 at
FT                   residue 29"
FT   gene            113898..114860
FT                   /locus_tag="Memar_0123"
FT   CDS_pept        113898..114860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA0506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56058"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRQ8"
FT                   /protein_id="ABN56058.1"
FT                   /translation="MNMKLIGVSAGVLALLGVICVVSIPVFFSDSHTPDCGQSNQIGGV
FT                   KSAGAANLTYTASVPFPPTPAEVILYRVLEPEITTELVSSMAEKIGLKGTVRESYDQML
FT                   LSDEPHSLEVHMKSGRVALIDIPRWMNPNDKDLPESLPSDDEAIQIATQYLEETGLMPP
FT                   DAILCGVAHPQIVEYNEDGEVIGIAFEDVQVSYSRTIDGRPVVGSKLTAEIGGGGDILN
FT                   VYKLWRDYAPEKEIAVITPQEAFEELKATGLAVDGKGPTAVITGIELGYYEAPAMDEPT
FT                   YLVPVYIFRGEVRDETGGTAFVRYIPASPDLGEGIPAVK"
FT   sig_peptide     113898..113993
FT                   /locus_tag="Memar_0123"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.924) with cleavage site probability 0.771 at
FT                   residue 32"
FT   gene            114899..115474
FT                   /locus_tag="Memar_0124"
FT   CDS_pept        114899..115474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56059"
FT                   /db_xref="GOA:A3CRQ9"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRQ9"
FT                   /protein_id="ABN56059.1"
FT                   /translation="MKKILYLVITCAAAGMLVLVGIHILPNPDLQGPGEIPTEVPENRT
FT                   PRPTGVPRENTSFIEIHHAGDPGVILYPGDPGYPAIEAECREQIRSTCGQYKMGFSRVE
FT                   LDAMKQNDTYVAMHLPAPTRFETGYIVDGSPKEILADEAVFFLDFEDWPENIIIMRLGD
FT                   VCGVWDASRDREKLRVLADPFLVGRAAS"
FT   gene            115977..116981
FT                   /locus_tag="Memar_0125"
FT   CDS_pept        115977..116981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56060"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRR0"
FT                   /protein_id="ABN56060.1"
FT                   /translation="MNGKIGLRAFSTLLAIMLVSVVMVPAMAMDAGALDIEKLDIVDPA
FT                   TLQERSPSFISELRSKGCSEEEIAEAIRSLPRVSYLDGWTEADDERVSPLLQQARDEVN
FT                   YSMYGEIDPLTEDGVSAVKMCSSGIWLFDTVFQGVNGWVHPGLMECSSDGTRRQFLTTH
FT                   LGKKIGTTANWIEIGIESVCDDPNPARYHVFTYDNNNISRPMVVHSNLTNGDRDYNFEI
FT                   YVSDVQYPEGYPYMILWEGQVVRVGHVPFAEGDLNEVHEYVRNDPGSFSDVSTSYVCDS
FT                   YVYYDGYGVWWNEQLDAQLAHPTQLHADTQEGVYGDFYRPWWSNAYRIDTWIA"
FT   sig_peptide     115977..116063
FT                   /locus_tag="Memar_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            117001..117375
FT                   /locus_tag="Memar_0126"
FT   CDS_pept        117001..117375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56061"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRR1"
FT                   /protein_id="ABN56061.1"
FT                   /translation="MVIISVLLFCCTGCVEEQPVNQSKYINISLTEPISQADAVIVALS
FT                   YPGVAKTIENDSFRITVGKLTVSDVREGRLKEHHMVYIDRFNSTTHEPLEGLQVIVTYD
FT                   GDVYKIWRSFPPVNSSIAAE"
FT   gene            117401..117706
FT                   /locus_tag="Memar_0127"
FT   CDS_pept        117401..117706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56062"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRR2"
FT                   /protein_id="ABN56062.1"
FT                   /translation="MPAPEPTPAKEPGRAGNLTVIRATGDSKPPQAVPILSSWRDIGPE
FT                   ICEPTEEDWAFVKDAATDLSEEEKTRFVTEVRKIPAGNRHCPRRSRSIWRGDLGTT"
FT   gene            complement(117901..118095)
FT                   /locus_tag="Memar_0128"
FT   CDS_pept        complement(117901..118095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56063"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRR3"
FT                   /protein_id="ABN56063.1"
FT                   /translation="MIIVGTMHVTFLAWEMVDNWRICAASVAPLLTRVFADARHTSQIV
FT                   FVSTNGSSVTVPLMTTVLL"
FT   gene            complement(118268..118741)
FT                   /locus_tag="Memar_0129"
FT   CDS_pept        complement(118268..118741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0129"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56064"
FT                   /db_xref="GOA:A3CRR4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRR4"
FT                   /protein_id="ABN56064.1"
FT                   /translation="MEEVTLDRGDIAALSSDVRVAILKALDIRPMAMSELADGLGLAKS
FT                   TVHEHLAVLADADLVAHENARKWRDYTLTEKGRRILHPGRDHRIIFLLGTSLVAMTAGV
FT                   LCVTSYLRGFVVQGGSVVREPLLLYAGEALLGVTFVLWYIALRCRRRTAPIPA"
FT   gene            complement(118861..119676)
FT                   /locus_tag="Memar_0130"
FT   CDS_pept        complement(118861..119676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56065"
FT                   /db_xref="GOA:A3CRR5"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRR5"
FT                   /protein_id="ABN56065.1"
FT                   /translation="MHSKTWIWLGIGAVLILAAVNLAILTAFPPGQQHVQEPLKRVNWI
FT                   LPFGPGFEYPDPCESPIITYDADNETWHLENATAWNRTISLGDRYSLDPARPEDIRYTP
FT                   DIAIESDRISLDFFIRNLAGEDCARADLAVTTETASLNTTTGSPEGDVLPGASTSLPVD
FT                   DLAAGEWREVRVMADLPQPGPEEVLSLTIGLAAPYTLTTPNGTPIDFDFRRATVTIPGS
FT                   NTSWKEEIDPGSTPDPNLNRDRLPGGSATFVVVGIGAPEPVPPPTLRAE"
FT   sig_peptide     complement(119569..119676)
FT                   /locus_tag="Memar_0130"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.458 at
FT                   residue 36"
FT   gene            complement(119703..120479)
FT                   /locus_tag="Memar_0131"
FT   CDS_pept        complement(119703..120479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56066"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRR6"
FT                   /protein_id="ABN56066.1"
FT                   /translation="MKRIYIVAMLCLVVAVSIVSATDANAPIGVDTAKEKAQDFLNAPD
FT                   ATVQYQKTERLNLGEYYVFGTGDGQVYANARTGVIERATFDSARKDCRDVRLDRAAAEV
FT                   TARAYAEEKYSGFAKKSMQLTRSDLVSHGDAGSEYSYIWREEISGVLTPNTVVVNLNPS
FT                   TGEIVSYIGIQREIKCSLEPKLSRDEALKIVAGQFPGIRVTGATADLSVEYTRPDVQTL
FT                   TWVITMSGEPEDHVLQGGLVVIDAQTGEVLMVSPYL"
FT   sig_peptide     complement(120414..120479)
FT                   /locus_tag="Memar_0131"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.835 at
FT                   residue 22"
FT   gene            complement(120495..121187)
FT                   /locus_tag="Memar_0132"
FT   CDS_pept        complement(120495..121187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56067"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRR7"
FT                   /protein_id="ABN56067.1"
FT                   /translation="MKPWIYMLAALFLLAALPAVASAAPPAHNYDCSDTTPTAYDARVD
FT                   QAAMYYSSSSSTNAHASTAYGQFRSDAVFFFNGHGLYYDDSHKGGGIKFSSKSWILADT
FT                   DGHYPGNDRYYITDYGTDIRDVLLAVYLACHTSHYNPYNGDLLQQTMNKGADICLGFDG
FT                   EVEVENGKCWSGSFWDRLRNGETVASAASNAKDDCYLHWPFGYHGVDTYEISGSYNSYL
FT                   TPARYGVY"
FT   sig_peptide     complement(121116..121187)
FT                   /locus_tag="Memar_0132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.926 at
FT                   residue 24"
FT   gene            121653..122720
FT                   /locus_tag="Memar_0133"
FT   CDS_pept        121653..122720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM0971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56068"
FT                   /db_xref="GOA:A3CRR8"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRR8"
FT                   /protein_id="ABN56068.1"
FT                   /translation="MYAFRVLKMCASSASWKESRRTIMNELRRIGRISILLGVLLCVAL
FT                   ISTASAGEVTLERSFLQDEAALDHYAHLSPDEQTIVLKALEETYSESKFEETTAELKKI
FT                   WDGTSALEETEKRELLASVIASVFTYYCPDTSRQISPMWGGAIGENPDGVHNALAGIAG
FT                   QKRGWGYSQTKILDANSRDPDTWGLEQMVEHYLDGAPFFSNAPDKCSYYANEARTQMRS
FT                   NPYSESAWRCLSWSMHYMSDLSMPWHTQGVADPAQLATHTLYEGYVQEKFTDPEYGFKA
FT                   ALVSAPNTWVVISDPASSARSLASYSSARYSGLQLKIVTIPFGWGEDDWVKSTTKDLLK
FT                   EGLKYNMGLVEYATH"
FT   sig_peptide     121653..121808
FT                   /locus_tag="Memar_0133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.982 at
FT                   residue 52"
FT   gene            122744..123424
FT                   /locus_tag="Memar_0134"
FT   CDS_pept        122744..123424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56069"
FT                   /db_xref="GOA:A3CRR9"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRR9"
FT                   /protein_id="ABN56069.1"
FT                   /translation="MNEQRKKIRKAILIGLAAVCILALMIFLIFLAVGFVEIISPNNSY
FT                   AIEITGLSSLAVNGTATVMVPIPANVDGVPAMSEEVLTSRYQAFGWRTAIRETPYGKML
FT                   AFTTTDGYGPGISVSSGEFEKKEEPRLLVPVLATPENVSVEEFSRSSGGTYTTVVFLDG
FT                   FIPPPENATPITFNLRYQGGGGMKHLIKENVWTTTVNATVPGTASGFIPIPAEYHVTPG
FT                   GLYL"
FT   sig_peptide     122744..122848
FT                   /locus_tag="Memar_0134"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.802 at
FT                   residue 35"
FT   gene            123436..124629
FT                   /locus_tag="Memar_0135"
FT   CDS_pept        123436..124629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0135"
FT                   /product="protein of unknown function DUF306, Meta and
FT                   HslJ"
FT                   /note="PFAM: protein of unknown function DUF306, Meta and
FT                   HslJ; KEGG: hne:HNE_1289 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56070"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRS0"
FT                   /protein_id="ABN56070.1"
FT                   /translation="MRKNSRRAVRVALAGLLVFVVCLGVLVFTHSAGARDDTRLPPDGN
FT                   PSLLANDNQSPLSGRSWHLTSYWTEEGEVPVIEKTDPIIAFTDAGRVSGTSGCNIFFGG
FT                   HDLSGSTLRIHDIESTKMTSTPEVLDQEKVFFTLLQKTRAYTIDGDCLRLFDASGREIL
FT                   SFTSQTQPLQGKAWYLWSPRNDTGGAVQDPGTDQISLQFLGESQFRGTAAGTDYCGTYE
FT                   ASGDTIRFGPAEGWVELPEWYSSLLKQAHGYRIIGAQLDIMNENGHSIMSFTRMPPSLV
FT                   SVDWYLQQHRAADGPGLLTPEGTYDLILFMPDGMITGIIHGIQLFAQYDADDSSISFGP
FT                   VAMLIAEDDDPGKASESREMIESMFGEARTYWVWNGTLELSSGDGKPLVTMANTPAL"
FT   sig_peptide     123436..123540
FT                   /locus_tag="Memar_0135"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.983 at
FT                   residue 35"
FT   gene            124769..125218
FT                   /locus_tag="Memar_0136"
FT   CDS_pept        124769..125218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56071"
FT                   /db_xref="GOA:A3CRS1"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRS1"
FT                   /protein_id="ABN56071.1"
FT                   /translation="MKSKVNRRLVIEGVLAFIGVILLVAMVVLMCTALFNWLEASGGSP
FT                   RLDVWEIRGELPPENASIIHLTEKDFEQHPALDSAIRGDNRGPGPWYSGDTPYGVLDER
FT                   TIGSAPVTYLEREVLIESFGPDVEARNQPYIEYEGAYYYFLILIP"
FT   sig_peptide     124769..124879
FT                   /locus_tag="Memar_0136"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.767) with cleavage site probability 0.390 at
FT                   residue 37"
FT   gene            125246..125692
FT                   /locus_tag="Memar_0137"
FT   CDS_pept        125246..125692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56072"
FT                   /db_xref="GOA:A3CRS2"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRS2"
FT                   /protein_id="ABN56072.1"
FT                   /translation="MEEDKNPKSRNRLKTAALVVACGLAGVIAIALGLMLADALIIYAH
FT                   ESSGEQPMFYVMERAEPGGSVIVPLTEQDFEQHPELAAVIRGEERNPSAWEWGYRDQRV
FT                   IGGTKVSYTESKALHDAYGPREGRGLYPLMEYEGAYYVVLTTWP"
FT   sig_peptide     125246..125356
FT                   /locus_tag="Memar_0137"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.503 at
FT                   residue 37"
FT   gene            126237..127574
FT                   /locus_tag="Memar_0138"
FT   CDS_pept        126237..127574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1712 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56073"
FT                   /db_xref="GOA:A3CRS3"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRS3"
FT                   /protein_id="ABN56073.1"
FT                   /translation="MEVGYMKGKTGLRAFSMLLAVMLVSVVLVPVVSASASNSGGEQMS
FT                   NRSVSEKALVHFGDLTEMRIVDERAVNVKIPFSIKNYDLVVFDLPKIREYLLHGDQLTV
FT                   YLEGQPYTMDLQETTIDTEAIAKGIHSFTGSLAGVEDSQVLLTVGNKVLLGRIVIDYTE
FT                   YFIESTSMQDSKSSSAFLQYVYSSKDIVPEGDTIPIDSHLLSTHAIDEKAYALKKMLEE
FT                   QADPRATVTVRVLVATDSKWMTDEPDWQDTAAAIIQYCNYDFNTLGVNIVPIYDTSKAQ
FT                   QLSSDPQIINSSLSTFKKYFPESYLNSKSADLGLYLGGYDSIEFEGVGSSGGYDFPSLC
FT                   RYAWAQMADDPSTYDAVLKDRAVVTMHELGHAFDAAHEYAPNQTETYNRAYQFYEHNRY
FT                   YQTVMWGCFMKTAWLQFSATDGFYGDANHDNSRRITETKGVVASYC"
FT   sig_peptide     126237..126347
FT                   /locus_tag="Memar_0138"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.588 at
FT                   residue 37"
FT   gene            127692..128546
FT                   /locus_tag="Memar_0139"
FT   CDS_pept        127692..128546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56074"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRS4"
FT                   /protein_id="ABN56074.1"
FT                   /translation="MIQKNPLLPALLLVAVATVLAAGFAVFGPGTEVADTTTPQERVLV
FT                   HIDSFTEKRDASTRDPGDLGIPSSVRRYDLVVYDTQAIRDRLLSGEPLIVYIAGLPYTA
FT                   DLQESLHDPESRSAGRHSFSGTLDRGGAALLTVSDSVFLALFRIGGVEYYVESTKQHDT
FT                   VSPERVLHYVYSSADVVPEGPPAMLSGYYLILHNISNGRAEYYGFDLPANWTEADFRSA
FT                   GYDIARLTDADFAELPTVNETLHSGGLEVPLSEDEAGRIAKSYRGKIVEYCGSYYLIDF
FT                   IES"
FT   sig_peptide     127692..127757
FT                   /locus_tag="Memar_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.662 at
FT                   residue 22"
FT   gene            complement(128620..129165)
FT                   /locus_tag="Memar_0140"
FT   CDS_pept        complement(128620..129165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0140"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, MarR; regulatory protein,
FT                   ArsR; KEGG: mac:MA0504 transcriptional regulator, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56075"
FT                   /db_xref="GOA:A3CRS5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRS5"
FT                   /protein_id="ABN56075.1"
FT                   /translation="MLLSPGGRIPDRFGPGPLTERFQGMEEIALDRDDITALSSDVRVM
FT                   ILKALDSRPMTVSELADRLGLAKSTVHQHLAVLASADLVAHASARKWRDYTLTEKGRRI
FT                   LHPGRDHRITIILGTSLVAVTAGALCVTSFLRGFAVQGGSVVREPLLLYAGEALLGVTV
FT                   VLWYLAMRCRRRTTPIPA"
FT   gene            complement(129222..130019)
FT                   /locus_tag="Memar_0141"
FT   CDS_pept        complement(129222..130019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56076"
FT                   /db_xref="GOA:A3CRS6"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRS6"
FT                   /protein_id="ABN56076.1"
FT                   /translation="MHSKTWIWLGISAVLILAAANLAILTAFPPGQQHAQEPLKRVNWI
FT                   LPFGPGFEYRGPCESPVIVYDGVNETWRLQNAAAWNRTISLDDRYSLDPAHPEDIRYTP
FT                   DILVEGDRISLDFFIRNLAGENCAHADLTVTTGTASLNATTGSPEGDVLPGAATALPVD
FT                   DLAAGEWREVRVTADLPRPGPEELLYLTIGLAAPYTLTTPNGTPIIFDLREMSSVASGP
FT                   TLTGGDAIDPDYNRARLPRASATFVVAGKDAPEPVLPPTLRAV"
FT   sig_peptide     complement(129912..130019)
FT                   /locus_tag="Memar_0141"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 36"
FT   gene            130538..131239
FT                   /locus_tag="Memar_0142"
FT   CDS_pept        130538..131239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A3152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56077"
FT                   /db_xref="GOA:A3CRS7"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRS7"
FT                   /protein_id="ABN56077.1"
FT                   /translation="MEKKRQLLPVIVVLLLTASVCPGPASANPVADGYNITVERAELTD
FT                   DEYTAAVEFLRSSEHVVDTRGYLPEFKDAQHRRSWYNFLENLTSDTFDSVKPYLYPDGP
FT                   VIGFGYDIEGYVGIGIVEEYPRDKASVAVDEIYTMLNGEAEKLGVEDIPVKVRTVDPDS
FT                   LELDVLIDPTDGETPPAVLAEPADMTTYRGSGGAYSIFYNPVLLGCALGAVIVLAVGYY
FT                   LIRRSRGKDAP"
FT   sig_peptide     130538..130621
FT                   /locus_tag="Memar_0142"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            131236..131817
FT                   /locus_tag="Memar_0143"
FT   CDS_pept        131236..131817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56078"
FT                   /db_xref="GOA:A3CRS8"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRS8"
FT                   /protein_id="ABN56078.1"
FT                   /translation="MSLLIFPAVAFVLAWPFALITLVGKLGQEKRRPAVSLGIGIVAVA
FT                   SGTIATVYAGAPATPLVSGIILLSMVTVSASAVATACFLFGNVAPNGRRLCAAAGSLLQ
FT                   LPFLVAQFVGPDRLPGAAPPVFAEKLPLLGILFDALAAAIGTAGEIGYRGFFSLGLLAG
FT                   LYLEVFLGAAAVCLVAGIVMGSPGEGATGG"
FT   gene            131822..132928
FT                   /locus_tag="Memar_0144"
FT   CDS_pept        131822..132928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0418 PKD"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56079"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRS9"
FT                   /protein_id="ABN56079.1"
FT                   /translation="MTPTKRNLRIFAAVAAFILLTVVAGCLDRPLTPGHRTLEGDVWVL
FT                   KLGDAGDREWFTVIDSGRFDEAFSIVEVPGGYAIAGSVSDAGEFHPTPRVILLDREGAV
FT                   TWNTTYPTPDDRRGTGIAPAGAGGFAVAASRGLLILTDADGSERHRTDLAAEGDYWAIA
FT                   PSGAGGWIAAGDDQVARIDANGSVAWQEPAGGVSPVSLPIIVPDPAGGCLVAGEAAGAP
FT                   GTVIAAKFDDRGAPVWNTTVQGSPGEQYLISAVRQDVTGGYSLLAGFTGAEPAGVLEVS
FT                   LGEDGSILRQNAINASAPVTWTPDGGYLSAALAENDYGGAQLRVERFDEDGAASWTSTQ
FT                   RLDEYSRLVALIPTADGGSAVLGMYMKY"
FT   sig_peptide     131822..131896
FT                   /locus_tag="Memar_0144"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.971) with cleavage site probability 0.697 at
FT                   residue 25"
FT   gene            133053..134549
FT                   /locus_tag="Memar_0145"
FT   CDS_pept        133053..134549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0145"
FT                   /product="Peptidase M12B, propeptide"
FT                   /note="PFAM: Peptidase M12B, propeptide; KEGG:
FT                   mbu:Mbur_0167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56080"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRT0"
FT                   /protein_id="ABN56080.1"
FT                   /translation="MQGIKILLILALLLPAGSAAAPAPSTGGTTNWLDTFDEWVGPRDM
FT                   SMYNPAIETPQRVPITEEIARQHPGMILLDENVTFPDAGYVVAPGLPSGPTVDVVVTDP
FT                   VYFSPVPPAGGANLTSLPPLRKYDLVTADPAAFVTDAGSGGPVTLRLPGGEFVLDLEPV
FT                   PGPVAEGARAFVRNESGTFEVALPSTWRFEGTVAGEPGSSAAFTVGSDVILGTVRCGST
FT                   SLVIGQAGTVEVGGEQKIVHVIYDERDVIPKFWPLATDVCVTPSGTGGSPEVTGARVAT
FT                   LVKSLMDAVAFGSCRGGKPDELDPAFGRTGESDPDPGRISLERAKQIASDYIEERDNGQ
FT                   DLALVTARYVVPHAEGLPGEYLIRYSRIIGGVRCLSDGITVTVHPATGCVMSYYKSWTM
FT                   PEGQVPTDAGAKISESEAGAIVADVMTENGAGGVQILSSEKQWVDLNYPAGLQEPHDIR
FT                   LAWHVRFTDDYYRSRGVTFPAAVWVDAETGEVFRCLYSLD"
FT   sig_peptide     133053..133115
FT                   /locus_tag="Memar_0145"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.907 at
FT                   residue 21"
FT   gene            134704..135177
FT                   /locus_tag="Memar_0146"
FT   CDS_pept        134704..135177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA4326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56081"
FT                   /db_xref="InterPro:IPR025377"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRT1"
FT                   /protein_id="ABN56081.1"
FT                   /translation="MKNILPALLLLCCLLAAAGCTGTEETVPEHAGTLAEAREVFGPDI
FT                   PEPSYLPEGYAFESAVRSPDGSVTLTYTGTAGDLRVTRLSAADAPCPGPTVAGNEERIV
FT                   QGNGIQGHLVYENDDRSEGSLWLFRWEWNDAAFCMTGKLPVDEITKVASSIVE"
FT   sig_peptide     134704..134772
FT                   /locus_tag="Memar_0146"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.599 at
FT                   residue 23"
FT   gene            135260..135451
FT                   /locus_tag="Memar_0147"
FT   CDS_pept        135260..135451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56082"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRT2"
FT                   /protein_id="ABN56082.1"
FT                   /translation="MVFSNVRFFGHMSGMLDGRPAFGHLPILRNTGSRCVKAVFEWSVD
FT                   PNDPTCRRAAQKRYVEER"
FT   gene            135510..135818
FT                   /locus_tag="Memar_0148"
FT   CDS_pept        135510..135818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56083"
FT                   /db_xref="GOA:A3CRT3"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRT3"
FT                   /protein_id="ABN56083.1"
FT                   /translation="MKDRQFINGTGRGGLICIALLLFILAGSGIACASPGGEPPADAGE
FT                   GREAVLAEPGDTTTYHGSESAYSIFYNPVLLACGLGAVLVLAVGYVLIRRSRGKDAP"
FT   sig_peptide     135510..135611
FT                   /locus_tag="Memar_0148"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.964 at
FT                   residue 34"
FT   gene            135983..136501
FT                   /locus_tag="Memar_0149"
FT   CDS_pept        135983..136501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA0562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56084"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRT4"
FT                   /protein_id="ABN56084.1"
FT                   /translation="MDSKKIMGVLLGLAAVLSAILFAFPPVSTDCAGDDEAAHGGIDRV
FT                   SGYDRMTRILRNDSEVRDLVEGGYIFKAGVFNETGESVAFISLPPLRQAASDSGPAARE
FT                   SIESYRVVTAVTDAGGETVGRESTVNTTGWENYKIILDIPNGTVSSVDRVGQLPEWMKQ
FT                   IDVTAVPRR"
FT   sig_peptide     135983..136054
FT                   /locus_tag="Memar_0149"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.950 at
FT                   residue 24"
FT   gene            136699..137604
FT                   /locus_tag="Memar_0150"
FT   CDS_pept        136699..137604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0150"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   afu:AF1724 dinitrogenase reductase activating
FT                   glycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56085"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRT5"
FT                   /protein_id="ABN56085.1"
FT                   /translation="MLDQFKGCLLGAAIGDALGMARESTPPDFQRLHEGYRRAWRGHPN
FT                   TGLKPGQFTDDTQMMLLVAEMLADDTYSESAYAAALARMYMNEELRFPDGAVDAACRHL
FT                   LLSSGKPGGVSSDTAGCTGIAVPFGLLYGDPIDVTERVVQACSVTHTHPGAHAGAVTVA
FT                   MLVHHAVRGRSDALELAEKHAGLEDVALGNKIRDAVRLANEGISLESALSVIGNDVTVY
FT                   QTVPLAFFLINRIKDVTALLTTAAHVGGNTDTIALICGAYAGAVYGRSALPPDLLEGLE
FT                   GRDEIESVAARLYERYTAKP"
FT   gene            137631..138617
FT                   /locus_tag="Memar_0151"
FT   CDS_pept        137631..138617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0151"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: mhu:Mhun_3227
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase, NAD - binding; Semialdehyde
FT                   dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56086"
FT                   /db_xref="GOA:A3CRT6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CRT6"
FT                   /protein_id="ABN56086.1"
FT                   /translation="MEIAIIGASGYTGGELMRLLLHHPSADVVAATSRKLDGTPVASVH
FT                   PHLRGLTDLVFRNAGAGDIDADFAFLAVPHTAAMKVAGTLAERGIRTVDLSADYRLPKD
FT                   VYEKIYGVTHEAYFEAPYGLPELHRDEIRGASFVANPGCFPTGATLAAAPLAKFAHTII
FT                   YDSKTGVSGAGTSPSATTHYPNVGDNFSAYKWTSHRHLAEMKQEAARLGSTARCYFTPH
FT                   LLPVNRGILTTAHILLREPMGQDEVEALYKKFYADEFFVRYQKPTLAAVRGTNFCDVAV
FT                   ESEGDRVVAVSAIDNLVKGASGQAIQNMNLMCGFAEDTGLRTAGMFP"
FT   gene            138628..139110
FT                   /locus_tag="Memar_0152"
FT   CDS_pept        138628..139110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0152"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mhu:Mhun_3228 putative transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56087"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRT7"
FT                   /protein_id="ABN56087.1"
FT                   /translation="MKVRDVMTPDPVTVRVASTVSEAAGLLRKYHIGGLPVMDGDRVAG
FT                   IVTETDILSLLDTGDISDDLWLPSPLEVIEVPVREFINWERTKRALTDIGNMEVRRVMS
FT                   SPVIAIGEDSDIADAASLMLREGIARLPVLRDDNLVGIVTRADIVHGLGASSGEKS"
FT   gene            139107..140246
FT                   /locus_tag="Memar_0153"
FT   CDS_pept        139107..140246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0153"
FT                   /product="N-acetylglutamate synthase / glutamate
FT                   N-acetyltransferase"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /note="KEGG: mhu:Mhun_3229 arginine biosynthesis
FT                   bifunctional protein ArgJ; TIGRFAM: arginine biosynthesis
FT                   bifunctional protein ArgJ; PFAM: arginine biosynthesis
FT                   protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56088"
FT                   /db_xref="GOA:A3CRT8"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRT8"
FT                   /protein_id="ABN56088.1"
FT                   /translation="MKSICAVEGVTAAGIREGKYGLALIRASGTAAGVFTSNKMRAAPV
FT                   EVMMERIERGALDAVVVNSGCANAYTGERGYRDAVEMCGIAAGPLGLDPGSVGVASTGV
FT                   IGRYLDLPLIRDQCGRAAPLLARSADAEDAAARAIMTTDTFPKHALVQTESFAVGGITK
FT                   GSGMIAPNMGTMLAFIYTDAEVEAPVLQDILRQATRRSFNRVVVDGDTSTNDVAFCTAT
FT                   GAAGRVDRAELAKAVEAVCRDLAVQIARDGEGATKLLEVTVRGAPDEDAAAAVARTVVA
FT                   SPLVKTAVYGEDPNWGRVVAAAGRAGVEFDPYAVSLRVGEIPLVRRGEIVADLGAAKAA
FT                   MRGATVTFDLDLAAGEGKATAWGCDLTEKYVEINGKYTT"
FT   gene            140243..141112
FT                   /locus_tag="Memar_0154"
FT   CDS_pept        140243..141112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0154"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: mhu:Mhun_3230 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56089"
FT                   /db_xref="GOA:A3CRT9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CRT9"
FT                   /protein_id="ABN56089.1"
FT                   /translation="MKREDVLMEALPYIQKFYGKTIVIKLGGHAMVDQSILETVIRDAV
FT                   LLRYVGMKVVLVHGGGPEITAKMQAMGKEPKFVGGLRITDPETLEIAQMVLVGKINDGI
FT                   VSLIANCGTRAVGISGNDGNLLIARKMDPQRVQVGEVMQEVDLGQVGEIEEVDPEVLHC
FT                   LLAQNYIPVVAPIAIDRQGMSLNINADTAAAEIAIALSAFKLVNLTDVDGVMDADRTMV
FT                   YHRLALTEAEAMIGAGVIAGGMIPKLEGCMKAVRNGVASAHVVNGNREHNLLLELFTDQ
FT                   GVGTMLTL"
FT   gene            complement(141126..141410)
FT                   /locus_tag="Memar_0155"
FT   CDS_pept        complement(141126..141410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0155"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: Chorismate mutase;
FT                   KEGG: mbu:Mbur_0876 chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56090"
FT                   /db_xref="GOA:A3CRU0"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010950"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRU0"
FT                   /protein_id="ABN56090.1"
FT                   /translation="MSLDAVRNEIREIDEKIIDLVAERQRLATQVARIKQEEGLSIHDP
FT                   AQRKIVLDRVFTYAVESRIDPVAVRRVFEILVDMNEERQRECSGDGNLP"
FT   gene            141506..142129
FT                   /locus_tag="Memar_0156"
FT   CDS_pept        141506..142129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0156"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: mhu:Mhun_2536 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56091"
FT                   /db_xref="GOA:A3CRU1"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRU1"
FT                   /protein_id="ABN56091.1"
FT                   /translation="MLERIPPRERRDLLIAWLAISIAFTLIFVRGMVSLDILVFYFAMS
FT                   LVTVGVAFVLHELAHKFAAMRYGYWAEFQKDNQMLLVAVVMAALVGVVFAAPGATYVYG
FT                   NATRTENGRISAAGPITNLLLCIPFAALMLFGGGGLLALVGLVGLRINAMIATFNMLPI
FT                   SVLDGRKVLAWNPVIFAVLIVASAGLLFWSLTLPLVWPSSLSLF"
FT   gene            complement(142147..146136)
FT                   /locus_tag="Memar_0157"
FT   CDS_pept        complement(142147..146136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0157"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: nph:NP2656A signal-transducing histidine
FT                   kinase; PAS/PAC domain protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: GAF domain protein; ATP-binding region,
FT                   ATPase domain protein domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56092"
FT                   /db_xref="GOA:A3CRU2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRU2"
FT                   /protein_id="ABN56092.1"
FT                   /translation="MEDAVLVLDEDARIIWANTASRRMLGVHESEPGQAGSVSDLADKI
FT                   LATPGNGTLEFECRLRNPGGGERGYHCSGWRTPSGKNWVLRLREAPETGDYEAIVEYTG
FT                   TATILIEGDGTISVANTEFERLSGYPRQDVTGVKRLADFIAPGEECRQIMEYHNLRRKD
FT                   PAAAPKNYSFTFIDRAGTLHAVEATIGLIPGTARSVMSLLDVTERNRAEQALRESEERL
FT                   NLALPAAGDGLVDWDVGTGTIYYSPRTFTMLGYEPGAFVPTLPAILALVHPEDRDRVGA
FT                   ALAGMAAGVRDRCEMEFRMKSASGEWVYVLDRLRVVERDARGTPIRIAGTHADITERKR
FT                   TERELLIRRVSLESSFAAIAIADLDGYITHVNRALLEMGGLTDPGEVIGRHLTEFWVEP
FT                   AKVERALATFTEQGKCTGKLVGRKADGTEFTAHVTATILKDDSGTPICIMATAVDISEE
FT                   TRMAEALRENKERYRMLTEFAPDVIFLVGMDGDILFVNGAGGRLVGADPESLQGKNIRE
FT                   LFPPDLVEGWLPVLRAVAESPGKIFTAEGQIPGDGGEVWLETRLTPMPGSDGTVRNLLG
FT                   ISRDVTERKRTEGQLRFQSQVLSQVEDAVVAADAEGRITYMNRAAERLYDVPSGEALGR
FT                   HASELFTTEWVRPDDEEAAKNALRSSGTWRGVVSHYKRGGEIIFVDETLSTLHDDFGRV
FT                   TGTLYSLRDVTRQRQAELELRIKDMAIASALEGISLSDHDGKIIYANRASLAIHGWEEE
FT                   EIVGQHVSVLWGDPGEMSRIREELVRNGAWSGEVKSRRKDGTAFPMQLSLTVVTDEAGR
FT                   RICTMGSGIDITERKRAEQELRIRDMAIASSPSAFTVAGLDGRLTYVNQAFLTMWGYGS
FT                   PAEAIGKPVTELWQNEEEARNTFVKVARTGGYTGERIGRRQDGTVFYVMFSGTLVRDSD
FT                   GVPLCITASFTDITSQKEAEAEIQAHNRELSVLNRIIGVSASATDIEEALERVLGATLD
FT                   LLNLSGGGIYLIEPGRQSARLVCTQRLPEGFPAHPCIPDITLAPYATVLVAGETLFPDE
FT                   CTEESGETPHTYASIPIIAHGRIIGALNVASRDDRRFSDADRSLLTAIGREIGNSVERT
FT                   ILIRQLEMAEREANLYLDILSHDIRNAENVSGLYTDLLVDMLEGEGRGYAQKLQSSIRK
FT                   SIEILRNVSTIRRIHKESTVLVPVDLDRVIRDEIAIFSGSRIRYGATNLAVMADALLPE
FT                   VFTNLIGNSIKFGGAEVEITVRVEENDDEVVVSVEDTGPGIPDAMKDAIFMRFGQSRQR
FT                   KSGQGLGLYITRMLVSRYGGRIRVDDRVPGRPECGAAFRFSLKRA"
FT   gene            complement(146406..147026)
FT                   /locus_tag="Memar_0158"
FT   CDS_pept        complement(146406..147026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0158"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mhu:Mhun_2732 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56093"
FT                   /db_xref="GOA:A3CRU3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRU3"
FT                   /protein_id="ABN56093.1"
FT                   /translation="MTVNVLGISGSPRRHGNTETLLDAVLEGAREAGAEVEKIVLRPLE
FT                   YASCQGCNVCHRTGVCVLKDDLTEVFEKIENADVIVLASPIYSMGITAEAKGLIDRAQY
FT                   LWARKFILKNLYYAPDHTRRHKGIFVSTAGLGWENVFDAAFPAITAFFNTTGFEYWDNV
FT                   IANDLDRYGGITRHPTALTEAREKGRDVVNLLAGQQEPEDAKP"
FT   gene            complement(147023..147634)
FT                   /locus_tag="Memar_0159"
FT   CDS_pept        complement(147023..147634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0159"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mhu:Mhun_2733 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56094"
FT                   /db_xref="GOA:A3CRU4"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRU4"
FT                   /protein_id="ABN56094.1"
FT                   /translation="MTIDVLAFAASPRRHGNSETLLDWVLAAMEAEGAAVEKIVVAEAD
FT                   IRPCRGCNICETLNRCVQHDYMDYVHDRIVAADCIILASPIYCMGLAAQAKALVDRAQV
FT                   FRSRKYVLHLPVVPPERKGKRMGIFLSTAGQNWDYVFDAAIPSVKCFFHVVDIKNKDLR
FT                   YLMVNGVDEKGAIERHPTAKADAESLAREVVAHLREVGAA"
FT   gene            complement(147683..149176)
FT                   /locus_tag="Memar_0160"
FT   CDS_pept        complement(147683..149176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0160"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: cvi:CV4302 high-affinity
FT                   choline transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56095"
FT                   /db_xref="GOA:A3CRU5"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRU5"
FT                   /protein_id="ABN56095.1"
FT                   /translation="MLREYLRREAVFLFSAGIILFFIGFGVARPDLLDSASSAVHAAIL
FT                   DNFSWLYLISVFFFLVFALALALSRYGTIKLGYDAERPQYGFFGWIAMLFAAGMGIGLL
FT                   FWGVSEPLVHFLQPPPFIDAASPDAASFAMRYAFFHWGIHPWAIYTIVSLSIAYFSFRR
FT                   GMPALISSCFYPVLGERIYGAAGKTVDVLAVFATVFGTATSLGFGALQIHSGLTHLYGL
FT                   SSAISVTIGIILIATALFMASAIIGVEKGVQVLSKFNIVLATVLLFLVLALGSPPYVLN
FT                   VFASTLGGYINNIIDLSLQSYPFAGFEWSRDWTVFYWAWWISWSPFVGLFIARISRGRT
FT                   IREFVLTVLTVPTLFTFVWFTIFGGSALHLELEEGAGIAAVAGEDVSLALFAFLEHYPF
FT                   AGILSLAAILLLIVFFITSADSATVVLGSLTSGGGLVVPNYKKVVWGLSLSAVAIVLLL
FT                   TGGLDALQVMAITAAFPFMLVMIGLCYTLAIGLSQEKVQ"
FT   sig_peptide     complement(149090..149176)
FT                   /locus_tag="Memar_0160"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.604) with cleavage site probability 0.580 at
FT                   residue 29"
FT   gene            complement(149166..149996)
FT                   /locus_tag="Memar_0161"
FT   CDS_pept        complement(149166..149996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0161"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mtp:Mthe_0923 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56096"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRU6"
FT                   /protein_id="ABN56096.1"
FT                   /translation="MFEKTLIPVAYGERPEEVRKAGTILKSLGASSVCLYHVNEPGSFF
FT                   RGADLSWLTLLAEALEETGLVVEVKTGEGHIASAIAETALLEGVDGIYMKAKRRWHIET
FT                   MLLGSVSRDLLRLADVPVFVHKVRPRLPDDGADPAQSDLNVLYATDLDETSARPLPYVM
FT                   EFAGAWCHVLHVRGRMADPLAERVRREAVDRELGTVAEELRPYFGRVTVEQRIGDPAAQ
FT                   VLYVSDQIEADVVVVGRKSAAFLSAPMGYTAERIVTGSRASIFLVPQPGSRNAS"
FT   gene            complement(150191..150835)
FT                   /locus_tag="Memar_0162"
FT   CDS_pept        complement(150191..150835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0162"
FT                   /product="3-Cys thioredoxin peroxidase"
FT                   /EC_number="1.11.1.15"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mhu:Mhun_2734 peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56097"
FT                   /db_xref="GOA:A3CRU7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRU7"
FT                   /protein_id="ABN56097.1"
FT                   /translation="MEPEELLQMPVIGEKAPEFDVLTTHGRLKLSDLKGKWVILFSHPA
FT                   DFTPVCTTEFMAFAAIADELKELDVQLVGLSIDSVHSHLAWVRNIKEKMGVEIPFPIIA
FT                   DLDMKVAKRYGMLHPGQSTTSTIRTVFFIDDKGVMRAMLYYPMFNGRSMPEILRLTKAL
FT                   QTSDEHGVATPANWEPGAKVIVPAPKTPEEIEKRMQEGYECKDWYLCFKEL"
FT   gene            complement(150839..151189)
FT                   /locus_tag="Memar_0163"
FT   CDS_pept        complement(150839..151189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0163"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mhu:Mhun_2735 alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56098"
FT                   /db_xref="GOA:A3CRU8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRU8"
FT                   /protein_id="ABN56098.1"
FT                   /translation="MEEKRLEEKIGKIPVIFKELKETDPDLYASVMGLDQMIWADGALS
FT                   KQTKKVIAIAIAAALRDGHAVRAQMAGAGSIGVSKEEIEEGLRVAFLLAGMPAYVHGKT
FT                   ALEEYLGNRPRK"
FT   gene            complement(151195..151320)
FT                   /locus_tag="Memar_0164"
FT   CDS_pept        complement(151195..151320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0164"
FT                   /product="Desulfoferrodoxin Dfx domain protein"
FT                   /note="PFAM: Desulfoferrodoxin Dfx domain protein; KEGG:
FT                   mhu:Mhun_2736 desulfoferrodoxin Fes4 iron-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56099"
FT                   /db_xref="GOA:A3CRU9"
FT                   /db_xref="InterPro:IPR004462"
FT                   /db_xref="InterPro:IPR012002"
FT                   /db_xref="InterPro:IPR038094"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRU9"
FT                   /protein_id="ABN56099.1"
FT                   /translation="MVNVSAKGQVYHCEICGNVVQVLEAGGGELVCCGEAMVLEE"
FT   gene            complement(151331..151573)
FT                   /locus_tag="Memar_0165"
FT   CDS_pept        complement(151331..151573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56100"
FT                   /db_xref="InterPro:IPR009912"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRV0"
FT                   /protein_id="ABN56100.1"
FT                   /translation="MAEPETNKTAKAGEKPGPGRFICIDCGREVRIDSSDEDLVKCPTC
FT                   ACEMYNCLPMTHIRPDIKSPEDVLNPPERKKPENR"
FT   gene            151673..152263
FT                   /locus_tag="Memar_0166"
FT   CDS_pept        151673..152263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0166"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mhu:Mhun_2738 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56101"
FT                   /db_xref="GOA:A3CRV1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRV1"
FT                   /protein_id="ABN56101.1"
FT                   /translation="MPKKVVALLGSPVLDGNTARLLDEAIRGAEEAGCEVEKVEVAHMD
FT                   VLPCMELFQCMGSETCLIQDGMEEYYRKFREMDGLIIATPVMTMGIPGRLKSFIDRFQV
FT                   FYMAKYHRGQSFISPERRKTRKMLFISIAGMNIPNVFLGVKMTARAFGEIIDCPYWDEV
FT                   LRNDMDTIRDIRTRPEVMEAAYKKGYDLGRLLG"
FT   gene            complement(152255..153172)
FT                   /locus_tag="Memar_0167"
FT   CDS_pept        complement(152255..153172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0167"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   mbu:Mbur_1011 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56102"
FT                   /db_xref="GOA:A3CRV2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRV2"
FT                   /protein_id="ABN56102.1"
FT                   /translation="MSARGANGTREDQRSPGVTGRKVRRIFIIVLALNLAVALAKVVFG
FT                   LLAGSVSMVADAFHSGFDSLSNVIGIVALYFAGKPPDPEHPYGHGKIETLGTLVIGAML
FT                   LLTAGGILYEGYHRLVEAVAPEITAVTVAVMVGTLVVNLAVSTYERRKGEEYRSQILVA
FT                   DSQHTKSDVFVSLAVLGGFLAVGLGFPQADPVIAFAIGLLIARMGVRVLYDAARVLTDT
FT                   MKLPCDPALIEAVVMDTPGVTGYHDFRCRGKPDEILADIHITVDPALPVSRAHEISDEV
FT                   ERRLKEAVPGLAEVVVHIEPDDSA"
FT   gene            153765..154265
FT                   /locus_tag="Memar_0168"
FT   CDS_pept        153765..154265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0168"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; Rubredoxin-type Fe(Cys)4
FT                   protein; KEGG: chy:CHY_0738 rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56103"
FT                   /db_xref="GOA:A3CRV3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRV3"
FT                   /protein_id="ABN56103.1"
FT                   /translation="MPTDENAQNAYAGESQANRKYSVFAEKAAAEGYPAVAKLFRAASE
FT                   AEAVHAKRLLFILNAVGSTEENLKDAMEGENYEFMEMYPAFVAEAKEERKNEASIVFTH
FT                   AMKAEEVHANLYLQALEAVREGKDLDAEKVFLCPVCGNVEIGEAPDKCPICGVPARMFR
FT                   EIQ"
FT   gene            154303..155511
FT                   /locus_tag="Memar_0169"
FT   CDS_pept        154303..155511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0169"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glutaredoxin; KEGG: mhu:Mhun_3049
FT                   glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56104"
FT                   /db_xref="GOA:A3CRV4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRV4"
FT                   /protein_id="ABN56104.1"
FT                   /translation="MLNTVPEIFPFMAGVKVYTTENCPYCRMVKAFLRKHDIEHEIVDV
FT                   GKDREAAREMIEISGQRGVPVTVSGDEVVVGFDAKRLRELFGTALEETVYDAVIVGAGP
FT                   AGLTAAVYCARKLMKTVVIAENIGGQAAWSWAIENYMGFSTISGEELVRKFEEQVRGFD
FT                   VRLELESVGDVRKEDDTILVRTASGTVYRSRTLILAPGKEPRRLGLPGEDRLMGKGISV
FT                   CAICDAPLYRDKPVAVVGGGNAALQTAIEMTKFASSVTLIARRDLRCDEVYVDRAKKAG
FT                   VRTFSHHEVTALHGDAGLTGVTVRDRETGEETGLDVEGLFLAIGLAPNTGFLKDLVVLN
FT                   EQGEIDIDENGHTSVPGVFAAGDATCVKAKQIIVAAGDGAKAALEAHEYFEGEPEEEQI
FT                   VCT"
FT   gene            complement(155516..155803)
FT                   /locus_tag="Memar_0170"
FT   CDS_pept        complement(155516..155803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0170"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: pfu:PF0772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56105"
FT                   /db_xref="GOA:A3CRV5"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRV5"
FT                   /protein_id="ABN56105.1"
FT                   /translation="MEQVRVLAREIRARRRVSAIILYGSFSRGDFHEESDVDLIVVGDF
FT                   PERPHKRAAFIIGLTDLPVEPLCYTDEEFADLIREENPFVLQALAEGTRV"
FT   gene            complement(155803..156210)
FT                   /locus_tag="Memar_0171"
FT   CDS_pept        complement(155803..156210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0171"
FT                   /product="HEPN domain protein"
FT                   /note="PFAM: HEPN domain protein; KEGG: mhu:Mhun_3061
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56106"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRV6"
FT                   /protein_id="ABN56106.1"
FT                   /translation="MDANMREAGRWLRQGERDLVSARNSCRSGDFEWACFQAQQSAEKT
FT                   LKALLYARGYRRILTHSVYELIREIGEYEPSFLALKSEAKALDAAYITTRYPDSIVGNL
FT                   TPSEYYDQEDAEECIEHADSICSAAREALAG"
FT   gene            156416..156745
FT                   /locus_tag="Memar_0172"
FT   CDS_pept        156416..156745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0172"
FT                   /product="nucleotidyltransferase"
FT                   /note="KEGG: tko:TK1709 nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56107"
FT                   /db_xref="GOA:A3CRV7"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRV7"
FT                   /protein_id="ABN56107.1"
FT                   /translation="MYGSFVQGPFRDIDIAVFLADDSTGSSDPLRYELALEQELEEVTG
FT                   VPIDVRVLTAAPLSFAFTVLRTGEILVSRDEEARCEFVCRILVEYHDFSYHRERYRREA
FT                   LGLLR"
FT   gene            156777..157157
FT                   /pseudo
FT                   /locus_tag="Memar_0173"
FT   gene            157419..158021
FT                   /locus_tag="Memar_0174"
FT   CDS_pept        157419..158021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0174"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   rxy:Rxyl_2978 CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56108"
FT                   /db_xref="GOA:A3CRV8"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRV8"
FT                   /protein_id="ABN56108.1"
FT                   /translation="MIEEHLRAGTSGVLTRITALIARTGATPNTLTLLGFLGMAAAGIL
FT                   CASGSFFFAGLVVAASCVFDALDGALARVTGAASPFGAFFDSFLDRYAEAAVYGGLVIY
FT                   YAGAGTPWGVEAAFFAAIGSLMVSYARARAEGLGVECRAGLFARPERIAVIIAGLVTGF
FT                   VLPALVILAVATNVTALRRLLCVRGATLLPSRPPRSP"
FT   sig_peptide     157419..157598
FT                   /locus_tag="Memar_0174"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.684) with cleavage site probability 0.678 at
FT                   residue 60"
FT   gene            complement(157984..160422)
FT                   /locus_tag="Memar_0175"
FT   CDS_pept        complement(157984..160422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0175"
FT                   /product="Oligosaccharyl transferase, STT3 subunit"
FT                   /note="PFAM: Oligosaccharyl transferase, STT3 subunit;
FT                   KEGG: mhu:Mhun_2859 oligosaccharyl transferase, STT3
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56109"
FT                   /db_xref="GOA:A3CRV9"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="InterPro:IPR026410"
FT                   /db_xref="InterPro:IPR041154"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRV9"
FT                   /protein_id="ABN56109.1"
FT                   /translation="MAPAALKDHKTALTAAALLVFMLVAVLLRAIPHAALVDGSFTTLI
FT                   GTDAWYNLRQVEVIAANYPGYAWFDPMTAYPGGKEIAWGPLFPLITATLCLVAGAAARP
FT                   EIVYVAAWVPPLLAAAVVPVVYLTGKTLADRTTGLVAAGLIAVVSASFFARSIFGFVDH
FT                   HVAETLFSTLFCLAYIAALAYAARHPVTLADTKTILPVALLALAAGAAYVLGLLVMPTI
FT                   ILFALIAGIFTVIQAVRNHLDGTGPEGLLVVNAVTFALPAIFLPISGFMVDSMSLSLYS
FT                   VAHVYAYLLLIAVTALLAGISLALKGKRREYLAALAALGVAGVAFLTLSDIGKTMANGL
FT                   AAFFGRDMTATAIREMGAWDLSLAWQSFNVGLLLIPAGLAVLALRARRENRPEVLFTIV
FT                   WSVVILIATIQHLRFEYYLAVNLALLAAVVVAWALDYGFEKTADYLREPESKKKKKALP
FT                   TAEIAAVGIAVLLAVILVGASASENIGYAQNGVPRTMLADDWRDALEWMNVNTPDPGVD
FT                   YYAIYEKDGFAYPENSYSVMSWWDYGHWITFIAQRIPVTNPFQDNVRSATGFFLATSEE
FT                   KADAAGSRYIVTDGRMAAEGFPAIAYWHDATTGTTPYAMPLLVAVPGREDTYSIESFYR
FT                   EAYYETMTVRLQAFDGTLVEPENALYVEYDTRSVPETGYPLLTGSKEMSPAEAQAAADA
FT                   YTGPGKAAVFGSDSASPAGTVPALRHYRLVYESSPDPATSVKIFERVEGAAIPGEGVIE
FT                   ATVVTNTGREFVYRQASEDGTFVVPYSTTGNPYDVKTVGGYRIGNKEITVTEEAVTGVA
FT                   "
FT   sig_peptide     complement(160318..160422)
FT                   /locus_tag="Memar_0175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.752 at
FT                   residue 35"
FT   gene            complement(160564..160845)
FT                   /locus_tag="Memar_0176"
FT   CDS_pept        complement(160564..160845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56110"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRW0"
FT                   /protein_id="ABN56110.1"
FT                   /translation="MFTVLIERKARELLKRLPPKTRRIVVEKIQELADDPFPGGNKEKL
FT                   EYPHPPAVYRLHISRSFTVFYIIEHQESIVKIEKIVTNERAHKEYSRR"
FT   gene            complement(160867..161097)
FT                   /locus_tag="Memar_0177"
FT   CDS_pept        complement(160867..161097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56111"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRW1"
FT                   /protein_id="ABN56111.1"
FT                   /translation="MSSATSDAGNQIKRIPVKEPTWRDLHDLKEAGESYDELLGRMIRR
FT                   ERDYRDWKMIVEIEETGEFVAFDPDDLLQDD"
FT   gene            complement(161573..161743)
FT                   /locus_tag="Memar_0178"
FT   CDS_pept        complement(161573..161743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM2979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56112"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRW2"
FT                   /protein_id="ABN56112.1"
FT                   /translation="MAKGRAATAVNVELVLLYWHIGDRIGRDILKEERAPYGKRILSTL
FT                   SKELIAEYGPG"
FT   gene            162031..162216
FT                   /locus_tag="Memar_0179"
FT   CDS_pept        162031..162216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56113"
FT                   /db_xref="InterPro:IPR003847"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRW3"
FT                   /protein_id="ABN56113.1"
FT                   /translation="MNATKRIIVREEVWAALSSMREPGMTFSELIEDMIEHEKKRRLVE
FT                   DIKRIQETEELVEIPL"
FT   gene            162213..162500
FT                   /locus_tag="Memar_0180"
FT   CDS_pept        162213..162500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hal:VNG0070H hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56114"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRW4"
FT                   /protein_id="ABN56114.1"
FT                   /translation="MTFAVLFRQSAADFLHSLPEKSQRIITAKLAILRIDPYPGSGGDK
FT                   ERLNTDDTEVFRLHIGRTFTAIYLIHTDRNRVEITHLMTIEQAHKRYGRL"
FT   gene            162513..162785
FT                   /locus_tag="Memar_0181"
FT   CDS_pept        162513..162785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mtp:Mthe_0526 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56115"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRW5"
FT                   /protein_id="ABN56115.1"
FT                   /translation="MPFGEVVPSKTSGLPELLTQNPSGFSNSGPAGHRTLRPVVPRTNT
FT                   LIHLPPQPIPQEATRLKIAYVYDAVYPWVKGGVEKRIREVSVRLL"
FT   gene            complement(163211..165031)
FT                   /locus_tag="Memar_0182"
FT   CDS_pept        complement(163211..165031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0182"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG: tbd:Tbd_2681
FT                   predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56116"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRW6"
FT                   /protein_id="ABN56116.1"
FT                   /translation="MRGCAELLSELNTCDEHWRIEAKETSRTLGKTASQTISAFSNEPG
FT                   IEGGYLLLGVSRDPASGNYRVTGVHEPDKLQREVASLCASAFNRPLRPNVQVCMVDEKP
FT                   VIVVYIPEEVPHNKPIYIKAQGLPRGAYRRIGSTAQHCTDEDIRMFHTSAERRTYDESV
FT                   IPGASLDDIDPHAIDEYRRARRAANPHAPELNWNDGDLLLALKCADKQGDELIPTLAGV
FT                   LLFGRDMAIRKYLPLMRVDYIRVPGHKWDGEISYALEFREPLLRMIPRVIAGVMDDIPR
FT                   CVAFHEGSIQRHERPLIPERVVREAVVNALMHRNYRSCGTIRIIRYPGRLEITNPGHSL
FT                   VEIGDEGSITSVTRNPAIAAVLHDTNLAENKGSGIRMMVQLTREARLSPPVFESNHQAD
FT                   YFRAAFSLHHFFSEEELEWLRGFSAADLSDEEAMALVFVRRNGSISNEQCRDLIELDVV
FT                   GASKLLGKLRDLGFLIQHPHGAMTFYTPTGQLGVAPVCTTHQRVEVSLDEEETLSVDSE
FT                   AILPDIAESIRMLGKRSSPQEVMRVIVQICSVRPSSAGEIAQLVGRSKKWVSASYLKPM
FT                   IHDGQLEYVIPGEPNHPEQKYKVGRSEQEI"
FT   gene            165102..166532
FT                   /locus_tag="Memar_0183"
FT   CDS_pept        165102..166532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0183"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mba:Mbar_A1912 galactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56117"
FT                   /db_xref="GOA:A3CRW7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRW7"
FT                   /protein_id="ABN56117.1"
FT                   /translation="MPDEGYFLFASRRLRELCEAERRFLALMRGESKPEQYIRRTSVTP
FT                   EGTLRPESSGVHLRSRSRSPPLVPGPRTNTLIPLLPQPIPQEATRLKIAYVYDAVYPWV
FT                   KGGVEKRIREVSVRLADRGHEVHVYGMRCWDGPAVIERDGVTLHGVCPGEALYSDGRRT
FT                   VPQAVRFGKAVLRPLLSSGADVVDCQNFPYFSCFSAKAASVRRGFPLVVTWHEVWGDYW
FT                   YDYLGRRGAFGKAVERLAAGLTDHHVAVSPSTARALEALGVSGPVPVVPNGIDLARIAA
FT                   VPPAAEEWDVIFTGRLIREKNVDVLLRALVAVREEVPDLRALVVGDGPERPALERLARD
FT                   LGLDESVTFTGFLPDHDAVVAAMKASRVFVLPSTREGFGIAALEAMACGIPVVTTDHPG
FT                   NAAGDLVVPGVNGYRPGLSAGELGEGILAGLERGAQMRDGCLRTAGEYQWEEIVRRIEA
FT                   VYDRCVGDASAEVREGDV"
FT   gene            166532..167611
FT                   /locus_tag="Memar_0184"
FT   CDS_pept        166532..167611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0184"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mac:MA1175 mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56118"
FT                   /db_xref="GOA:A3CRW8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRW8"
FT                   /protein_id="ABN56118.1"
FT                   /translation="MRVAIFHDYFGAIGGGENVVLMMADALDADIITTDTDAVNRIKGH
FT                   RNVLSIGNTVKIAPFKQVSAAARFAACDFSDDYDFFIFSGNWAHYAAGKHHPNLWYCHI
FT                   LIGAMDDENIRFCDHSGRFARGFYRCGSSLHRSLDRRSMANVDRILANSRNTRAQIARY
FT                   YGRDADILYPAIDVSRYVHREAEDYWLSVNRLYPEKRIELQIDAFRRMPEERLVVVGGH
FT                   AAADHSSPYIRWLERDLPENVTILGEVPFDELVDLYSRSKGLICTSFNEPFGITPLEAM
FT                   ASGKPVVAVKSGGFLETVNEETGRLVEPDLADIVQAIREIAKEPEIYRLPCLERAQLFD
FT                   VSVFQERLRQIVLQAYREM"
FT   gene            167803..168279
FT                   /locus_tag="Memar_0185"
FT   CDS_pept        167803..168279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0185"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /note="KEGG: sat:SYN_00576 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56119"
FT                   /db_xref="GOA:A3CRW9"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRW9"
FT                   /protein_id="ABN56119.1"
FT                   /translation="MKPTIDGVAIKNLRLIPDERGWLMEILRCDDAIFEKFGQVYCTTA
FT                   YPGVVKAWHYHKKQTDNFTCVHGMMKVALYDAREDSPTRGNLMEFFVGEKNPILISVPP
FT                   GVYHGFKGIGTETAFFVSIPTLPYSYDDPDEFRLPPDTNEIPYDWGLTPGLKHG"
FT   gene            168295..169257
FT                   /locus_tag="Memar_0186"
FT   CDS_pept        168295..169257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0186"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility C-terminal domain; KEGG: mba:Mbar_A0231
FT                   dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56120"
FT                   /db_xref="GOA:A3CRX0"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRX0"
FT                   /protein_id="ABN56120.1"
FT                   /translation="MRILVTGGLGFIGSNFIRQMLEEHPGDSIVNLDKITYAGNPENLK
FT                   DIAGDPRYTFVRGDICDPGVVGSVFREHPIDAVVHFAAESHVDRSIEDASVFVRTNVLG
FT                   THVLLEAALSHGVGRFIHVSTDEVYGSIKSGSFRETDNLNPSSPYSASKAASDLLARSY
FT                   YITHNLPVIVTRCTNNFGPYQYPEKLIPLFATNLLEGKKVPVYGTGKNVRDWIHVADHC
FT                   RAVDFVLRHGEPGEVYNIGGDNEKSNLEITEGILRAVGKDESMVEYVPDRLGHDWRYSL
FT                   DSSKLRAMGWKPEFDFETALRATVQWYTENEWWWRPLKR"
FT   gene            169230..170042
FT                   /locus_tag="Memar_0187"
FT   CDS_pept        169230..170042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0187"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: mma:MM1168
FT                   dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56121"
FT                   /db_xref="GOA:A3CRX1"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRX1"
FT                   /protein_id="ABN56121.1"
FT                   /translation="MVVAAIKTVIFGAYGMLGHDLQTVYPGAVLRGHELDITDERAVGA
FT                   CIRDLSPDLVVNAAAYTDVDGCEDNRDLAFAVNGEALAYIASACSDAGATLVHYSTDYV
FT                   FDGSKREYIESDTPAPINVYGASKLLGEQNIVKNTGDYRIIRTSWLFGRHGKNFVETML
FT                   HLSKQMDQVRVVNDQVGKPTYTVDLARKTPEIVGLEPGIYHVTNDGVCSWYDFARAIIE
FT                   NVVPCSSAEFPRKAKRPAYSVLANTKTAPLRHWSDALADYLNAKGESD"
FT   gene            170039..170773
FT                   /locus_tag="Memar_0188"
FT   CDS_pept        170039..170773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0188"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: mma:MM2216
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56122"
FT                   /db_xref="GOA:A3CRX2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRX2"
FT                   /protein_id="ABN56122.1"
FT                   /translation="MKGVILAGGTGSRLYPLTKVTNKHLLPVYDKPMICYPLEKLIGAG
FT                   IEEIMIVSGRGHVGHFLELLGSGSELGVSITYEIQEGAGGIAEALGLARKWAGTDSVAV
FT                   VLGDNIFEDDFREDIESFDRGAKVFLKEVPDPQRFGVAEVNGSRILSIEEKPQAPKSNL
FT                   AVTGLYLYDARVFEIIRTLKPSGRGELEITDVNNAYVRNGEMQYSVLSGFWSDAGTFDS
FT                   LMRASVMVQRYRMKQAESAERQ"
FT   gene            170793..171749
FT                   /locus_tag="Memar_0189"
FT   CDS_pept        170793..171749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0189"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   mhu:Mhun_3077 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56123"
FT                   /db_xref="GOA:A3CRX3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRX3"
FT                   /protein_id="ABN56123.1"
FT                   /translation="MISVVVTNYNGRQYLPDCLSSLALQTCRDFETILVDNASTDGSVE
FT                   FVEEHYPEVRFVRNRENLGFAGGTNAGIRAARGEYILTLNNDTRADPGFVEHLRNAMEA
FT                   DTAVGMCAAKMLFPDGSINSTGICISRSGAAWDRGMYEPDHGQYDRPEEVFGPCAGAAL
FT                   YRREMLDEVGLFDEDFFCYMEDVDLAFRARLAGWTCRYVPGAQVYHYHGGTAGVGTDFA
FT                   VYYGNRNVVWYVMKNFPSRLLVTSLPWILGRNLAVVPYYATRGLGRAIVRSKVDAVRGI
FT                   PRMLHKRSTIRRSVPDSDIRRFTQTWSNIGRPPHVAC"
FT   gene            171736..172497
FT                   /locus_tag="Memar_0190"
FT   CDS_pept        171736..172497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0190"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mma:MM2215
FT                   polysaccharide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56124"
FT                   /db_xref="GOA:A3CRX4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRX4"
FT                   /protein_id="ABN56124.1"
FT                   /translation="MWLVDYRDLIWNLTISDLKVKYQSSVLGFAWSLLNPLLMMLVLYF
FT                   VFMNVFRFELENFALYLLIGIIAWRFLANGTMTAMGSIVGRPGLVTKLYIPRQILVMSS
FT                   VLSSFISSILEFAVLIPLLFILGAKVTPNILFFPVVHGIYFLIVYGISLVLASLFVYFR
FT                   DLNQVWDVVMQAGFFLSPIVYPITTIPAAFLGYYMLNPMTVLIETYREFLLYGVTPSLV
FT                   SFLFLLATGAVMVAVGTLVFKRLERRFAEEI"
FT   gene            172497..173249
FT                   /locus_tag="Memar_0191"
FT   CDS_pept        172497..173249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0191"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mma:MM2214 polysaccharide ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56125"
FT                   /db_xref="GOA:A3CRX5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRX5"
FT                   /protein_id="ABN56125.1"
FT                   /translation="MNNDEAIVVEHLSKEFRIPHDRKVTMYEHIVGLLKGGKYSYEQFQ
FT                   ALDDVSFTVRRGETFGVIGPNGSGKSTLLKILAGVLYPDTGRVRVNGRIAPFLELGVGF
FT                   QPDLTAKENIFLYGSIMGLTRKEIGKRYDEILDFAELRRFENMKLKNFSSGMAVRLAFA
FT                   TAVQTDPDILLVDEVLAVGDEAFQRKCSEKIEEIRRQGKTIIIVSHALGTVQELCERCM
FT                   LLKSGRILSSGETGKVVEEYLRISAAGS"
FT   gene            173298..176288
FT                   /locus_tag="Memar_0192"
FT   CDS_pept        173298..176288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0192"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   efa:EF2180 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56126"
FT                   /db_xref="GOA:A3CRX6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRX6"
FT                   /protein_id="ABN56126.1"
FT                   /translation="MSPIYEEHRSTRYEPPVIDLKNKNSSQVLLIELTGRNKDVLEVGT
FT                   STGYVSRVLKERGNTVTGIEIDPEAGEIAGQHCDSMIVGDIEKLDLDAYLAPSSFDVII
FT                   FGDVLEHLASPEDVLRKVKKYLRPDGYLAVSLPNVCHGDVILNLLMGDFKYTSMGLLDA
FT                   THLRFFGLRNIIDLFSRCGYSITGLHTTVFPVGGTEQRLDPGVVPEDLANFVKSLPNSS
FT                   VYQYIFKASPSPTPEAVEAVPAPDLDGLFRGAIEGSIQAEIKPLLEELSAYEVRTVSLA
FT                   EQVEQLTEETQSLQVTISERDAQIASLDGQVEQLTGETQSLQVTISGRDGQIASLNEQT
FT                   RQQAIQLMQLSNELASMKQSVVWRLLMKFHNGFVERALPQNTRRRRLYDLGLVGLRVLI
FT                   HEGPRGLRIRGEKKLRGESPSRLLQSSKSSIAMDKNNKYQLIPGTTDYVYIPPRCPNNI
FT                   NSIIESMAYKPHFSIVVPVYNTPPDLLNKAVRSLQLQWYPHWELILVDDASPSKETKRC
FT                   LSKINDPNIKVFTHPQNKGISGATNTAISHSTGDYVVLLDHDDELTEDCLFELALCINR
FT                   DDPDYIYSDEDKIDEKGYFTEPHYKPDWSPDTMMSTMYVCHVSCIKKSLLEEVGGLRSD
FT                   YDGCQDWDLILRIVEKTDRISHIPKVLYHWRIIPGSTSADIGAKSYVLDASRRVREDAL
FT                   KRRGLLGTVEPLEQVNGYFRVNYHLVDKPLISIIIPTRDHGDVLRRCIESIFKKSTYKN
FT                   FELIVLDNGSVDSATLEYLEEIKAEPNISVIRHAEPFNYSELNNVGADFAKGEILLFLN
FT                   DDTEVVTSDWLERMGGYAQLAHIGAVGAKLLYPGGKKIQHAGVLNLQDGPGHAFLHQNA
FT                   DLPGYYLRNLIEYNWLAVTGACLMIERKKFQSVNGFDVNYPIAYNDVDLCFRLRDAGFY
FT                   NLVSQSVRLIHHESLTRRMDHADHDKTERLKQDMRRLYQKHPFYYQYDPFYSINLHPNG
FT                   INFETFR"
FT   gene            176294..178120
FT                   /locus_tag="Memar_0193"
FT   CDS_pept        176294..178120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0193"
FT                   /product="hydrolase (HAD superfamily)-like protein"
FT                   /note="KEGG: spt:SPA2017 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56127"
FT                   /db_xref="GOA:A3CRX7"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRX7"
FT                   /protein_id="ABN56127.1"
FT                   /translation="MENVYSIQNEGSNLTLQCSDNIELKEKVASAEVVSFDFFDTLFVR
FT                   DLLNPEDVFDIMSKIFEIEDFRTQRRSAQVEAFKRMHHDGLKEINLVGIYDCFDACPVS
FT                   PKELMETEIEVELLLTHPNPELTDLFKSVVECGKQVVLTSDTYLPESFFKDIFRLYAIK
FT                   PVPMYISAERNATKRDYGELFDIIVNETDCSPRQLLHIGDNYHSDVLQADAKGLTTYHY
FT                   KAYRSPPIPNRVTPETSLARGLLRKHMGQIPSDTPKELGFLYGGPAMVGFLDWITAQAR
FT                   RDAVDHILFLSRDGYFLNSLANLRKGRSLPSYHYFLGSRIVFTLAAMTEDNFSQFLPFL
FT                   LSGAEGLSAYELLERIDVPSPSDAVMNDLKLGPEIRYTEDKYDQFQEFLYAYRSEILKV
FT                   CRRNRRSLFKYLRSLEILEGSRVAFVDVGWNGTSQDAFELAIQDFYDLEVFGYYFCLAD
FT                   TRERRRIGQKRRMSSFLAEPFVPKDTVRRIYDNRVGVELFFSAPHQSVIGYDILSSREV
FT                   SAIHDDRNGSSHDIESFYLELMKGMELFAESYENLRDRLHISTDPYDLASLLVDFIIKE
FT                   DWTAQGEISSLRNFDGWSFTHNVDVSLAQYLP"
FT   gene            complement(178538..179350)
FT                   /locus_tag="Memar_0194"
FT   CDS_pept        complement(178538..179350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pcu:pc0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56128"
FT                   /db_xref="InterPro:IPR027555"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRX8"
FT                   /protein_id="ABN56128.1"
FT                   /translation="MVDQSVAQIRNYVLNQYVKSTPRPQNAIDIFKGEWTSKLPTPYED
FT                   LEVGSTQLFEDPRISWAVEQFGGVNNKSILELGPLEGGHTYMLEHLGAESILSIEGNTR
FT                   AYLKCLIIKEILGLKRAQFMCGDFIEYLRNADTKFDVAIASGVLYHMRNPVELIAMLSK
FT                   VSDEMFIWTHYYDQEIISQNSLIPANKFGNCTISEYGGFKHELHRYEYDAALDWTGFCG
FT                   GSDLFSNWMTREDILACVEHFGFSDIRINFDHPQHPNGPAFALSATRR"
FT   gene            complement(179379..179507)
FT                   /locus_tag="Memar_0195"
FT   CDS_pept        complement(179379..179507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56129"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRX9"
FT                   /protein_id="ABN56129.1"
FT                   /translation="MCTKGSSHCLGDIYAEVIEFYKSKVEADFEFTGRVRHERLCE"
FT   gene            complement(179594..179710)
FT                   /locus_tag="Memar_0196"
FT   CDS_pept        complement(179594..179710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56130"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRY0"
FT                   /protein_id="ABN56130.1"
FT                   /translation="MHLPHIDSFVRIEPHSFGLLFNIAGSFNQTMRFFGQFS"
FT   gene            complement(179888..179989)
FT                   /locus_tag="Memar_0197"
FT   CDS_pept        complement(179888..179989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56131"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRY1"
FT                   /protein_id="ABN56131.1"
FT                   /translation="MERIPTDRHLVQEILRIQIAIPLMDAVAEPYLQ"
FT   gene            complement(180065..182014)
FT                   /locus_tag="Memar_0198"
FT   CDS_pept        complement(180065..182014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afu:AF0303 A. fulgidus predicted coding region
FT                   AF0303"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56132"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRY2"
FT                   /protein_id="ABN56132.1"
FT                   /translation="MVSRHSRSIREKLAENNYKPLHLLLLAFIYAVPIIFGFYYISHYA
FT                   VNVPYWDQWDTIVPMTIEWYDGTFEYSSIFEPQNDSRPVITNALMLLVSVITTLNIKTM
FT                   FFVGYILFLVCILFIFYFVKKDSGLDLPTLVLLTPIMFYTLNPYYLSRFVSNLGAFACP
FT                   ILILAVLASLYLLHKSKESNGYFLCSIGMGVVCTLSGAAGLTIWFAGFVQLVLQKMHKK
FT                   LEKIIIWTISAATTFYVYFVLLGFQTEGLHSTGAYNSFIETTLHYPLNKFLCFMGTVGA
FT                   EIIHDSQIALFFGLIILAITIALLYVNRESLQLDRYSKWYGLLTFGILTSLEVTLTRSG
FT                   ALEYLGSPETIFYIPAPRHSLVIFLPILCIYILAIIYLKESVAQERTVDRKSYRFKSFL
FT                   QAREHKNLFLVGIIFTLLVCSVVLHGMPGITLGEATHDQQLTNQYYLLNYANVPDEKMK
FT                   TLHPIPDRVKSQAVKLEQHNLSIFASTDPEPHRVRVYWLEPDTKFASGGGILEASNYRK
FT                   HTNLRIGSESMPAIFEHPQGPTGTTIVYENIDIREGSHLEFSIGIDEGVWDKPESDGVT
FT                   FEIHLHDPIANTTQEVFSYTLDPAHAEGDRGWHYFAIPLEECSAGNVSVQFITRPNGNA
FT                   AYDWAWWGDPKIVW"
FT   gene            183065..184057
FT                   /locus_tag="Memar_0199"
FT   CDS_pept        183065..184057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0199"
FT                   /product="conserved hypothetical protein 374"
FT                   /note="PFAM: conserved hypothetical protein 374; KEGG:
FT                   mac:MA1182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56133"
FT                   /db_xref="GOA:A3CRY3"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRY3"
FT                   /protein_id="ABN56133.1"
FT                   /translation="MRINSVRDLNVKHPTLAKAAAVLITVALLAILLSQVSVADVITTL
FT                   TSINPLYLVAGYFLYAFSYFFRALRFHVLLNREVGLRDLFQIVCVHNMVNSILPAKTGE
FT                   LSYIYLLKKVHKRSVGEGVATLVMARVFDFIAITVLFFCSILMIEDLPPTVQNGIVIIA
FT                   IFMIVMIALLIGLLYFGRPFLNTIERVFKYVHLDRRRFGAYLLIKFDEVVGALEEVRVS
FT                   RNLFFVGLMSFLIWSLNYAVVYLLLSSMHIALSLQKVILGSTFTLLTSLLPIQGIGGFG
FT                   TTEGVWTLVFVQLGMPMDIAITSGLVYHILVVIYYVVLGMWGIVAIKHR"
FT   sig_peptide     183065..183184
FT                   /locus_tag="Memar_0199"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 40"
FT   gene            complement(184151..184372)
FT                   /locus_tag="Memar_0200"
FT   CDS_pept        complement(184151..184372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56134"
FT                   /db_xref="GOA:A3CRY4"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRY4"
FT                   /protein_id="ABN56134.1"
FT                   /translation="MKIYPQNIYIFYYNPLNYIAKYLVSTINILFRALFLLYGHKTTKI
FT                   FTKHIIAVASKGSMGLESTYQIHQTINR"
FT   gene            complement(184377..184934)
FT                   /locus_tag="Memar_0201"
FT   CDS_pept        complement(184377..184934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0201"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: aae:aq_1079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56135"
FT                   /db_xref="GOA:A3CRY5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRY5"
FT                   /protein_id="ABN56135.1"
FT                   /translation="MDTTEKERLYGSYTSTFLGRIHHGGADEFPIYHKYFRRNYLMHLP
FT                   VQKDARILDLGCGMGHFLNFLEKEGYRNYLGIDLSPENIHFCREHGYTVRMSDIFSFLE
FT                   ETTELFDAIVMNDVLEHFEKQEVIRFLDLAYQKLTSNGKLILKVPNAANPLLASTIRYI
FT                   DFTHELSFTEVSLSQVLKKCFV"
FT   gene            complement(185028..186137)
FT                   /locus_tag="Memar_0202"
FT   CDS_pept        complement(185028..186137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0202"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   pab:PAB0827 galactosyltransferase or LPS biosynthesis rfbU
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56136"
FT                   /db_xref="GOA:A3CRY6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRY6"
FT                   /protein_id="ABN56136.1"
FT                   /translation="MKILMLNYEYPPLGGGAAPVTKSLSEELVRQGHEVDVVTMGYKEL
FT                   PKQEYLNGVQIYRVPSIRKKLEMCTFHEMLSYCISAGRLLPKLLKENNYDINHTHFIIP
FT                   TGAVSSHYHKKIPYIVTTHGSDVPGHNPDRFQFQHVLFKPFSTIVLNRARYVTSPSNYL
FT                   KGEIIRNYGERKIAVIPNGIFVDTYIPQRKERKILTVSRLFEMKGIQFVIEAMKDIEGF
FT                   EYVICGDGPYRPQLEDLVERMHLEHKVKFRGHLKPEQLKQEYGSAAIFVLPSTSESFGL
FT                   VLIEAMSAECAVITSNKTGCAEVVDDAALLVPPKDSEAIKNQLLTLINDPKRCRELGTQ
FT                   GRRRVEQQFSWSSVTKKYSDLYENILSNE"
FT   gene            complement(186134..187078)
FT                   /locus_tag="Memar_0203"
FT   CDS_pept        complement(186134..187078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0203"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   mac:MA1184 glycosyltransferase group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56137"
FT                   /db_xref="GOA:A3CRY7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRY7"
FT                   /protein_id="ABN56137.1"
FT                   /translation="MGVELSVVIPAYNEEESVGLLYEELHEVLSASGRSYEIVFVDDGS
FT                   TDATFERLRALHERDPAVRLVKFRSNFGQSAAMKAGFDHAGGEVIVTMDADLQNDPHDI
FT                   PRLLEKMEADDLDVVCGWRYNRHDPLSKKIFSKFANLLRKTLTHETIHDSGCTLRAYRR
FT                   ECVKDLELYGELHRYIPAMLLWKGYHVGELQTNHRDRSFGRSKYNWVRLAKGFLDLLVI
FT                   VFWQRYSVRPMHVFGGAGLVMAGVGLALALYLGISRLFLGMGLTDRPLFLVALVLLIVG
FT                   VQFVAFGILADILLKVYYGQNGRKPYLVEHMVQ"
FT   gene            complement(187054..188055)
FT                   /locus_tag="Memar_0204"
FT   CDS_pept        complement(187054..188055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0204"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility C-terminal
FT                   domain; KEGG: mac:MA1185 UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56138"
FT                   /db_xref="GOA:A3CRY8"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRY8"
FT                   /protein_id="ABN56138.1"
FT                   /translation="MVSAGERARRTGSYRRYREGQNIRILVTGGAGFIGSHIIERLLDD
FT                   GHEVVCLDNFDPYYDPEIKKSNIQPFLENKNFTLEVGDIRNRDTLTRLLEGTDYVFHEA
FT                   AQAGVRISVEDPIKPHEVNATGTLNLLEASRDSGVKKIINASSSSVYGTVEYLPFDEDH
FT                   PRRPVSPYGVSKLAAEEYCRVFSELYGLKSVSLRYFTVYGPRMRPDLAISIFTRKALAN
FT                   EPITIFGDGTKTRDFTNIKDIVRANLIAMQKGEGAYNIGGGHRVSIQTLAETIIETTGS
FT                   SSEIRYADTVKGDAEHTFADTKKAERNLGWRPQVSLEEGLRRYAAWVSNSRS"
FT   gene            complement(187977..188765)
FT                   /locus_tag="Memar_0205"
FT   CDS_pept        complement(187977..188765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0205"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase; Nucleotidyl transferase; KEGG: mtp:Mthe_1181
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56139"
FT                   /db_xref="GOA:A3CRY9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRY9"
FT                   /protein_id="ABN56139.1"
FT                   /translation="MPVRQGLIPAAGSGSRLGPFTNAIPKELLPVGEKAVIEHVVEAMS
FT                   LAGITDIVIVVSPHKHGLSDYLGSGKRFGVDFTYVVQDERLGLANAVAAGEHVIDGTFA
FT                   VVLGDNFFAPKTFLADLIGYHAAHRPDTTVGVARVEDVTRHGIILPDGDRVADMVEKPQ
FT                   PTAAPSNLGALGAYVFETSIFDAIARTKPGHKGEYQLTDAIRLEIAEGRDVRYRVIDGI
FT                   HIDVGTPRDLMRANEWYLRENGHAEPDHTVVTGRDRTFGY"
FT   gene            complement(189277..189816)
FT                   /locus_tag="Memar_0206"
FT   CDS_pept        complement(189277..189816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0206"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: acylphosphatase; KEGG: mtp:Mthe_0951
FT                   acylphosphatases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56140"
FT                   /db_xref="GOA:A3CRZ0"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRZ0"
FT                   /protein_id="ABN56140.1"
FT                   /translation="MKRFVAVAQGRVQRVGYREHVYNETFERNISGYVKNLDTGEVEIV
FT                   AEGSESDLRDLINEINIIRRPIAVKSFAVRWEEATGEYADFEIIRGDIQEETFERMDYA
FT                   GNALHSMDTKLDRMLGQQDQMLDKQDQTLQIARETKEEIVGLRSDTRKHLDDEFGEIRK
FT                   ELVSIKDALARAGIQV"
FT   gene            complement(190141..191406)
FT                   /locus_tag="Memar_0207"
FT   CDS_pept        complement(190141..191406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0207"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; UDP-glucose/GDP-mannose dehydrogenase;
FT                   KEGG: mtp:Mthe_1081 UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56141"
FT                   /db_xref="GOA:A3CRZ1"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRZ1"
FT                   /protein_id="ABN56141.1"
FT                   /translation="MRITVVGGGYVGLVTGACFAELGHTVDIVEIDARKAAAINAGRAP
FT                   IHERGLDMLLERHAGERLSAGTDYGPVAEADLSFVCVGTPPAADGSADLSMVAAASRSI
FT                   GEALRDGNGLHTVVVKSTVPPGTTAGLVVPAILEHSGRNEIGFAMNPEFLREGRAVEDF
FT                   LHPDRIVIGSRDDRSGEAVAAVYRGLSAPVVRCGLTAAEMIKYASNALLATKISFSNEV
FT                   GNVCKRLGIDVYEVMEGVGMDHRVSPHFLSAGAGFGGSCFPKDVAALVSLAESLGEEPA
FT                   LLRSVLDVNDRQPLRLVGLLEEKIGDLAGKRVAVLGLAFKDNTDDIRESRAIPVIAELL
FT                   RRGAAVAAYDPLAVPSMRRVFPGIDYAASAADALRGADACLVMTEWPEFSDLNGEFDLM
FT                   KSRVVIEGRRILSCGGKEGICW"
FT   sig_peptide     complement(191344..191406)
FT                   /locus_tag="Memar_0207"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.733) with cleavage site probability 0.712 at
FT                   residue 21"
FT   gene            192015..192377
FT                   /locus_tag="Memar_0208"
FT   CDS_pept        192015..192377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA0102 nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56142"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRZ2"
FT                   /protein_id="ABN56142.1"
FT                   /translation="MSDSERKHRQVRGAEFEHRQVRGTEQEHRRCERAEFEKPDGFRTE
FT                   REESDIDILIEFEEGGRSFDAYMDFKFFLEDLFRRRVDRDTVKPALAPYILRSVRYAPG
FT                   NKQERMICDAGRDTML"
FT   gene            192374..192802
FT                   /locus_tag="Memar_0209"
FT   CDS_pept        192374..192802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA0173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56143"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRZ3"
FT                   /protein_id="ABN56143.1"
FT                   /translation="MRRRHLLKAGEKEEVLRTIRMILAGFDEIEVGYVFGTFCRGDFGD
FT                   VDVAILVTGEPAPYQAMRFARRVERELERGFCYRFEADVKVLNTAPVSFQYEVIKSGRL
FT                   VLSRDRERRVRYEAGVLSRYLDYAETLDWFDRVLLTRA"
FT   gene            192805..193239
FT                   /locus_tag="Memar_0210"
FT   CDS_pept        192805..193239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0210"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   mma:MM1473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56144"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRZ4"
FT                   /protein_id="ABN56144.1"
FT                   /translation="MIMDEGVLGHLRELDEAALDWERYRSITLEDLRTDRDKRNMVLHA
FT                   LLVSIQASIDIANHLVAASSSRRPETYRESFAILCDGGLIPEDLAVRLSDLAGFRNVLV
FT                   HLYCRLNLDEVYGVLQDDLPIVNRYRDLVRMILRDRLLPE"
FT   gene            193255..193398
FT                   /locus_tag="Memar_0211"
FT   CDS_pept        193255..193398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56145"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRZ5"
FT                   /protein_id="ABN56145.1"
FT                   /translation="MNREEILPSLRPPGPSRLHEQIEVGDASLDECRPGVVEEMLDSEP
FT                   TR"
FT   gene            complement(193670..193960)
FT                   /locus_tag="Memar_0212"
FT   CDS_pept        complement(193670..193960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56146"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRZ6"
FT                   /protein_id="ABN56146.1"
FT                   /translation="MTFRLMVDKRALDFLNSLDARDRRVIKAKPRILRENPYPGSDEDK
FT                   EKLHTNKKRESYRLHIARTFTVIYNINSDEKPVYITHIMPIEKAHRRYGRI"
FT   gene            complement(193979..194176)
FT                   /locus_tag="Memar_0213"
FT   CDS_pept        complement(193979..194176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56147"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRZ7"
FT                   /protein_id="ABN56147.1"
FT                   /translation="MRGLGGRHLSGFYVCYGEHTRIGRDNQILDLRRPDETLNDTLARL
FT                   VESAKKATAHGRYRRSHGPQ"
FT   gene            194225..195361
FT                   /locus_tag="Memar_0214"
FT   CDS_pept        194225..195361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0214"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   mac:MA1187 dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56148"
FT                   /db_xref="GOA:A3CRZ8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRZ8"
FT                   /protein_id="ABN56148.1"
FT                   /translation="MNAPALSVVLPALNEEATIGKCIGKIRTVFADLGIDGEIIIADSS
FT                   DDRTAAIARDLGATVVRPEKRGYGNAYLAGLACARGRYIVIGDADDTYDFLEIPKLLAL
FT                   LDAGADMALGSRLRGEIRPGAMPALHQYVGNPFLTWLLNRVFSIRISDAHTGFRAFRRE
FT                   ALERMNVKTGGMEFASEMIIEAAKANLRIDEVPITYSARVAPSKLQSFSDGWRHVRFML
FT                   LYRPIPFITVPGLLFTVFGFFLMVIFAFRGDVETSFIHSFILAALFFVGGLQALVAGIN
FT                   IAVYSAVQGYGEAGPFLSRLMNYHNLERELLAGILLMAGGGLVGLGILRDWAAAGFGPL
FT                   FQIANAVWALALFLAGMQVVFSGIFTSMVLLKRGEEQG"
FT   gene            195494..196807
FT                   /locus_tag="Memar_0215"
FT   CDS_pept        195494..196807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0215"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   PFAM: Radical SAM domain protein; KEGG: mbu:Mbur_0274
FT                   protein of unknown function DUF160"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56149"
FT                   /db_xref="GOA:A3CRZ9"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022459"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:A3CRZ9"
FT                   /protein_id="ABN56149.1"
FT                   /translation="MAILSTNQQEIAERIDAGAAAEVWRDWRWHVRHAITEISTFERLL
FT                   GVSFGKDERRELEETASRFPLRITPYYLSLIDAKDLWNDPIFMQCFPSPAELQVEPDDM
FT                   EDPLAEDADHPAPCITHRYPDRVLFLVSNVCAMYCRHCTRKRKVGDVDSIPSEAEVIES
FT                   LDYIRENPGIRDVLLSGGDPFMLPDDRLDWILTELDDIEHVEVVRIGTRTPVVLPYRIT
FT                   EELCAMLARHHPLWVNTHFNHPAEITASSQKALARLADAGIPLGNQTVLLAGVNDCSRI
FT                   MKTLVHKLVRNRVRPYYLYQCDLSEGLAHFRTPVSKGIEIIENLIGHTSGFAVPTYVID
FT                   APGGGGKIPVMPQYLISWSTNRVVLRNFEGVITTYREPDSYEPVWCDRKCATCGQYLRL
FT                   EGADESKAVGIVKLLSDEDPTTALVPEHTERFERRNES"
FT   gene            196797..197636
FT                   /locus_tag="Memar_0216"
FT   CDS_pept        196797..197636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0216"
FT                   /product="beta-lysine acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pca:Pcar_1402 putative acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56150"
FT                   /db_xref="GOA:A3CS00"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022525"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS00"
FT                   /protein_id="ABN56150.1"
FT                   /translation="MSPDTVTTIDGTLVQHGRLSDRIYVMHLSPADLPGILDDLDALAQ
FT                   RERYTKIFVKVPASALPLFIARGYIVEARVPRFFRGREDGYFAAKFFDADRRQESADVA
FT                   AVIAAVREKAGDARPAGLPPGWKYAPGSEDDADDLAALYGEVFATYPFPIADPGYLRET
FT                   MAGDYRYFTVRTADGRLAAASSAEIYREDENVEMTDFAVHPDFRGQNLSGLLLSRMEGE
FT                   MRAAGMKTAFTIARALSYPINATFARAGYAWGGTLVNNTNICGGFESMNVWYRPLVR"
FT   gene            complement(197919..198149)
FT                   /locus_tag="Memar_0217"
FT   CDS_pept        complement(197919..198149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0217"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pho:PH1422.1n hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56151"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS01"
FT                   /protein_id="ABN56151.1"
FT                   /translation="MELKFDREKNRQERLAFVRRHALRVREVPNEVWSREQADLIDAFF
FT                   ENAENFALSRSEYLRMHRVARHRPEPVHGDG"
FT   gene            complement(198133..198735)
FT                   /locus_tag="Memar_0218"
FT   CDS_pept        complement(198133..198735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pho:PH1422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56152"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS02"
FT                   /protein_id="ABN56152.1"
FT                   /translation="MQIANAPDGTIRVDGKVVTSLDRFVASVTSIIEWYTRYVIVSGYV
FT                   AILFGRARGTEDIDIFIDYMDYDTFRPFSEDLLAQGFYFLNSDDIEEIYSMLCDRLAVR
FT                   IAGAGRIIPNIEMKFKKDDFDRYAMSRAKTVEFDDIRFFVSPIELQIPYKLYLGSDKDI
FT                   EDAVYLWVLFREMLDSELLRSFMERLQVRGEQYGIEV"
FT   gene            complement(198803..198940)
FT                   /locus_tag="Memar_0219"
FT   CDS_pept        complement(198803..198940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56153"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS03"
FT                   /protein_id="ABN56153.1"
FT                   /translation="MNRDRRDINIPRNRYRTRDEIVPGFPGGFGHREWLLKEDKHLRDN
FT                   "
FT   gene            complement(199005..200468)
FT                   /locus_tag="Memar_0220"
FT   CDS_pept        complement(199005..200468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0220"
FT                   /product="thiol-driven fumarate reductase, iron-sulfur
FT                   protein"
FT                   /EC_number="1.3.99.-"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; protein of
FT                   unknown function DUF224, cysteine-rich region domain
FT                   protein; KEGG: mhu:Mhun_3052 succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56154"
FT                   /db_xref="GOA:A3CS04"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS04"
FT                   /protein_id="ABN56154.1"
FT                   /translation="MKTITLRVSRFDPAADAEPHFEEYIVQVNEGARVLHALHAVRDEH
FT                   DPTLAYRYCCGSGQCGSCAVQVDGKPVLACMEEARDGMTVEPLALPVLKDLMVDLEPVI
FT                   AKIARICPAPDAALPAREEIEAIKPLRDCIECLCCVSACPALQVTDFAGPTVLRQEMRL
FT                   ALDPRDSGDRITDAIEKGLFYCTTCKRCTEVCPKEIDVPGKAIEKLREIANRRGLTLPR
FT                   HQEVARLVQETGRSVERTQPTFLEQVPEVIEPDGPVRGEVGFFVGCMFNGRVPQTALDA
FT                   MEVMKRNGIRVIVPHDQVCCGSPLIRTGQTSFVDDLKQKNIEAFASRGIKTVMTICAGC
FT                   GATLKNDYETPFEVKDVTEILTEYGIELPSKLDVRATYHDPCHLLRGQGISEQPRTLLR
FT                   LGVREFVEMPTQCCGAGGGVRSGVPEEAKALGAKRDECVKGTGADVVVTVCPFCEFHIA
FT                   DCTDVPVKNLTTILLEGYRKKDAERKGSS"
FT   gene            complement(200465..202096)
FT                   /locus_tag="Memar_0221"
FT   CDS_pept        complement(200465..202096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0221"
FT                   /product="thiol-driven fumarate reductase, flavoprotein
FT                   subunit"
FT                   /EC_number="1.3.99.-"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: mhu:Mhun_3053 succinate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56155"
FT                   /db_xref="GOA:A3CS05"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS05"
FT                   /protein_id="ABN56155.1"
FT                   /translation="MHVDEIVDAHVLVVGSGGAGVRAAIEASRYGGVVMVSKTIAGKGG
FT                   CTTMAEGGYNAVLRDRDSVDVHREDTLSGGAYLNDPALVDALVREAPERMADLVRWGAV
FT                   FDVTEAREVAQRPFGGQRFPRTCYAGDRTGHEMIMTLLDRLDATDTHLYQEVSVVDFVK
FT                   DENGAVAGAIALDRDGDVVLFRSDATVLATGGGTQVYDISTNSAAGTGDGFAMAYRAGA
FT                   ELIDMEMIQFHPTGAVYPYDARGRLVTEAVRGEGGLLLNARRERFMERYDPERMELSTR
FT                   DVVARAIATEVLEGRGTGRGGVYLDVTHLPAETIETRLPVMLEQYLAYGVDIRREPMEV
FT                   APTAHHIMGGVRITPECRTTIPGLFACGEVTGGVHGANRLGGNALADTQVFGKRAGEFA
FT                   GKAPARSGRIDPARIDEVTRMLGGFYEGAISPADVRKDLKLTMWNQAGIFRSAPDLRTA
FT                   LGHVRRLADKRLCAASTVNLLECCTVRNMCTTASLIVRCALLRPENRGAHVRRDADVAT
FT                   EPATSPFSHTYVSLTREGIERREAAA"
FT   gene            202169..203557
FT                   /locus_tag="Memar_0222"
FT   CDS_pept        202169..203557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0222"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: mhu:Mhun_3054 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class;
FT                   PFAM: aspartate/glutamate/uridylate kinase; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56156"
FT                   /db_xref="GOA:A3CS06"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS06"
FT                   /protein_id="ABN56156.1"
FT                   /translation="MKFGGTSVGEADCIGRVADIVESHRSAGDEVAVVVSACSGITDRI
FT                   IAVADEVIASKEQPDIGTLLDAMRERHTRLLKETAPDHAREVTAVIDDRLTRLQNILTA
FT                   VHTLKELTPRSRDYIVSFGERLSAPIVAAALRQRGIASVALDGAEAGITTTANHGDARA
FT                   LPVSAENIRARVAPLLADAVPVIMGFMGATEQGVITTLGRSGSDYSAAVIGAGVDADEI
FT                   WIWTDVDGVMTSDPRIIPDARVLDDISYLEVMELSYFGAKVLHPRSIEPAMQKDIPIRV
FT                   KNSFKPEVPGTLVLRDKHQEKRVVKAIALIEKVALVNINGAQMVGRPGVAKTIFSALAE
FT                   REVNVMMISQGSSEANISLIIDESHLDAALGALDPLVEQGIVREVTYDHDVAAVAVVGA
FT                   GMAGTPGTGGRIFSAIGRAGINMMMISQGSSEVNVSFVVKAGDGKRALQVLHDEFRLSE
FT                   NSDD"
FT   gene            203550..204548
FT                   /locus_tag="Memar_0223"
FT   CDS_pept        203550..204548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0223"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: mhu:Mhun_3055
FT                   phosphoribosylformylglycinamidine cyclo-ligase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56157"
FT                   /db_xref="GOA:A3CS07"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS07"
FT                   /protein_id="ABN56157.1"
FT                   /translation="MTEEAHTYREAGVDIDLEARAVRALIDSLTYRRSGDFSMLGKVGH
FT                   FAGLIDFGPYVLALAVDGVGTKMLVADALRDWSTVGIDCIAMNVNDLYVMNLEPVAFVD
FT                   YIATDALSPEKMAQIGLGLNEGARLANMNIVGGETATLKGLVNGLDLAGTCLGVQEKEK
FT                   VVTGEGVVPGDLIVAVPSSGVHSNGLTLARKVVEDCGSYETLLSNDKTLGEELLTPTRI
FT                   YAEVLRVTEACEVHGMCHVTGGGLLNFRRLSEYGFSFTDPLAVPEIFSWLQENGKISDT
FT                   EMYRTFNMGMGYAFVAPEKSVAAIRAIVPDARVVGEVTEEPGVRLKGVEIR"
FT   gene            204627..205730
FT                   /locus_tag="Memar_0224"
FT   CDS_pept        204627..205730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0224"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mtp:Mthe_1215 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56158"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS08"
FT                   /protein_id="ABN56158.1"
FT                   /translation="MADVYFTPLRARGPHESKAAKIRRLFDAAGFDAAIRPGDLAAVKL
FT                   HVGERGCDTYLHPLFARQVVDTIKERGAQPFLTDTATLYAGSRADAVRHTVTAIEHGFA
FT                   YAVAGAPVIIADGLTGGYWREVAVDGNHFERVRIAGSILDADSMIVLSHVKGHDLAGFG
FT                   GAIKNLAMGCAPPSGKAEQHAGRPYVEIERCGGCGKCTTVCPQAAMTLADGRAVLNPEH
FT                   CVGCGDCMRACPEGAIEFDWTTEIRPFIERLCEYALGAVRTKPGRVGYVNFLLDITPDC
FT                   DCVSWSDAAIVPDIGILASTDPVAIDHASFDLVNSEQGFSQTQLGRNFAPGEDKFKGTW
FT                   DYTDGRYQFEYAATIGLGDADYRLIEV"
FT   gene            205732..206301
FT                   /locus_tag="Memar_0225"
FT   CDS_pept        205732..206301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0225"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mth:MTH1595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56159"
FT                   /db_xref="GOA:A3CS09"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS09"
FT                   /protein_id="ABN56159.1"
FT                   /translation="MSTGKVVLLCGSPRPGGNTAQVLGECAKVLEREGIETETVLLGEK
FT                   RIFSCTACGLCTEGECALDDGLNEIIGKIREAEGFIVGTPVYFGTARGDVTAALQRIGM
FT                   VSMSSDSFLSRKVGGPIAVARRGGHTATLQELLMFYLINDMIVPGSTYWNMVFGRTPGE
FT                   ALGDEEGMRTVRRFAENVAFLIRKLR"
FT   gene            206627..206974
FT                   /locus_tag="Memar_0226"
FT   CDS_pept        206627..206974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0226"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: xcb:XC_2102 pterin-4-alpha-carbinolamine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56160"
FT                   /db_xref="GOA:A3CS10"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS10"
FT                   /protein_id="ABN56160.1"
FT                   /translation="MDLSSEAIVLDVADTAPLTRREIADLLPEVPDWSLEDGRLAARFA
FT                   CKGFDEAVTFLNDVAGFAARENHLPDLGIHAARYVDVAWYTYAIGGLSRNDFIMAARLS
FT                   EWLRCRQGAFL"
FT   gene            complement(206971..207387)
FT                   /locus_tag="Memar_0227"
FT   CDS_pept        complement(206971..207387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0227"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: mtp:Mthe_0711 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56161"
FT                   /db_xref="GOA:A3CS11"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS11"
FT                   /protein_id="ABN56161.1"
FT                   /translation="MEGERPLDDELQRLREERLRKLEERLTGTPGGVIEIADDAFQTTL
FT                   QEHPALVVDIWAEWCGPCRMVAPVVEDLARDFAGRVTFGKCNVDENPKIAASFSITAIP
FT                   TLLFFANGMLVDRVVGALPREAVKARVMRAFGTG"
FT   gene            207524..207598
FT                   /locus_tag="Memar_R0001"
FT                   /note="tRNA-Met1"
FT   tRNA            207524..207598
FT                   /locus_tag="Memar_R0001"
FT                   /product="tRNA-Met"
FT   gene            complement(207812..209248)
FT                   /locus_tag="Memar_0228"
FT   CDS_pept        complement(207812..209248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0228"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase, class-II;
FT                   phosphoribosyltransferase; KEGG: mhu:Mhun_3061
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56162"
FT                   /db_xref="GOA:A3CS12"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS12"
FT                   /protein_id="ABN56162.1"
FT                   /translation="MCGIVGIVDAGGVSFPLYYALYALQHRGQESAGISTFEGTTLYTH
FT                   KAQGLVAEVFNSQTLQDLRGNAGIGHVRYPTTGSKVPENVQPFNFRYRGLDLSIAHNGN
FT                   LVNTVELREEYERRGQIFCTTTDTEIIGNIIADALRTSKSMEDAVLLCMRRLRGSYATV
FT                   ALLNNTVYAFRDPLGIKPLCIGKLDNGYIVASESVAIDALDGTFVRDVRPGELVRIDES
FT                   GLTSTQIATANRKAYCIFEYVYFARADSVMDGTLVYDVRRRIGQKLYDANPVEADTACP
FT                   VPDSGIAYAAGYAEQSGIPFIEGLMKNRYMGRTFIMPTQEQRERAVRIKLNTVRGNLKD
FT                   KRVVLIDDSVVRGTTSRRIVNMIRDAGAEEIHLRVGSPPIIAPCYLGVDMPTRTELIAS
FT                   GKEVEAVRESVGATSLTYIPLDDLVEAIGCGERNLCTGCLTGCYPVEINGEKSCHSIVD
FT                   YVAGTHQSDLSTFKAGKERT"
FT   gene            complement(209258..209440)
FT                   /locus_tag="Memar_0229"
FT   CDS_pept        complement(209258..209440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0229"
FT                   /product="LSU ribosomal protein L37E"
FT                   /note="PFAM: Ribosomal protein L37e; KEGG: mhu:Mhun_3060
FT                   ribosomal protein L37e"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56163"
FT                   /db_xref="GOA:A3CS13"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CS13"
FT                   /protein_id="ABN56163.1"
FT                   /translation="MSKGTPSMGKRQKRTHIACRRCGKISFHAQHKVCAACGFGKSRRI
FT                   RSYRWTEKKAKVPTH"
FT   gene            complement(209458..209685)
FT                   /locus_tag="Memar_0230"
FT   CDS_pept        complement(209458..209685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0230"
FT                   /product="Small nuclear ribonucleoprotein, LSM family"
FT                   /note="PFAM: Like-Sm ribonucleoprotein, core; SMART:
FT                   Like-Sm ribonucleoprotein, eukaryotic and archaea-type,
FT                   core; KEGG: mhu:Mhun_3059 like-Sm ribonucleoprotein, core"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56164"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR022901"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS14"
FT                   /protein_id="ABN56164.1"
FT                   /translation="MTPRPLDILDQVLNRQPVIISLKGGREIRGILQGYDVHMNLVLDK
FT                   AEEEVDGAAQKLGTLIVRGDNVIYITPSVE"
FT   gene            209794..210291
FT                   /locus_tag="Memar_0231"
FT   CDS_pept        209794..210291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0231"
FT                   /product="RNA-binding protein, containing PUA domain"
FT                   /note="PFAM: PUA domain containing protein; KEGG:
FT                   mhu:Mhun_3058 uncharacterized domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56165"
FT                   /db_xref="GOA:A3CS15"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015266"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="InterPro:IPR022430"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS15"
FT                   /protein_id="ABN56165.1"
FT                   /translation="MARITVKKRHVIRKSQISELLERLTDEIGASADLFRSDRIERVET
FT                   DAPVGIYLVDKKPLLMGAEDWAFPTLRGLVEHPIPERRVVVDSGAVRFVANGADAMRPG
FT                   IVSISPDIRAGHPVQVVEERHGKPLAVGIALFDAADMERQEKGKSVKSVHYVGDDLWNL
FT                   EI"
FT   gene            210342..210719
FT                   /locus_tag="Memar_0232"
FT   CDS_pept        210342..210719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0232"
FT                   /product="Protein of unknown function DUF1621"
FT                   /note="PFAM: Protein of unknown function DUF1621; KEGG:
FT                   mhu:Mhun_3057 protein of unknown function DUF1621"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56166"
FT                   /db_xref="GOA:A3CS16"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR012426"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS16"
FT                   /protein_id="ABN56166.1"
FT                   /translation="MVKKLFDSILGKSPARNEEDYMELDLASYEGSNDEEPASMYIKIA
FT                   TIADLKDTPRVKDEVYNGNIVIVDIGRLKMDKVTFERVLKDLRDVAKDVNGDIVGLGEQ
FT                   KYVVITPMSVKVSREKIGGGL"
FT   gene            210719..211246
FT                   /locus_tag="Memar_0233"
FT   CDS_pept        210719..211246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0233"
FT                   /product="ZPR1-related zinc finger protein"
FT                   /note="TIGRFAM: ZPR1-like zinc finger protein; ZPR1-related
FT                   zinc finger protein; PFAM: Zinc finger, ZPR1-type; KEGG:
FT                   afu:AF0783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56167"
FT                   /db_xref="GOA:A3CS17"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR004470"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="InterPro:IPR042451"
FT                   /db_xref="InterPro:IPR042452"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS17"
FT                   /protein_id="ABN56167.1"
FT                   /translation="MRESHPGTCPACGGEIRIVHHRLDIPHFPDILLVSIACDACGFRH
FT                   TDTIILGEGDPVRWTVRVEEPGDLAIRVARSTTGTIEIPELGLRVEPGTACEGFVTNIE
FT                   GVLSRFEQAVETILANPESEDERAAALRMVETIAAAREVAFPFTVILEDPAGNSALVSE
FT                   KAEKMLLDQGEA"
FT   gene            211326..211562
FT                   /locus_tag="Memar_0234"
FT   CDS_pept        211326..211562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56168"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS18"
FT                   /protein_id="ABN56168.1"
FT                   /translation="MARTISVLKWESEAEVENAVHNIRAEMDRAGGLSKETERAMQHSF
FT                   WVADPGLANHFLRLIREQVPGALHYFEEEGGGA"
FT   gene            complement(212358..212840)
FT                   /locus_tag="Memar_0235"
FT   CDS_pept        complement(212358..212840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0235"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56169"
FT                   /db_xref="GOA:A3CS19"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS19"
FT                   /protein_id="ABN56169.1"
FT                   /translation="MITAVLPELNTKPAGIRPEVRELTSAEFSAAEEVWREYHGTAGDP
FT                   ARDRIFATFLAGQIVSLARCRRHPDGLEIDGVFTPEDCRKKGYARTTMAALVTACHNDD
FT                   LYMYAVERLAGFYAELGFISIPERDLPPGIRERYTWAAGNMEGAEVRPMFRRAGLL"
FT   gene            complement(212851..214257)
FT                   /locus_tag="Memar_0236"
FT   CDS_pept        complement(212851..214257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0236"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: mhu:Mhun_1199 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56170"
FT                   /db_xref="GOA:A3CS20"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS20"
FT                   /protein_id="ABN56170.1"
FT                   /translation="MNVTDIQTTFVSDTRNRIAIIAGLAVLTLGGNLLALILGAPEELL
FT                   PLPTLPLTIPIILASYWYPRRGILFSVCFASIYAVTTYFLSPPGPLLAYTIVLRAILLV
FT                   LIGGVVAFLATKLRESEQEMNQIIEFLPDATFAIDRGGEVIAWNRAIEEMTGVKKVAML
FT                   GRGDYEYAVPFYGEPRPLLADRILQGDPEAGYPSVRRSGDVLVAEIYTPLLRGGRGAHI
FT                   RFAATALLDRSGRVTGAIESIRDVSDEVMTEAALQNAGRQLNILTGILRTDLSNRLAVL
FT                   YGHLSVGAMKFDDPEILSFIDDLNDAANGIRRQIEISREFRDIGTSPPAWIPVQQAVGK
FT                   AAASLSFRDTSLDAWTERLEIFADPHLATVFIHLFENSLAPATKASRIVVTYQLRPEGC
FT                   AIIVEDDGTGIPDAETEDLFVQKAESYGHGLFLAHEILAITGIAIRETGTFGTGAKFEI
FT                   LVPSEGYRIV"
FT   gene            complement(214286..215608)
FT                   /locus_tag="Memar_0237"
FT   CDS_pept        complement(214286..215608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0237"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; KEGG:
FT                   mhu:Mhun_0493 response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56171"
FT                   /db_xref="GOA:A3CS21"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS21"
FT                   /protein_id="ABN56171.1"
FT                   /translation="MEGKHEGGTKMSVLVVEDSRTQAEFIRHVLETEGYDVTLVADGNE
FT                   AIRRMEVDMPDIVLTDIMMPGMDGYELCRRIKQQNPDTPVILVTNLFDPADVLKGLASG
FT                   ADSFIVKPVDPEHVRSQIEAVMRTREIPEPKESPAELEIPFAGSTYTIAAGRLKILNTL
FT                   LSTYTIAVTKNTELQEAQEQLHSLNEQLQEAVADLSRSNESLAEENRERRRVEKALAEA
FT                   NRKLQLMASITRHDLLNQLAALWGYLDLAQVLREREPANAWRHVESAAEMVNRLNNTVR
FT                   FTAEYQKVGATAPVWQEIRTLVERSEKYVSTGKITLENAIPAGVEILADPLIEKVFSNL
FT                   IENSLRYGETVTAIAFSLKQDGGTYTILCEDDGVGVPADEKEKIFTYAHGMNTGLGLFL
FT                   AREILAITGITIQETGIPGNGARFELLCPAKVIRAPDRQTG"
FT   gene            complement(215610..217904)
FT                   /locus_tag="Memar_0238"
FT   CDS_pept        complement(215610..217904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0238"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; Hpt domain protein; KEGG: mhu:Mhun_0494 CheA
FT                   signal transduction histidine kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56172"
FT                   /db_xref="GOA:A3CS22"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS22"
FT                   /protein_id="ABN56172.1"
FT                   /translation="MTGPDDVFRARLLETFREEADEYLEAITEGLIALEKAGPTPELVE
FT                   RVYRTVHSLKGASRAVNHREIESICQNLETAFSLMKRGEYVPGVDDFDLFHRTVAVIKS
FT                   LLRGERPDASPTEINGALRAIPGGTGPPEGRPGEPGPASREKHTYDAPGGYNSGEQGAD
FT                   RGTVRIAAHKLDRLTAGADSLLTTRLFITQRIRELEEMMARFSLWQWNHSQAFNDLQTI
FT                   RRKAFGEEKAAIPPDLVLPLQRAVEFQEYNREFVTNLQHDLATHLRSMEFDRSALETST
FT                   SEISDLVHDAALLPASTILTPFSAFVREFSRTSGKSVDLTIEGGEIEVDRRILDALKDP
FT                   IMHLIRNSIDHGIESPEARRARQKSATGSVRIRVFPRSGSRVGIEVADDGAGVDSSAIR
FT                   RTAVENEVITADEDATLTDSEAIWLIFRSGMTTSRIVTDLSGRGLGLAIVEDTVSRLGG
FT                   EVTVSSTVGRGTAITLTVPVSMATLRGLLVRSERQVYVLPMQQVKQVLRVRPDSLAVSR
FT                   GRPTILLSGETIEVIRLTDALGIPLSGPPTEEGQPKPLVIIAYGAGQIACIVDEVIRVQ
FT                   EIVVRPLGSQLTSVRRIDGAVILGDGRLALVLDPLDLIQDAMQAERPVSASTLPQEAER
FT                   RVMVVEDSVTSRALLQAVLEGAGYQVETAVNGIDAFARLKQHEFDMVVSDVDMPRMNGF
FT                   TLTEKIRAEGGHLAGIRVVLVTSLDSPEDRERGKAVGADAYIVKKSFEADEFLRIIRRL
FT                   VRRREGEIQER"
FT   gene            complement(217916..220297)
FT                   /locus_tag="Memar_0239"
FT   CDS_pept        complement(217916..220297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0239"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: mhu:Mhun_0495
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56173"
FT                   /db_xref="GOA:A3CS23"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS23"
FT                   /protein_id="ABN56173.1"
FT                   /translation="MLTFFSDMKVGTKILVICLFLAIIPTLMLGIVAYTSSSGVINEQI
FT                   ETLLETQVHDARGWTNDVYKLTRNKVNSDLNVLHENFYARGTPEIIDEELALVDGTGNP
FT                   YVINDNFEIVDQVQSLVGGAATVFQVYDDHAVRVSTNVIGTDGTRAVGTELTQNVYDVV
FT                   VNQGETYYGSRDLFGKRYVTAYEPIRDSRGNIVGVLFVGTEEQETLDVVKSSLKDTVIG
FT                   RNGYMFVVDSNGQLLVHPSEEGENKADEGYIQEMIENKVGIIRHQVDGTDIIDAYTYYE
FT                   PLDWHIVSRAELSDFTGPIDTIRNTIVIVVLASIAIGVAIAILFGRSISDPLQQVVLML
FT                   KELRNGHLSARLNIRRQDEIGVMARTMDEFAGDLQENVVGNLRKIALGEYVQEFPVADE
FT                   GDEIRPALAMMVQSLDHLHKETLKLTDAARAGDLSIRGDEKAFRGGYRMIIAGFNKTLE
FT                   SITEPVNEAMRLARFYASGDFTARFDENIPVAGEFVAYRDALNTIGIELSRLMKLISEE
FT                   LYEGVSVLSLASNEILAVTSQLAAASSQTAATVNETSDSVESVRKKTELVNLKTKGVSE
FT                   KAMRALEVSKGGQKSVRETLEGMNQIQRQMDIVRMSVIRLSEQSQAVGEIIATVNDISE
FT                   QSNLLAVNASIEAAKAGEFGKGFAVVANEIHNLAEQSKKATSNIRAILTDIQQGVSSTA
FT                   ASTEQGIRSVTDAAQLTSNAQEVIEVLAQSIADTSQEVIEIATSIQTQASGIDQISRAM
FT                   ENIRDAAQKNLETTHKAEKTAEDLHELGARLKRITQQYRV"
FT   sig_peptide     complement(220196..220297)
FT                   /locus_tag="Memar_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.748) with cleavage site probability 0.441 at
FT                   residue 34"
FT   gene            complement(220428..221405)
FT                   /locus_tag="Memar_0240"
FT   CDS_pept        complement(220428..221405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0240"
FT                   /product="putative CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: mhu:Mhun_0496 CheW
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56174"
FT                   /db_xref="GOA:A3CS24"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS24"
FT                   /protein_id="ABN56174.1"
FT                   /translation="MTHLLSFTVEGLTCALPLAETRQVVGMVELQPETGKRRGGAGTMN
FT                   LHGRAVPVYSLRRLLGLADRQPLPTDVLIIAHPTRECVALWADGVRGVQESPVELPPET
FT                   DATSPPGMLLTEEEEIIIYDLGAFLAAEETAQHSLPGTAGTGEEAPPYDDGKGDEILAE
FT                   RARAFARPEEEAGGETPFSELLTFRLADREYAIKTQYIREVFIMHEITPVPGVPDFVAG
FT                   ICAVRGEIISVVDLRALFSIPKHGLTDLNRVIVLSDGTVTFGILADYITDIYIRPTDQF
FT                   SPVEPETTPIEQRYLLGVTDESVLVLDAAAILGDPAMVVGQTRK"
FT   gene            complement(221470..222273)
FT                   /locus_tag="Memar_0241"
FT   CDS_pept        complement(221470..222273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hal:VNG2165H hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56175"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS25"
FT                   /protein_id="ABN56175.1"
FT                   /translation="MQGTVYAVLALAVLATVIAGCTGVPGVEETEQFDRTVAVEPESGI
FT                   VVINHNGNVAVNVREGEDVGITAVKRSVYGRGELEKVRIEVTEGDPLRVETVHTTFDPR
FT                   VSVDYTISLPPTVVLQRIESSNGGIELSGVRLEETELLTSNGRIEIRGAEGYVTATTSN
FT                   AGITVEDCGGIAGLATSNGEVTAELSAVRGDVTVSSSNAGITLRFAEDLDARVVATTSN
FT                   GGITVHDLMLRLEESTGTSVSGTLGNGGPTVTVKTSNAGIDLFGP"
FT   gene            complement(223548..224384)
FT                   /locus_tag="Memar_0242"
FT   CDS_pept        complement(223548..224384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0242"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mac:MA4681
FT                   multidrug ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56176"
FT                   /db_xref="GOA:A3CS26"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS26"
FT                   /protein_id="ABN56176.1"
FT                   /translation="MAWEFLTVYWREMIRYVRFRTQLFSSLLQPALWMAFFGIAMSSNF
FT                   DRFTSSIPAPAGVVPLDYLTFMAAGVIAMTTLFTSLFGGMSLLFDKNWGLMREMLASPM
FT                   PRTHIMLGVSLSGMTKSFIQASIIMAFGLLLGVQFFPGYSAARIALSILGIFVFVGVFS
FT                   LGFLLFSSTISMRLESPEGLQGIITLLTLPLFFVSNALYPIQAFPPFLQTLSIFNPLTH
FT                   LVNGIRYFALGGDFFAVGARYTSTTADVLGSFAYLVIFAAVMYLLARRTFERAVVT"
FT   gene            complement(224389..225339)
FT                   /locus_tag="Memar_0243"
FT   CDS_pept        complement(224389..225339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0243"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: mac:MA2689 multidrug ABC transporter,
FT                   ATP-binding protein; TIGRFAM: daunorubicin resistance ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56177"
FT                   /db_xref="GOA:A3CS27"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS27"
FT                   /protein_id="ABN56177.1"
FT                   /translation="MGGDDIIEVHDLEHAFGNFAAVRGISFTVKNGEIFSFLGPNGAGK
FT                   STTINILTTLLPLQKGTVRVAGYDVAREPGKVRKAIGIVFQEDVLDRDLTVRETMEFHG
FT                   RLYAIPREERRRRIDDLLRIVELESKRDERTKNLSGGMKRRLQIARGLMTQPEVLFLDE
FT                   PTQGLDPQTRMRIWDYIRQVNGTGTTIFLTTHYMEEADMLSDRISIIDHGRIVVSGTPA
FT                   ELKNALGEDVVYLETEDDEKARAALSGIEEIRSVTESPRGLSVTISADGSHCLPQIIER
FT                   VRGAGIGISNVNLKKPTMDDVFVHYTGSELRDTGA"
FT   gene            225687..226181
FT                   /locus_tag="Memar_0244"
FT   CDS_pept        225687..226181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56178"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS28"
FT                   /protein_id="ABN56178.1"
FT                   /translation="MTPRLRTALVLLLAALALAAPASGLVVENADLTPAEVNLLFAMRE
FT                   YTLTYNEYADRLPGWVTGPFADETVNLYVTSPDGVLVMGITFHDKKVIQFDAKGCPDPI
FT                   VTVTTDVATVEAVMVSDRPFDTFRAAMQNGTATIEGNNLLGMLRTGMVLFGFRVMDILG
FT                   M"
FT   sig_peptide     225687..225761
FT                   /locus_tag="Memar_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.484 at
FT                   residue 25"
FT   gene            226625..226789
FT                   /locus_tag="Memar_0245"
FT   CDS_pept        226625..226789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56179"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS29"
FT                   /protein_id="ABN56179.1"
FT                   /translation="MHRYAKLLLYGILAFAVFAGISFTLGGRVNWALAAATAVGVMIAY
FT                   FFAAPRGKR"
FT   sig_peptide     226625..226684
FT                   /locus_tag="Memar_0245"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.950) with cleavage site probability 0.415 at
FT                   residue 20"
FT   gene            226795..228093
FT                   /locus_tag="Memar_0246"
FT   CDS_pept        226795..228093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0246"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="PFAM: amidinotransferase; KEGG: tac:Ta0987 arginine
FT                   deiminase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56180"
FT                   /db_xref="GOA:A3CS30"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS30"
FT                   /protein_id="ABN56180.1"
FT                   /translation="MAAGVRAEWERLRTVAVHRPGIEMFFGLLEPYAALYERAFSRYEA
FT                   RREHDALQRTLREEFGVRVLRLKETVLDAADRDPAVRRRLVDWAHETVAVRGDVREVAE
FT                   ARRSMEQNADALDSLHFFTLLLLNPVIDVGRRGAAGGVDVRILGQEPLANLYFMRDQQA
FT                   ATARGLVVGRPAKRQRAREPEITRFLWEILGIPIAGTVQAPGTFEGGDFMPMGEFALVG
FT                   TGDRTNRDGASQFLGFAPGFDEIGIVHQPGHPLIPGDRPDPMVDMHLDTYFNVAGSGVV
FT                   LGSERLLRRARLEVRHRSDGGYEPSGETTTLYDYIRSKGFSVIELSLLEQLSYAANVLC
FT                   VRDGSILAVEGERVMRTVLSNLERKAARDPQRYGRLLRHAEEDYRRIQNGGHVFPHKPE
FT                   FSRHGIEVCPLHLENLTGGYGGPHCMTCTLERG"
FT   gene            228098..229042
FT                   /locus_tag="Memar_0247"
FT   CDS_pept        228098..229042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0247"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="TIGRFAM: carbamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: mta:Moth_1948
FT                   carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56181"
FT                   /db_xref="GOA:A3CS31"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS31"
FT                   /protein_id="ABN56181.1"
FT                   /translation="MAERTVVIALGGNAILQHRETGTAEDQFENVRKASRRIAEIVAEG
FT                   YAVAVTHGNGPQVGDILLRNELAKDTLPPMPLDVCGAESQGMIGYMLQQSMQEALREAG
FT                   YDRPVATLLTQTLVDGDDPAFENPEKPIGPFYTPMQAKKLQEEKGWRMVRIPGEGYRRV
FT                   VPSPRPIAFVEERAIARLVSAGAIVIAAGGGGVPVVADGGGALRGVEAVVDKDYTAAFL
FT                   ARLVGAEDLLILTDVERVALNYGWPDQQEISEMTVREARGHLAAGQFPPGTMGPKIEAA
FT                   VGFLETGGERVIIASLEEASVALAGRAGTRIHL"
FT   gene            229104..229442
FT                   /locus_tag="Memar_0248"
FT   CDS_pept        229104..229442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56182"
FT                   /db_xref="GOA:A3CS32"
FT                   /db_xref="InterPro:IPR040493"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS32"
FT                   /protein_id="ABN56182.1"
FT                   /translation="MADNFWTGVIVGWLVGLILGFLLPVIGPLIGGFVAGWMVRGGIGN
FT                   GAKAGLLAGILGAIVIAVLLLVGGTVLLGAFGFIAGLGTSLVIIVMAFVYQGLLSMIGG
FT                   VIAGAIRR"
FT   gene            229499..229873
FT                   /locus_tag="Memar_0249"
FT   CDS_pept        229499..229873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56183"
FT                   /db_xref="GOA:A3CS33"
FT                   /db_xref="InterPro:IPR040493"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS33"
FT                   /protein_id="ABN56183.1"
FT                   /translation="MAKQDSPYWLSPLVGIIFMLFISPFFPVGGPIVGGIIGGYLGPPG
FT                   AARGALGGLIGGLVVAAIFSVVAVVGGTALLGPIGALIGLGIAALLFALALYFGILGAV
FT                   GGAIGGALKTWMVSRRNVTG"
FT   gene            complement(229863..231077)
FT                   /locus_tag="Memar_0250"
FT   CDS_pept        complement(229863..231077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0250"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rxy:Rxyl_0517 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56184"
FT                   /db_xref="GOA:A3CS34"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS34"
FT                   /protein_id="ABN56184.1"
FT                   /translation="MPDPPPETRQDLRDLSIRLILLLGAASLCGSLVSNGARSVTGPYI
FT                   LLLGGSAAIVGLVAGAGEFIGYALRSATGIYVGKNHRYWKAATAGYGLLAAIPLLAVAG
FT                   RWETAAALIVAERIGKAVRTPARDTILSHATTAVGRGWGFGVHKALDQVGAVAGPLVMA
FT                   AALAVTGGYGVGFLLLGIPLAGVAVALFLAQSEVPRPGRLEGEGEGNRDNLPGIVPYAA
FT                   FVFLGMAGFASFPLISFHLKAQSIVPDAAIPLFYAAAMTVSVAVALLVGRAFDRIGTHV
FT                   LLTIPALSIATVALAFSPEPGAAVAGSLVWGAGIGIFEPVLRASIAESTALDRRGKVYG
FT                   SVSAVFGTAWFVGSAVMGVLYDVSIGHIVAYVVIVEAAAIAAYLWMCRSRIVVRLQEGL
FT                   GEIIP"
FT   gene            231209..232585
FT                   /locus_tag="Memar_0251"
FT   CDS_pept        231209..232585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0251"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mac:MA1657 efflux pump antibiotic resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56185"
FT                   /db_xref="GOA:A3CS35"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS35"
FT                   /protein_id="ABN56185.1"
FT                   /translation="MEQEESKSYSRRFILILVTVATFLNPFTGSAINLALPAIGGEFSA
FT                   DAATLAWVTSAYLLASVIFLLPAGRLGDSRGKVTVFLAGIVVYTAGSLLTILTPTMDLL
FT                   LVCRFIQGMGGAMIYANSVALITHLYPPGERGYAIGLNTTAVYAGLSLGPFLGGALTQF
FT                   LGWRSIFIVTALLAVPVLFYAGKFPAFLNERQREHFDVAGLILSSALILCLFLGLAWVT
FT                   TPTGATLLAAALVLGAVFFRVERGRQNPLLPVTLLEKNRVFAASNAAALINYSATFAVG
FT                   FLLSLYLQYIRGYEPVAAGTLLLLQPIVQVFVAPVAGRLADRMQPGLVASVGMGITAVG
FT                   LFGFSLLGETTPIAAILALLVLLGVGLGIFSSPNTTAIMGCVEKRYYGSASAMVAMMRS
FT                   LGMMLSMGAVLVVFAVIMGSTTVTPAIFPEFLASLRLIFLAFAVLSAFGVLLSLRRNKC
FT                   "
FT   gene            232673..234286
FT                   /locus_tag="Memar_0252"
FT   CDS_pept        232673..234286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0252"
FT                   /product="ATPase-like protein"
FT                   /note="KEGG: nph:NP2180A homolog to predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56186"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS36"
FT                   /protein_id="ABN56186.1"
FT                   /translation="MEIVIGKNGDRDVAIDAQELVTGRTCVIAQSGAGKSWGIAVLCEQ
FT                   LLQARVGFCLIDTEGEYFSLRDRFPLLWIGSTDDCDVDIGQVNLRELMQNAICSRTAVI
FT                   FDVSEADMQERVSYLAEVLYDLESELKQPFLLIVEEADKFIPQSGESIKKIEEISRRGR
FT                   KRGLGLLVATQRPSLVTKNVLSQCNSQILGKLSIENDLKAVSLFFSSRKEAGELADLEP
FT                   GEFFVMGKLSRENATKMRFGARLCEHRGLTPRLVPARPIEPAKPAKPSRVEPTRTEPCV
FT                   PEDIPREEPEVPPAPANAVIPVLLREEALDIAKGKRKRRFRFLEPEERIVSGDRVYRPL
FT                   HRVEVRYIGGLLRKSTRTASFVLDGCTGCIIEVDRGMKIRPGFSELLGLDEAAVKIVAG
FT                   LANGGSTLTEIEADTHLGPGVVKKAMKSLADVKLITEMKTVGDTKVYVPLLAADVPALS
FT                   SLRRGADLPMESLREEPLEAKVTESSLRTILKGLEPTAEIVGFDTIYYPVYLIRFASER
FT                   GERSIVLDGCTGKELLFPVS"
FT   gene            234372..234530
FT                   /locus_tag="Memar_0253"
FT   CDS_pept        234372..234530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0253"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   sfu:Sfum_3222 rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56187"
FT                   /db_xref="GOA:A3CS37"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS37"
FT                   /protein_id="ABN56187.1"
FT                   /translation="MDSYRCTLCGYVYFPAIGDTDHGVKPGTAFEDLPETWKCPRCGAP
FT                   KSRFKKV"
FT   gene            234809..234967
FT                   /locus_tag="Memar_0254"
FT   CDS_pept        234809..234967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0254"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   mth:MTH156 rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56188"
FT                   /db_xref="GOA:A3CS38"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS38"
FT                   /protein_id="ABN56188.1"
FT                   /translation="MDSYRCGLCGYVYNPRAGEPGQGIEARTEFGDLPDTWACSRCGAE
FT                   KNLFRKA"
FT   gene            complement(235070..235276)
FT                   /locus_tag="Memar_0255"
FT   CDS_pept        complement(235070..235276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56189"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS39"
FT                   /protein_id="ABN56189.1"
FT                   /translation="MKPPSPTGSEYPPTRSSPFSLRHGGDWSYAAEGFTAISAVTKTTV
FT                   YDEMEHLAGLEVRGEGLRVFRFG"
FT   gene            complement(235333..236382)
FT                   /locus_tag="Memar_0256"
FT   CDS_pept        complement(235333..236382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0256"
FT                   /product="tungstate/molybdate transport system ATP-binding
FT                   protein"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: mhu:Mhun_1331 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56190"
FT                   /db_xref="GOA:A3CS40"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS40"
FT                   /protein_id="ABN56190.1"
FT                   /translation="MLGTAGLTKRLGDFTLDDVDLTVADGEYFVILGPTGAGKTILLET
FT                   LAGIYSPDAGTIALDNRDITRTDPKDRGIGMVYQDYMLFPHLTVGENIGFGLKQRKAEP
FT                   ARIRESVQETAALLGIGHLLHRTTGTLSGGEQQRAAIARALALRPRVLLLDEPLSALDT
FT                   VTRERLRRELKAIHRTTGTTVIHITHHFEDIFALADRVAVMQDGRIVQTGTPDEVFRRP
FT                   ATEFVAAFTGMENVYCGVSRVRNGEATIDLGEIVVRTVTAIEGDVCVGIRPEEVILSRQ
FT                   PFESSAANTFSGTVAEIRQNGMFSRVVVDTGLPFVAVLTRQSVARLGLVEGEPANVTFK
FT                   ASAVHVFKR"
FT   gene            complement(236383..237195)
FT                   /locus_tag="Memar_0257"
FT   CDS_pept        complement(236383..237195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0257"
FT                   /product="NifC-like ABC-type porter"
FT                   /note="TIGRFAM: NifC-like ABC-type porter; molybdate ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; KEGG: mhu:Mhun_1979 NifC-like ABC-type porter"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56191"
FT                   /db_xref="GOA:A3CS41"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR006469"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS41"
FT                   /protein_id="ABN56191.1"
FT                   /translation="MFRNRAALPRLTPFKAIFLAVSFALIVYMLVVIGGLVVYPPLPAL
FT                   IESLLSPEILFAVELSLVTSAVSTAFCVVAAVPVAYSLARFSFPGRGVANTIFNIPLAL
FT                   PPLVAGVALLIFYGPSTFGKMLSEWGLDVIYTPLGIVVAQFFVNLPYMVRVARSAFETI
FT                   NPRYEHVARTLGCTEWGAFRQITLPLAKSGLIAGLVITWSKSIGEFGAVLMLAGATRMK
FT                   TETLPIALFLNMSTGDLDLAVAASVILIVISVISLAVFERYTGGRGVF"
FT   sig_peptide     complement(237091..237195)
FT                   /locus_tag="Memar_0257"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.821) with cleavage site probability 0.788 at
FT                   residue 35"
FT   gene            complement(237198..237689)
FT                   /locus_tag="Memar_0258"
FT   CDS_pept        complement(237198..237689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0258"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   mhu:Mhun_1333 protein of unknown function UPF0066"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56192"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS42"
FT                   /protein_id="ABN56192.1"
FT                   /translation="MNGTEYSCRTIGVARTAFTDPAATPIQAAFSTACGTVEVYPEFRD
FT                   GLSALAGFSHLILIYRFHRAAGEEIAERPLIDGAEPHGIFATRHFNRPNMLGISVVRLA
FT                   GIDGGTLVVKGIDLLDGTPILDIKPYIPAFDCIGGASSGWVTSQHVERIKLQSASFQVD
FT                   "
FT   gene            complement(237686..238498)
FT                   /locus_tag="Memar_0259"
FT   CDS_pept        complement(237686..238498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0259"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein, family 1; KEGG: mhu:Mhun_1978
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56193"
FT                   /db_xref="GOA:A3CS43"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS43"
FT                   /protein_id="ABN56193.1"
FT                   /translation="MVSMFKNTIVLVTLALLLFAGGCTTVTGDNTAAGDDATLLVYSGA
FT                   GLKKPMTEIGDVFAEKYGIDVEYTFAGSGTLITQMELSRKGDAFVPGGTPDYRIAREKG
FT                   LVEEPGYAAYHVPVIVVAKGNPKNITSVDDFARPGLKIALGGANTTAIGRAGDKLFQAH
FT                   GTLDAVEKNVVLRAPTINEVVVAMNMGTADAALITLDLVNPETMDTIDLPQEDGLTLIV
FT                   PIGATTFTEQPDVAQTFVEFVTSDEGKAIFAKHGFPVYPDPAYAGIEP"
FT   sig_peptide     complement(238412..238498)
FT                   /locus_tag="Memar_0259"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.827 at
FT                   residue 29"
FT   gene            238656..239024
FT                   /locus_tag="Memar_0260"
FT   CDS_pept        238656..239024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_1659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56194"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS44"
FT                   /protein_id="ABN56194.1"
FT                   /translation="MEDLLSTLLDIEKRAWKAADVRDVEFYREYLAPEALVVTLCAVLD
FT                   RDGIIRDLIENPNELPAYVITDPKVVPLGEKGAVLAYTVSFGGQTIFVSTVYTRSDGRW
FT                   RAAFHQRTPASPATCPAD"
FT   gene            complement(239021..239656)
FT                   /locus_tag="Memar_0261"
FT   CDS_pept        complement(239021..239656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0261"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: mta:Moth_2162 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56195"
FT                   /db_xref="GOA:A3CS45"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CS45"
FT                   /protein_id="ABN56195.1"
FT                   /translation="MGYDLYVVTDETIGRGRTHTDLARLAAAGGADVIQLRDKRLPGRD
FT                   LLSAAVAIREITTDAGALFIVNDRLDVAIAAGADGVHLGANDLPVGEARRIVPPGFLIG
FT                   ASVGSVAAAVRAAAEGADYVALSPTFATGSKDDAGPGCGLAALKEIRAAVSLPLVAIGG
FT                   ITAANVADVIAAGADGVAVISAVVGEGDVTAAARSLRDRIAAAKAEGR"
FT   gene            complement(239656..240495)
FT                   /locus_tag="Memar_0262"
FT   CDS_pept        complement(239656..240495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0262"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="PFAM: hydroxyethylthiazole kinase; KEGG:
FT                   mhu:Mhun_2217 hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56196"
FT                   /db_xref="GOA:A3CS46"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CS46"
FT                   /protein_id="ABN56196.1"
FT                   /translation="MPDNTREGSSARFVDGAIPAGLLAAVRSQRPLVHHITNGVTINDC
FT                   ANITICAGAAPVMAEAPEEVAGMVAAAGALVLNIGTLSAAQVEAMLIAGRRANELGIPV
FT                   VLDPVGVGATEFRTATARKLLDTLDIAVLKGNAGEIGVLAGTGGSVRGVDSGGVAGDPV
FT                   ETARECARSTGTVVSMTGAVDVVTDGSRVFLVGNGNPAMDRLSGTGCMASSVTAAFVAV
FT                   AEDYAVASAAALAAFGLAGEWGAAGARGPYTFRTALFDELAGLSPDDLAGHARIEER"
FT   gene            240625..241569
FT                   /locus_tag="Memar_0263"
FT   CDS_pept        240625..241569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0263"
FT                   /product="methenyltetrahydromethanopterin cyclohydrolase"
FT                   /EC_number="3.5.4.27"
FT                   /note="PFAM: Methenyltetrahydromethanopterin
FT                   cyclohydrolase; KEGG: mhu:Mhun_2384
FT                   methenyltetrahydromethanopterin cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56197"
FT                   /db_xref="GOA:A3CS47"
FT                   /db_xref="InterPro:IPR003209"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS47"
FT                   /protein_id="ABN56197.1"
FT                   /translation="MLSVNRTAMPAVRELIDRRDEHGIAVAEQENGATCIDCGVHVPGS
FT                   YRAGALFVETCLAGLATTAITMGRVGDVPVPFLHLTVSRPALACLGSQKAGWVLKAGGY
FT                   SAMASGPARALSLKPKNTYKMLGYRDTSRTGILALEADSLPDEEVTGFIAEKCGIEPEN
FT                   LYVLVAPTRSLVGSVQISGRVVTATLHKLEEKGYDVLRISHAAGRSPIAPIKRTGIEAM
FT                   GTTNDCNIYYGSVSLVAEGYDPVFATLPSRTSPDYGRPFARVLKDAGYDFLKVDSLLAF
FT                   SPAEVTVNDSESGEVHHFGRLNADVLLESFGFL"
FT   gene            complement(242550..242822)
FT                   /locus_tag="Memar_0264"
FT   CDS_pept        complement(242550..242822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0264"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mhu:Mhun_2383 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56198"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS48"
FT                   /protein_id="ABN56198.1"
FT                   /translation="MSSDEKKMPKQFPWIIPFSCEGCGDCVEACPTGSIELVDLGKKID
FT                   KAWITNPETCIGCGKCADACVVGAVQMTSYVEKALERYREKTSPE"
FT   gene            complement(242829..243308)
FT                   /locus_tag="Memar_0265"
FT   CDS_pept        complement(242829..243308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56199"
FT                   /db_xref="GOA:A3CS49"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS49"
FT                   /protein_id="ABN56199.1"
FT                   /translation="MTVNLTDRMKAWIEAMGCHLCVATPEGVPFVVLGRYAKATTNGEV
FT                   AFALAQDEAKVIAPVLSENPRVAFGVSRQGGIRAAYQFKGTGELLRSGSVFDTVAAQAK
FT                   EEKGIDAELVLLVRLTELYCTKPGYEAGQRLDGMTPEELDAWERQRWKDVPRKRD"
FT   gene            complement(243314..243805)
FT                   /locus_tag="Memar_0266"
FT   CDS_pept        complement(243314..243805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0266"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mhu:Mhun_2381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56200"
FT                   /db_xref="GOA:A3CS50"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS50"
FT                   /protein_id="ABN56200.1"
FT                   /translation="MVKFTKEMKEALRVPGKGGSLIYLCTSSRDGNPNIAAMRFVATHM
FT                   DDKILIADMFLLKTKANIKENPEVAVTICHPLDEGRWWVFKGKAVDMEYGFPRDFDWYG
FT                   ANATDILNEWGNWNKAEPPDEVPPDIVFPKAVQRGVVVVHVEEAYSIEPGNVGEKVLTG
FT                   "
FT   gene            complement(243824..244912)
FT                   /locus_tag="Memar_0267"
FT   CDS_pept        complement(243824..244912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0267"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region domain protein; KEGG: mhu:Mhun_2380
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56201"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS51"
FT                   /protein_id="ABN56201.1"
FT                   /translation="MAFDLSKCDFSRCRGECLVRCPYVSYDEDDAKRAMKSLIEGERHP
FT                   ILKECITCAACNDFCPLGADPWDLIARRQEETGVLGIPADAKPSSDWLTKPAVVIRRGK
FT                   PGGALISAGGIYEVVPQAEFLTGQVFEDATVIGGGPYACGFTETHLGRASRPLKNLPQF
FT                   IENLAKAAEEFGVDEIVFTHDACYNVATTLATQQGIEVPFRPVHILEHIRNWLRDHPDR
FT                   IKNPLGLSVAVQGGCTTRYAPRGGDREIWSDWLADIFEMIGVESVEEKRTYTGDDRLCC
FT                   GCGIFHTQHERAVDIQRKNIGDAAEAGAEELVFICPACISVMRATCRKMEIEPIYITQL
FT                   VKQALGEELGPAGTAAFGYPVK"
FT   gene            245235..246089
FT                   /locus_tag="Memar_0268"
FT   CDS_pept        245235..246089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0268"
FT                   /product="ATP-binding protein"
FT                   /note="KEGG: mhu:Mhun_0907 ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56202"
FT                   /db_xref="GOA:A3CS52"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS52"
FT                   /protein_id="ABN56202.1"
FT                   /translation="MAEADNTTKDAGQQQKNPLEKVAVSVRHVILVLSGKGGVGKSTVA
FT                   ANFAMALANHGYQTGLLDLDIHGPNIPKMLGIEETKLTSTNGTTIEPVYVVPALGVVSM
FT                   AFLLPDKSTPVIWRGPMKMQAIKQFLADVNWGDLDYLVVDLPPGTGDEALSIIQLAPNV
FT                   AGAVVVTTPQEVAVLDSTKAVKFIEKMDIKVLGIVENMSGMVCPHCGKEIDLFGQGGGK
FT                   KAAKDLGVPYLGNIPLDPDVRRAGDEGRPFIVRRPGMSADNPTWEHVDRVMQAVLRSIG
FT                   EAH"
FT   gene            246135..246320
FT                   /locus_tag="Memar_0269"
FT   CDS_pept        246135..246320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56203"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS53"
FT                   /protein_id="ABN56203.1"
FT                   /translation="MKKFRIELTGFIEMDTDQERDARILAERILEEIRSVFSGHGAIQD
FT                   CDVGIGLVTEKPLTRR"
FT   gene            complement(246363..248255)
FT                   /locus_tag="Memar_0270"
FT   CDS_pept        complement(246363..248255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0270"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: hma:rrnAC2211 HTR-like protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: GAF domain protein; histidine kinase
FT                   A domain protein domain protein; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; PAC repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56204"
FT                   /db_xref="GOA:A3CS54"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS54"
FT                   /protein_id="ABN56204.1"
FT                   /translation="MYRCFDELDDAVVILDRDNTVVRLNRSFCETFGIGDDAARGMEIG
FT                   DLIARHLAPFFEEGDSAGRMIEALRHREEVTHETHRMRTSTGEVRHFSFSCRVISGEPS
FT                   AGERLARFRDVTPERDEAVRRAWEESARVGAESVFTAVGELVPYGFWVCGPDGNVLYLS
FT                   ASFLELVGRTIEECRRSGWPECIPLEDAAAVRSDWRRCLDTGCRWNRELRVPDPDGECR
FT                   TILSRGAPIRDGDGQIVLWAGINLDITARKQAERHTAVRAAQQAAIADLGQFALAGAEP
FT                   PELMNAVVRMVAERLGVDYAKVLRYLPEEDLFILEAAVGFGGVRVGTEKVNGGTDSQAG
FT                   YTLLSHEPVIVEDFDAETRFQGPALLRNEGILSGISVIIQGDEAPYGVLGAHTRTLRRF
FT                   TRDDINFVQAAANVLALGFKRKAAEEALSKSEEKFRQIAQRSFDMIYTCYHDRGITYMS
FT                   PAVARILGYTPAELIGCRCRDYVSPLSLAAWEEGQKKMARGEPTEGLEVEFRRKDGTTA
FT                   FVELNESPIVENGKVVGVQAVGRDVTERKQIDQLNRQAFDQIERNIEQFAVLGDHIRQP
FT                   LQVILGMADLTDDPKTSAVIHDQVRRINEYIRQLDRGWVESREVRAFLRRHDRG"
FT   gene            complement(248469..248553)
FT                   /locus_tag="Memar_R0002"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(248469..248553)
FT                   /locus_tag="Memar_R0002"
FT                   /product="tRNA-Ser"
FT   gene            complement(248811..250400)
FT                   /locus_tag="Memar_0271"
FT   CDS_pept        complement(248811..250400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0271"
FT                   /product="chaperonin Cpn60/TCP-1"
FT                   /note="PFAM: chaperonin Cpn60/TCP-1; KEGG: mhu:Mhun_0972
FT                   chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56205"
FT                   /db_xref="GOA:A3CS55"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS55"
FT                   /protein_id="ABN56205.1"
FT                   /translation="MLAGQPIIILRDNVERTRGFEAQHSNIMAAKAIAAAVRTTLGPRG
FT                   MDKMLVSSSGDVVITNDGATILHEMSVQHPGGKLIVEVAETQDDEVGDGTTTATVIVGS
FT                   LMEEAETLLAQDVHPTIIANGYQLGMEKALAILEELAIAVSAEDKENLIKLAGTAMTGK
FT                   SIEAIKDQISGIVVDAVRQVAGKTDRGTYIVDEDDIKIKKQVGDSMDDAELIRGIVIDK
FT                   KRVFEQMPDKVTDAKVALLAQPLEITKTQVKSKIKITSSDQMKAFSEQERASLRKLAEQ
FT                   IVAAGANVVLCQKGIADAVQYYLAKDGIYAIEDVKEADMKFAARALCGSIVNKPEELTE
FT                   ETLGHAEAAEEVPDADLTIISGCENPKAVTILLRGTSQLLLDELERAVYDAARVIQDAI
FT                   EDGKFVVGGGSVETELQLQIRDYAATVGGRVQLAIEAFANAFEVVPRTLAENSGFDTID
FT                   KVVALRKAHADGAKHAGLNVYTGEVVDMFEAGVIEPQRVKTQAIKSATETAMLLVRVDD
FT                   MMITQTGQPAGQ"
FT   gene            complement(250613..251227)
FT                   /locus_tag="Memar_0272"
FT   CDS_pept        complement(250613..251227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0272"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: mhu:Mhun_0973
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56206"
FT                   /db_xref="GOA:A3CS56"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR022854"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CS56"
FT                   /protein_id="ABN56206.1"
FT                   /translation="MSALEELITKAKALQAEGHTPGQISDELGLSMETVTWLLTQQKGM
FT                   EAPKDVHIDWAAVGSHGVLLNDMAMMMLKRFLYLEEGGDVRAIEDLPDTVVGIAPSGAP
FT                   LATLIAAEEGLKLAVYLPAKHSRSEAPTGSLSGTFSAIAAQRCIIVDDVVTTGTTLSET
FT                   IAFLRQHGATPVAVWSLFDKRGAREIDGVPVHSLFVISRLG"
FT   gene            complement(251249..251704)
FT                   /locus_tag="Memar_0273"
FT   CDS_pept        complement(251249..251704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0273"
FT                   /product="nucleic acid-binding protein, containing PIN
FT                   domain and zinc-ribbon module"
FT                   /note="KEGG: mhu:Mhun_0974 nucleic acid-binding protein,
FT                   containing PIN domain and zinc-ribbon module"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56207"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS57"
FT                   /protein_id="ABN56207.1"
FT                   /translation="MTLVLDASVFFTEIPFDGPASTTPSVVAELTDTHAKCRFEVLTAA
FT                   GLRVREPREEDLARVDAAALRTGDSGVLSGTDRDILALALELSAVLVTDDFAVQNVAHR
FT                   LGIETRSIRQRPARPIRWRYRCSGCGRYWKGPGDCPICGASIKRKLK"
FT   gene            complement(251701..252687)
FT                   /locus_tag="Memar_0274"
FT   CDS_pept        complement(251701..252687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0274"
FT                   /product="RNA-3'-phosphate cyclase"
FT                   /EC_number="6.5.1.4"
FT                   /note="PFAM: RNA 3'-terminal phosphate cyclase; RNA
FT                   3'-terminal phosphate cyclase, insert region; KEGG:
FT                   mtp:Mthe_0003 RNA-3'-phosphate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56208"
FT                   /db_xref="GOA:A3CS58"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS58"
FT                   /protein_id="ABN56208.1"
FT                   /translation="MLTVDGSHLEGGGQILRLAVALSAISATPVTVTRIRENRPNPGLA
FT                   PQHIAAVRAVAGACDAECTGLTPGSREISFAPGRIRRKDLAIDPGTAGSIPLIVQAWLP
FT                   VALQAGGSITVSGGTEVPWSPTIDYLDRVFAPVLRRAGASIEITVRERGYYPRGGGRVH
FT                   VRVEPSRPDPIAIPEGEEGGCGIVSCSAGLPAHVAERQAAAAQSLLDRELGLPCTAALD
FT                   PREGGTSVGSSVTVWSGAKGAVALGKRGLPAEKVGQAAARALADEYRSPGTVDIHLADQ
FT                   LLVHLACHGGEYSTHTLTMHAKTAGSLLAEFGYPIVCQKNDIVRFSA"
FT   gene            complement(252674..253531)
FT                   /locus_tag="Memar_0275"
FT   CDS_pept        complement(252674..253531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0275"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: mhu:Mhun_0975 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56209"
FT                   /db_xref="GOA:A3CS59"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037514"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS59"
FT                   /protein_id="ABN56209.1"
FT                   /translation="MRIISTERSQVLAARVAEKLGAPLVETKFTRFPDGELYLKCRELD
FT                   DETLIVSSIVDNDMFMQTLLAIDAADQSKNTLVVPYLGYSRQDKRFSPGEPISARAVAR
FT                   ALSAGIERVYVVNIHDPGVLGHFGVPAKNVTIAPAVGGYVGDLRLKNPLVLAPDEGAIG
FT                   FASDVAAVGGWDCDHLEKTRLSGEEVRIAPKTIDAAGRDVVIVDDIISTGGTLATAACM
FT                   LREQGAASIHAACVHGVLTSGAYTRLRAAGVSSVVSSDTYENASSFISAASAIVTAIRE
FT                   DAHR"
FT   gene            253613..255550
FT                   /locus_tag="Memar_0276"
FT   CDS_pept        253613..255550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0276"
FT                   /product="Lon-B peptidase, Serine peptidase, MEROPS family
FT                   S16"
FT                   /note="KEGG: mhu:Mhun_0976 peptidase S16, lon-like protein;
FT                   TIGRFAM: peptidase S16, Lon-like protease; PFAM: peptidase
FT                   S16, lon domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56210"
FT                   /db_xref="GOA:A3CS60"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004663"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS60"
FT                   /protein_id="ABN56210.1"
FT                   /translation="MDSTPTTEIPNIELTTDDLEETDVFSGLELSASSDIDVPPNLIDQ
FT                   VIGQEHGVEVIRKAAVQRRHVMMIGTPGTGKSMLAKAMAELLPKEELQDIMVYPNPEDN
FT                   NNPIIRTVPAGRGKQIVNAHKVEARKKIQMRSTLVMLLIIGIIGYAIITYQWLMGIIAA
FT                   AFVFIALKYSMPREEAMVPKLLISHDSNTMAPFIDATGSHAGALLGDVRHDPFQSGGLE
FT                   TPSHDRVEGGAIHRAHGGVLFIDEINTLTPHSQQNLLTALQEGTFPITGQSERSSGAMV
FT                   RTEPVPCRFVMIAAGNIDAIQGMHPALRSRIRGYGYEVYMRETMEDTQENRKKFLRFIA
FT                   QEVKNDGKIPHFDRAAMLEVLREARRRSNRKGHLTLKLRDMGGLIRVAGDLARQEGAEF
FT                   TSAKHVLAAKSASRSIEDQISDEYIRRSRDYDITVVEGTRVGRVNGLAVMGSDSGSVLP
FT                   VMAEVTPSQGANGTVIATGMLKDIAKESITNVSALIKKFTGKDIRNMDIHVQFIGTYGG
FT                   VEGDSASVTVATAVISAIENIPVRQDVAMTGSLSVRGDVLPIGGVTYKIEAAAKAGIKK
FT                   VIIPRSNLDDVLIEDRYRAMIEVVPVDHIEEVLQNALVPENRDGFISKLRKLAVNPTAL
FT                   FDPNVGRSVV"
FT   gene            255557..256885
FT                   /locus_tag="Memar_0277"
FT   CDS_pept        255557..256885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0277"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   mhu:Mhun_0977 peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56211"
FT                   /db_xref="GOA:A3CS61"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS61"
FT                   /protein_id="ABN56211.1"
FT                   /translation="MAEVRYYDIRCVRGEITLVDIDNGVIESAGTSFFDKAVIRVLGSK
FT                   GWGILTRDHVDIDSKREVESLVEAASRLAAVTEDHLDLADAPRGVLPVPPLGEDPRDVD
FT                   LEEKTRLLAGIEGAARVAGVGNTRARYTEGIDAVRFLDSSGNEYSYEAVRSGFSVVAIA
FT                   SRNGVMQMGSERDHITTGFNLRNKQDLGRKAGEVAVSLLDAKLPKGGTKRAVLDPELAG
FT                   VFTHEAVGHASEGDLVREGASVLGGKIGERIGCPGLVIVDDPSLPEFGFMPVDAEGVAV
FT                   ERTEIIRDGILSSYLHNRETLVAVGNGIPGHARAEHGAPPIVRMSNTFIENGDAAYDEI
FT                   LEECRDGILLIGSRGGQVDPGRGVFQFNAEYGYLIEGGEKAGMVRDVSLSGEILSTLHS
FT                   IALIGNDRKMSPGYCGKGGQSVPVSDGAPHLLLENATIGGRGE"
FT   gene            256882..258174
FT                   /locus_tag="Memar_0278"
FT   CDS_pept        256882..258174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0278"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   mhu:Mhun_0978 peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56212"
FT                   /db_xref="GOA:A3CS62"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS62"
FT                   /protein_id="ABN56212.1"
FT                   /translation="MNGEDLIERVLREGERRADEVEVFYARGLSVGTEIKKGILGNAEE
FT                   SESWNMAVRTVRDGRIGFSATSDPDRWKECLDAALASGRLATPQQWGGFPKPADLAGTP
FT                   STADGDLVVAVEDAARMVGDLLAGAAEHPVEVVGGGADLARSYLAVANSSGVFYCMDRT
FT                   VAAVSLEAIREQSTGYEFDASPYLADIDARSVGERAASLAARSLSGRNIETGRYDVVLS
FT                   PVAAASLLGQVLLPAISGRNVKAGRSFLADKVGEQVFDERLSVYDDPFAPGLGSTAFDA
FT                   EGTPTRRLVFVEQGVLGRFAYDLKTGYRYGEGSTGSAVRSGAEPPGIGFHNLFIDGPRV
FT                   KDPGDERAVWIHDVVGAHTANPFSGDFSVEISNPFWIEGGDLVEPIRTAMLSGNVFEML
FT                   AGIGGLGNDARRVGRLTIPSIRLNNQQIIGK"
FT   gene            258175..258438
FT                   /locus_tag="Memar_0279"
FT   CDS_pept        258175..258438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56213"
FT                   /db_xref="GOA:A3CS63"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS63"
FT                   /protein_id="ABN56213.1"
FT                   /translation="MMEEILAILLAVAIAAALYYLMKKAMTLVINAIAGLITLGLLNYF
FT                   DVLSWFGAPDIQINLVTVLICALAGLPGALVLVLLHLVGIAI"
FT   gene            258878..259414
FT                   /locus_tag="Memar_0280"
FT   CDS_pept        258878..259414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56214"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS64"
FT                   /protein_id="ABN56214.1"
FT                   /translation="MSKRSEGGASGPPPAGAGATTVPLGGEPLLIQGERSFLLVAKAGS
FT                   RFTLCIETPDDEYCQGVDPDDLVAVSMPEGGPIEQARMMLELVRRYHIPLVVLPKNHPG
FT                   SKRLSMVVSVAPAILLACDIRRGTHPEQHLLCSSAEFSGLSLVGIPGGVTIENLPPGVE
FT                   MVHLNAEKSSADKQQ"
FT   gene            259466..259795
FT                   /locus_tag="Memar_0281"
FT   CDS_pept        259466..259795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0281"
FT                   /product="V-type H+-transporting ATPase subunit E"
FT                   /note="KEGG: mhu:Mhun_1177 V-type H+-transporting ATPase
FT                   subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56215"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS65"
FT                   /protein_id="ABN56215.1"
FT                   /translation="MKTDVLKSIRETEEEYQAMIRDAQAERKKSLSDAELEAENLVIKA
FT                   QKDAEDYRNQRLAEARAQAQHRHAEIVREGEARAEALIASGNKNLAEAVDFIVTRFKEQ
FT                   LHVKA"
FT   gene            259782..261743
FT                   /locus_tag="Memar_0282"
FT   CDS_pept        259782..261743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0282"
FT                   /product="V-type ATPase, 116 kDa subunit"
FT                   /note="PFAM: V-type ATPase, 116 kDa subunit; KEGG:
FT                   mhu:Mhun_1178 V-type ATPase, 116 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56216"
FT                   /db_xref="GOA:A3CS66"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS66"
FT                   /protein_id="ABN56216.1"
FT                   /translation="MLRPERMRRLLIAAPKGEIDAIIRELYRHNVYHIEDFVPESSPEA
FT                   LSIGHPLPEASDAASALIKVRAIENACGIDPENVEVKTKLPASKVREMIRTDLPVIQKE
FT                   AEDLVGSRSRLEARQKEHEQRARELEPFTAVPLDLEFYRGYTRFTVFTGHITHDVGIDV
FT                   PNEKYFSDKVAGNMIVVVVQNEHREEVERTLLDAGFQAIPVPEETGAPTDRLTAHLEEA
FT                   RRIEDEIAGVNAKIAGIRERHTDFLVACDELLTADVERAEAPLRFATTEETFITEGWVP
FT                   EDRADNILDALDKATNGRIYIEELEIEEDTSVPVEYENPSFASPTQMLMDIYARPRYSE
FT                   IDPTLMVAIVFPIFFGMILGDVGYGAVLLALSLGLRKFLKGEGGRNLLKVLSYASISSI
FT                   VFGVLYSEFLGFSLPWEPLVFSRHLNIGGHAGGHGPQVVELMVIAIWIGILHITLGRVL
FT                   GILNARRLYHGRHAAKAVISHAGWLGVMWGILLIIWSFFPIPMMPDLTGLPIVAMGFGV
FT                   AAVIGVVLLVAGVIGIAQENALEIVELPTIVSHVLSYARLVAVGLSSVAIAMVVNYISI
FT                   GMMIEPQLEAITPVGVILIIVGILVFLMGHVLNTALGLLGGGLHSIRLHYVEFFTKFYK
FT                   GGGKKYNPFGMISKFTEE"
FT   gene            261748..261996
FT                   /locus_tag="Memar_0283"
FT   CDS_pept        261748..261996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0283"
FT                   /product="H+-transporting two-sector ATPase, C subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, C subunit;
FT                   KEGG: mhu:Mhun_1179 H+-transporting two-sector ATPase, C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56217"
FT                   /db_xref="GOA:A3CS67"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS67"
FT                   /protein_id="ABN56217.1"
FT                   /translation="MVDVGTTLEIAQASQAGMSAVGAGLAVGLTGVGTGLAEMGIGAAA
FT                   VGATAENRDMFGLALLFTVIPETIVIFGLVVALLLLF"
FT   gene            262008..262586
FT                   /locus_tag="Memar_0284"
FT   CDS_pept        262008..262586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0284"
FT                   /product="H+-transporting two-sector ATPase, E subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, E subunit;
FT                   KEGG: mhu:Mhun_1180 H+-transporting two-sector ATPase, E
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56218"
FT                   /db_xref="GOA:A3CS68"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CS68"
FT                   /protein_id="ABN56218.1"
FT                   /translation="MGLEAVVNEIREKGRKEVETIRAETRTDVEEILVDAQTRAAGIKA
FT                   SAQEEADRAVTHIINQEASAANLVVKRQVLNAQKTLLDQVYSASLAAVGDLPAEFQEKA
FT                   LTALLKRAVKEIKKGVVHANERDSPVVEEILSQLKMFSGYTMGAPVDIPGGIIVESNDG
FT                   ELQIDYSYRTFLDEIWESGLKDASDILFT"
FT   gene            262600..263655
FT                   /locus_tag="Memar_0285"
FT   CDS_pept        262600..263655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0285"
FT                   /product="H+-transporting two-sector ATPase, C (AC39)
FT                   subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, C (AC39)
FT                   subunit; KEGG: mhu:Mhun_1181 H+-transporting two-sector
FT                   ATPase, C (AC39) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56219"
FT                   /db_xref="GOA:A3CS69"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR014272"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS69"
FT                   /protein_id="ABN56219.1"
FT                   /translation="MAGVSSGSAQYIYACTRMRVRKSLLIPREDYLRMLNMSLPEITRF
FT                   IGETIYRSEIDELGTSFSGINLVEVALSWNLAKEYQSILELVPGDLKHFTASYLRRWDI
FT                   QNVVTVLRGKMQKMQPGKIKEVLVPAGRLDRVALDRLVAEESPERVAESLKGERFYPVI
FT                   ERELPRATETGSFAHLENELYKGYYARLIADAKGGVKGGDIFLKYIRLEIDIRNIQNLF
FT                   RLRAGHVREDVRELMIPGGSFTVDELQRLSGLESQDEFIDALKRQVKMIPLLNALEEIR
FT                   GKTALHEIEVALTRVQLDQMERMSKRYAFSILPILVYLEKKKYEVANLRALARGKEAGL
FT                   PGERLQGYLVM"
FT   gene            263657..263959
FT                   /locus_tag="Memar_0286"
FT   CDS_pept        263657..263959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0286"
FT                   /product="Vacuolar H+-transporting two-sector ATPase, F
FT                   subunit"
FT                   /note="PFAM: Vacuolar H+-transporting two-sector ATPase, F
FT                   subunit; KEGG: mhu:Mhun_1182 vacuolar H+-transporting
FT                   two-sector ATPase, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56220"
FT                   /db_xref="GOA:A3CS70"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR022944"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CS70"
FT                   /protein_id="ABN56220.1"
FT                   /translation="MEIAVVGTGEFILGFRLAGVRKTYAAETDERLVEHINQVLDDRDV
FT                   GILVLKGSDMERIPLRLRTTLENSVKPTVIAIGGEEGGLSMRERIKRSVGVDLWK"
FT   gene            263959..265713
FT                   /locus_tag="Memar_0287"
FT   CDS_pept        263959..265713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0287"
FT                   /product="ATP synthase, A subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: mhu:Mhun_1183 sodium-transporting two-sector
FT                   ATPase; TIGRFAM: ATP synthase, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56221"
FT                   /db_xref="GOA:A3CS71"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005726"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CS71"
FT                   /protein_id="ABN56221.1"
FT                   /translation="MDKGKENRAQGVLKRISGPVVTAVGLDAHMYDVVKVGNEELMGEV
FT                   IKIQGENIIIQVYEDTAGIRPGESVGNTGLSLAVELGPGLLTSIYDGIQRPLEVLVDKM
FT                   GNFIERGVSAPGLSHEKKWEFVPTVKKGDEVKAGDILGTVQETNIVHKVMVPPKAKGGK
FT                   IKKISGGSFTVDETVCVLEDGTEIAMLQRWPVRVPRPVTQKLNPDIPLITGQRILDGLF
FT                   PIAKGGTAAIPGPFGSGKTVTQQQLAKWSDAEIVVYIGCGERGNEMTEVLTEFPELEDP
FT                   KTGKPLMERTVLIANTSNMPVAAREASVYTGITIAEYFRDMGYDVSLMADSTSRWAEAM
FT                   REISSRLEEMPGEEGYPAYLAARLSEFYERAGRVISLNGEGGSVSVIGAVSPPGGDFSE
FT                   PVTQNTLRIVKVFWALDAKLSQRRHFPAINWLNSYSLYLDALNEWYDKEVSPEWNPLRA
FT                   WAMGVLQKEAELQEIVQLVGSDALPDEEQVTIEVARMIREIFLQQNAYDAVDTFCPMSK
FT                   QYDMMKAIKHYADLARTAQTGGATPQQVIGIRSKNELPQIKFIRDYEPELAKIMKDMEA
FT                   EFDAMRAV"
FT   gene            265716..267101
FT                   /locus_tag="Memar_0288"
FT   CDS_pept        265716..267101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0288"
FT                   /product="ATP synthase, B subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: mhu:Mhun_1184 sodium-transporting two-sector
FT                   ATPase; TIGRFAM: ATP synthase, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56222"
FT                   /db_xref="GOA:A3CS72"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005724"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CS72"
FT                   /protein_id="ABN56222.1"
FT                   /translation="MKEYRTVAQIAGPLVFVEKTEPVGYSELVNIVTADGTVKRGQVLD
FT                   TSDEIVVVQVFETTAGIGRDSGIRFTGETIKMPVGKDMLGRILSGGGKPIDGGPDIVPE
FT                   KRLEITGAAINPYARSSPEDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNDVALQIA
FT                   RQAKVPGSTEEFAVVFAAMGITREEANYFMADFEKTGALERSVVFLNLADDPAVERTIT
FT                   PRLALTTAEYLAFDLGYHVLVILTDMTNYCEALRQIGAAREEVPGRRGYPGYMYTDLAS
FT                   IYERAGIIKGVKGSVTQIPILTMPGDDITHPIPDLTGYITEGQIVVNRELHRKGIYPPI
FT                   NVLPSLSRLMNLGIGEGHTREDHKKVSDQLYAAYAEGNDLRGLVAIVGKDALSERDRMF
FT                   LEFADLFEDRFVRQGLYEDRSIEETLDLGWELLSTLPEEQLVRIDRELIQKYHPKYRKK
FT                   AQG"
FT   gene            267108..267734
FT                   /locus_tag="Memar_0289"
FT   CDS_pept        267108..267734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0289"
FT                   /product="V-type ATPase, D subunit"
FT                   /note="TIGRFAM: V-type ATPase, D subunit; PFAM:
FT                   H+-transporting two-sector ATPase, D subunit; KEGG:
FT                   mhu:Mhun_1185 V-type ATPase, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56223"
FT                   /db_xref="GOA:A3CS73"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS73"
FT                   /protein_id="ABN56223.1"
FT                   /translation="MALRDIKPTRSELINVKRRIKLSERGYNILKMKRDGLILEFFKVL
FT                   QQAKDSRGALLERYERAMEMIALAETVEGAIGVKAAAFSTADVPAISLKSKNIMGVVVP
FT                   EIQASSVRKGVLDRGYGMLGTSAVIDETAEAFEDLLEAIIEAAEIETTMKRLLDEIEST
FT                   KRRVNALEFKVIPELSEARDFIKMRLDEMEREELFRLKKIKARST"
FT   gene            267805..268971
FT                   /locus_tag="Memar_0290"
FT   CDS_pept        267805..268971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0290"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: mhu:Mhun_1194
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56224"
FT                   /db_xref="GOA:A3CS74"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS74"
FT                   /protein_id="ABN56224.1"
FT                   /translation="MLRVDFNSPIDPSSNQILDDKRFREHLPTVQALEDARLVVLTHQS
FT                   RPGKKDFTTLEAHAAKLERLLGRPVTYVEDIFGRCARDAIRSAKRGDVLMLENLRFAAE
FT                   ENLTLKPEEAKKTLLVRRLASMADVYVNDAFGTAHRSQPSIVGLPLVLPSVAGLLMEKE
FT                   VANLSRVFSGAPRPVTFVLGGTKVDDSIAVAQNVLERGTADRVIVVGVVGNVFLLAAGH
FT                   EIGRPSARLIDDLGYRAEIDKAKALLESYADRLSLPHSVAVREDGERVEYPLDTVPEDA
FT                   QVLDIGSDSIESLTETISGSGTVVVNGPAGLFEEEPFAVGTFELLRAASAVEFSVVGGG
FT                   HSGAAIERLGLESEFTHISTGGGAAIEFLTGKKMPAIEALEMSRKIFG"
FT   gene            complement(269569..270426)
FT                   /locus_tag="Memar_0291"
FT   CDS_pept        complement(269569..270426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0291"
FT                   /product="protein of unknown function DUF89"
FT                   /note="PFAM: protein of unknown function DUF89; KEGG:
FT                   mhu:Mhun_1616 protein of unknown function DUF89"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56225"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR014444"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS75"
FT                   /protein_id="ABN56225.1"
FT                   /translation="MKLTAGCTDCLISRVEYESRLCIDDPLRVSEIVDACRNLLGRIIA
FT                   DPVPAPVIASRVHRLAYRMIGDDDPYRSLKKGNNEDAAAVCREVRGDLSTFRDLALASV
FT                   IGNTLDYGSKAHTVTDNFVGFFRREFAAGLTVDDTAAIEGHTSRVVYLADNCGEIVFDS
FT                   LFADYLKKSGSHVTFAVRGAPILNDATMEDAVALGLDRRVDLLTPNTDGIAELGLNRDL
FT                   APPALADALDRATLVIAKGMANYESLSDDRDLPPVAYLMSVKCGPIGADIGIPVGSRVA
FT                   LLCE"
FT   gene            complement(270466..270542)
FT                   /pseudo
FT                   /locus_tag="Memar_R0003"
FT                   /note="tRNA-OTHER4"
FT   tRNA            complement(270466..270542)
FT                   /pseudo
FT                   /locus_tag="Memar_R0003"
FT                   /product="tRNA-OTHER"
FT   gene            complement(270606..270809)
FT                   /locus_tag="Memar_0292"
FT   CDS_pept        complement(270606..270809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56226"
FT                   /db_xref="GOA:A3CS76"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS76"
FT                   /protein_id="ABN56226.1"
FT                   /translation="MTMDINAIMIVLLSVTIVCLLFIMYVMYVRIQQLLREVDALSGRM
FT                   EITGSELEQLTRSVEEYKNARG"
FT   gene            complement(270809..271594)
FT                   /locus_tag="Memar_0293"
FT   CDS_pept        complement(270809..271594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0293"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: cell division ATPase MinD; PFAM: Cobyrinic
FT                   acid a,c-diamide synthase; KEGG: mka:MK0218 ATPase involved
FT                   in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56227"
FT                   /db_xref="GOA:A3CS77"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010224"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS77"
FT                   /protein_id="ABN56227.1"
FT                   /translation="MIRAYTIASGKGGTGKTTVTANLGTALAQHGRETCIVDTDVGMAN
FT                   LGLVLGLAETPITLHEVLAGTASIQDAMYVGPYGLKVVPSGLSLQGFQNANPERLRDVM
FT                   CDLTDRCDFLLLDAPAGIGTDGVIPLTVADEVLLVVNPEISSIVDALKIKILTETVGGT
FT                   IGGAILNRAILEETDMNRRKIEKTLGVSIIDTVPEDANVRRAAAAKTPVVVRSPGSESS
FT                   KAFRRIAATLAGIPVLEEPHKVQEGFVERFARALFRREP"
FT   gene            271932..272312
FT                   /locus_tag="Memar_0294"
FT   CDS_pept        271932..272312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0294"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   mhu:Mhun_1617 roadblock/LC7"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56228"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS78"
FT                   /protein_id="ABN56228.1"
FT                   /translation="MSRHPFMEESAQRHIDEIQSVVGVAACALVSSEGRILGKRFPEGD
FT                   LTSSLCAAMCATVLASAEAACGSVNMERPFLVTVTSADATILIVSVGEAALITAVIDKS
FT                   ADLPTVQRQLLDIAVRIGEEEA"
FT   gene            272312..272947
FT                   /locus_tag="Memar_0295"
FT   CDS_pept        272312..272947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0295"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   mhu:Mhun_1618 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56229"
FT                   /db_xref="GOA:A3CS79"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="InterPro:IPR040541"
FT                   /db_xref="PDB:3C3M"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS79"
FT                   /protein_id="ABN56229.1"
FT                   /translation="MYTILVVDDSPMIVDVFVTMLERGGYRPITAFSGEECLEALNATP
FT                   PDLVLLDIMMEPMDGWETLERIKTDPATRDIPVLMLTAKPLTPEEANEYGSYIEDYILK
FT                   PTTHHQLYEAIEHVLARRHSIAADIERAREAGVDSHLVDEYERLAKSVDINRRLLKILE
FT                   TTYSIKDARAGMGEDITRAIKSMAVSIKIQEERLNQVRNQFEELFVAR"
FT   gene            complement(273031..273462)
FT                   /locus_tag="Memar_0296"
FT   CDS_pept        complement(273031..273462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56230"
FT                   /db_xref="GOA:A3CS80"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS80"
FT                   /protein_id="ABN56230.1"
FT                   /translation="MIPSKSHADKAISAISWVTLGIYLLIAISLSLLAIFSFYDVVLQV
FT                   AALIHAEDMTQGILGVLHALLLTLIIVEILETVTAYFRTNKVLVTPILIAGITAMVRRV
FT                   LTFGVEPVEPIDIGMTLAAILVLTTAIVYIGKRERADGY"
FT   gene            273652..273725
FT                   /locus_tag="Memar_R0004"
FT                   /note="tRNA-Lys1"
FT   tRNA            273652..273725
FT                   /locus_tag="Memar_R0004"
FT                   /product="tRNA-Lys"
FT   gene            273804..274055
FT                   /locus_tag="Memar_0297"
FT   CDS_pept        273804..274055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0297"
FT                   /product="DNA-directed RNA polymerase, subunit H"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase subunit, RPB5; KEGG:
FT                   mhu:Mhun_0049 RNA polymerase subunit, RPB5"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56231"
FT                   /db_xref="GOA:A3CS81"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS81"
FT                   /protein_id="ABN56231.1"
FT                   /translation="MGTSLDVLNHEMVPDHQIMGEEEVADLLATYHITLEQLPKIYHDD
FT                   PAVKAIGGEVGNVIRIVRDSRTAGRAEAYRLVVKRPKK"
FT   gene            274099..275640
FT                   /locus_tag="Memar_0298"
FT   CDS_pept        274099..275640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0298"
FT                   /product="DNA-directed RNA polymerase"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb2, domain 2; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2, domain 3; KEGG:
FT                   mhu:Mhun_0050 DNA-directed RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56232"
FT                   /db_xref="GOA:A3CS82"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS82"
FT                   /protein_id="ABN56232.1"
FT                   /translation="MSRAYFAREHVARHQLDSYNNFLLHNLQKVVDEQRVIETDIETRG
FT                   KGKEAVWVELGKVEVKKPLVREADGSQSELFPSEARLRNLTYAAPIQLEMTLVQGEEAQ
FT                   DPIVTTIGQLPVMVGSAACNLYNMSDPERIEHGEDPLDPGGYFVVNGTERVLMTLEDLA
FT                   SNKIMTEFTERYNERIYVAKVFSQYRGYRALVIVERNRKNLLEVSFPSVAGHLRFIDLM
FT                   RALGLQGDHDIVEAVSTDEEILTFMMQNLEEGECDTVDEGVMYVGKKLAPNQTRDYQRK
FT                   RAEFVLDNYLLPHLNYLMPVGLKEEDPGYRTAVEGVRLAKAHFLGRMAEACFDLVLDRR
FT                   RIDDKDHYSNKRLKLAGDLMEDLFRISLNRLTRDVKYQLERASMRHRDLSIGTAVRADV
FT                   LTERLLHPLATGNWVGGRTGVSQLLDRVDHMAVLSHLRRVISPLSRSQPHFEARDLHPT
FT                   QWGRICPSETPEGPNCGLVKNFAQMVEISKGVINEEEVKNILYDMGVIALRRETA"
FT   gene            275637..277451
FT                   /locus_tag="Memar_0299"
FT   CDS_pept        275637..277451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0299"
FT                   /product="DNA-directed RNA polymerase"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb2, domain 6; RNA polymerase
FT                   Rpb2, domain 7; RNA polymerase Rpb2, domain 4; RNA
FT                   polymerase Rpb2, domain 5; KEGG: mhu:Mhun_0051 DNA-directed
FT                   RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56233"
FT                   /db_xref="GOA:A3CS83"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019969"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS83"
FT                   /protein_id="ABN56233.1"
FT                   /translation="MRQSRVFVDGALIGLVDDPRELVERMREMRRHGEISSEVNVSYKD
FT                   FNNDVIIHTDRGRARRPLIVVKGGVPQVTDDDIERLRNGETIFEDVARKGAIEFVDAEE
FT                   EEDLFIAINEADLTPEHTHLEIDPSLILGIGAAHVPFPEHNASPRVTMGAGMVKQALGF
FT                   AASNMKLRPDTRGHMLHYGQKPLTFTQTSDVIGSDDRPAGQNFVVAIISYEGFNIEDAL
FT                   IINKASIDRGLGRSHFFRTYDGEERRYPGGQVDRIEIPDEEVSGAHGAEFYANLDIDGV
FT                   INPETVVREKDVLIGKTSPPRFLEEPTSELIAVEKRRDTSVTMRSNEHGIVDTVIITEG
FT                   ENSSRLVKVRTRDLRVPEVGDKFASRHGQKGVIGLIQPSADMPFTESGMTPDLIINPHA
FT                   VPSRMTIGHMLEMLGGKVGSLEGHRINATAFRGERETALRSSLKELGFSHNGREVMYDG
FT                   ITGRQFAADIYIGVIYYQKLYHMVSSKMHARSRGPVQVLTRQPTEGRAREGGLRFGEME
FT                   RDVMIGHGAAMALKERLLDESDKVTQWVCAKCGMVAMVDRKRKVTRCLACGGETDIYPV
FT                   EMSYAFKLLLDEMKSMGIAPRLRLDDMV"
FT   gene            277473..280121
FT                   /locus_tag="Memar_0300"
FT   CDS_pept        277473..280121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0300"
FT                   /product="DNA-directed RNA polymerase, subunit A'"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: mhu:Mhun_0052 DNA-directed RNA polymerase,
FT                   subunit A'; TIGRFAM: DNA-directed RNA polymerase subunit
FT                   A'; PFAM: RNA polymerase, alpha subunit; RNA polymerase
FT                   Rpb1, domain 3; RNA polymerase Rpb1, domain 1; RNA
FT                   polymerase Rpb1, domain 4; SMART: RNA polymerase I subunit
FT                   A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56234"
FT                   /db_xref="GOA:A3CS84"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS84"
FT                   /protein_id="ABN56234.1"
FT                   /translation="MTSPKRVGRIEFGLFSPKEIRKMSVRKIIWADTYDDDGFPYPQGL
FT                   MDLNLGVIDPGLRCKTCDQKAADCPGHFGHIELAKPVIHVGYTRLIRKLLRVTCRSCSR
FT                   LLMTSEEVEKIIGPEDSELAGEIVSEKDIKKERVCPHCGEQQLKINFEKPTTFSEVFVE
FT                   DGRKVEHKLTPADIRARLERIPDDDLRALGVNPDVARPEWTILTVLPVPPVTMRPSIIL
FT                   ENGQRSEDDLTHKLVDIIRINQRFKENQDAGAPQLIIEDLWELLQYHVTTYLDNEVAGC
FT                   PPARHRSGRPLKTLSQRLKGKEGRFRGSLSGKRVNFSARTVISPDPNLSIGEVGIPLAI
FT                   ANEMTLPIRVTTFNIEEMRQYVLNGPERPTIRSPCGANYAIRPDNRRMRLSDANLETVA
FT                   EMIEPGWTVERQLKDNDIVLFNRQPSLHRMSIMAHRVVVMDGKTFRLNPAVCPPYNADF
FT                   DGDEMNLHIPQTEEARAEAEILVSVSSNILSPRTGGPIIGGIHDHISGIFLLTHTVRHF
FT                   SKEEVLYLTQHLPVEHLPEPDRMDENGNPLWTNKQVFSLVLPDNLNMVFQASSCQNCET
FT                   CKREMCENDAFVRVVNGNLITGTIDKKGIGAFDGQILHRIIRQHGMKRAARFIDDVTKL
FT                   SIRGIMLEGFSFGIDDEDLTRTEYGQIDEVLDGAISDVDRRIKIYNEGQLEPMPGRTLE
FT                   ETLEMQIMQVLGKARDRTGEIAGRHLGMDNSAVVMAVSGARGSMLNLTQMAGCLGQQSV
FT                   RGERIMRGYEDRTLPHFRRNERGAEAHGFITNSYKSGLSPTEFFFHAIGGREGLVDTAV
FT                   RTSQSGYLQRRMINALQDLKVAYDGTVRTTGGRIIQFRYGEDGTDPGRSSYGAPVDVKG
FT                   IIESVLKEEVK"
FT   gene            280118..281290
FT                   /locus_tag="Memar_0301"
FT   CDS_pept        280118..281290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0301"
FT                   /product="SSU ribosomal protein S2P"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: mhu:Mhun_0053 DNA-directed RNA polymerase,
FT                   subunit A''; TIGRFAM: DNA-directed RNA polymerase, subunit
FT                   A''; PFAM: RNA polymerase Rpb1, domain 5"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56235"
FT                   /db_xref="GOA:A3CS85"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012757"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS85"
FT                   /protein_id="ABN56235.1"
FT                   /translation="MNSDMEQRIDSLDLPYRTREDLKASLADRDVTEEEFEQILEMVFS
FT                   EYQKSRIEPCEAVGVVAAQSIGEPGTQMTMRTFHYAGVAEINVTLGLPRLIEIMDARRE
FT                   PSTPTMAVHLLDDWAFNRDRAREVSWQIEAAPLHEFGDITIDMENMQVLVMLNKAVCDR
FT                   RKISIDEILEAGPRKMREKRHFRDFDVEGDPKRASITFTPKNRESYQNLFQLAEHVRHV
FT                   IVQGIDDIERVVVRKEGGEYILYTEGSNLKDVFEVEGVDTSRTRSNNISEIADVLGIEA
FT                   GRNAIIQEALSTLNEQGIGVDVRHIMLVADMMCMEGEVKQIGRHGIAGEKESVLSRAAF
FT                   EVTVNHLLDAAIANEVDELNGVTENVIVGQPIQLGTGDVKLIAKPINLKI"
FT   gene            281302..281589
FT                   /locus_tag="Memar_0302"
FT   CDS_pept        281302..281589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0302"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   mhu:Mhun_0054 ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56236"
FT                   /db_xref="GOA:A3CS86"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS86"
FT                   /protein_id="ABN56236.1"
FT                   /translation="MDFNASLRKAVKTGTVFLGRNKTRESIEAGKAKLVVVARNSPESV
FT                   KNLVNEIDIPVYAYEGSSVQLGKACGMPYVVSALAVIEPGESDILSAARV"
FT   gene            281593..282042
FT                   /locus_tag="Memar_0303"
FT   CDS_pept        281593..282042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0303"
FT                   /product="NusA family KH domain protein"
FT                   /note="TIGRFAM: NusA family KH domain protein; PFAM: KH,
FT                   type 2 domain protein; KEGG: mhu:Mhun_0055 NusA family KH
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56237"
FT                   /db_xref="GOA:A3CS87"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS87"
FT                   /protein_id="ABN56237.1"
FT                   /translation="MPQVTLTEECMRLISQFESLTGAGSRDCIVDNRNERIIFVINPGD
FT                   MGLAIGKSGSSIKKASDVMGKRIEVVEYSADPSQFLRNCFLPAQVTGIDFDTDEEDQQI
FT                   ALIDVRDEDRGLAIGKAGKNIFKAKVLAQRQHDIADVQLMQNDSA"
FT   gene            282205..283671
FT                   /locus_tag="Memar_0304"
FT   CDS_pept        282205..283671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56238"
FT                   /db_xref="GOA:A3CS88"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS88"
FT                   /protein_id="ABN56238.1"
FT                   /translation="MNGVPARIVKPALAAAEPANRVRGVPGPRRAAPLRSLLLAIVVLV
FT                   LCIGMLAPLASALPGSDENGTADAPGEKLADKKAPITPAESLDPEEQDEKILSNSTGAT
FT                   VGNGNETADAETNGTLTAAPSQNATTTTEPTATKTAVADDKKKKKSANPTPTLERYAPP
FT                   RPSATMAKSHYSQDRPLVQSDHQMILPGSSYTPEENETGIPSAVAVPRDGLLVRGIGVL
FT                   LDRTPEDVVLTRSGVEIANLDWLLDPAMRLGSRHPRAVLEGETFTVIVTVEARNVTVTE
FT                   ENPAYVVLVPPPDETGVYEITRTREFQTLGDGERGVWEFTVVTRTGRLTLANLTLPEER
FT                   LVTNLTSNPNLFAFQAYALAGDQEVPSSGFSDPVLAIRPEGDAGAAEESSLPGLYALSG
FT                   VENSTLSPSETMAGAWARGVDHDAIVAAAVGDLEILNGLGKEELAAIYDLEGGGEGGAG
FT                   GDPSASSPSIFDQIMEFFRGLFGMNQERAS"
FT   gene            complement(283733..284770)
FT                   /locus_tag="Memar_0305"
FT   CDS_pept        complement(283733..284770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0305"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /note="KEGG: mta:Moth_0877 pyruvate formate-lyase
FT                   activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56239"
FT                   /db_xref="GOA:A3CS89"
FT                   /db_xref="InterPro:IPR014846"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS89"
FT                   /protein_id="ABN56239.1"
FT                   /translation="MIDLKTPLLAIDVGRGTQDILVYEPGRAVENSIKLVLPSPTVVAA
FT                   AKIREATRAGRPVFLDGYLMGGGANTGAIRKHLAADLPVYATPKAALTLHDDPERVRAL
FT                   GVEIRTAPPGDAAVVRTTDYMEPELRQALSLFGVDYPQNVAIAVQDHGYSPHRSNRIHR
FT                   FELMRERLDAGDWDLLSLASDPPIADMTRMQAVLSQAPGAFVTDTGPAALIGALCDPQV
FT                   RRMAKTGVTLVNAGNGHTLCFTLKGREIHGLFEHHTGALDPAKLQDYIRRLADGTLTTE
FT                   EVFDDGGHGAAIRKPLATGAVAVTGPNRLRLLPEAYQAAPFGDMMLSGCFGLAYLWKRF
FT                   REPTL"
FT   gene            complement(284983..286953)
FT                   /locus_tag="Memar_0306"
FT   CDS_pept        complement(284983..286953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0306"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: mhu:Mhun_2811 ribonucleoside-triphosphate
FT                   reductase, anaerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56240"
FT                   /db_xref="GOA:A3CS90"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS90"
FT                   /protein_id="ABN56240.1"
FT                   /translation="MLGLQSLSGPLIREIVNMTLLERGLVPYRNVCTRVGTPVFDAHLI
FT                   DVGRGFEAHDNANLQENAETSHKKKADKISKEQYLLQLPPDLADHHLRGDLHIHDLEYF
FT                   GTRPFCQDWDLRYFLYYGLMPDGNGTKASVAGPAKRAEVAVLHAVKALGSAQTNFAGGQ
FT                   GYYNFLTFMAPFFEGMDYEEIKQLMQMFVYEMTQMMVARGGQVVFSSVQLSPGVPTLWK
FT                   DKPCVYRGKVWNGEQAPLRTYNEFEREVRLLFKALMEVMLEGDYWGKPFSFPKPEISIE
FT                   PDFLNEDEEFNREHPDLPTYQDLYLMTFELASKYGTPYYDNQIPPYRGAGEGISCYQCC
FT                   AYQFSSLADEDDEFEDKLYFREGKHFSMGSWMVMSINCPRAAYKAEGDQERLFAELKAL
FT                   MDTAVELFRIKRRWMSHIRTNGRMPFAMQRPKDPNTGERGAVAVDLEGLVYTIGVVGVN
FT                   EMVQHFTGHQLHESRDAFRLAVRAMTELEMYARELSQKHNMTIALARTPAETTGQRFAV
FT                   ADLLDERFRDHAIRVVKGDADAALDTLGTTLDLPIYYTNGTHIAPGAPVPLTKRIEIEH
FT                   IFFPIVDGGNIFHVWLGEARPDPRGLMEMAMNLCRTTQIGYFAFTRDLTVSLKEYRELK
FT                   PARPDTGKTAGTSPAADRAGA"
FT   gene            complement(286964..287314)
FT                   /pseudo
FT                   /locus_tag="Memar_0307"
FT   gene            287670..288032
FT                   /locus_tag="Memar_0308"
FT   CDS_pept        287670..288032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0308"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   mhu:Mhun_1617 roadblock/LC7"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56241"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS91"
FT                   /protein_id="ABN56241.1"
FT                   /translation="MEESAQRHIDEIQSVVGVAACALVSSEGRILGKRFPEGDLTSSLC
FT                   AAMCATVLASAEAACGSVNMERPFLVTVTSADATILIVSVGEAALITAVIDKSADLPTV
FT                   QRQLLDIAVRIGEEEA"
FT   gene            288032..288667
FT                   /locus_tag="Memar_0309"
FT   CDS_pept        288032..288667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0309"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   mhu:Mhun_1618 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56242"
FT                   /db_xref="GOA:A3CS79"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="InterPro:IPR040541"
FT                   /db_xref="PDB:3C3M"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS79"
FT                   /protein_id="ABN56242.1"
FT                   /translation="MYTILVVDDSPMIVDVFVTMLERGGYRPITAFSGEECLEALNATP
FT                   PDLVLLDIMMEPMDGWETLERIKTDPATRDIPVLMLTAKPLTPEEANEYGSYIEDYILK
FT                   PTTHHQLYEAIEHVLARRHSIAADIERAREAGVDSHLVDEYERLAKSVDINRRLLKILE
FT                   TTYSIKDARAGMGEDITRAIKSMAVSIKIQEERLNQVRNQFEELFVAR"
FT   gene            complement(288751..289182)
FT                   /locus_tag="Memar_0310"
FT   CDS_pept        complement(288751..289182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56243"
FT                   /db_xref="GOA:A3CS80"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS80"
FT                   /protein_id="ABN56243.1"
FT                   /translation="MIPSKSHADKAISAISWVTLGIYLLIAISLSLLAIFSFYDVVLQV
FT                   AALIHAEDMTQGILGVLHALLLTLIIVEILETVTAYFRTNKVLVTPILIAGITAMVRRV
FT                   LTFGVEPVEPIDIGMTLAAILVLTTAIVYIGKRERADGY"
FT   gene            289372..289445
FT                   /locus_tag="Memar_R0005"
FT                   /note="tRNA-Lys2"
FT   tRNA            289372..289445
FT                   /locus_tag="Memar_R0005"
FT                   /product="tRNA-Lys"
FT   gene            289524..289775
FT                   /locus_tag="Memar_0311"
FT   CDS_pept        289524..289775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0311"
FT                   /product="DNA-directed RNA polymerase, subunit H"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase subunit, RPB5; KEGG:
FT                   mhu:Mhun_0049 RNA polymerase subunit, RPB5"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56244"
FT                   /db_xref="GOA:A3CS81"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS81"
FT                   /protein_id="ABN56244.1"
FT                   /translation="MGTSLDVLNHEMVPDHQIMGEEEVADLLATYHITLEQLPKIYHDD
FT                   PAVKAIGGEVGNVIRIVRDSRTAGRAEAYRLVVKRPKK"
FT   gene            289819..291360
FT                   /locus_tag="Memar_0312"
FT   CDS_pept        289819..291360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0312"
FT                   /product="DNA-directed RNA polymerase, subunit B'"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb2, domain 2; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2, domain 3; KEGG:
FT                   mhu:Mhun_0050 DNA-directed RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56245"
FT                   /db_xref="GOA:A3CS82"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS82"
FT                   /protein_id="ABN56245.1"
FT                   /translation="MSRAYFAREHVARHQLDSYNNFLLHNLQKVVDEQRVIETDIETRG
FT                   KGKEAVWVELGKVEVKKPLVREADGSQSELFPSEARLRNLTYAAPIQLEMTLVQGEEAQ
FT                   DPIVTTIGQLPVMVGSAACNLYNMSDPERIEHGEDPLDPGGYFVVNGTERVLMTLEDLA
FT                   SNKIMTEFTERYNERIYVAKVFSQYRGYRALVIVERNRKNLLEVSFPSVAGHLRFIDLM
FT                   RALGLQGDHDIVEAVSTDEEILTFMMQNLEEGECDTVDEGVMYVGKKLAPNQTRDYQRK
FT                   RAEFVLDNYLLPHLNYLMPVGLKEEDPGYRTAVEGVRLAKAHFLGRMAEACFDLVLDRR
FT                   RIDDKDHYSNKRLKLAGDLMEDLFRISLNRLTRDVKYQLERASMRHRDLSIGTAVRADV
FT                   LTERLLHPLATGNWVGGRTGVSQLLDRVDHMAVLSHLRRVISPLSRSQPHFEARDLHPT
FT                   QWGRICPSETPEGPNCGLVKNFAQMVEISKGVINEEEVKNILYDMGVIALRRETA"
FT   gene            291357..293171
FT                   /locus_tag="Memar_0313"
FT   CDS_pept        291357..293171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0313"
FT                   /product="DNA-directed RNA polymerase, subunit B'"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb2, domain 6; RNA polymerase
FT                   Rpb2, domain 7; RNA polymerase Rpb2, domain 4; RNA
FT                   polymerase Rpb2, domain 5; KEGG: mhu:Mhun_0051 DNA-directed
FT                   RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56246"
FT                   /db_xref="GOA:A3CS83"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019969"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS83"
FT                   /protein_id="ABN56246.1"
FT                   /translation="MRQSRVFVDGALIGLVDDPRELVERMREMRRHGEISSEVNVSYKD
FT                   FNNDVIIHTDRGRARRPLIVVKGGVPQVTDDDIERLRNGETIFEDVARKGAIEFVDAEE
FT                   EEDLFIAINEADLTPEHTHLEIDPSLILGIGAAHVPFPEHNASPRVTMGAGMVKQALGF
FT                   AASNMKLRPDTRGHMLHYGQKPLTFTQTSDVIGSDDRPAGQNFVVAIISYEGFNIEDAL
FT                   IINKASIDRGLGRSHFFRTYDGEERRYPGGQVDRIEIPDEEVSGAHGAEFYANLDIDGV
FT                   INPETVVREKDVLIGKTSPPRFLEEPTSELIAVEKRRDTSVTMRSNEHGIVDTVIITEG
FT                   ENSSRLVKVRTRDLRVPEVGDKFASRHGQKGVIGLIQPSADMPFTESGMTPDLIINPHA
FT                   VPSRMTIGHMLEMLGGKVGSLEGHRINATAFRGERETALRSSLKELGFSHNGREVMYDG
FT                   ITGRQFAADIYIGVIYYQKLYHMVSSKMHARSRGPVQVLTRQPTEGRAREGGLRFGEME
FT                   RDVMIGHGAAMALKERLLDESDKVTQWVCAKCGMVAMVDRKRKVTRCLACGGETDIYPV
FT                   EMSYAFKLLLDEMKSMGIAPRLRLDDMV"
FT   gene            293193..295841
FT                   /locus_tag="Memar_0314"
FT   CDS_pept        293193..295841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0314"
FT                   /product="DNA-directed RNA polymerase, subunit A'"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: mhu:Mhun_0052 DNA-directed RNA polymerase,
FT                   subunit A'; TIGRFAM: DNA-directed RNA polymerase subunit
FT                   A'; PFAM: RNA polymerase, alpha subunit; RNA polymerase
FT                   Rpb1, domain 3; RNA polymerase Rpb1, domain 1; RNA
FT                   polymerase Rpb1, domain 4; SMART: RNA polymerase I subunit
FT                   A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56247"
FT                   /db_xref="GOA:A3CS84"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS84"
FT                   /protein_id="ABN56247.1"
FT                   /translation="MTSPKRVGRIEFGLFSPKEIRKMSVRKIIWADTYDDDGFPYPQGL
FT                   MDLNLGVIDPGLRCKTCDQKAADCPGHFGHIELAKPVIHVGYTRLIRKLLRVTCRSCSR
FT                   LLMTSEEVEKIIGPEDSELAGEIVSEKDIKKERVCPHCGEQQLKINFEKPTTFSEVFVE
FT                   DGRKVEHKLTPADIRARLERIPDDDLRALGVNPDVARPEWTILTVLPVPPVTMRPSIIL
FT                   ENGQRSEDDLTHKLVDIIRINQRFKENQDAGAPQLIIEDLWELLQYHVTTYLDNEVAGC
FT                   PPARHRSGRPLKTLSQRLKGKEGRFRGSLSGKRVNFSARTVISPDPNLSIGEVGIPLAI
FT                   ANEMTLPIRVTTFNIEEMRQYVLNGPERPTIRSPCGANYAIRPDNRRMRLSDANLETVA
FT                   EMIEPGWTVERQLKDNDIVLFNRQPSLHRMSIMAHRVVVMDGKTFRLNPAVCPPYNADF
FT                   DGDEMNLHIPQTEEARAEAEILVSVSSNILSPRTGGPIIGGIHDHISGIFLLTHTVRHF
FT                   SKEEVLYLTQHLPVEHLPEPDRMDENGNPLWTNKQVFSLVLPDNLNMVFQASSCQNCET
FT                   CKREMCENDAFVRVVNGNLITGTIDKKGIGAFDGQILHRIIRQHGMKRAARFIDDVTKL
FT                   SIRGIMLEGFSFGIDDEDLTRTEYGQIDEVLDGAISDVDRRIKIYNEGQLEPMPGRTLE
FT                   ETLEMQIMQVLGKARDRTGEIAGRHLGMDNSAVVMAVSGARGSMLNLTQMAGCLGQQSV
FT                   RGERIMRGYEDRTLPHFRRNERGAEAHGFITNSYKSGLSPTEFFFHAIGGREGLVDTAV
FT                   RTSQSGYLQRRMINALQDLKVAYDGTVRTTGGRIIQFRYGEDGTDPGRSSYGAPVDVKG
FT                   IIESVLKEEVK"
FT   gene            295838..297010
FT                   /locus_tag="Memar_0315"
FT   CDS_pept        295838..297010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0315"
FT                   /product="DNA-directed RNA polymerase, subunit A'"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: mhu:Mhun_0053 DNA-directed RNA polymerase,
FT                   subunit A''; TIGRFAM: DNA-directed RNA polymerase, subunit
FT                   A''; PFAM: RNA polymerase Rpb1, domain 5"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56248"
FT                   /db_xref="GOA:A3CS85"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012757"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS85"
FT                   /protein_id="ABN56248.1"
FT                   /translation="MNSDMEQRIDSLDLPYRTREDLKASLADRDVTEEEFEQILEMVFS
FT                   EYQKSRIEPCEAVGVVAAQSIGEPGTQMTMRTFHYAGVAEINVTLGLPRLIEIMDARRE
FT                   PSTPTMAVHLLDDWAFNRDRAREVSWQIEAAPLHEFGDITIDMENMQVLVMLNKAVCDR
FT                   RKISIDEILEAGPRKMREKRHFRDFDVEGDPKRASITFTPKNRESYQNLFQLAEHVRHV
FT                   IVQGIDDIERVVVRKEGGEYILYTEGSNLKDVFEVEGVDTSRTRSNNISEIADVLGIEA
FT                   GRNAIIQEALSTLNEQGIGVDVRHIMLVADMMCMEGEVKQIGRHGIAGEKESVLSRAAF
FT                   EVTVNHLLDAAIANEVDELNGVTENVIVGQPIQLGTGDVKLIAKPINLKI"
FT   gene            297022..297309
FT                   /locus_tag="Memar_0316"
FT   CDS_pept        297022..297309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0316"
FT                   /product="LSU ribosomal protein L30E"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   mhu:Mhun_0054 ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56249"
FT                   /db_xref="GOA:A3CS86"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS86"
FT                   /protein_id="ABN56249.1"
FT                   /translation="MDFNASLRKAVKTGTVFLGRNKTRESIEAGKAKLVVVARNSPESV
FT                   KNLVNEIDIPVYAYEGSSVQLGKACGMPYVVSALAVIEPGESDILSAARV"
FT   gene            297313..297762
FT                   /locus_tag="Memar_0317"
FT   CDS_pept        297313..297762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0317"
FT                   /product="NusA family KH domain protein"
FT                   /note="TIGRFAM: NusA family KH domain protein; PFAM: KH,
FT                   type 2 domain protein; KEGG: mhu:Mhun_0055 NusA family KH
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56250"
FT                   /db_xref="GOA:A3CS87"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS87"
FT                   /protein_id="ABN56250.1"
FT                   /translation="MPQVTLTEECMRLISQFESLTGAGSRDCIVDNRNERIIFVINPGD
FT                   MGLAIGKSGSSIKKASDVMGKRIEVVEYSADPSQFLRNCFLPAQVTGIDFDTDEEDQQI
FT                   ALIDVRDEDRGLAIGKAGKNIFKAKVLAQRQHDIADVQLMQNDSA"
FT   gene            297925..299391
FT                   /locus_tag="Memar_0318"
FT   CDS_pept        297925..299391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56251"
FT                   /db_xref="GOA:A3CS88"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS88"
FT                   /protein_id="ABN56251.1"
FT                   /translation="MNGVPARIVKPALAAAEPANRVRGVPGPRRAAPLRSLLLAIVVLV
FT                   LCIGMLAPLASALPGSDENGTADAPGEKLADKKAPITPAESLDPEEQDEKILSNSTGAT
FT                   VGNGNETADAETNGTLTAAPSQNATTTTEPTATKTAVADDKKKKKSANPTPTLERYAPP
FT                   RPSATMAKSHYSQDRPLVQSDHQMILPGSSYTPEENETGIPSAVAVPRDGLLVRGIGVL
FT                   LDRTPEDVVLTRSGVEIANLDWLLDPAMRLGSRHPRAVLEGETFTVIVTVEARNVTVTE
FT                   ENPAYVVLVPPPDETGVYEITRTREFQTLGDGERGVWEFTVVTRTGRLTLANLTLPEER
FT                   LVTNLTSNPNLFAFQAYALAGDQEVPSSGFSDPVLAIRPEGDAGAAEESSLPGLYALSG
FT                   VENSTLSPSETMAGAWARGVDHDAIVAAAVGDLEILNGLGKEELAAIYDLEGGGEGGAG
FT                   GDPSASSPSIFDQIMEFFRGLFGMNQERAS"
FT   gene            complement(299453..300490)
FT                   /locus_tag="Memar_0319"
FT   CDS_pept        complement(299453..300490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0319"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /note="KEGG: mta:Moth_0877 pyruvate formate-lyase
FT                   activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56252"
FT                   /db_xref="GOA:A3CS89"
FT                   /db_xref="InterPro:IPR014846"
FT                   /db_xref="UniProtKB/TrEMBL:A3CS89"
FT                   /protein_id="ABN56252.1"
FT                   /translation="MIDLKTPLLAIDVGRGTQDILVYEPGRAVENSIKLVLPSPTVVAA
FT                   AKIREATRAGRPVFLDGYLMGGGANTGAIRKHLAADLPVYATPKAALTLHDDPERVRAL
FT                   GVEIRTAPPGDAAVVRTTDYMEPELRQALSLFGVDYPQNVAIAVQDHGYSPHRSNRIHR
FT                   FELMRERLDAGDWDLLSLASDPPIADMTRMQAVLSQAPGAFVTDTGPAALIGALCDPQV
FT                   RRMAKTGVTLVNAGNGHTLCFTLKGREIHGLFEHHTGALDPAKLQDYIRRLADGTLTTE
FT                   EVFDDGGHGAAIRKPLATGAVAVTGPNRLRLLPEAYQAAPFGDMMLSGCFGLAYLWKRF
FT                   REPTL"
FT   gene            complement(300703..302898)
FT                   /locus_tag="Memar_0320"
FT   CDS_pept        complement(300703..302898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0320"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: mhu:Mhun_2811 ribonucleoside-triphosphate
FT                   reductase, anaerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56253"
FT                   /db_xref="GOA:A3CSA3"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSA3"
FT                   /protein_id="ABN56253.1"
FT                   /translation="MRLTRKSTQATLFGEFVPTFPKVRTSRGYLLDWNRNRIVKQILEE
FT                   SRLVEVFYGYEGADEETAKDIARRVERKIQMLGLQSLSGPLIREIVNMTLLERGLVPYR
FT                   NVCTRVGTPVFDAHLIDVGRGFEAHDNANLQENAETSHKKKADKISKEQYLLQLPPDLA
FT                   DHHLRGDLHIHDLEYFGTRPFCQDWDLRYFLYYGLMPDGNGTKASVAGPAKRAEVAVLH
FT                   AVKALGSAQTNFAGGQGYYNFLTFMAPFFEGMDYEEIKQLMQMFVYEMTQMMVARGGQV
FT                   VFSSVQLSPGVPTLWKDKPCVYRGKVWNGEQAPLRTYNEFEREVRLLFKALMEVMLEGD
FT                   YWGKPFSFPKPEISIEPDFLNEDEEFNREHPDLPTYQDLYLMTFELASKYGTPYYDNQI
FT                   PPYRGAGEGISCYQCCAYQFSSLADEDDEFEDKLYFREGKHFSMGSWMVMSINCPRAAY
FT                   KAEGDQERLFAELKALMDTAVELFRIKRRWMSHIRTNGRMPFAMQRPKDPNTGERGAVA
FT                   VDLEGLVYTIGVVGVNEMVQHFTGHQLHESRDAFRLAVRAMTELEMYARELSQKHNMTI
FT                   ALARTPAETTGQRFAVADLLDERFRDHAIRVVKGDADAALDTLGTTLDLPIYYTNGTHI
FT                   APGAPVPLTKRIEIEHIFFPIVDGGNIFHVWLGEARPDPRGLMEMAMNLCRTTQIGYFA
FT                   FTRDLTVSLKEYRELKPARPDTGKTAGTSPAADRAGA"
FT   gene            complement(302895..303056)
FT                   /locus_tag="Memar_0321"
FT   CDS_pept        complement(302895..303056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0321"
FT                   /product="glutaredoxin-like protein"
FT                   /note="KEGG: mhu:Mhun_2810 glutaredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56254"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSA4"
FT                   /protein_id="ABN56254.1"
FT                   /translation="MASAEALTELRINGVFVQEAPVLQKGDAFYTSAELFSGGAFQENL
FT                   VADLIAEA"
FT   gene            303399..303938
FT                   /locus_tag="Memar_0322"
FT   CDS_pept        303399..303938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0322"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: 2',5' RNA ligase;
FT                   KEGG: mhu:Mhun_2809 2',5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56255"
FT                   /db_xref="GOA:A3CSA5"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSA5"
FT                   /protein_id="ABN56255.1"
FT                   /translation="MVRTFVAIDLPEEIRERARESQEILRRSSGRLAIVDPANLHLTVK
FT                   FLGEVDPAQVDPVVEALRAVHADPFSLTVGYAVCNPPRKPRVIWCDVTDGGESAVLARQ
FT                   VDALLAPLGFPRETRPFRPHVTLARVKEFHPSQCREAASTPREPLGTCRVTGIKLKKST
FT                   LTPRGSIYEDLAEVVF"
FT   gene            303935..305308
FT                   /locus_tag="Memar_0323"
FT   CDS_pept        303935..305308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0323"
FT                   /product="tRNA adenylyltransferase"
FT                   /EC_number="2.7.7.72"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: mhu:Mhun_2808 tRNA adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56256"
FT                   /db_xref="GOA:A3CSA6"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR008229"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR015329"
FT                   /db_xref="InterPro:IPR042090"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSA6"
FT                   /protein_id="ABN56256.1"
FT                   /translation="MTRCPCEEEVLNRIRPTPEERTYVRTMGQQLIEAVERSGKAKAMM
FT                   VGSVARDTFVRGDRDLDIFMLFDPALSREELQEQGLSLAHRIAEEFGATWREKYAEHPY
FT                   VNATIDSLDIDLVPCYAVASATEIKSAVDRTPFHTRYILGHIGGYADDVLLFKQFAKSG
FT                   GVYGSDHMTEGFSGYLCEILTIHYGGFHPLLRAAACWKPGEVIDIERHGTKEFEDPLVV
FT                   IDPVDPERNVAAALSLSRMFEFVELARGYLAEPSEAFFCRPPSPPLTREIFARLLSARG
FT                   THLFSIAFATPEYTPDTVVPQLRKSAESIRELLERSGFPVNRIDVCMGKERCMLLFELM
FT                   ADTVPVVRRHIGPPLSTRENAEKFLAKYVREEVFAGPYVEDGRYVVEVPRTFTRAVDLL
FT                   RSKTLLDVALGKHVRRSMKQGWTVKAGAECWDEEFAVFVSRFLDRASPVVRIKRLTGK"
FT   gene            complement(305337..306731)
FT                   /locus_tag="Memar_0324"
FT   CDS_pept        complement(305337..306731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0324"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mma:MM0168 hypothetical sensory transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56257"
FT                   /db_xref="GOA:A3CSA7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSA7"
FT                   /protein_id="ABN56257.1"
FT                   /translation="MSKESQPVNLYLTLGKVGVFAFVLMSVYQSMKDYFYPNMTLADSH
FT                   MHTVLFTTLLAVTAAYFVFRKQQTLLLMLTAEANERRVTGEALQKSEEKFRSIVEMANE
FT                   GILQIDSRYMITYANRTMAGMLGYSVEEMLGRPLTDFLFAEELDAHRNRMAAREQGLDG
FT                   RYECRLRHRDGSARWVLVSATARKDEDGRFAGSFAMFTDITERKQTEEALQRHTEDLAR
FT                   LHRELDSANREANLYLDILTHDIRNTENVANLYTELLIETLDGDSRTYMEKLQRSIRKS
FT                   IEILGNVSTIRRIHQPSGGHKRVDLDTVIRDEIAQFPEIAIHYEAVDRQVLADDLLSEV
FT                   FSNLIGNAVKFGGSGVEITVRVEDEDGFVRISVEDTGPGVPDDQKREIFHRYEKRRRGV
FT                   GEGLGLFLVQVLIERYGGRIWVDDRVPGTTEAGAAFRFTLQKVVRDEPGAPADGDVQGC
FT                   RVPLIG"
FT   gene            307165..307404
FT                   /locus_tag="Memar_0325"
FT   CDS_pept        307165..307404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56258"
FT                   /db_xref="GOA:A3CSA8"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSA8"
FT                   /protein_id="ABN56258.1"
FT                   /translation="MVLLVFSAALGTFLILVYFRDVQDRFVREGALLGGVWLLINRALD
FT                   AAVLLPLLGMDAGTYMGEIGLCYLMIPIIALGIG"
FT   gene            complement(307578..307826)
FT                   /locus_tag="Memar_0326"
FT   CDS_pept        complement(307578..307826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56259"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSA9"
FT                   /protein_id="ABN56259.1"
FT                   /translation="MRVPEGYPHSKPFGFLMLLPGRQSQLEDLRVSHAPAGTAVATHTY
FT                   GAQTPVLTDRRNPHLRCSNSGPNGPSQPTPTVLKLRS"
FT   gene            complement(307828..308577)
FT                   /locus_tag="Memar_0327"
FT   CDS_pept        complement(307828..308577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0327"
FT                   /product="daunorubicin resistance ABC transporter, inner
FT                   membrane subunit B"
FT                   /note="TIGRFAM: daunorubicin resistance ABC transporter,
FT                   inner membrane subunit B; PFAM: ABC-2 type transporter;
FT                   KEGG: mhu:Mhun_1528 ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56260"
FT                   /db_xref="GOA:A3CSB0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR005942"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSB0"
FT                   /protein_id="ABN56260.1"
FT                   /translation="MDIVYTIWLRNVKRYLRSKSRIVGSLGMPLFFMLVLGFGLNSIVS
FT                   IPGVEEGYLEFIIPGIVAMSVLFTSVFSGIQIIWDKQFGFLKETLVAPVSRLEIMIGQT
FT                   LGGATTAVIQGLILMVFALFIGLQPAGISGFLVAVGFMALIGVTFTAFGIAIASRMEDM
FT                   HGFQLIMNFVIFPIFGLSGALFPINSLPDWLRPLTLADPLTYGVEGIRYGLSGTAQIHP
FT                   LASLAVMAACAVLMTVAGAYLFRKIQT"
FT   gene            complement(308580..309599)
FT                   /locus_tag="Memar_0328"
FT   CDS_pept        complement(308580..309599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0328"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: mbu:Mbur_0389 daunorubicin resistance ABC
FT                   transporter, ATPase subunit; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56261"
FT                   /db_xref="GOA:A3CSB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSB1"
FT                   /protein_id="ABN56261.1"
FT                   /translation="MDCSTTPLQRTPDQAIDARNLTKSFGDLVAVDGISFSIASGEIFG
FT                   LLGPNGAGKTTTISMLSTMQKPTSGTATVNGHDVVTREDDVRKSIGIVFQDQSLDEELT
FT                   AYENMDFHGRLYRISGEERRRRIGELLTLVGLADRKDDLVKTYSGGMRRRLEIARGLLH
FT                   EPKVLFLDEPTLGLDPQTRNHLWEYIARLNDEKGITIILTTHYMEEADRLCDRIAIIDR
FT                   GTIVALDTAENLKASIGGDVVTITSPDPGAIAEILTAPWVSGIERHDGSVTIRLQEADR
FT                   HIPGIVTAIHQSGVGITSLSVRKPTLEDVFLHYTGRTIRDEEADGKETIRMFQRARRR"
FT   gene            complement(309603..309863)
FT                   /locus_tag="Memar_0329"
FT   CDS_pept        complement(309603..309863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0329"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: dsy:DSY3700
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56262"
FT                   /db_xref="GOA:A3CSB2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSB2"
FT                   /protein_id="ABN56262.1"
FT                   /translation="MFHNHHHRHDHSGRKHIFGTVKVGERGQIVIPKEAREIFDIKPGD
FT                   TLMVLGDEGRGLAVVKADKFRRIAEEMLRMFEVEPEEPPEE"
FT   gene            complement(309872..310471)
FT                   /locus_tag="Memar_0330"
FT   CDS_pept        complement(309872..310471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0330"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mac:MA4527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56263"
FT                   /db_xref="GOA:A3CSB3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSB3"
FT                   /protein_id="ABN56263.1"
FT                   /translation="MPEPAPGSESAHNSAEQADRVPDLYFRLMSLTIRIRDHFRPPARL
FT                   LTEFGIREGMTVVDYGCGPGSYVKGASGLVGAAGTVYAVDVHELAVKAVSHRSRKEGLR
FT                   NVIPVLANGYDSTLPDAAADLVYALDMFHLVERPEAFLAELRRITKPDGTLVLDDGHQS
FT                   REKTRRALLDSGVWSIEAETGEYLRCRLLSGNTPMR"
FT   gene            complement(310681..311700)
FT                   /locus_tag="Memar_0331"
FT   CDS_pept        complement(310681..311700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0331"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; KEGG: mac:MA4220 coenzyme
FT                   F420-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56264"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSB4"
FT                   /protein_id="ABN56264.1"
FT                   /translation="MEMKTFKDLKSEVWDTELCSGCGACVAVCPADALRFEPGNTDTPV
FT                   NIGYCKAENDGVPCGACYAACPRVDLAAQGKMLGPYEDIVAARAVFPVERKQSGGAVTA
FT                   ILVNALDEGLIDAVVTVTRDPWTMKPSSAVITSSEELVQHAGSRYSWWVPLLASLKEAV
FT                   VTRKYRRVAVVGVPCVARATQAIRASDHELLRPYAKAIRLVIGLFCTETFDYAKLVEGK
FT                   LQSEKKIEPWEIRHLDIKGKLDVYLQDERHISIPLAELEESVRPGCRVCNDFTAVNADV
FT                   SAGAVGSPDGYTTLVIRNDIGRGFVDRAVWQGKLATGSAVDLPVIEQLAARKAQRRQE"
FT   gene            complement(311706..312443)
FT                   /locus_tag="Memar_0332"
FT   CDS_pept        complement(311706..312443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0332"
FT                   /product="glutamate synthase (NADPH) GltB3 subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="PFAM: glutamate synthase, alpha subunit domain
FT                   protein; KEGG: mma:MM0968 glutamate synthase, large chain"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56265"
FT                   /db_xref="GOA:A3CSB5"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="InterPro:IPR035710"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSB5"
FT                   /protein_id="ABN56265.1"
FT                   /translation="MAKQVTIDAKGVHYTPLNQQIRKAIEDGADEIVVDNVLGQRFIGD
FT                   GLRGNATIRVNGVAGGDLAMFMSGPTVIVDGNAEHAPGNTMDSGKVVIHGSAGDAVAHS
FT                   MRGGKVFVRGDIGYRGGIHMKQYETQRPILVVGGSAQTFLGEYMAGGLLVVLGLDGAMK
FT                   AREIGSGIHGGEIVIRGDVDDACLAAGAKKLPVTDEDRARIAPVIREFAADFGLDAEPL
FT                   VKANYTRIVPASARPFAGKYTWE"
FT   gene            complement(312449..313966)
FT                   /locus_tag="Memar_0333"
FT   CDS_pept        complement(312449..313966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0333"
FT                   /product="glutamate synthase (NADPH) GltB2 subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; ferredoxin-dependent glutamate synthase; KEGG:
FT                   mac:MA4218 glutamine-pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56266"
FT                   /db_xref="GOA:A3CSB6"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSB6"
FT                   /protein_id="ABN56266.1"
FT                   /translation="MSSNFGSMPLRYRISIDREQCMECGRCVENCSYGVFRWDGNRILI
FT                   NSRNCTACHRCLTYCPRDAIMLQEHPCDYRSHPVWTRSVRESIYNQARTGKIILAGMGS
FT                   VSNLPIIFDHLMLDACQVTTPPTDPLREPVELRTYLGKKPSKLEFRQKPNGDVELSTEL
FT                   TPNLMLETPIMLGHMSYGALSLNAHVAMARAAKETGTFMGTGEGGLHPGLYPYQDRMIV
FT                   QVASGRFGVNIDYLERGAAIELKLGQGAKPGIGGHLPGEKVSADVSRTRMIPEGSDAIS
FT                   PAPHHDIYGIEDLPQLVNSVKEATERKKPIFAKIAAVNNNAENVAAVARSGVDAIAIDG
FT                   FRGGTGAAPRVFRDHVGIPIEVAIATADRELRKQGLRNEVSLIACGSIRESTDVVKAIA
FT                   LGADAVYIATAALAAMGCRVCGNCYQGLCPWGIATQRPDLVARLDPDVASKQVANLIHA
FT                   WTLEITELMGAAGINSIESLRGNRDRLRGYMLDEGLLEILDVKSVGA"
FT   gene            complement(313963..315015)
FT                   /locus_tag="Memar_0334"
FT   CDS_pept        complement(313963..315015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0334"
FT                   /product="glutamine amidotransferase, class-II"
FT                   /note="PFAM: glutamine amidotransferase, class-II; KEGG:
FT                   mhu:Mhun_0780 glutamine amidotransferase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56267"
FT                   /db_xref="GOA:A3CSB7"
FT                   /db_xref="InterPro:IPR012375"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSB7"
FT                   /protein_id="ABN56267.1"
FT                   /translation="MCGIFGVMDKRRQMMDGSGIREALSIMNERGSGEGAGYVAYGIYP
FT                   DYRDCYALHVFFDNPGKSKAVVDATLEQWGTIEHDEAIPTCDQPNLKVNCTPWRYFFKP
FT                   DASLAPGSASPEKDVVTSIVMQINASANGAEIVSSGKNVGLFKASGWPEDVADYYRIQD
FT                   YEGYIWLAHNRYATSNPELWERPDPFNLHDWSVVENGKITTYGANRRYVESFGYNCSTG
FT                   TDSEVIAYLIDLLTRKHGLGIDLAIRALAPPYWDEIDGMPEAEQNLNRALRFAYGSATM
FT                   NGPFTVVAANPDTMIGFTDRGKLRPMVVGECGDRLYIASEETAIRAMEPCVESIRRPAA
FT                   GEPVIGRVAP"
FT   gene            315118..316446
FT                   /locus_tag="Memar_0335"
FT   CDS_pept        315118..316446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0335"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: mhu:Mhun_0779 glutamine synthetase, type I;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase, catalytic region; glutamine synthetase,
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56268"
FT                   /db_xref="GOA:A3CSB8"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSB8"
FT                   /protein_id="ABN56268.1"
FT                   /translation="MSRDATSAMLERIEQDNVRFLRLQFTDLLGMPKNVAIPVKQAEKA
FT                   LTTGIGFDGSSIEGFVRIEESDMVLKPDLSTYTLLPWRSGDYAEARFVCDVYKASGKPF
FT                   EGDPRYVLRRAMEDAAKDGYVFNTGPELEFFLFRMHEGRPTTQFQDVGGYFDLAPTDLA
FT                   EDVRREIILALTEMGFEIEASHHEVAESQHEIDFKYSDALHTADNVISFKFAAKTIALM
FT                   RGLHASFMAKPIYGICGSGMHTNCSLAKNDKNAFYDPEAPLQLSRTCMHFIGGLLKHAK
FT                   AITRLANPTVNSYKRLVPGYEAPCYVSWSAGNRSALVRVPSPRGNSTRVEFRSPDPTCN
FT                   PYLAFAAMLTAGMEGVRERIEPPVGVDTNIYHMSVEERKGAGIETLPGDLYEANQALLA
FT                   DDLICRAFGSHVVEALTSVAEAEWDAYRTAVHPWELDRYLATY"
FT   gene            complement(316529..316846)
FT                   /locus_tag="Memar_0336"
FT   CDS_pept        complement(316529..316846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56269"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSB9"
FT                   /protein_id="ABN56269.1"
FT                   /translation="MDYSRILAGRGEGLPVFARVVEALEEFEEFPFLLEPIYREASELG
FT                   DDDLDRLRFGLVRLQVYADIHRYEDMETAQRMKYVAATIERVLFGKLLLEGEEDGKQQC
FT                   C"
FT   gene            complement(316848..317750)
FT                   /locus_tag="Memar_0337"
FT   CDS_pept        complement(316848..317750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0337"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   mhu:Mhun_0907 ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56270"
FT                   /db_xref="GOA:A3CSC0"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSC0"
FT                   /protein_id="ABN56270.1"
FT                   /translation="MTQTNEPNKETCTGNCSSCPSTTKCDDPRNADAQKGLPPKADVSV
FT                   KHVVLVLSGKGGVGKSTVSANLAYALANRGFNTGLIDLDIHGPDIPKMLGIEEARLQSY
FT                   DGKIIEPVKVTGNLAVISMAFLLPERNTPVIWRGPMKMTVIRQFLEDVNWGDLDYLIVD
FT                   LPPGTGDEALTVAQLAPNIAGAVIVTTPQDVAVLDSSKAAEFIKKLELRVLGIVENMSG
FT                   FVCPHCKEEIDIFGRGGGKKEAEQLGVPFLGSIPLDPEMRKAADEGRPFIIRKAGAEES
FT                   PTWKSFDAIMQALVDQIEE"
FT   gene            complement(317890..318168)
FT                   /locus_tag="Memar_0338"
FT   CDS_pept        complement(317890..318168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0338"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /note="TIGRFAM: MoaD family protein; PFAM: thiamineS
FT                   protein; KEGG: mtp:Mthe_0009 MoaD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56271"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSC1"
FT                   /protein_id="ABN56271.1"
FT                   /translation="MRVKVRAFAMLREIIPAEYDVKLPGGSTVGDLLDHLSTRHPGLGD
FT                   ALFTSAGELAPYVNILTNGRNIHFSGGLETPLEDSDTVALFPPAGGG"
FT   gene            318356..320155
FT                   /locus_tag="Memar_0339"
FT   CDS_pept        318356..320155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0339"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="PFAM: aldehyde ferredoxin oxidoreductase; Aldehyde
FT                   ferredoxin oxidoreductase-like; KEGG: chy:CHY_0789 aldehyde
FT                   ferredoxin oxidoreductase, tungsten-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56272"
FT                   /db_xref="GOA:A3CSC2"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSC2"
FT                   /protein_id="ABN56272.1"
FT                   /translation="MNGYAGKILHVDLAREQTMEEPFPEEWKRAYIGGRGLGVRIIGDL
FT                   VNPGSDPLGAENVLVFATGPVAGSGLPLGSRYDVVTKSPLTGTLTSANSGGKFGTSMKR
FT                   AGYDAVVIRGRAQRPVYLLLDDGHAEVRDASELWGLTTSETTSAIQNDLNDPGASVACI
FT                   GPAGERLVRIAGVINETSRAAGRGGVGAAMGSKNLKALAARGSGRCTVADRDRFLALKS
FT                   DIAEKIRENAISGGGLPRFGTAVLVNIINENYILPVRNFQIAHFPAAENVSGERMADTI
FT                   LTGKMGCQGCVIQCGRDVEVEGKRTAGPEYETIWAFGPDCGIDDLAAVVKANNLCNDLG
FT                   LDTISTGSTIACAMELSEKGYIDEEVRFGDAEQMLDLVHRIGYRDGIGDELAEGSFRFA
FT                   RRHGHPELSMSVKRQELPAYDPRGLQGHGLAYATSVRGGDHVYAYLIAPEVLGSPEKLD
FT                   PYSSEGKAVWTKTFQDLTAFIDSSGSCLFTSFPLGAADYGAMVSAVTGYDIDAGEVLRI
FT                   GERIWNLQKVFNIRAGCTREDDTLPPRLLREPLTEGAPKGRVWEREPLLDEYYRVRGWD
FT                   REGRPTPEKLRDLGIGEEAVAAP"
FT   gene            complement(320162..320599)
FT                   /locus_tag="Memar_0340"
FT   CDS_pept        complement(320162..320599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0340"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   afu:AF0241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56273"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSC3"
FT                   /protein_id="ABN56273.1"
FT                   /translation="MTAIECIPIGAVRSPYRERGDAPRQGRLADTVAEIHVLDAYVPGL
FT                   EGLERSSHLIILYWLDRAERGLLFAKPPGETRERGVFSTRSPARPNPIGLGIVDLVRRE
FT                   GNVLVVRGLDALDGTPVLDIKPYSPEIDCIPEATGGWHIKK"
FT   gene            complement(320604..321032)
FT                   /locus_tag="Memar_0341"
FT   CDS_pept        complement(320604..321032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0341"
FT                   /product="ribonuclease H"
FT                   /note="PFAM: ribonuclease H; KEGG: mhu:Mhun_1437
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56274"
FT                   /db_xref="GOA:A3CSC4"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSC4"
FT                   /protein_id="ABN56274.1"
FT                   /translation="MTKTDAVTLYTDGASRGNPGDAAWAYVIVRDGSVVAGRSGYIGTA
FT                   TNNVAEYHAVINGLDAAREFTGGRLEVRSDSELVVRQLTGRYRITKEHLAGLAEEVRRR
FT                   MRHFAEVRFESVPREHPCIQVADRLCNETLDAERRGRR"
FT   gene            321209..321877
FT                   /locus_tag="Memar_0342"
FT   CDS_pept        321209..321877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0342"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: ana:all1995
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56275"
FT                   /db_xref="GOA:A3CSC5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSC5"
FT                   /protein_id="ABN56275.1"
FT                   /translation="MRDRLSVFENRTDAGRQLAAPLSSLEMAAEPVICAIPAGGVPPGL
FT                   EVARALKAPLRMAVVRKVQVPWDPEAGFGAVTWNGRVFLNQPLMSALDLSETEVNAAVA
FT                   KAKKNVEERIEKFAGGREEPGIRDQTAILIDDGLATGYTMFAAIEAARAGSPREIIVAV
FT                   PTGSLHAVNFIARKVDLVVCLNVRTSPTFAVAQAYERWHDITDQEVQELLIQARDMGLF
FT                   "
FT   gene            321946..322413
FT                   /locus_tag="Memar_0343"
FT   CDS_pept        321946..322413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0343"
FT                   /product="phospholipid-binding protein, PBP family"
FT                   /note="PFAM: PEBP family protein; KEGG: mhu:Mhun_0135 YbhB
FT                   and YbcL"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56276"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSC6"
FT                   /protein_id="ABN56276.1"
FT                   /translation="MNPGIANLIVSLRSAELPVWNTCDGPDLSPELRVRGLTDEMLSMA
FT                   VFALNPFEPGCSFTTWIIWNLSPSPLVPEGIPPQDVVTAPVDAVQGTNDYGSIGWRGPC
FT                   PPPGETHRCLFKVYGLDAMLDIAPGTGKHDVIDAMRGHVLGFGETAAMYSR"
FT   gene            322471..322929
FT                   /locus_tag="Memar_0344"
FT   CDS_pept        322471..322929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0344"
FT                   /product="phospholipid-binding protein, PBP family"
FT                   /note="PFAM: PEBP family protein; KEGG: pab:PAB0765
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56277"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSC7"
FT                   /protein_id="ABN56277.1"
FT                   /translation="MTQKLVVNLDFEEFPEEYTCRGANRSPPIRVEGILPNIKSLAILA
FT                   TTSPEEGPSKVAWVLWNLPAVPLIPEGFPEGEVVESPLHAVQGTNDFGTSGYRGPCPEA
FT                   GKAEAYLFRVYALDVDLALAPGATWEEMVRAMNGSLNQSGEAIVFAMG"
FT   gene            complement(322974..323426)
FT                   /locus_tag="Memar_0345"
FT   CDS_pept        complement(322974..323426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0345"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mka:MK0525 CBS-domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56278"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSC8"
FT                   /protein_id="ABN56278.1"
FT                   /translation="MGLVKCCREQVVAVSPDTPAVEVAKIMGEKNVGSVVVVTGDNRPT
FT                   GILTDRDLAVRVMAQEKNPGEVRASEILTRDVITFQDSMGIYEAIQKMTNEGIRRMPIV
FT                   DDAGRLIGIVTMDDIVRMLGEEMAAIAKNIEKQSPPMQEAGAPIPM"
FT   gene            323548..324477
FT                   /locus_tag="Memar_0346"
FT   CDS_pept        323548..324477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0346"
FT                   /product="protein of unknown function DUF475"
FT                   /note="PFAM: protein of unknown function DUF475; KEGG:
FT                   mhu:Mhun_1043 protein of unknown function DUF475"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56279"
FT                   /db_xref="GOA:A3CSC9"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSC9"
FT                   /protein_id="ABN56279.1"
FT                   /translation="MDWLLIVLTVAGLSVFEIVSSIDNAIINADVLATMGEKARRWFLL
FT                   WGLIAAVFVVRGLLPWLIVWATNPSLGPVDALLATFSSDPAVTAAIEESAPILLIFGGT
FT                   FLVFLFFHWLFAEEKTCGLRSERFFSRQSVWFYAVVSVLLAILVWFALQINVMMGFAAV
FT                   LGSTAFFIVHGFRQNAEVQEARLRRPGMSDLSKIAYLEVLDATFSIDGVIGAFAFTLSV
FT                   PLILIGNGIGAVVVRELTVRGVDRIRSYCFLKNGAMYSILVLGTIMLADSFGFHIPAWL
FT                   SPVATFAIVGYFLYRSVQEQKTGPAGAA"
FT   gene            324563..325138
FT                   /locus_tag="Memar_0347"
FT   CDS_pept        324563..325138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0347"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: mba:Mbar_A3349 flavoredoxin Flr"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56280"
FT                   /db_xref="GOA:A3CSD0"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSD0"
FT                   /protein_id="ABN56280.1"
FT                   /translation="MTKRSIGPRTLLYPHPDLIIGTYDASGRPDAMAAAWGGICSSRPP
FT                   SVAVSVQKARQTYANLVEQREFTISIPSTDYVREADYFGIVSGRDEDKFAATNLTPVKS
FT                   DLVNAPYVGEFPVVLECRLLQTVEIGVHTQFIGEILDVKVEESVLGEDGKPDIEKLRPF
FT                   AYDSMRQEYYGFGKVLAKAFSAGKEFKK"
FT   gene            complement(325176..325340)
FT                   /locus_tag="Memar_0348"
FT   CDS_pept        complement(325176..325340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM2971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56281"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSD1"
FT                   /protein_id="ABN56281.1"
FT                   /translation="MTAIGQILCRIGLHRWGRKRGYDEYSSNVIEWEQRCERCGKRKRW
FT                   VEAKRDRRR"
FT   gene            325497..326288
FT                   /locus_tag="Memar_0349"
FT   CDS_pept        325497..326288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56282"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSD2"
FT                   /protein_id="ABN56282.1"
FT                   /translation="MAFIYYGQGVSSLYGDFVERLMSQLALRGTEITHQNIGDASSRMD
FT                   VRHTGEEGHMEITVDRENVRVSYTVDRERKEVKKGIAGAIAGAGLGGLLGGIVRGDRDV
FT                   SDVIGGALGGAAAGGAYGAYDGYESSREDRTAFAEVLAQAVKDVEDELQSIIEGQEEAR
FT                   EALRERGRQKREEDAARTEELRELLEELYGDLLAVQEEVEIAAAEGQDVKKSRTRTDRA
FT                   ETLYQEAEVALNDGNHAIVKAKAKAARAMVDGARELLDAAE"
FT   gene            complement(326315..327433)
FT                   /locus_tag="Memar_0350"
FT   CDS_pept        complement(326315..327433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0350"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mhu:Mhun_2880 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56283"
FT                   /db_xref="GOA:A3CSD3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023819"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSD3"
FT                   /protein_id="ABN56283.1"
FT                   /translation="MYYHLILTDNCNLCCTYCRGKAFTVEPPELPDIAVDEDLPVDLDI
FT                   NLADLYRFLEKDPDAVLTFYGGEPLLAADLVREIARDAPVSALILHTNGILLDRLEPGT
FT                   VNRFDTILVSIDGPEELTDAHRGERTFERIIGNLQGLMAGEFSGELIARMTVTEDTDIV
FT                   EAVRYLTENDLFSFPAVHWQMDANFWNDYHLRDYAAWVERSYNPGIRSLVEYWVETMRD
FT                   DGRVLRWYPFIDPVEDMLLSRPSVLRCGCGHANYSIMTDGHIVPCPIMVGMKDYYAGHI
FT                   ATADPLRLPVTDVGGACTACDIRDFCGGRCLYSNITNPWPEEGRRIVCGTVRNLYSALS
FT                   AALPEIRALIRDGRVRMEDFAHRKYNSCEIIP"
FT   gene            327532..327867
FT                   /locus_tag="Memar_0351"
FT   CDS_pept        327532..327867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0351"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: mhu:Mhun_0538 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56284"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSD4"
FT                   /protein_id="ABN56284.1"
FT                   /translation="MPEAKKENLAEQVIDPRDLVAYQPGSIVSRMLVYTKAGTITIFAF
FT                   DAGEGLSEHTAPYDAVLQVIDGEALITIAGKEYPMKTGDLIIMPAEIPHAVHTVTRFKM
FT                   MLTMIHA"
FT   gene            328100..330859
FT                   /locus_tag="Memar_0352"
FT   CDS_pept        328100..330859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0352"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: cation transporting ATPase
FT                   domain protein domain protein; Haloacid dehalogenase domain
FT                   protein hydrolase; cation transporting ATPase domain
FT                   protein; E1-E2 ATPase-associated domain protein; KEGG:
FT                   mma:MM0901 cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56285"
FT                   /db_xref="GOA:A3CSD5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSD5"
FT                   /protein_id="ABN56285.1"
FT                   /translation="MDTPLSPEESRTTAWHALPVDDAARRLASAAGGLTDEEVARRKEV
FT                   FGANALPQKRPPTVLEIFLRQFTSPLIYVLLAAGIISVLFVDLTDAAFIFIVILVNAVV
FT                   GTFQEVKAERSATALQQMLKIHARVRRDGREATVPAEDLVPGDRVVLESGDRVPADVRV
FT                   IRARSLTVDESLLTGESHAVGKNTDPVDVSLPLGDRQSMLYAGSTVMTGRSTGIVVATG
FT                   QNTEIGQIAETVTASEAGKPPLVIRMEDFSKKISIAVLAATGVLAIIVLGQGVPPIEVF
FT                   FLAVALAVSAIPEGLPIALTVALSIAASRMAGRNVIVRFLAAVESLGSCTLIASDKTGT
FT                   LTVNQQTARVVALPTGEMFSVTGAGYAGEGEVLDGSGGPVAGSVRDRVESLARAATISN
FT                   EAALERTDEGEWAYQGDAIDVAFLALTYKLGLDPAGIRESAPAVAEIPFESERRYAAVW
FT                   YREGGETLVAVKGAVETVLPFCRTMTAAGGGGSVPLDPDRVQEDLETLTSRGYRVLAVA
FT                   RGRAEGEVSAENPKVPPLELLGLVGFIDPIRPDVPDAVRRCRDAGVDVVMVTGDHPATA
FT                   FAIARELKITDSPDRVVTGAELGDDEVSTFLEFIDRVQGARVFARVTPLQKLRIVEAYR
FT                   ESGAYVAVTGDGVNDAPALRSANIGVAMGSGTDVAKDTASLIVTDDDFASIVAGIEEGR
FT                   YAYDNVRKVVYLLISTGFAEVLLFMLALLIGLPLPILAVQLLWLNLMTNGIQDVALAFE
FT                   GGDPRVMNRPPRRPEEGIFNRLMIEETVISGVAIALVALGAWYWLLSNGWDEFAARNLI
FT                   VLLVVLFENFHVFNCRSEYFSAFRVPISRNYFLIAGVVAAQGIHILALYVPFLQDVLQL
FT                   QPVSLVEWLSLLALASSVVIVMEVFKAVRRHRPPVHRTGTGVGEAPHR"
FT   gene            complement(330817..332724)
FT                   /locus_tag="Memar_0353"
FT   CDS_pept        complement(330817..332724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56286"
FT                   /db_xref="InterPro:IPR014441"
FT                   /db_xref="InterPro:IPR019198"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSD6"
FT                   /protein_id="ABN56286.1"
FT                   /translation="MWNRNAVLVAVLGCLVIAAIIGTALASEGGGEETQGDLLKFSSKE
FT                   EIEAFLKEHAQGVRSGNGYPWMTGTGRQETAMDAPAPTSAPPAPSAARDYSTTNVQVEG
FT                   VDEADFLKNDGRYIYVISGETLAILEAFPAEDARIVSETRIEGFPTALFLAGDRLTIFA
FT                   TGTEEIMTTVKGSVTPVPVQRAVTHAYIYDIGDRSDPELVRTRTFTGSYYDARMIRDNV
FT                   YVVTREAPVWIRDEIVLPEVRTDSGEPILPDVYRPGTPLQNYVFYTASAFSVKNDRVSP
FT                   DAETFLLGYDTTLFASQKNLYIGYRHMGTPRTAPDYTGSREETIVHRFAIDDGRIEYEA
FT                   MGRVPGHLLNQFSLDEYGENLRVATTVEGWTREGSVQYNNVYVLDPAMDVIGTLEHIAP
FT                   DERIYAARFVGDRLYLVTFKRIDPLFVIDLSDPKHPGILGKLKIPGYSDYLHPYDGDHI
FT                   VGIGKETSENDWGGVSVEGLKIALFDVSDVNNPILIHDVVIGEPGTDSEALRDHKAFLF
FT                   VKEKDLLVIPVSEIKRVENSESKYPGSYGTAAWQGAYVYRVNPAEGFVLQGTVAHAEKG
FT                   SPYTWDSPDAVRRSLFMDDTLYTVSARSIVMTDLADGSRVNEVFLPYRWGASPTPVPVR
FT                   "
FT   sig_peptide     complement(332644..332724)
FT                   /locus_tag="Memar_0353"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(333174..334109)
FT                   /locus_tag="Memar_0354"
FT   CDS_pept        complement(333174..334109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0354"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG:
FT                   sdn:Sden_3438 K+-dependent Na+/Ca+ exchanger
FT                   related-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56287"
FT                   /db_xref="GOA:A3CSD7"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSD7"
FT                   /protein_id="ABN56287.1"
FT                   /translation="MIVTFVILAVGIALLVKGADLFVGGGSGLALRYRISPALIGSTII
FT                   AFGTSLPELVVSTNAAVTGNSGIALGNVIGSNIANVALVLALCTFIRPGMVAASGASRP
FT                   ALVRHTALMLAATAAFALFALRGTLDIVAGTVFLLLFVAILAVLLREEREGGEVEIRSH
FT                   GRADALYIGLGLVAVIVGAQLVVDGAVTLAEAFGIPAFVIGVSVVAVGTSLPELATSIV
FT                   AAARDEGSISIGNILGSNIFNLLLVLGISLLLAPVTVGSLVDIAVVVLFSVAILPLLFA
FT                   RPSVVRGWSALLLLGYAAYIAWSFGAVPIG"
FT   gene            334229..334990
FT                   /locus_tag="Memar_0355"
FT   CDS_pept        334229..334990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0355"
FT                   /product="nitroreductase"
FT                   /note="KEGG: pca:Pcar_2755 nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56288"
FT                   /db_xref="GOA:A3CSD8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSD8"
FT                   /protein_id="ABN56288.1"
FT                   /translation="MFTPGARSLHGAGREFMQRTELGAQPPSDQMLGRPPPPLEVPYTR
FT                   AKTVVPLPAPGDIAIPAVDLRDAIEQRESVRNYAPEPLTLEEVAFLLWCTQGVRRVVDG
FT                   VFTLRTVPSAGARHAFETYLLVNRVEGVPPGLYRYLALEHRLAEESRDPEIKRRVAAGC
FT                   LDQPHVLESAVTFLWTAVPDRMTWRYGERGYRYLHLDAGHACQNLYLAASGVRCGVCAI
FT                   AAFDDAAMNLLLGIDGERQFLIYVATVGKKP"
FT   gene            335080..335793
FT                   /locus_tag="Memar_0356"
FT   CDS_pept        335080..335793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0356"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   mma:MM0827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56289"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSD9"
FT                   /protein_id="ABN56289.1"
FT                   /translation="MPVTFTFDEQITALEAERERLLRFPEDEFIAIIREVGFSCDCCGR
FT                   CCTREFNGHVFLLEEDTGSVRSFAPDAVVPAPDFDACDQQGRFYVSGYALRTKPDGSCI
FT                   FLEDGRCSIYDRRFAICRVYPYMLHREADETGVVDWRQIGGLNEHGCYNNPIDDAECAR
FT                   IARETRAYEAAFLDQAIRFRRALRDLFDREGLRYVRRTYDLLMRDFKKGAEVEVRVFHH
FT                   GRFEPHRVTRDVYGE"
FT   gene            335857..337644
FT                   /locus_tag="Memar_0357"
FT   CDS_pept        335857..337644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0357"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; TrkA-C domain protein;
FT                   TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: sru:SRU_1767 putative sodium-dependent
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56290"
FT                   /db_xref="GOA:A3CSE0"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSE0"
FT                   /protein_id="ABN56290.1"
FT                   /translation="METEILLTLLVVAGTAVLFISGAVRVDVAAVLVALALAWLGLVTP
FT                   AQALSGLSSSAVVAMLSVMVLGHGLDRTGVTIRIARAIVGLAGTGERRLIAAVSIVAGS
FT                   LSAFMQSVGATAVFLPSLLRVSSLSGVPASRLLLPVGYAAILGGTVSMVGAGTLIILND
FT                   LLSQQGYAPFGLFAVTPIGVPLLLAGIAFFYFFGDRVLPRREKARLSPQEELIRTWCPP
FT                   CRIFYLRVPSGSPIVGKTREEVHMISHYNLHLISLAERGEITYTPWRHTRFVAGQELGI
FT                   LGQDEDVRRFVDDFGLEWVRAGESTANVMADPNVGFAEVIVRPYGEFVGKTLRDLEFRV
FT                   TYGVEVLILLSGTEEQRRNLADRPLQAGDAMVVLGRWERLRALATNRNFVMVTPVEGRA
FT                   GIRERGAAAAVLCFLAAVALTYTGLSIATSLLSGVLAMILLRVIPIGEVYRAIDWRTLT
FT                   LIAGILPLGIAMDTSGTARFIAEQTAGLVAGYPTPLILIAVAVLATAFSLVMSNIAATV
FT                   LLVPLALVMAGSFGLDPRGLALLVGICTSNSFLLPTHPVNALLMGPGNYRTRDYIVPGS
FT                   IMTVVFILIAVGIVSFLYF"
FT   sig_peptide     335857..335937
FT                   /locus_tag="Memar_0357"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.863) with cleavage site probability 0.727 at
FT                   residue 27"
FT   gene            337741..339111
FT                   /locus_tag="Memar_0358"
FT   CDS_pept        337741..339111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0358"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: sep:SE0080
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56291"
FT                   /db_xref="GOA:A3CSE1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSE1"
FT                   /protein_id="ABN56291.1"
FT                   /translation="MEREYDVVVIGTGNAGSDIAWHCRKAGMQVAIVDSRDYGGTCALW
FT                   GCVPKKVLAGAAEVVSRAHDQLGNGIRGAIAIDWPELIAFEQTFTDPVPRQKEERFRGA
FT                   GIHTYHGLARFAGPDRVAVGDDTLTGRYIVIAAGAHPRPLNVPGEDLMTSSDDFFYLEA
FT                   LPERIVFVGGGYISFEFAHIAAAAGSAVTILQRSGRALKEFDPDIVDRLLLASGEAGID
FT                   VQMNMPLVSVEKNAADLRVRAGRDGEEKTFGADMAVHGAGRVSAVGELDPAAGNVETDR
FT                   RGIVVDEHLRSVSNPAVYVAGDANPGSPQLTPVAVMDAHIVVDNILGGNARVADYSVVP
FT                   SAVFTNPPIASVGLTEEAAKEKGIPYVANAGDLSGRFTNRSIGQKHAGYKLLIDEDSRR
FT                   ILGAHLIGPHVEEVINIFALAIKHGLTVDDLTLDAIPWAYPSSTYDIIHMVYPLVRK"
FT   gene            complement(339663..340076)
FT                   /locus_tag="Memar_0359"
FT   CDS_pept        complement(339663..340076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0359"
FT                   /product="ech hydrogenase subunit F"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mhu:Mhun_1746 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56292"
FT                   /db_xref="GOA:A3CSE2"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSE2"
FT                   /protein_id="ABN56292.1"
FT                   /translation="MGIFQMTKTVLRNLAGGPATRQYPAVPARSCSLTRGHIVFDPATC
FT                   RSCSLCVKRCPCEAIRLDKEAKVWEIDRMRCIACGDCVEGCPFGSLTMEQSYHPPVTEH
FT                   VVERYTITYVKPERPAKKPAEESTKEEGVGESA"
FT   gene            complement(340084..341163)
FT                   /locus_tag="Memar_0360"
FT   CDS_pept        complement(340084..341163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0360"
FT                   /product="ech hydrogenase subunit E"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 49kDa;
FT                   KEGG: mhu:Mhun_1745 NADH-ubiquinone oxidoreductase, chain
FT                   49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56293"
FT                   /db_xref="GOA:A3CSE3"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSE3"
FT                   /protein_id="ABN56293.1"
FT                   /translation="MPERIIVPFGPQHPVLPEPIHLDLVLEDEKVVEAIPSIGYIHRGL
FT                   ERLVQKREYTEYVYVAERICGICSFIHALCYSQGVEHIMKIEVPDRARYLRTIWSECSR
FT                   IHSHLLWLGLFADGMGFENLFMRSWQLRESVLDVLEDTTGGRVIQGTCKVGGVRRDIGQ
FT                   EKLDEMHRTLDPFEQQCRDLGDVFLNDDTVKYRLKGLGVISKDEAYDLGAAGPTARGSG
FT                   VAMDHRETGYAAYGDLGFKPVVETTGDCYARCAVRVKEVYASIDLIRRAIEEMPEGPID
FT                   VKVKGTPDGEYFSRAEQPRGEVIHYLKGDGSKHLARARIRTPTLANIPPLVKMLPGIQL
FT                   ADVPVVVLSIDPCIGCMER"
FT   gene            complement(341148..341528)
FT                   /locus_tag="Memar_0361"
FT   CDS_pept        complement(341148..341528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0361"
FT                   /product="ech hydrogenase subunit D"
FT                   /note="KEGG: mhu:Mhun_1744 Ech hydrogenase, subunit EchD,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56294"
FT                   /db_xref="GOA:A3CSE4"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR012179"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSE4"
FT                   /protein_id="ABN56294.1"
FT                   /translation="MTVNEEQTTTGITLEDLLREVEALHARGYRLVQIGCTDLDGSYEL
FT                   NYSFDKGYQFRNLRLTVGPETEVPSISGIYWGAFVYENEMHDSFGIPVKGINIDFKGTF
FT                   IRTDEKYPFSVTRRGGDRCQNA"
FT   gene            complement(341525..342007)
FT                   /locus_tag="Memar_0362"
FT   CDS_pept        complement(341525..342007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0362"
FT                   /product="ech hydrogenase subunit C"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase, 20 kDa
FT                   subunit; KEGG: mhu:Mhun_1743 NADH ubiquinone
FT                   oxidoreductase, 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56295"
FT                   /db_xref="GOA:A3CSE5"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSE5"
FT                   /protein_id="ABN56295.1"
FT                   /translation="MAFLKRSPWILHYDASSCNGCDIEVLACLTPLYDVERFGMINTGN
FT                   PKHADILLITGGINTQNREVVENIYEQMPEPKVVIAVGVCAATGGIFRECYNIVGGIDK
FT                   VIPVDVYVPGCAARPEQIIDGVVTALSILEKKRAAMAGTAQTKEEEQHAEQAGEST"
FT   gene            complement(342013..342891)
FT                   /locus_tag="Memar_0363"
FT   CDS_pept        complement(342013..342891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0363"
FT                   /product="ech hydrogenase subunit B"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase, subunit
FT                   1; KEGG: mhu:Mhun_1742 respiratory-chain NADH
FT                   dehydrogenase, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56296"
FT                   /db_xref="GOA:A3CSE6"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSE6"
FT                   /protein_id="ABN56296.1"
FT                   /translation="MTWTWLIGAVLFLVLAPIAGGLIAGIDRRITARMQGRVGPPLLQP
FT                   FYDVGKLFEKESVVVTTAQNFYVLAYLIFIALSGALFFAGGDLLLIIFAFTLAHVFLVL
FT                   GAYAAHSPYSHIGAERELIQLMAYEPMIILAAVGFYMVTNSFYVAEIAVSAIPAILYLP
FT                   GVFLGFVTILTIKLRKSPFDISTSHHAHQEIVKGITTEFSGSTLAQVEIAHWYENVFLL
FT                   GFVYLFFAWNPVVGIIAVVITYLAEIFVDNVTARVRWQAALKSGWLAAVLGIVNLAILA
FT                   YILAYMMTGGA"
FT   sig_peptide     complement(342817..342891)
FT                   /locus_tag="Memar_0363"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.861 at
FT                   residue 25"
FT   gene            complement(342888..344798)
FT                   /locus_tag="Memar_0364"
FT   CDS_pept        complement(342888..344798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0364"
FT                   /product="ech hydrogenase subunit A"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: mhu:Mhun_1741 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56297"
FT                   /db_xref="GOA:A3CSE7"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSE7"
FT                   /protein_id="ABN56297.1"
FT                   /translation="MQTLLFLILFPILVACLLLFVKRTTLRYAVVALSALVIGGASIYL
FT                   LMRYAFEGAVYFAAPSEAASLAMVAIEMGLALFIIYMGAKFRNYLAIVLAVIQAALVVY
FT                   LEATFSENLHAVNNLFIDQFSIIMGLIIGIIGSLIAVYAVRYMETYHHHHPEVRDRQKM
FT                   FFFVIFIFLAAMFGLVFSNNLMWVFFFWEITTITSFLLIGYSETEEATKNAFLALVMNL
FT                   LGGVAFVAALIFLAATEATSGGIDLARVLASGDAAVILIPAVLIGFAGITKAALMPFSS
FT                   WLLGAMVAPTPVSALLHSSTMVKAGVYILVRFSPVFAGTFAGFSIGLVGAVTFVVASAI
FT                   AISQSNAKLVLAYSTIANLGLIAACAGVGTYMLVWAAILLIIFHAVAKSLLFLGTGAIE
FT                   HRIGSRDIEDMEGLIVRMPRMAVMMFIGIAGMFLAPFGMLISKWAAIEAFVQVQAPFGL
FT                   VFIALLAYGSAITVFFWAKWMGKLIAITRNQEKVEKGFFEEPWAPLYIITGLVVAAVLL
FT                   FPVISSTLIEPYVLAIYGVTARLAEANVAIMLLMMALLLILPVSFLLFRRSAKRLPAYM
FT                   GGRTATPDLHFAGSLGLTREAQTRNYYLTEYFGEAKLFLPGAVICTVLILVSWALAGVA
FT                   L"
FT   gene            complement(344954..345319)
FT                   /locus_tag="Memar_0365"
FT   CDS_pept        complement(344954..345319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0365"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   swo:Swol_1000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56298"
FT                   /db_xref="GOA:A3CSE8"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSE8"
FT                   /protein_id="ABN56298.1"
FT                   /translation="MPCPFCNPAPGDIVAKNNLCYARYDIHPVSPGHLLVIPFRHVGSY
FT                   FDTTDEERMAIARLIDDCRGLTDRDRRPDGYNIGVNVGEAAGQNVMHVHIHFIPRYRGD
FT                   AGEHGGGVRGVMPCKPE"
FT   gene            complement(345370..346548)
FT                   /locus_tag="Memar_0366"
FT   CDS_pept        complement(345370..346548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0366"
FT                   /product="protein of unknown function DUF362"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF362; KEGG:
FT                   dsy:DSY4491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56299"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSE9"
FT                   /protein_id="ABN56299.1"
FT                   /translation="MLPGDRDTTVAVARCDDYAPDEVDAAVRRAVDLVGGIGRFVSPGE
FT                   SVLLKPNLLQGQAPERCVTTHPEVVAAVARLLVEHGCRVVIGDSPGAGIVYSEANLRRA
FT                   YARSGFAAVAEETGTALNYDTGSQIVAFPEGEVMKQFSIITPAVEADAIVVVSKAKTHM
FT                   WTRMTGAAKNLFGLIPGLEKPVFHFRFQDEYAFGRMLADLNECMKPRLQIVDAVVGMEG
FT                   DGPQAGSPRTIGVILAGSDYAVVDTVLARLIGMDPLEIGSTRSAAERGLFDPEGVRTVG
FT                   DDPAEFMVPDFQKPSTYTGGRTGVWRRVVLAVVQRFGRTYAPRPGVIASSCIGCGKCER
FT                   ICPVHAITVAEGKATIDLSRCIRCYCCHEMCTEHAIALSRSLTGKVLARLLG"
FT   gene            complement(346553..347329)
FT                   /locus_tag="Memar_0367"
FT   CDS_pept        complement(346553..347329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0367"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein; KEGG: sco:SCO5572 ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56300"
FT                   /db_xref="GOA:A3CSF0"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSF0"
FT                   /protein_id="ABN56300.1"
FT                   /translation="MKLSTIWTRFRIGDLCRRRLPRRPEPAGLDREAEVRALLAHPPFG
FT                   ITDVAKTAIPLYDRALTHRSYANHGEYPAETFEDNERLEFLGNYVLDFVIADHLYGEYD
FT                   LPPGEMNRRLQVTRNTKLAEIVRRQGLGIDGAVRRRGQPPTDSIVADAFEALIGAIYLD
FT                   RGLGVARDVVLAIFEEEIAECDTHRNYRGRLQEYVARENLGELEYAFLQTGPGNCPVWA
FT                   ARVTVGGIPFGEGEARTKQGAAMIAAKEALARLRGE"
FT   gene            347371..348267
FT                   /locus_tag="Memar_0368"
FT   CDS_pept        347371..348267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56301"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSF1"
FT                   /protein_id="ABN56301.1"
FT                   /translation="MAYVLPDKPLPETEPPGNLFVAAEEILSVVQPAAYEAGRRVYLDI
FT                   EFGYVYGTCRAVMMPIEIGAVLYRPEDDSVRYVGEQFCYDIDVEIWKKVTDECGKTVGV
FT                   ATTVANMGRGEYGMPYDHSYRSPGDGVSAAKATAKKAFADLRLFMESVVSAGDAPAIVV
FT                   FAADMERRAFRTAGFSLDGCMLVDLQREIRRHFKMKQVLSLDRLARLIDFSADDSIVAS
FT                   THFRYPVPREYRHLLAAHRGMGDAVRTFLLAREFQENLLHLEERIRSLMETCEGESEEG
FT                   GCRNGSAGDATDGTAGT"
FT   gene            complement(348282..349538)
FT                   /locus_tag="Memar_0369"
FT   CDS_pept        complement(348282..349538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0369"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG: mhu:Mhun_0664
FT                   molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56302"
FT                   /db_xref="GOA:A3CSF2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSF2"
FT                   /protein_id="ABN56302.1"
FT                   /translation="MVRQRLASKPLAEVREVMRSAFPTPGRTVTLPVADTAGRMTAKPV
FT                   YSLLTVPEADIAARDGFAVESRETAGASAANPVGLENPQRVNTGNAIPAGYDAVVMIED
FT                   VAGRDGAWSTRKAVIPGEHLHPRGTEIRQGDQILPAGHRIRPCDIGALLSYGIAAIDVR
FT                   EVRVGLIPTGSELVLAGELPGPGGAVESNTAAAAALLGEAGSTCTRYGIVRDDPALLRE
FT                   AVEKGIRDNDLLLISAGSSAGTRDFTAGVIGDLGEVLVHGIAMKPGEPAIIGRIDGKPA
FT                   IGLPGYPIAAQTAVRELALPLLVAWGFHPPPAERLRARLDRMVTSDPGYDEFVLLAVSR
FT                   AGDRYAATPLPRGGGTQMAMVRANAYLHVPRGTSGICEGTEIEVLLTGPGREADEISEP
FT                   APKRPVQVRKESLPVKDDT"
FT   gene            complement(349599..350399)
FT                   /locus_tag="Memar_0370"
FT   CDS_pept        complement(349599..350399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0370"
FT                   /product="formylmethanofuran dehydrogenase, subunit C"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: glutamate synthase, alpha subunit domain
FT                   protein; KEGG: mhu:Mhun_1990 formylmethanofuran
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56303"
FT                   /db_xref="GOA:A3CSF3"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR017550"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSF3"
FT                   /protein_id="ABN56303.1"
FT                   /translation="MKTVTLTLTNSPELYIEGQNITPDNFAGRKAAEITALDVWEGKQK
FT                   SPLGKYFTVEGDGAATAEETKIVLRGDCTRVKRIGQQMTAGEIVIEGNADMYIGGWMKG
FT                   GKIHVKGDVDSFCGIGMEGGELIVDGNAKSHLGSSPRGEWRGMQGGLIRVAGSVANDTA
FT                   TFINGGTIVIGGDADIHVSTHGEGGTVIIKGNAKGRVGGQMVKGDIYVYGTIENPLPGF
FT                   SMVGEVEQEVDGETATFVHYIGDLGERHPVSKGKTVYANLYTRT"
FT   gene            complement(350413..352125)
FT                   /locus_tag="Memar_0371"
FT   CDS_pept        complement(350413..352125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0371"
FT                   /product="formylmethanofuran dehydrogenase, subunit A"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: mhu:Mhun_1989
FT                   amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56304"
FT                   /db_xref="GOA:A3CSF4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012027"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSF4"
FT                   /protein_id="ABN56304.1"
FT                   /translation="MSELLIRNGFVFDPLQGIKGDRMDIGVKDGKIVETSALNSPKTID
FT                   AAGMTVMAGGVDIHSHVVGPKVNVGRLFRPEDKLFKSPHKSPTCSRMEMGCSVPSTFKT
FT                   GYDYARMGYVFVNEAAMPPLHSPHVHEEIRDTPIIDIAAMPVFGNNWFTLEYLKNNEIE
FT                   NNAAYTAWLLRATRGFGLKVVNPGGSEAWGWGLNCEHIHDPVPYFDIAPAEIVKGLIET
FT                   NEYLGLPHSVHLHCNNLGNPGNYTDTLESLKLAEGYAPKNDFGREQVLHITHLQFHAYG
FT                   GDSWGNFESRAKDVMDYVNSHDNITVDIGQVTLDETTTMTADGPFEHHLRGLNNLKWAN
FT                   VDVELETSAGVVPYIYSPKVKVCTIQWAVGLEIALLSRDLMRTFVTTDHPNAGPFTRYP
FT                   QVIAWLMSRGARDETMKTFKWLERTIDATSIDSIDRELTLYEIAQMTRAGPAKALGIGN
FT                   TYGGLAPGMDADIAVYSLNPEDMPSDPAMIEKAFSRCAWLVKDGIVTVRDGEVVSEPAK
FT                   RTVWVDVKVPENAQVQRDIYEHFLRHYSVKLDNYSLFEEHLHNPRVIEVDTTQ"
FT   gene            complement(352129..353499)
FT                   /locus_tag="Memar_0372"
FT   CDS_pept        complement(352129..353499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0372"
FT                   /product="formylmethanofuran dehydrogenase, subunit B"
FT                   /EC_number="1.2.99.5"
FT                   /note="KEGG: mhu:Mhun_1988 formylmethanofuran dehydrogenase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56305"
FT                   /db_xref="GOA:A3CSF5"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR016457"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSF5"
FT                   /protein_id="ABN56305.1"
FT                   /translation="MPKKIENVGCPYCGVCCDDLVVTVSDDGKQILEVENACAIGNQIF
FT                   HHATGSERVKLPRLRQPDGTYKDISYDEAVDYAAKVLYDAKKPLIYGFGSTNCEGMAAA
FT                   AKVAERAGAVLDNCASICHGSSFLAIFDNGYPSCTLGETKNRADVIVYWGANPAHAHPR
FT                   HMSRYSIFPRGFFTGKGHKSRKIIVIDPRHTDTAQVADIYLQVKQGHDYELFDAFRAVV
FT                   RGHEIPEEVAGIKREQILEVANIMKKARFGTIFYGMGLCHSDGRNHNVDIAISLTRDLN
FT                   DYTKWTIMAMRGHYNITGPGAVWSWQYGFPYCLDLTKKDIAHMNPGETSSVDLAMRDEV
FT                   DAFINIGTDAGAHFPIEAVKHLRKHPWITIDPNICMASEISDLHIPVGIVGVEVPGIVY
FT                   RMDNVPIQYRKVIDPPEGVISDEELFERIHKRLGELEAEETAKGPAKAAPEGVRAEE"
FT   gene            complement(353499..353888)
FT                   /locus_tag="Memar_0373"
FT   CDS_pept        complement(353499..353888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0373"
FT                   /product="formylmethanofuran dehydrogenase, subunit D"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: molydopterin dinucleotide-binding region;
FT                   KEGG: mhu:Mhun_1987 molydopterin dinucleotide-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56306"
FT                   /db_xref="GOA:A3CSF6"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSF6"
FT                   /protein_id="ABN56306.1"
FT                   /translation="MITQRSIEEGVAMEKGKTTPEYFEACSIIEMHDDDVKALGLVPNQ
FT                   LVRVTSECGSVVVKAVKGRQSLYPGLAFIPQGVWANQVVPPRTQATGEPQYSGFPVTVE
FT                   SVNGERRKSALELVQGAVGMWRGDQ"
FT   gene            complement(353891..354115)
FT                   /locus_tag="Memar_0374"
FT   CDS_pept        complement(353891..354115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56307"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSF7"
FT                   /protein_id="ABN56307.1"
FT                   /translation="MLRPDVSFPRVSRAPPCRKVLLAGYRNPGRSSDATEYPITGVAGV
FT                   TVPAAGLPKTREAGLSNYIEAKPWRTGLH"
FT   gene            354913..356217
FT                   /locus_tag="Memar_0375"
FT   CDS_pept        354913..356217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0375"
FT                   /product="methyl-coenzyme M reductase, beta subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="PFAM: Methyl-coenzyme M reductase, beta subunit;
FT                   KEGG: mhu:Mhun_2144 methyl-coenzyme M reductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56308"
FT                   /db_xref="GOA:A3CSF8"
FT                   /db_xref="InterPro:IPR003179"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR022679"
FT                   /db_xref="InterPro:IPR022680"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSF8"
FT                   /protein_id="ABN56308.1"
FT                   /translation="MAKYTETIDLYSDDGKLLKSGVALDRISPLVNPATGKIIDLTKRT
FT                   ISVNLGGIQDALKVGKLGKGKIKGRELDLPIMENKDAIVAKIKEMIQVEEGDDTEIMEF
FT                   NGGKLLLVQVPTKRLVNASTYDAAITSVAAATTFSIVDQFNIDAFNASTVKAACWGSYP
FT                   HTQDMEGALVTSILTIPQNNEGIGYALRNIPVNHTVMMTGRNALQGAALSSTLETAGIF
FT                   EMGSAVGPFERAQLLAYAYQGLNANNMVYDLVKANGQNGTVGTVVQSLVERAIEDKVIA
FT                   PGKKGGYFQFYDTKDPMLWNAYAAAGTMAATIVNCGAGRFAQAVSATLLYFNDLLEHET
FT                   GLPSTDYGRVMGTAVGFSFFSHSIYGGGGPGIFNGNHVVTRHANGVAIPCVVAAAALDA
FT                   GTQMFSPESTSKLFADTYGKIDVFNKPIDQIANGA"
FT   gene            356234..356713
FT                   /locus_tag="Memar_0376"
FT   CDS_pept        356234..356713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0376"
FT                   /product="Methyl-coenzyme M reductase, protein D"
FT                   /note="PFAM: Methyl-coenzyme M reductase, protein D; KEGG:
FT                   mhu:Mhun_2145 methyl-coenzyme M reductase, protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56309"
FT                   /db_xref="GOA:A3CSF9"
FT                   /db_xref="InterPro:IPR003901"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSF9"
FT                   /protein_id="ABN56309.1"
FT                   /translation="MTNAAFPQLRIVPVRMLKPETAERLLNMLACVAGIRRMMIHGPGL
FT                   PKVVPYGPARGSPNPHSDRRAIRVADAEIALRVQVGMVILEVEDASVIEEVRSLCDGFF
FT                   VEFPYLLQEGRFMKTAPTLVDYAKYGPDADTSLVGLTDPRNGEKPVVIRTEQCGA"
FT   gene            356790..357554
FT                   /locus_tag="Memar_0377"
FT   CDS_pept        356790..357554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0377"
FT                   /product="methyl-coenzyme M reductase, gamma subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="PFAM: Methyl-coenzyme M reductase, gamma subunit;
FT                   KEGG: mhu:Mhun_2147 methyl-coenzyme M reductase, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56310"
FT                   /db_xref="GOA:A3CSG0"
FT                   /db_xref="InterPro:IPR003178"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR036994"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSG0"
FT                   /protein_id="ABN56310.1"
FT                   /translation="MAYKPQYGPGTSIVAANRRKQMDPKQKLEKVRSVTDEDIVLILGH
FT                   RAPGSAYPTAHPPLAEQQEVNCPMRKLVKPTEGAKAGDRVRYIQFADSMFNAPSQPYQR
FT                   TYTEMYRFRGIDPGTLSGRQIVECRERDLEKYAKDLIETEMFDPALVGIRGATVHGHSL
FT                   RLAEDGMMFDMLQRNVLGEDGIVKYVKNQIGEPLDRAVAVGKPMDEKWLKAHTTIYHSL
FT                   VGTSYRDDTEYIEYVQRIHSLRTKYGFMPKEE"
FT   gene            357560..359266
FT                   /locus_tag="Memar_0378"
FT   CDS_pept        357560..359266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0378"
FT                   /product="methyl-coenzyme M reductase, alpha subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="PFAM: methyl-coenzyme M reductase, alpha subunit
FT                   domain protein; KEGG: mhu:Mhun_2148 coenzyme-B
FT                   sulfoethylthiotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56311"
FT                   /db_xref="GOA:A3CSG1"
FT                   /db_xref="InterPro:IPR003183"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR009047"
FT                   /db_xref="InterPro:IPR015811"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR016212"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSG1"
FT                   /protein_id="ABN56311.1"
FT                   /translation="MAKIERSQKLFLKALKEKFQGQDVESETAEFYNFNGVRQSPRKME
FT                   FMKASRAVEMDRGISMYDPERCHLGGIPMGQRQLMTYEVSGTGVFVEGDDLHFVNNSAM
FT                   QQMWDDIRRTVIVGMDLAHQTLQKRLGKEVTPETINEYLHILNHAMPGGAVVQEHMVET
FT                   HPGLVDDCYVKVFTGDQELADDIEPQFLLNIEKLFPAKQAEELKAEVGKSMYQAIHIPT
FT                   AVSRTCDGGTTSRWSAMQIGMSFIAAYRMCAGEAAVADLSYAAKHAGVVQMGSILPARR
FT                   ARGPNEPGGIKFGLFSDIIQANRKYPNDPAKASLEVVGAGTMLYDQIWLGSYMSGGVGF
FT                   TQYATAAYTDNILDEFTYYGMDYAKDKYKVDWKNPSPSDKVKPTQEIVNDLATEVTLNA
FT                   MEQYEQFPTMMEDHFGGSQRAGVIAAASGLTTSITTGNSNAGLNGWYLSMLLHKDGWSR
FT                   LGFFGYDLQDQCGSANSLSMVSDRGLMGELRGPNYPNYAMNVGHQGEYAAIVGGSHYGR
FT                   GDAFCYSPLVKVCFADPSLRFDFAEPRREFAKGAIREFMPAGERSLIIPAR"
FT   gene            complement(359779..360015)
FT                   /locus_tag="Memar_0379"
FT   CDS_pept        complement(359779..360015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56312"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSG2"
FT                   /protein_id="ABN56312.1"
FT                   /translation="MGRERLPLIIPAMICESPKTDFEGISPFGERRSAGAEFEHRRCEV
FT                   GLTGSAMGGTPGVRPPSGGEGGAYPLPCLHLLE"
FT   gene            360129..361211
FT                   /locus_tag="Memar_0380"
FT   CDS_pept        360129..361211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0380"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   mba:Mbar_A2765 DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56313"
FT                   /db_xref="GOA:A3CSG3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSG3"
FT                   /protein_id="ABN56313.1"
FT                   /translation="MTTGSRIVLHVDMDSFFASIEVRRDPSLAGRPVIVGADPKGGAGR
FT                   GVVSTCSYEARRYGVHSGMPISRAFDLCPHGVYLPVDRPFYASVSVEIMALLSRHAGRI
FT                   EQVSIDEAYLDVSDAGSFPAAGALAAAIKREVREETGLTCSVGVAPGKAVAKIASDFQK
FT                   PDGLTIVRPDEVAGFLASLPVGRIPGIGKKTGEDLRQAGILTVGDLARRDVQEVIARLG
FT                   RSGVRVHHLARGIDDGEVQGREGCKSISRETTFEADTADPPVLAGTLAELADDVAETLR
FT                   ADNLRCRTVTVKVRYRGFQTHTRSRTLPRFTSDPETIRRAASGLLLPFLNGEPVRLIGV
FT                   RLSMLEGGCTRQASIDEFFS"
FT   gene            361264..362094
FT                   /locus_tag="Memar_0381"
FT   CDS_pept        361264..362094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0381"
FT                   /product="protein of unknown function DUF114"
FT                   /note="PFAM: protein of unknown function DUF114; KEGG:
FT                   ttj:TTHA1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56314"
FT                   /db_xref="GOA:A3CSG4"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSG4"
FT                   /protein_id="ABN56314.1"
FT                   /translation="MPDLWTVLLAAVILLLFAVPVVQQQVTRARRLRAIQDLEAGRRTR
FT                   VVALIHRQERIGFLGIPLFRYIDINDSEEVLRAIRLTAPEMPIDLILHTPGGLILSSEQ
FT                   IAMALRRHKGKVTVFVPHYAMSGGTLICLAADEVVMDENAVLGPVDPRIGEYPAASLLR
FT                   VPRLKPPEEIDDETFVLVDIAAKAQTQMREFVADLLRERMDAGRADSLARLLSGGTWTH
FT                   DYPITFEQARELGLPVTSGMPAGIYRLMDLFPQAMPRRPSVAYVPIPYREEKKR"
FT   sig_peptide     361264..361335
FT                   /locus_tag="Memar_0381"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.713 at
FT                   residue 24"
FT   gene            362233..362658
FT                   /locus_tag="Memar_0382"
FT   CDS_pept        362233..362658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56315"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSG5"
FT                   /protein_id="ABN56315.1"
FT                   /translation="MTSTITRTLLVCLFFAAVLLCAGCTEQQSSPGEAMDAEFRGETAG
FT                   YDDRVEFRFVPDTDEPGAYSATYTIERDVSWGTTIETRENVQYEDISRADPIEVVVPRE
FT                   APSDGVALEIEIRNSAGDVLHRSRTSVAPATPVPTPS"
FT   sig_peptide     362233..362313
FT                   /locus_tag="Memar_0382"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.358 at
FT                   residue 27"
FT   gene            362713..363144
FT                   /locus_tag="Memar_0383"
FT   CDS_pept        362713..363144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0383"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   rsp:RSP_0212 HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56316"
FT                   /db_xref="GOA:A3CSG6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSG6"
FT                   /protein_id="ABN56316.1"
FT                   /translation="MSTDLQLSLDAFDRSKPPLCGDNPGRNGFRRLCRQCPFAVRDGTV
FT                   VYCERFEIPIRARDKYTLRRWKETRSGVLERDGNRCTVCGGEQDLHIHHIDRDPTNDVP
FT                   SNLVTLCDICHARVHTELRREGGIGRVARVLPAARRRLE"
FT   gene            363254..364093
FT                   /locus_tag="Memar_0384"
FT   CDS_pept        363254..364093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0384"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: mth:MTH83 O-linked
FT                   GlcNAc transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56317"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSG7"
FT                   /protein_id="ABN56317.1"
FT                   /translation="MSGVSITERLFGRSEPEGREGACTDSTVSRKAVSLAQQGRFPEAI
FT                   DCFDRVLESDPANVKMWNNKGVFLDLLGRDQDALDCWEKALSIDPEFAPAWVSRGMLHR
FT                   RRNRLEEALACYDRAVELNPDSAVAWYNRSGVFVAMHRMDDAVACYERVLAIDPHFVAA
FT                   WTDLGYAHFLGHRHEEAIACYDRAVADDPGSVRVWSLKGGALYALGEYRKALECFDKVL
FT                   SIDPKYAAGWSMKCSVLYHLGMYRHALACADKALEINPTCELTGQVRKMLLSLIQKW"
FT   gene            364246..365106
FT                   /locus_tag="Memar_0385"
FT   CDS_pept        364246..365106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0385"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; transcription
FT                   activator, effector binding; KEGG: mma:MM3170
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56318"
FT                   /db_xref="GOA:A3CSG8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSG8"
FT                   /protein_id="ABN56318.1"
FT                   /translation="MPVDQIPIGTFSRITHLSQKALRLYDERGLLVPAARDICTGYRYY
FT                   TYDQIERGIRIRNLLWLGFGLSEVEAILEARERGDAAMIQEHFARRLAENEREAGRLHA
FT                   IAGALRKQQQDPFNGGFSMSITEPVIKDIPTVRALSLRERGIYQETIPRMIRELFTYVC
FT                   PEDGRQPAARIAGPIMFICHDEEYRETDADIEVAVPITGSVSLDGTAVEVVNLPGGRFL
FT                   SVLHTGPYPGVGKAYERLFSYMNEHRLVPSGPSRELYLNDPAEVPEEELLTEVQSPVKD
FT                   LPPSP"
FT   gene            complement(365117..366598)
FT                   /locus_tag="Memar_0386"
FT   CDS_pept        complement(365117..366598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0386"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: aba:Acid345_4079 alpha
FT                   amylase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56319"
FT                   /db_xref="GOA:A3CSG9"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSG9"
FT                   /protein_id="ABN56319.1"
FT                   /translation="MNTHTPRHPALYEVNARVLLRHLGREAGRRLTLDDIPDSRLAELA
FT                   GCGFSWVYLMGAWETGEAGRRVSRSNEQWLAGYRCLLPDLSEEDICGSPFAVAGYFLHP
FT                   DLGEPEALPRFRERLHRYGIRLMLDFVPNHTAPDHPWVQDRPDYYVHGTEEELARRPQE
FT                   FVRVNLPGGPAVLAHGRDPYSGGWPDTLQLDYGNPAMQEAMTAELRRVAGQCDGLRCDM
FT                   AMLVLPEIFRRTWGRETEPFWPRAIEGVHKEHPGFTFVAEVYWDLEWTLQQQGFDYTYD
FT                   KRLYDRLRNGAARPVREHFWADPEYQKRSVRFLENHDENRAAAVFPPDRHRAAAVLAFL
FT                   CPGLRFIHRGQVSGRHKKVSVHLCRGPEEPADPAIEEFYRRLFACLRLPAFRDGEWRLL
FT                   DCTPAWEGNPSHDGYVAFAWEREEQRFLVAVNYAPDRGQCYVPLPWADLTGKAVRLRDL
FT                   IGEARYDRDGEGLLSPGLYLDLPGWGRHVFEVAGE"
FT   gene            complement(366638..367849)
FT                   /locus_tag="Memar_0387"
FT   CDS_pept        complement(366638..367849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0387"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase, FAD-binding; FAD dependent oxidoreductase;
FT                   KEGG: dde:Dde_2189 geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56320"
FT                   /db_xref="GOA:A3CSH0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSH0"
FT                   /protein_id="ABN56320.1"
FT                   /translation="MKGRPEYDAVVVGGGPAGSTAACLLAEAGHSVALLERRTYPRNKV
FT                   CGGCLSQKTVRFLDRVFSLPVPALRQAGLLDFTGTGYALYIGSRRILTEDLDEPVYFTG
FT                   RERYDAFLAKMAARAGAEVHTGAEAAGIDHARRTVTTSDGDRYSARVIIGADGVHSRVR
FT                   RTLPQSVVDRKRWQNNLGWTLELAIPRREAETLVNEDGPIRLDDGLATPHLILAACRWG
FT                   YGWVFPNREAIIVGIGGLLSANGGNLRDTFEAFLKSVGLSAFAARKPAGYLLPLGNYIP
FT                   SPAHEGTVLVGDAGGFTGPLLGEGIFYAHRTAELAAHAADRHLTAGAPLAATYTALLRR
FT                   RLIPELRAETALRNFVYRCLDARMHAPLAAFMRATNTLVIDAVQGTRSFRGFLRDDDLH
FT                   SAIW"
FT   gene            367979..369181
FT                   /locus_tag="Memar_0388"
FT   CDS_pept        367979..369181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0388"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mtp:Mthe_0251 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56321"
FT                   /db_xref="GOA:A3CSH1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSH1"
FT                   /protein_id="ABN56321.1"
FT                   /translation="MSVAEQKLTYLTAAGRFDICSPGECLQLLPVAVETREVSPAPEIL
FT                   PVPLDTLRASQETPDGLEDPNVRTVIAPYISYNRRTGGCGRMLKMLLNGTCSYDCAYCP
FT                   VRLQREPASFSPREFADTFLRLWRDGLVEGLFLSSGIPRDVDCVMHDLVETGEVLRRRG
FT                   YGGYLHLKILPGATRADIHDAARVADRISINLETTSPDRLGGIAGVKDYRQDILKRQSW
FT                   VAEEKPGGHTTQLVVGAADETDAEILSCLADQYRRVRPSRVYFSAFHSLPRTPLASHPD
FT                   TPAWRAQRWYQADYLLRDYGITADELRAALDEEGFFPNRDPKAVLAAGRMPVNVNLAPR
FT                   RDLLRVPGIGPKAADRILSLRRVRPFASPADLARVGIRGRAAARHLTFGDRDTIQTKLF
FT                   P"
FT   gene            complement(369211..370410)
FT                   /locus_tag="Memar_0389"
FT   CDS_pept        complement(369211..370410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0389"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: mma:MM1794
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56322"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR021527"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSH2"
FT                   /protein_id="ABN56322.1"
FT                   /translation="MAETILEQQVRRTEGPEFFSSEDVVGKRVKNPEGYDLGEISSLRV
FT                   GLPTGRVAYAVLRTGGMFGLGAKHFAIPIEAMVYRPGDDVFLVNISKYRLENEPGFSEG
FT                   DWPREANWSLIESRRPMGPPSQEEARAVTRTEAPPREVVTTERVEVRERAPREGMAIRA
FT                   EEVEEGRARTAVPVTGAPPRETVVEEVETRPVTEAHAPTLESMMKAEDVEKGRVETAPR
FT                   ETVVEEVRREPPAAMETRPTTTGPAPGHLSAAGLQTYLAGMNYPAGRQDLITHARKKSA
FT                   PENVLTTLGGFPDRTYRSAADVSAEFGGEARTRQPTGIETPAGEVRETGTVTPSLTHIS
FT                   AADLQAYLKGIDYPAGRQDLIAHARKNDAPETVIAAIEGFSDRKYHSAADVSTEFGKVR
FT                   "
FT   gene            complement(370613..372193)
FT                   /locus_tag="Memar_0390"
FT   CDS_pept        complement(370613..372193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0390"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: noc:Noc_0486
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56323"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR021527"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSH3"
FT                   /protein_id="ABN56323.1"
FT                   /translation="MAEQQMGSVLETRRPAREETVNLMRAHDIRDVKVRNPEGENLGDI
FT                   SDVAIDRDSGCIAYAVLSYGGILGFGEKHFAIPWEAVRTRPGERSVIVDANKRTLDSSP
FT                   GFSRDRMPREANWSLVRTPPPARAAAEPTAPVTEREVPPSRGVGTAAAAATGAAVKGAT
FT                   APAETTPAGRERVVPTPPPVQTVARGWGEQPAEQPVEERPVTTEAPPPREPGVRPVHRE
FT                   RIVETAPRETVVEEVRREPPAAMETRPVTEAERSLMTPGPSAGHLSAAGLQTYLAGMNY
FT                   PSGKKDLISHARQRDAPQSVITALENFNDRTYRSAADVSAEFGSEARTRQPTGIEAPAR
FT                   EVHETRMEEVHEEAPAARRMVPPRTHLSAADLQVYLKGMDYPAGRQDLMTHARKNNAPH
FT                   DVITAIEGFSDRTYRSAADVSTEFGSEVRGEQSAVMETRREPGVTAKEVRREERPETRT
FT                   RAPSLTHLSAADLQVYLKGMDYPAGKQDIVAQARKNNAPEDVITAIEGFSDRTYRSAAD
FT                   VSSEFGKFR"
FT   gene            complement(372345..373652)
FT                   /locus_tag="Memar_0391"
FT   CDS_pept        complement(372345..373652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0391"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: mhu:Mhun_2167 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56324"
FT                   /db_xref="GOA:A3CSH4"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023979"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSH4"
FT                   /protein_id="ABN56324.1"
FT                   /translation="MEITILSPGIYTYGAMLIGGVLRDAGHRVTLTRTPAVPADSVLLM
FT                   SLFSTQHLLDPAIRDLVRTHRERGGLVYVGGPVSAAPEMVLGELAPDAVVVGEGEETVI
FT                   RLVEEGVSDALPGIAFLDAGRPVVTPPAPPASMDRPLPLIPDDIGNQSVRGASAYIETH
FT                   RGCIGGCTFCQVPRFFGRAIRSRPLDRIVEEVKAFSAHGATRLSVSGGTGSLYGSTGGE
FT                   MNPEAFIGLLRSMAEVMGPKNVSSPDIRVDCISDEILGAVRQYTIGWVFFGIESGSDRV
FT                   LRLMGKGATVRQVEEAVERCREHGLRVAGSFIVGYPGETERDYEATKDLIAALSLDDVF
FT                   VSSAEPIPATPLADLAVRTPRDKNPAFVPHTGEYRALSLTESEARCFDLMMHADLFRPQ
FT                   LRLVTDEVYNTYLAEARKQGRDIRAATELILRYARA"
FT   gene            complement(373699..374376)
FT                   /locus_tag="Memar_0392"
FT   CDS_pept        complement(373699..374376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0392"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56325"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSH5"
FT                   /protein_id="ABN56325.1"
FT                   /translation="MTHLRHLNTTCAVCGEACRFTVPEAAGCVGSRDLDTRPAEPLRST
FT                   IYAWVKRCPSCGYCAPDPGKAPEGAADVVKLPRYRWQLDARKFPNIANTFLCWSIIQED
FT                   LGLLAQAAWASLHAAWVCDDEGEDVPARICRKRAADLLRRAWEKGERLAGLEGTDEAVL
FT                   ADLLRRAGRFREARTVVAETLEKNPLPIIADIMRLQARLIAASDRGAHTVAEARRFRQP
FT                   VPL"
FT   gene            complement(374466..375548)
FT                   /locus_tag="Memar_0393"
FT   CDS_pept        complement(374466..375548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56326"
FT                   /db_xref="GOA:A3CSH6"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSH6"
FT                   /protein_id="ABN56326.1"
FT                   /translation="MNTRNIGLIAKKELFGLSSEKTIVFAILLQVFVAMFSSFLMVGLT
FT                   AMYDPEAIEGYSTITYGVGYAGAESPLIDEFEKRDDLILHRMDLGQALAALRERQVSAV
FT                   VYVPDTPPDAEGPVTVTLYLIQNDLQSSVINVKVKEVLQGYEKELREIRADRMNAFPVS
FT                   LNFPESGGGENFFEFVYGLLIPLLVLLPAIVSAALIIDLITEEYQRQTLETLMSTPVTF
FT                   AEMVWGKVAACEVLVPVQAGAWLLLLGFNGIAVDNAAAILLHASVGGLFLILLGALVAL
FT                   HYRERTSAQFIFSTALVVVFLLVMAVPYNPLNLMVRLAVDTAGPVHWLILALVAGATVL
FT                   LGWTVTAYARRVGEAAPQAR"
FT   gene            complement(375545..377350)
FT                   /locus_tag="Memar_0394"
FT   CDS_pept        complement(375545..377350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0394"
FT                   /product="ABC-type transport system permease protein"
FT                   /note="KEGG: mhu:Mhun_1463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56327"
FT                   /db_xref="GOA:A3CSH7"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSH7"
FT                   /protein_id="ABN56327.1"
FT                   /translation="MSLASSIRTIAAWEMNRSMTTMGRSVLPLAAGLLVLLVLVTAFAA
FT                   QSGVHMQDGMYRVGIDDPEIARIVAPDSRFTAYLDNGAALWENRFAYDIVILNGEVYAA
FT                   DTDKGRAALKTIERDYEGYVSHVAAGEPDLFAAYPLWIDLQYVKSEIDFLATQSGQQVG
FT                   APADARRPPVPSGPVEAVTPPASAMPVSEETLREHLADTGSGHPLERYTGVISGGSAME
FT                   QFRTPSELSPPLPFDAIILVFVFIFPLYFTSQFFMMSVMNERVGRAGEALLSTPARPTA
FT                   IVVGKALPYFTIMILIAAAITLFSGAPMTILLPLIPVILFFLANALIIGMAARSFKELS
FT                   FVSIFFSALATSYLFFPTVFANTHVISIISPLTLVVLEIQGDGFTAMEYVYSTVLFFAT
FT                   SVILFYVGITNFREERLFSEKPLASRLADFVSGGISRDHPHLSLFLLAAFTIPFVFMAQ
FT                   MLTLVLFFNIPMPLSLVLLTVSAAFIEEFAKSIGLYAVARERPGFLTPRNLLLGAVAIG
FT                   FGFLAGEKLLLLATLAQITESIFGSVLFLSLQVLWMPLLLHIAGVLVTGGFLLLWGRQG
FT                   YGPGLIAACMVHSLYNLYFLMGALL"
FT   sig_peptide     complement(377216..377350)
FT                   /locus_tag="Memar_0394"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.979 at
FT                   residue 45"
FT   gene            377431..378318
FT                   /locus_tag="Memar_0395"
FT   CDS_pept        377431..378318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0395"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mhu:Mhun_1464 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56328"
FT                   /db_xref="GOA:A3CSH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSH8"
FT                   /protein_id="ABN56328.1"
FT                   /translation="MITARSLVKHYGDFPALDDVTFDLDDARILGVIGHNGAGKTTLLK
FT                   IMAGLIAPTAGSLVVDGIDVTRRPLDLKRNLGYLPEESRLYETMTTDAYLAFFGEIYGL
FT                   SKPVIRERRDVLLDSLALEADGKKIGELSKGMKRKVAIARSLMHDPDLLIYDEPTSGLD
FT                   PMTSRSVLDYVKSLRERGKTVIFSAHNLFQVEEACDLVLILRRGKVVANGTMPELRETF
FT                   GSLTYQVFFRIPDPAAFATSVGYSASDGRYLAEARSVEELNRTTAALAADGATIERIES
FT                   HYPTLEEMLLKIGR"
FT   gene            378397..378621
FT                   /locus_tag="Memar_0396"
FT   CDS_pept        378397..378621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56329"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSH9"
FT                   /protein_id="ABN56329.1"
FT                   /translation="MWNGESPVLLSPRNALAGFLPGQNLYSSGMYVPSRSHSHRNNRPP
FT                   VRNPGAGGGRWGLAGRRGVPSAMEKSLCG"
FT   gene            complement(378694..378766)
FT                   /locus_tag="Memar_R0006"
FT                   /note="tRNA-Lys3"
FT   tRNA            complement(378694..378766)
FT                   /locus_tag="Memar_R0006"
FT                   /product="tRNA-Lys"
FT   gene            378838..380340
FT                   /locus_tag="Memar_0397"
FT   CDS_pept        378838..380340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0397"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: phosphoesterase, RecJ domain protein; TrkA-N
FT                   domain protein; KEGG: mhu:Mhun_0616 TrkA-N"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56330"
FT                   /db_xref="GOA:A3CSI0"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSI0"
FT                   /protein_id="ABN56330.1"
FT                   /translation="MESLNTMRSYTIVRMPEAVQNVSKERIKYIILGCGSTGYNVAEEL
FT                   EQENEDLIIVDKDEKRVEDLRDQKYEALVRDLRDPNFMEGLPVPEVAFILANDREANLT
FT                   ALQTVKNRYPATYVIARATDPVSVDLLQQEGADIVLYPQEVVARTAIHHIRKLQSSRLA
FT                   LRLYDMLASWEGTLCIVTHLNPDPDSISSAMALSMIARHASRNKLNCRIVYEGDIGHQE
FT                   NRAFINLLDIKLERLTPQILEECDYIALVDSSGPGVNNELPRSTRVNIIIDHHKNGEHP
FT                   STVADFIDIRPGVGATASIMTQYLMELDIPVNKSVATALLYGIRADTRDFKRNVTPQDL
FT                   NYAAFLLPLTDSDLLDKITSPSMSLETVEIIGNAIRNRRIKSGYLFSNVGYIRNRDALP
FT                   QAADMLIHLEGVNTALVYGISDQNIVISARNKDIRLHLGNVMAEAFGPIGEAGGHATMA
FT                   AALIPLNYFSMAKEKEGLLELIIDPILKRFSSIVGLDDEDKQ"
FT   gene            380337..380960
FT                   /locus_tag="Memar_0398"
FT   CDS_pept        380337..380960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0398"
FT                   /product="protein of unknown function DUF115"
FT                   /note="PFAM: protein of unknown function DUF115; KEGG:
FT                   mhu:Mhun_0615 protein of unknown function DUF115"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56331"
FT                   /db_xref="GOA:A3CSI1"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="InterPro:IPR027510"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSI1"
FT                   /protein_id="ABN56331.1"
FT                   /translation="MRFSDWEPHYTAILAYFGFEREADEVAARLLADLADRDDLGLLEA
FT                   LIRGREVTVCGNAPSLPEELDRIEGTVLAADAAAEVLADHGIRPDAVFTDLDGATDVFI
FT                   DLSEQGTVMVVHAHGDNVPLLRHWVPRIPGPLVATTQAAPLAHVHNFGGFTDGDRAVFA
FT                   ADELGAARVRIVGFDLADKNVDPLKRGKLYWAGELLHLIGYDLQ"
FT   gene            381193..382845
FT                   /locus_tag="Memar_0399"
FT   CDS_pept        381193..382845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0399"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mhu:Mhun_0614 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56332"
FT                   /db_xref="GOA:A3CSI2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSI2"
FT                   /protein_id="ABN56332.1"
FT                   /translation="MPESTNALIIDGYVDEPACLGVAPYISPYIREVAGVLAGHGYTPR
FT                   YVTIDQVRADPSLVAGCGRGDLVVMIAGLTVPGAYIGGKPATLTEIQQLGILLRQPTTA
FT                   IGGPIAFGYAPGGGRKAIRQAIAGFDVTLSGSPAVALDSWLSGGEPAGAGDYALTYPWS
FT                   VAGAGIVAQHPAFPYVMCELETATGCSRATVGGCSFCTEPFYGLPRYRSIEGIAEEVAA
FT                   LHAAGARHFRLGRQPDLLAYKSSGGGEFPVPRPEVLKELFSAVRESAPDLKTLHIDNIN
FT                   PGTIARHEDAARAALEAIVAGHTPGDTAAFGMETADPAVVTANNLKAMPDDVFRAIEVV
FT                   NDVGAKRTGGVPELLPGLNFIIGLAGETPATFDANEAFLQRVLDAGLLVRRVNIRQVMP
FT                   FEGTKAYEGNTLGKHDARFRSFKEWARTHFDEPMLRRVFPVGTVLPEVVVEVPGKPSFG
FT                   RQMGSYPILVGIPLELPARTVLDAVVVDWGMRSVTAFPCPVEINTLPVAALRWIPGVGK
FT                   KRAATIAARRPFSSLEEFREVAGETGIEGVMRF"
FT   gene            complement(383398..384534)
FT                   /locus_tag="Memar_0400"
FT   CDS_pept        complement(383398..384534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0400"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; peptidase M50;
FT                   KEGG: mhu:Mhun_0613 peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56333"
FT                   /db_xref="GOA:A3CSI3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSI3"
FT                   /protein_id="ABN56333.1"
FT                   /translation="MEASLQIGTLAGIPVKLHWSFLLVIPLFAWIIGSQIQLTTGLIEA
FT                   LFGVPIDPTLITEGFNPYILGIVVALGLFFGVFIHEMAHSLIAKAKGIEIHSITLLILG
FT                   GVSQMEETMPDPKIELPMALAGPLTSLAVGIISAALVYVVAAIDMDPGVAGVLIFTFGY
FT                   LGLLNVLLFGFNLLPAFPMDGGRVLRAWLARRMPLSRATRIAADVGKGFAVLFGIVGLL
FT                   LLNPILIIIAFFIYIGANQEATFLRYNILLQDVTVADAMSSPVVTVEPTLPLPRVVDMM
FT                   YETKHLGFPVVDRGSLAGIVALADVHKISPIDREAMQVRDVMTRDPTVLPPSAPLIDAL
FT                   RIITGQEIGRIPVVEDDTLVGIVTRTDVLRVMELREEE"
FT   gene            384587..384850
FT                   /locus_tag="Memar_0401"
FT   CDS_pept        384587..384850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0401"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: mhu:Mhun_0611
FT                   PRC-barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56334"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSI4"
FT                   /protein_id="ABN56334.1"
FT                   /translation="MRTQITEMFGLRVYTDRAVFIGNVDDVVLDVDQKKVDALAVGELN
FT                   PEIGEVKGYNGLQIPFRIVKSVGDIIIVRHIPGLFKSPAKED"
FT   gene            384892..385626
FT                   /locus_tag="Memar_0402"
FT   CDS_pept        384892..385626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0402"
FT                   /product="tRNA(His)-5'-guanylyltransferase"
FT                   /EC_number="2.7.7.-"
FT                   /note="PFAM: protein of unknown function DUF549; KEGG:
FT                   mhu:Mhun_0610 protein of unknown function DUF549"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56335"
FT                   /db_xref="GOA:A3CSI5"
FT                   /db_xref="InterPro:IPR007537"
FT                   /db_xref="InterPro:IPR024956"
FT                   /db_xref="InterPro:IPR025845"
FT                   /db_xref="InterPro:IPR038469"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSI5"
FT                   /protein_id="ABN56335.1"
FT                   /translation="MDTKDREIFSTLTIFPPVFVRLDGRAFHRLARARNLKKPFDPAFN
FT                   ESMRAVCRYLLTGSGLSPAFAYTFSDEISLYFNALPFSGRVEKLDSVTAAVAASKLTIE
FT                   LGCTEPLAFDARTIPAAGEFAVEYLVSRQNEAWRNHINAYCQNALVEEGMTAREAAAML
FT                   RGMQSEAMHEMMFERGVNLAATPAWQRRGTLLYRDECIKEGYNPLTGETVEAVRTCIRE
FT                   PEETPLFSTPEGEALIRSLTGA"
FT   gene            complement(385609..388788)
FT                   /locus_tag="Memar_0403"
FT   CDS_pept        complement(385609..388788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0403"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   mhu:Mhun_0606 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56336"
FT                   /db_xref="GOA:A3CSI6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSI6"
FT                   /protein_id="ABN56336.1"
FT                   /translation="MKEVTGSYNPRELEAGVQDTWKRENTYARVQEVRKDGKAFFFVDG
FT                   PPYTTGHIHLGTAWNKIIKDTILRYHRMGGRNIIERAGYDMHGLPIEVKVEHQLGFTSK
FT                   KDIEDYGIAAFIEQCRTFAVTHMEIMSEQFRQLGIWLDFDDPYQTIKAEYIESAWWAVQ
FT                   RAEERGLLERGHRVVNWCPRCETAIADSEVEYWDETDPSIFVKFPVTGRENEYLVIWTT
FT                   TPWTLPANVAVAVSPAFTYARVAAKKDGSEEILWIADELVESVLKMGRYQDYTVLERVN
FT                   GSDLVGTEYESPLAGQVPHQAEIRHRVVAADYVALENTGLVHIAPGHGWDDYLIGIQEG
FT                   LEAFCPVDAGGCFTREAGAFADMYVRDANDLVIDALGDYLLARRTITHRYGHCWRCKTS
FT                   IIYRATAQWFLKATEIREPMLQEIAKVKWYPEWAGSARFHDFVRDSRDWCISRQRYWGI
FT                   PIPIWQCEQCGERTVIGTIAELEERSGARVPDPHRPYVDEVVIPCSCGGEMHRVADIFD
FT                   VWFDSAVASWATLGFPREREAFDRLWPADFITEGQDQTRGWFYSQLGASTVAFGRAPYK
FT                   SVLMHGFALDADGRKMSKSFGNVVTPEEVMNQFGVDVLRFYVLWANAPWDDLKFNWDSV
FT                   KTIHRTLNILWNVYRFPLPYMVLDSFEPAAGDGGLWDGSFVRGNINDMPEEDRWIISRV
FT                   NSLARTTAGDMQEYHLHRVTRALAAFILEDLSRWYVQLVRPRMWLEEDSPEKRYAYETV
FT                   YYVMRRLVALLAPFTPHIAEEIYGNLRLAGDPESVHMLDWPEADDLLIAPDLESAMEVV
FT                   RSFDDAVATARQNGRRKLRWPVAETVVVTGSDGVKTALEDLNDLALNRANSRTVRVVTG
FT                   RWDRILWQAEPVMRAIGPEFGKEGPKVKALIEGADGTALKAAIERDGKAELGGYEIAER
FT                   HVTFAEALPEGVFAAPMKDATVYVDVTLTPALEAEGYAREVIRRIQEMRRQLDLNVDDF
FT                   IVAAVDVADDRVASLIAEEEWQKEIAGEVRAAALTVRRTDGERPTETFALEKDWDVEGV
FT                   QMQIGISRAGE"
FT   gene            388947..389429
FT                   /locus_tag="Memar_0404"
FT   CDS_pept        388947..389429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56337"
FT                   /db_xref="InterPro:IPR005268"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSI7"
FT                   /protein_id="ABN56337.1"
FT                   /translation="MQIAVIGRGDCSVEEYEAAETIGYLIAGNRETVCCGGLGGVMEAA
FT                   CRGAKEAGGTTMGILPDTGEGNAFLDIVIRTGLGHARNVVLVNSADAVIAVGGGYGTLS
FT                   EIAVALKTGKPVFGLLTWKIEGVFVCATPEEAVILAVRAGRLSRPSRSPRGPGESS"
FT   gene            complement(389356..391266)
FT                   /locus_tag="Memar_0405"
FT   CDS_pept        complement(389356..391266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0405"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG: mhu:Mhun_0664
FT                   molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56338"
FT                   /db_xref="GOA:A3CSI8"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSI8"
FT                   /protein_id="ABN56338.1"
FT                   /translation="MVKRYLSVISLAEARALVETAFSAVPGIVRIPVNPGAVGKITAES
FT                   IFARFSVPAIHLSAMDGIAVRSADTVGASEQRPVTLPDAARVNTGNIVPPGYDAVVMIE
FT                   DVWVGSKSDDVSGSAPVERRDGETYTVRKPVSPWQHIRPVGEDIGESEMILPRGHRIRP
FT                   HDLGALANYGVTEVAVMNLRAGLIPTGSELVPAGEMPPPGKVVESNTLMAAAVLAEAGV
FT                   EAHRYGIVPDDYGMIRDAIRRGVAENDILFVSAGSSAGTRDYTADVIADLGEVLAHGVA
FT                   IKPGKPVIIGRIEGKPVIGLPGYPLAAATVLREIVMPLVARYGMPVRDPDHVEARLTTS
FT                   LHSDIGTDEFVLLSTGRIGGRWVAVPQSRGAGVQMSAVRANGYMQIPSQKEGAEAGEAV
FT                   DVRLTVPHAEAEEAVLVTGSHDPALDYLADLVRPRGVDIHSTHVGSMGGVIALKKQECH
FT                   AAPMHLLAPDGTYNIHYLERYMPGADLVLLCVAERQQGIISRDGLGFEELPGRTFVNRQ
FT                   RGSGTRMLLDHHLAEHGIDPGLIPGYEREVTTHLAVALAVRTGEVDAGMGVYSAAKALD
FT                   LAFVPVATERYELAMHREMLDDPRIAALIETVSSEAFRKILRDLGGYETAGTGVLRELR
FT                   E"
FT   gene            complement(391260..392462)
FT                   /locus_tag="Memar_0406"
FT   CDS_pept        complement(391260..392462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0406"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG: mhu:Mhun_0663
FT                   MoeA-like, domain I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56339"
FT                   /db_xref="GOA:A3CSI9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSI9"
FT                   /protein_id="ABN56339.1"
FT                   /translation="MSLFLEVVSVVEAVKAVQKIAPPPGCEDVPLEDALYRVLAKDVLA
FT                   DIDIPGFDRSTVDGYAVAAAETTGASEAIPAMLQCRGRIGMGSADAGSISPGSCRYVPT
FT                   GGALPTGADAVVMIEHAEQIGDDILVHRPVAPGENVVFRGEDFGAGKVVLERGRVLSPR
FT                   EIGVAAAVGADRVSVVKMPRIGIISTGNELVPVAETPGAGEVRDANSYLAGAFVTERGC
FT                   HPVYFGIVRDERPVLKRAVSSALDRCDAVLVSGGSSKDERDNTAAVLAELGKVLVHGIA
FT                   IAPGKPTIIGTARGKPVIGLPGHPASAFVVLVAVVDHLLATMRQTAVSRRTVRARLTQN
FT                   IPSTRGREDYVRVSTSGGEATPVFGKSGLLNTLVQSEGVVRIPASSEGFEVGEEVEVIL
FT                   W"
FT   gene            complement(392459..392641)
FT                   /locus_tag="Memar_0407"
FT   CDS_pept        complement(392459..392641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56340"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSJ0"
FT                   /protein_id="ABN56340.1"
FT                   /translation="MDEDKIRKAFEASGIEDEITCPQAFEISEKYSIPKMDIARYCNQR
FT                   EPRIKIRGCQLGCFR"
FT   gene            392724..394049
FT                   /locus_tag="Memar_0408"
FT   CDS_pept        392724..394049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0408"
FT                   /product="Protein of unknown function DUF516"
FT                   /note="PFAM: Protein of unknown function DUF516; KEGG:
FT                   mhu:Mhun_0661 protein of unknown function DUF516"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56341"
FT                   /db_xref="GOA:A3CSJ1"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSJ1"
FT                   /protein_id="ABN56341.1"
FT                   /translation="MLYPMRIALINSQQDVGGVNIKNHLQTLLAAGGRWPLAEQHELTF
FT                   YEVAGRLIHQDRIDEEVDADLILFISRHASVHPTPALTVHVTGNYEGADLGGEPGRLAP
FT                   AAPAWMHAILGNLAARAPEGYRVSYEVTHHGPTALSTPSLFVEIGSTATEWADPAAGRA
FT                   VAESILAAEPQETIDLLGFGGTHYAVRQTEIALSSRGAFGHMVPTRQIGAVDPVLLRTM
FT                   QEASGAVAGYIDRKSLTKDDAGRIERMLGDAALPLLSESEIQEASGLAWAAYLRVRELA
FT                   EEIAPGSRVRIHDLRGEGTPAVVRIGPGLIEETIKSDRSGFLKGLDELPVAHLSKGSNE
FT                   VLSTFICFENESSRLASDITTLCVKLLLICENAVIDGDHLVLRKVRFDPEKARRHGIPK
FT                   GPLFAMLAGGKAVEIEGRMVTPDAVQTTSVKRIHIPGLERYI"
FT   gene            394046..395143
FT                   /locus_tag="Memar_0409"
FT   CDS_pept        394046..395143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0409"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ, GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   mhu:Mhun_0660 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56342"
FT                   /db_xref="GOA:A3CSJ2"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSJ2"
FT                   /protein_id="ABN56342.1"
FT                   /translation="MKSIVEEALSRAREEQRFAEPTEVDKDLEDLLMELRTEIAVVGCG
FT                   GGGSNTVTRMADEGINGARLIALNTDAQHLVRTRSDTRILIGRQRTRGLGAGSIPQVGE
FT                   EAALENEDDIKLAVQGCDMVFITTGLGGGTGTGSAPVVAKAAREEGALTIAVVTLPFTV
FT                   EGAIRGQNAEAGLERLREVADTVIVVPNDRLLEVVPRLPLHAAFKVSDEVLMRAVKGIT
FT                   ELITMPGLVNLDFADVRTVMERGGVAMIGMGESDSEDKAADSVKKALRSPLLDVDISGA
FT                   TAALVNVVGGPDMTMSEAEGVIQEVYDRIDPDARIIWGAQVDPDMQGKMRTLLVVTGVR
FT                   SPQIYGRNEKSMPRMMKQFEIDFLK"
FT   gene            395150..395359
FT                   /locus_tag="Memar_0410"
FT   CDS_pept        395150..395359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0410"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="TIGRFAM: protein translocase SEC61 complex, gamma
FT                   subunit; KEGG: mhu:Mhun_0659 protein translocase sec61
FT                   complex gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56343"
FT                   /db_xref="GOA:A3CSJ3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSJ3"
FT                   /protein_id="ABN56343.1"
FT                   /translation="MMDYKETLEEVKSFKIEEELFKKYWRVLKLARTPTRDEFSKIAIV
FT                   AAAGIMLIGLVGFIIYEIMLVLPK"
FT   gene            395365..395838
FT                   /locus_tag="Memar_0411"
FT   CDS_pept        395365..395838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0411"
FT                   /product="LSU ribosomal protein L24A"
FT                   /note="KEGG: mhu:Mhun_0658 NusG antitermination factor;
FT                   TIGRFAM: ribosomal protein L24; PFAM: KOW domain protein;
FT                   SMART: NGN domain protein; KOW (Kyrpides, Ouzounis, Woese)
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56344"
FT                   /db_xref="GOA:A3CSJ4"
FT                   /db_xref="InterPro:IPR005100"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011590"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSJ4"
FT                   /protein_id="ABN56344.1"
FT                   /translation="MVESPNRIYAIKTTAKQERTVADNIEKVSREQKDIHVMAVMVPEE
FT                   LKGYVLVESPDSIARIEQLVELIPHARAVVQGSTALSEVEHFLVPKPVVSGITEGTIVE
FT                   IIAGPFKGEKAVVKRIDTGKEEITVELYESMVPIPITVRGDSVRVVERSEDAS"
FT   gene            396033..396509
FT                   /locus_tag="Memar_0412"
FT   CDS_pept        396033..396509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0412"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11; KEGG: mhu:Mhun_0657
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56345"
FT                   /db_xref="GOA:A3CSJ5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSJ5"
FT                   /protein_id="ABN56345.1"
FT                   /translation="MAETVEVLVPGGKATAGPPLGPALGPLGINVKAVVDDINKKTAEF
FT                   NGMQVPVTVTVDDKKNFTIEVGIPPTTALVMKEAGITKGSTEPGALVAGDLPLEAAVRI
FT                   ARMKFDGMLSYDLKSAVKEVLGTCVSVGVTVEGKKPREMIQAVNNGEYDGVLVA"
FT   gene            396561..397202
FT                   /locus_tag="Memar_0413"
FT   CDS_pept        396561..397202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0413"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1; KEGG: mhu:Mhun_0656
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56346"
FT                   /db_xref="GOA:A3CSJ6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023669"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSJ6"
FT                   /protein_id="ABN56346.1"
FT                   /translation="MVDKTSIQEAVKTALSKAPERKFKESVDITVNLRNIDMSQPKNRI
FT                   DETIHLPNGFDNVKIAVLGKGDIVTQAKEVNVDLIIGPEEIERLGGEPREARKVAGEYR
FT                   FFLAETAMMPLVGRYLGVRLGPRGRMPMPVPQGMDIRPIVQRLRSSVKIRTKDKKVFHT
FT                   KVGTSGMEPEQIAENIDAVLHRVESVLESGTMNIHSVYVKTTMGPAVRVI"
FT   gene            397202..398242
FT                   /locus_tag="Memar_0414"
FT   CDS_pept        397202..398242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0414"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10; KEGG: mhu:Mhun_0655
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56347"
FT                   /db_xref="GOA:A3CSJ7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022909"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSJ7"
FT                   /protein_id="ABN56347.1"
FT                   /translation="MALYTHHLPRWKKDEVEEIKRGIEEHTLVGVVDMYGIPASQVQQI
FT                   RRNLRGTARVKMARNTLIEHALNELGGSVATLNDHAEGQSALIFTNENPFKLFKLLEKT
FT                   KTKMAAKPGETAPEDIVIPKGPTSFKPGPIVGELQQVGIPAAIEGGKVKIRETKTVVKK
FT                   GEVINKKVAEALVKLGVKPMDVGLILQAAYYRETIFTPDLLAIDEEVYANNIVLAAQQA
FT                   FNLSVNAVIPTRLTVAAIIGKAVSEARNVGVEASIYEKDIVDLIIGRAQREMLAVALAA
FT                   QGRGFELDEATLKAASAATAAAPAAAAPAAAEDKAEDKAEEEETEEEKKEEDEEGGMAG
FT                   LGALFG"
FT   gene            398271..398588
FT                   /locus_tag="Memar_0415"
FT   CDS_pept        398271..398588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0415"
FT                   /product="LSU ribosomal protein L12AE"
FT                   /note="PFAM: ribosomal protein 60S; KEGG: mbu:Mbur_1948
FT                   ribosomal protein 60S"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56348"
FT                   /db_xref="GOA:A3CSJ8"
FT                   /db_xref="InterPro:IPR001859"
FT                   /db_xref="InterPro:IPR022295"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSJ8"
FT                   /protein_id="ABN56348.1"
FT                   /translation="MEYIYAALLLHNAGKDVTEENVTAVLNAAGVEVQDARVKALVAAL
FT                   EDVNIEEAISKAAVAPVAAAPAAAAAPAAAAPAAEEEAEEEGKKEEEEESGMAGLGALF
FT                   G"
FT   gene            399027..400709
FT                   /locus_tag="Memar_0416"
FT   CDS_pept        399027..400709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0416"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: pca:Pcar_2730 putative ATP-dependent DNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56349"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSJ9"
FT                   /protein_id="ABN56349.1"
FT                   /translation="MSGDMDVQLREIMRLPAETEWIEFKEAKNNYDFDKIGKYFSALSN
FT                   EANLNEKPAGWLIFGVTDKLPREIIGSNYRLTPPGLDRLKEEIARHTNHEMTFAGIHEL
FT                   MIDGKRVIMFETPPAARGIPTTWKSVAYGRIHESLGPLGLHEIEVIRRQAPLDDWSAKV
FT                   CVGATLADLDPEAIAFAREKYKEKHQVFASEVDEWDDVSFLARAHVCRQGRITNAAIVL
FT                   LGKSEAAHLLSPAIAHITWVLRDKDEVEIDYAHFGLPLILAVDKIFSKIRNLTVRHISG
FT                   ETLFPLEVTQYDPWVVREALHNCIAHQDYQQSARITVTERPDSLVFTNRGDFIPGTVQS
FT                   VIERDVPPDQYRNPFLAGAMVELKMIDTIGSGIKRMFRIQRDRNFPMPDYDLGEAGVVK
FT                   VTIPGRVIDERYTRMLIKRKDLTLMDVITLDKIQKGYSITPEERTILRTKKLIEGRHPN
FT                   LYVSESVAAETDTRADYIRKRSFDRAHFKSLVVAYLKAYHEANRAEIEDLLLDKVSDAL
FT                   NEEQKHHFIRDLLQEMRKDGTIMPIGRTKAAKWVLVPDQVHDA"
FT   gene            complement(401030..403237)
FT                   /locus_tag="Memar_0417"
FT   CDS_pept        complement(401030..403237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0417"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="TIGRFAM: [NiFe] hydrogenase maturation protein HypF;
FT                   PFAM: acylphosphatase; SUA5/yciO/yrdC, N-terminal domain;
FT                   zinc finger, HypF domain protein; KEGG: mhu:Mhun_2500
FT                   (NiFe) hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56350"
FT                   /db_xref="GOA:A3CSK0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSK0"
FT                   /protein_id="ABN56350.1"
FT                   /translation="MRTSGTIIIRGIVQGVGFRPFVYAKAREFGITGTVKNLGSEVEIH
FT                   ASGDRFEEFFEAVSRGTPLSQIDSVDVQNLRGSPTEGFTILESNSGSLSGFIPTDVATC
FT                   DDCIADIFTRDGRYEGYWATSCVNCGPRYSIISTIPYDRERTSMAEFPVCPACEGEYTN
FT                   PSCRRHHAQTIACAACGPHLALLRADGTPAAGDPIRETAALLDAGSIVAIRGIGGFHIA
FT                   CTEEAAGVLKRRLGRTEQPLAVMATAEEVERIAIVSDEERRILHSRERPIAVLEKRDPA
FT                   SHPTISSLHTIGCMLPYTGLHHLLFANLAHPLLVMTSANLPGYPMITDLDTALERLPGQ
FT                   VDYILTHDRRIVNRCDDSVVRDGYIIRLSRGLAPKRKAIDLGGGSILGVGPELNANISI
FT                   YKSGFCITSPHVGNVRNPQTLAYLQETAERLGGLTGARYDRIVHDLHPQFLSTRYAREV
FT                   AEAVGAELLAVQHHRAHIAATTREECVGIAIDGVGYGDDGTIWGGEVFAGEVPHLDRVA
FT                   HLEVVPMPGGDLATRFPERMLYGILPTSEVRDMLASRGWSDIELAVLVRQVERGLNVAA
FT                   TSSTGRVLDAGAALLGICRERTYDGEPAMKLETAAHAGKPSAWENEYQRDGGCEVLSTR
FT                   SLLAEAHRRSAAGERANDIAASIQYNLARGVAAMAVRAAEERGIPRVALSGGVAYNRAI
FT                   RETIRTEVLAAGLEFIMNKDYPLGDGCISFGQVVYGGSTEK"
FT   gene            403295..403807
FT                   /locus_tag="Memar_0418"
FT   CDS_pept        403295..403807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0418"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: mhu:Mhun_2501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56351"
FT                   /db_xref="InterPro:IPR014517"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSK1"
FT                   /protein_id="ABN56351.1"
FT                   /translation="MTGHIKILNDPVELVPLLITFNNADYKKIYELLNKAWLTEEDLAT
FT                   YAGSSTVTECLSILKKGNLIEEQWRMPKPGEKPTKEYRATYSKFRASFQCSMGDIGDLL
FT                   HIAVSNDEGLRTIVDSVEQEIVAGTTSIGDISRKYGVSPTFIKGLAKRIPGLDVKGQGM
FT                   VLLDRLH"
FT   gene            403791..404600
FT                   /locus_tag="Memar_0419"
FT   CDS_pept        403791..404600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0419"
FT                   /product="regulatory protein, MarR"
FT                   /note="PFAM: regulatory protein, MarR; Helix-turn-helix,
FT                   type 11 domain protein; SMART: regulatory protein, Crp;
FT                   KEGG: mhu:Mhun_2502 regulatory protein, Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56352"
FT                   /db_xref="GOA:A3CSK2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012015"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSK2"
FT                   /protein_id="ABN56352.1"
FT                   /translation="MTDFTDDPLYVILRSKREATRFQILVEIAEHQPAVRQQEIAAKLG
FT                   VTPQAVSEYIRELVDEGLVTAHGRGRYEVTKSGIEWVLRHAEALEAYARHINRDVIQQV
FT                   AVWTAIARDDIRKGDTVGVFMRDGWLYATGEEQSATGLATMDAAPGEDLGVAQLNGIIQ
FT                   HEEGLIHVCKVPRVERGGSRQVSPDLLREAVRDAEMVGAVGLESYVALRKAGIEPDMFF
FT                   GAREGVVEAAFHGRECAILIVDEEFTDFLKRLETVGLAYTIHDLIPS"
FT   gene            404597..406606
FT                   /locus_tag="Memar_0420"
FT   CDS_pept        404597..406606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0420"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like;
FT                   KEGG: mhu:Mhun_2503 DEAD/DEAH box helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56353"
FT                   /db_xref="GOA:A3CSK3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSK3"
FT                   /protein_id="ABN56353.1"
FT                   /translation="MKVIVQPQKGTYKLLFVEGGRVEGSGFVDLAATPKGRRPKNFKMR
FT                   RRGKQLKPTPTRDLITLLRRSSVLLAAKSPEFESFLADLQIPSSRIDICRFCQLEDRFA
FT                   PVDKATGVRYGGEWICMECAKREMRRELGYLGKFGGSVLVHLEKLLAQIRDLDRVLASV
FT                   GPDHPDRKRTLFDRLEAHEVQKTAHITDLPLPPAFAKAAGVEYLMPVQQLAVQNGLLEG
FT                   QHLLVVSATASGKTFIGEMAGMKNFLEGRGRTLFLVPLVALANQKYQRFRDRYGHLVRV
FT                   TLQTGVSRLNLPETRPAGDRDVNAPVVVGTYEGIDHALRTGRSVKDIGTVVIDEVQMLE
FT                   DPERGHRLDGLIARLKHIAPEAQFLYLSATIGAPGLLAEKLRANLVRYADRPVPLERHL
FT                   IFIERNKKIGFIKQMAAEEYKVRSSKGYRGQTIVFTNSRARCHVIADALGTKAAPYHAG
FT                   LTSQERRDVERRFTNGEISAVVTTAALAAGVDFPASQVIFDALAMGIQWLTVQEFHQMM
FT                   GRAGRPDFHDLGRVVILAEPGGSYSRTSGKTEEEVAVGLLRGEMEEVAPEYDMEQSTEE
FT                   FVANAVVSNGDEQQVIKMNRTMVGTLEPALPTLLDYGLVRRRGGRIELTDMARVMAEHF
FT                   IGAERLMEIMDLVRRMDDAAEVVAELECAEEKTP"
FT   gene            complement(407126..408199)
FT                   /locus_tag="Memar_0421"
FT   CDS_pept        complement(407126..408199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0421"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: histidine kinase
FT                   A domain protein domain protein; PAS fold-4 domain protein;
FT                   KEGG: mhu:Mhun_1147 putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56354"
FT                   /db_xref="GOA:A3CSK4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSK4"
FT                   /protein_id="ABN56354.1"
FT                   /translation="MASRNDQPPFPAFPPAAHCISRAPNQAPLTLVLPFGFSREFLTSP
FT                   AVLLIELLLVCIAFGLLGIWLKEREVATRIAGMDASIEGIRTTGSIPPRLPAAGGDPIS
FT                   RFVEEVNLVLVELERSRRDLQESRDRYRLLFESGNDFLLVCAVGREGTPYRILDANALA
FT                   CRCLGYTRDELFALTPGSVILVRSDFKKGGQRLHSADLIPREGERIPVEASIHRITLGG
FT                   TPAILIIARDVTERRRAEKELMDYRYRLEELVTQRTEELRAANESLKREMRERERIERE
FT                   RMEAYRQIERNIEQFAVLTDHIRNPLQVVQGMADLIDDPRAEKIREQVRQIKAILRQLD
FT                   EGWVESEKVREYLERYR"
FT   gene            complement(408480..409673)
FT                   /locus_tag="Memar_0422"
FT   CDS_pept        complement(408480..409673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0422"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mhu:Mhun_2873 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56355"
FT                   /db_xref="GOA:A3CSK5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSK5"
FT                   /protein_id="ABN56355.1"
FT                   /translation="MNTAKRIYNVLFISVFATMLGLGIVSPLLPIYAENLGATGIWLGI
FT                   IFSAFALSRSVFMPVIGRISDRRGRKWIILIGMFAYAVLSLAYIIVDSVYSLTAVRFAH
FT                   GLASAMVVPIAMAYVADLSEKGREGSHMGNFSISMFLGMGMGPLLGGFLNDAFGLDSVF
FT                   YVMAGLSAFATILVGISLPEAKRGTFTVQEGNPVPMRKILTLPVMRGVMVFAFISALGR
FT                   GGMMVFIPVFGPLIAISPTEVGIVLSANTFLMALLQVPMGRITDTGNKVVLIVAGSAIT
FT                   ALAIGAIPFSGSFGPLLAITSLVGIGGAIQQPAIMALTVDAGRTIGMGTSMGAYNTVFG
FT                   IGMIIAPLMGGVFMDYIGIDAVFYVGGAISLLGTGIFAVMMQRNARAADRKDIPGSG"
FT   sig_peptide     complement(409572..409673)
FT                   /locus_tag="Memar_0422"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.891) with cleavage site probability 0.881 at
FT                   residue 34"
FT   gene            complement(409791..410627)
FT                   /locus_tag="Memar_0423"
FT   CDS_pept        complement(409791..410627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSK6"
FT                   /protein_id="ABN56356.1"
FT                   /translation="MKVAEILEIDGCRLVEPSFADLTVDPYTDLLLRTVPDEARLLVDE
FT                   KEEPIALALHDDEGWHAASFLFREPTLAAIECFEAVGGDIYQESREAWLSAIREYYSAE
FT                   LLETTFPALEDLRPDREGKIRDLLDEVWGDRTGTPCLDCCCGSGVGTAALRAGGVRALA
FT                   YDNDPALLALGLSKGRLVPSDTMCIDAQKAPRYIAPVPLGAAFMVGEIYSYNTALWRSI
FT                   VANLLALTDEALITVGTEEEAARVQEWCAGQGRETEIFENRRDPLYDRWCCVARRA"
FT   gene            complement(410624..411478)
FT                   /locus_tag="Memar_0424"
FT   CDS_pept        complement(410624..411478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nph:NP1670A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56357"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSK7"
FT                   /protein_id="ABN56357.1"
FT                   /translation="METTGDHDWIRSCALPDHTELQERTLKTDQDIVIGERCRIDYGLF
FT                   GNDVVVCEFSKINGNIVASGDARIDNWCEINGDVVVEEDAYLGEGVKIQGKLVVKGDLD
FT                   IGDNVQIERGFEAKGWISIRNPMPVIIYIMMYLVAVLGIEKEEDLSSVLEKIFGDDDET
FT                   TPSATPLMIPGGAVLNMQTFSVPEKMAVGSGCRLHGNIRAGSIAVREETTIFGSLHARE
FT                   DASVARGTAIHGDVQSDGDVMIEQDVHILGNVSCKRLTLHEDARVDGVIRAPGGMKIER
FT                   RTA"
FT   gene            complement(411495..412730)
FT                   /locus_tag="Memar_0425"
FT   CDS_pept        complement(411495..412730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0425"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: afu:AF1751 phosphoglycerate mutase; TIGRFAM:
FT                   phosphonopyruvate decarboxylase-related protein; PFAM:
FT                   metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56358"
FT                   /db_xref="GOA:A3CSK8"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSK8"
FT                   /protein_id="ABN56358.1"
FT                   /translation="MIAEKVLFLVLDGISDRPCEALDGLTPLAAARTPVLDRLAAEGVC
FT                   GIMDSVAPGIRPGSDTSHLALLGYPPQEFYTGRGPLEAEGTGIHMTAGMIGFRCNFATV
FT                   DADGLVTDRRAGRISGTEPLAEAIREGVDLSGLGLEFRFEAGAGHRAALALIGEGLGDK
FT                   VSSNDPKKEGVQPLTIRPGSDDPADAKTARACNEFIRQSREILDGHPVNVRRMEEGLPP
FT                   GNLLLIRGAGKMGALPQFPERYGLSGSVISAATLISGIGMVVGLEHIPVPGTTGSVDSD
FT                   LDAKVRAAIGELGRKDFVLMNIKGADEAGHDGKSIQKRDFIEVIDKALAPLLDLKNTLI
FT                   LVCADHSTPCSVKDHSADPVPVVIRGPGVRIDRTNRFDEVSCAEGGLHRIRGRDLMPII
FT                   LDLINKSHKYGA"
FT   gene            complement(412758..413267)
FT                   /locus_tag="Memar_0426"
FT   CDS_pept        complement(412758..413267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56359"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSK9"
FT                   /protein_id="ABN56359.1"
FT                   /translation="MTGYTPPEYEREVTAVMVEGQHTKGRRTTRVVLNHRGLDERQTMA
FT                   RGIIRRMLIQFHREWDELRERESGSARVLALNMMLDRYSHQIYNSACDMRTVLGEELAG
FT                   ELRCLSADVIMTTNILIMLGCGEECREESETLAKEALLRIEHCLALVQKGKGCPPTWIS
FT                   AAHREE"
FT   gene            complement(413355..413948)
FT                   /locus_tag="Memar_0427"
FT   CDS_pept        complement(413355..413948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0427"
FT                   /product="SSU ribosomal protein S3AE"
FT                   /note="PFAM: ribosomal protein S3Ae; KEGG: mhu:Mhun_2508
FT                   ribosomal protein S3Ae"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56360"
FT                   /db_xref="GOA:A3CSL0"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR030838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSL0"
FT                   /protein_id="ABN56360.1"
FT                   /translation="MARKKQVGRRLEGWKAKKWYRVYVPDAFGKAEIGDAISADPENMV
FT                   GRIMTATLGEVVQDYSKSHIKMRFKINNVAGDAAYTEFVGHEVTRDYLRSMVKRRASRI
FT                   DTIHPVVSKDKKLLRVTVVCLTLSRADQSQVHAVRQAISQALSARAAESDFETLVKDIV
FT                   SGDMARDIFKAVKTIYPIRRVEITKSKLEQVAAV"
FT   gene            complement(413953..414255)
FT                   /locus_tag="Memar_0428"
FT   CDS_pept        complement(413953..414255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56361"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSL1"
FT                   /protein_id="ABN56361.1"
FT                   /translation="MIRIEGAIETPHSHPGCVAAALEPDNLTLIRTFPIEGGVRAEIDG
FT                   TRLRSITASVDDYLMNLAIAEDVCTAASKRRQGGSESSGVESGSNGLKIHNNREK"
FT   gene            complement(414252..415469)
FT                   /locus_tag="Memar_0429"
FT   CDS_pept        complement(414252..415469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0429"
FT                   /product="phosphoesterase, RecJ domain protein"
FT                   /note="PFAM: phosphoesterase, RecJ domain protein;
FT                   phosphoesterase, DHHA1; KEGG: mhu:Mhun_2510
FT                   phosphoesterase, RecJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56362"
FT                   /db_xref="GOA:A3CSL2"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSL2"
FT                   /protein_id="ABN56362.1"
FT                   /translation="MSLDAAAASLADHLLEQEFVEVLAHHDADGIAAASILCHAMFREG
FT                   GRFRLRIRPGISTADLPGDGSVLLCDFGSALTDLPGDVMVVDHHLPRFEGDYHVNPHLA
FT                   GIDGDRDISAAGAAYLVAQRMGDNRDLAGLALLGIIGDDQALDGPNREIVNEGIANGFI
FT                   APRRGLRLPGRGLVEQLALAVDPYLPGFSGVPDRARTLVAEVTDEDDMDIESLLTRIVL
FT                   AAAPNASVSALCGIWGTTYSLGREVIDEALNLAAVVDACGKAGNGDIGASLCLRSSHAI
FT                   QEAWEITARYRQAVVTGIHGARRLDERVALFAVDDGSVASDVADALANDFVRSGPVFVI
FT                   GRIGDHCSVSARCPPGIDLDLEAVMRTIAEACGGQGGGHRLRAGARIAADQADQFRHEL
FT                   LEAIPA"
FT   gene            complement(415476..415934)
FT                   /locus_tag="Memar_0430"
FT   CDS_pept        complement(415476..415934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0430"
FT                   /product="SSU ribosomal protein S15P"
FT                   /note="PFAM: ribosomal protein S15; Ribosomal S13S15-like;
FT                   KEGG: mhu:Mhun_2511 ribosomal S13S15-like"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56363"
FT                   /db_xref="GOA:A3CSL3"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="InterPro:IPR023029"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSL3"
FT                   /protein_id="ABN56363.1"
FT                   /translation="MARMYARRRGTSSSVRPYRKEAPEWSNTDATEIEKIVVDLRKDGM
FT                   STSQIGLVLRDRYAVPDVKLATGKRIGEILREKGLESEIPEDLRNLMEKALGIRKHLAE
FT                   NNKDVHNKRQLQIAESKVRRLVKYYVRSGRMPKGWTYKPETAEILLTR"
FT   gene            416281..416351
FT                   /locus_tag="Memar_R0007"
FT                   /note="tRNA-Gly1"
FT   tRNA            416281..416351
FT                   /locus_tag="Memar_R0007"
FT                   /product="tRNA-Gly"
FT   gene            complement(416378..417196)
FT                   /locus_tag="Memar_0431"
FT   CDS_pept        complement(416378..417196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0431"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; 4-vinyl reductase,
FT                   4VR; KEGG: mth:MTH1349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56364"
FT                   /db_xref="GOA:A3CSL4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSL4"
FT                   /protein_id="ABN56364.1"
FT                   /translation="MEQGTNSRGRPGRPKANLEIDLYSTPAGARAVENPVRRTILAALR
FT                   ERECTFEEIVSLAGRAKSTVSVHLQDLAAAGVIGSRPDPEDSRRKIFFLTGDLVASVLP
FT                   ETRVADDLAAYAGMYRPGSGDPFAFYRLAFRTIRVSLMQEGVLLDPLLTRAGEWLGEEL
FT                   YPAVAAPETGAFCANIARFWEEHRLGRIEVAETEPLVLLIYDCFECVDLPVTGKPACAF
FT                   DSGILRALFSRHYGRPAEAVETRCYSMGFDHCRFEIAVEGGGREECRTPE"
FT   gene            417278..418492
FT                   /locus_tag="Memar_0432"
FT   CDS_pept        417278..418492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0432"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: afu:AF1520
FT                   flavoprotein (FprA-2)"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56365"
FT                   /db_xref="GOA:A3CSL5"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSL5"
FT                   /protein_id="ABN56365.1"
FT                   /translation="MMPTKLAPGVHWVGAIDWNLREYHGYTLPGTTYNAYLVQGEKTAL
FT                   IDGAYAGFEGEVLGRIGSVCDPGAIDYIVVNHIEMDHSGTLPAFVRRMPAVPIYCTERA
FT                   RAGLARHYDTTGWNIRVVKSGDTLDLGGKTLVFLEAPMLHWPDSMFTYLAEDAILFPND
FT                   AFGQHVASAARFDDELGRDAAMTHAQKFFANLIIPLAPKVLKKLNEVGGLGIDIRMIAP
FT                   SHGVIWRSHAGDILEAYTDWSRGVAKDKVTIVYDTMHGSTTMLAKAIAEGVMAEGADVR
FT                   VCLLRDGRYEGTHRSDIVTEVLDSKAVLVGSPTLQDEVLPTVAGFLSYLRGLRPGRLTA
FT                   KKIGCAFGSHGGMGGAVAQAEAALKAAGIEVIDGGFHVNYRPDGDEIARAYELGRRVAR
FT                   EIRAR"
FT   gene            complement(418560..419729)
FT                   /locus_tag="Memar_0433"
FT   CDS_pept        complement(418560..419729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0433"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mhu:Mhun_1092 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56366"
FT                   /db_xref="GOA:A3CSL6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSL6"
FT                   /protein_id="ABN56366.1"
FT                   /translation="MDGKHRAAYTVIVLFGIVSLFGDIIYEGARSVSGPYLYILGASAL
FT                   AVGVVAGLGEFLGYALRLASGYLADTTRHYWAITFIGYGMLAAVPLLALAGSWEAAALL
FT                   LILERAGKGIRVPARDAILANATTTVGRGWGFAVHEALDQVGAVIGPLIFTAIFLAQGD
FT                   YRSGFALLAVPFVLMILALLFARRRAPEPVSLEAGGSDSRGTSLPGPLLPYGVFTALTM
FT                   AGFAAFPIIAYHFAVTGTVSEAEIPLFYAVAMGVDAIAALTIGRAYDRFGLVTLLSVPL
FT                   LAIGIPFLAFGTSYALALAAVVLWGAAMGAQETILRAAVADYTHISKRGTAYGIFNTVY
FT                   GAAWFAGSAVIGWAYTVAVPLVVGFLVVMQIGALAAFAWMRRGSAAPAS"
FT   gene            419929..421002
FT                   /locus_tag="Memar_0434"
FT   CDS_pept        419929..421002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0434"
FT                   /product="conserved hypothetical protein 374"
FT                   /note="PFAM: conserved hypothetical protein 374; KEGG:
FT                   mhu:Mhun_1115 conserved hypothetical protein 374"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56367"
FT                   /db_xref="GOA:A3CSL7"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSL7"
FT                   /protein_id="ABN56367.1"
FT                   /translation="MKNLRWIALSLLLSGAALIGLLAATFTPATRAYLGEVGVAALLLA
FT                   FALRAGSILCRVVRIGVICRGLGYTVPLSSLAITQSLSLFAGSITPGQVGGEPVRIHRL
FT                   SRSGLAVGDAVTVVVAERVLDLAVFASLTVAALLAVQHLWDYLAATVLYPVAAFLVLVL
FT                   SLLLALVLLVRRPSLANRVIGGAAVRVLDRCGRSRRWLRFCPGSDGAEGLAERIARETE
FT                   IFAASSSRFVRADPRALGGAILISILDWVLLFSTASALLVALDLPPSFPESFLFQGILQ
FT                   MIAAVPLIPGAAGIAEIGAATLYSRIVPTYLLGLFVVLWRLILYFLNIPLGLLAAALAA
FT                   RERSGGEGADRLGTENL"
FT   sig_peptide     419929..420027
FT                   /locus_tag="Memar_0434"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.493 at
FT                   residue 33"
FT   gene            421122..421781
FT                   /locus_tag="Memar_0435"
FT   CDS_pept        421122..421781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0435"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   mtp:Mthe_0706 amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56368"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR015832"
FT                   /db_xref="InterPro:IPR040537"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSL8"
FT                   /protein_id="ABN56368.1"
FT                   /translation="MYALSIITENRAGVLRDVATVMADYLANIQMIQQSIIASGPNTGK
FT                   AYLYFEFEECGNHGELIADLARVPSVVDVTIYPPFSRIFGSRVIIIGGGAQVAQVALGA
FT                   VNEADRHNIRGERISVDTIPLVGEQDLALAVDAVARLPRASILVLAGSLMGGEVSRAVE
FT                   RVRAAGIPVIALKMAGSVPSHADLVVTDPIQAGVFAVMHVSGKAVFDINRVRGREF"
FT   gene            421781..422356
FT                   /locus_tag="Memar_0436"
FT   CDS_pept        421781..422356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0436"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC, N-terminal domain; KEGG: mhu:Mhun_0562
FT                   SUA5/YciO/YrdC/YwlC"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56369"
FT                   /db_xref="GOA:A3CSL9"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSL9"
FT                   /protein_id="ABN56369.1"
FT                   /translation="MDPIDMAVRVLSRDGLVVYPTETVYGLGADALSEDAVMRVYEAKN
FT                   RPLGKPISIAVSDMEMLAAVAVVDDAARAFIERFLPGPVTVLLPAKSCLPAVLTGGTGL
FT                   IGVRWPDHEIAAAIIARLDAPITSTSANISDDIPPTRPDEVSVPHDYLVDGGELPGTPS
FT                   TVVDLPARRVLRKGAGWEAVEAFLESLK"
FT   gene            422353..423279
FT                   /locus_tag="Memar_0437"
FT   CDS_pept        422353..423279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56370"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSM0"
FT                   /protein_id="ABN56370.1"
FT                   /translation="MSSIRLRDFIEDREGCLYAVSNYDNAERIGCILRYVPDPDGERTN
FT                   LAGRRYHKYDFAESFDWIRAHKPEYLDSVHRVPYCDVARVYKPEEEIAGVAARNRRVAR
FT                   LLAHLDLPAGSFGCTGSLLCGLENGASDIDLVVYGDAWFVAQRRLRDLVERGAIPGMST
FT                   AMWRKVYDKRVPEISFDAFVLHEQRKWNRGEFEGTYFDLLYTRDYGNLDAIPAGAGRVL
FT                   GRATIEATVTGASLSFDSPAVYAVDHDEISRILSFTHTYSGQALAGEVIEAKGVVEEHG
FT                   DERWLIVGTTREAKGEYIVSKTLLESV"
FT   gene            complement(423276..423938)
FT                   /locus_tag="Memar_0438"
FT   CDS_pept        complement(423276..423938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56371"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSM1"
FT                   /protein_id="ABN56371.1"
FT                   /translation="MTDYIPVSGVVACHICPRRYYFERSEEHPESPRYTVCKQVSTHLG
FT                   ELLEAEQIWQEILCVLPEAAEDVRELFDECVAACSETKWERPVQVDLAVESDTLGIRGR
FT                   VDKIFEDGTFAVTRSSAAPKAGVYNTDRLRIACYVACLKETLGRPVAGGYVEYVASGVC
FT                   RYVEPQPRDRREMIKAIRAAKRVVAGELPPRPLRAPCEGCPHLERCTAGPRRLSDLF"
FT   gene            424055..424357
FT                   /locus_tag="Memar_0439"
FT   CDS_pept        424055..424357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0565 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56372"
FT                   /db_xref="InterPro:IPR021857"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSM2"
FT                   /protein_id="ABN56372.1"
FT                   /translation="MGMANREISVNIPGNLDPVYSNRIQIAYKEDEFTFLFLHEIPGMN
FT                   QARGKAIVSISPRHAKNLVEVLAKSVADYEQKFGKITAPEAAAQQESNVTIRGYS"
FT   gene            424431..424502
FT                   /locus_tag="Memar_R0008"
FT                   /note="tRNA-Thr1"
FT   tRNA            424431..424502
FT                   /locus_tag="Memar_R0008"
FT                   /product="tRNA-Thr"
FT   gene            complement(424709..425947)
FT                   /locus_tag="Memar_0440"
FT   CDS_pept        complement(424709..425947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1779 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56373"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSM3"
FT                   /protein_id="ABN56373.1"
FT                   /translation="MPLTDRYIGSELSVVERELIFNDKYANVGFVKYDTKDGEYFFLNP
FT                   SPFLKTSKNEIYHVSGHPPPENQFIEANVIDEKTVILPRTVRKSINVKEVDSWKLFDPT
FT                   PLAQRRKILDFEEIVEYFAYPLTGEDEVVEEIAGCSSLFAFSSPPIEDDTGGIKSAIFG
FT                   KNYQWDLFRKPLKVIPDDFRKTSSDYYYYISKLERNLSKTEGEVNLAILQPEKLVSDIP
FT                   IYFEGVKERKHSKDYYSLLDQESGVITAYILDSLLLKPQYTGKVEAMMHDAIYELREEY
FT                   YSSGQRPYHQNVGDALPKLASSYARLRASPDIEPPDVKYATDLWFSMFRKAEKITSNPA
FT                   KISDLFLITGDARKVYYKLYDIFGADYWIPVIEAVEVMAMDPEDVEISVDALVEKGYCV
FT                   RKEGHIMLLEPFK"
FT   gene            complement(426098..426814)
FT                   /locus_tag="Memar_0441"
FT   CDS_pept        complement(426098..426814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56374"
FT                   /db_xref="GOA:A3CSM4"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSM4"
FT                   /protein_id="ABN56374.1"
FT                   /translation="MEDEFFLHPIAIEETLDEIKTAVEERARALPEERNVRKKLDGWVL
FT                   GITELQTKAAHIQQHIIPQVRRDLQFDFEDSNLILRVMVDGTAKDMFSDMLKEFPETRH
FT                   PELRKSIYEFSKLPGKVESLAYLGNAALLLAAVHHLWASDTTPSKAMLDQKGQPFKDKK
FT                   YQAQLERKWMLYENTIGFDHKPRSNIDKENHDRSTLVEAVFGLLYIKGGLDAVIKAMPL
FT                   FLEEPDIKRELGSSRT"
FT   gene            complement(426983..427591)
FT                   /locus_tag="Memar_0442"
FT   CDS_pept        complement(426983..427591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56375"
FT                   /db_xref="GOA:A3CSM5"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSM5"
FT                   /protein_id="ABN56375.1"
FT                   /translation="MGVKTVEDCVYEINRLADKAGLIREICSYQCRKYKWISSGLSLSI
FT                   LFFSASIAFLSIADPTILQSLSLPFHAQQDTRNVIAFLGFLIFVISFSDRILNLTETLN
FT                   RNEQGVKILTDFIRDCHTFTDTGARDCDEITAAMKLESIKEQYGYLNQVMSPNTLFSKT
FT                   FLKIKKGYKMKVRVSKMLDGDPNISISKHYRMRIWNWLF"
FT   gene            complement(427615..427857)
FT                   /locus_tag="Memar_0443"
FT   CDS_pept        complement(427615..427857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56376"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSM6"
FT                   /protein_id="ABN56376.1"
FT                   /translation="MQQIITFGTIWNERSFETNISNQLISLNGSTMSTRCLLLYSGGIA
FT                   STACLHHLLSAGFAVTPLYVDPGQSELKNELERIS"
FT   gene            complement(428158..428712)
FT                   /locus_tag="Memar_0444"
FT   CDS_pept        complement(428158..428712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA2506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56377"
FT                   /db_xref="GOA:A3CSM7"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSM7"
FT                   /protein_id="ABN56377.1"
FT                   /translation="MANDIESGAGSLDTGGAAGSARWFVLFLGIIAILFGVLFFVYPIP
FT                   TLTLLATILGIYWLANGVVVLLSLSRHKTGWGWKMLVGILGILAGVIVLIYPLYSAVLV
FT                   PTIYAIIIGVEGLVIGAIYLVQGFSGEGWGTAVLGILSIIFGLILIAHPLIAALAFVLL
FT                   IAVLAIIGGIAAVILALRMPG"
FT   gene            429146..429592
FT                   /locus_tag="Memar_0445"
FT   CDS_pept        429146..429592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0445"
FT                   /product="metal-binding protein-like protein"
FT                   /note="KEGG: mhu:Mhun_2153 metal-binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56378"
FT                   /db_xref="InterPro:IPR014925"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSM8"
FT                   /protein_id="ABN56378.1"
FT                   /translation="MGDPIRLGIIICDRYRTCAGGKCLRALRDREGAFERYKGKDVELV
FT                   GFATCNGCPGGNIEYVPQEMKNNGAEVVHLATGMVVGYPPCPRISYFSRFIREKYDMDV
FT                   VVGTHPIPEKYFTTHTNLGSWDSALWKDLIAPTLTDEKTRLSYD"
FT   gene            complement(429772..430437)
FT                   /locus_tag="Memar_0446"
FT   CDS_pept        complement(429772..430437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0446"
FT                   /product="5-amino-6-(5-phosphoribosylamino) uracil
FT                   reductase"
FT                   /note="KEGG: mac:MA4367 5-amino-6-(5-phosphoribosylamino)
FT                   uracil reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56379"
FT                   /db_xref="GOA:A3CSM9"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSM9"
FT                   /protein_id="ABN56379.1"
FT                   /translation="MYPEVIIHNTVSLDHAVRGFEIDLGLHYGALLALEPGAVLAGSAT
FT                   ARSGIELFTDVNETETEADRHRPEVRPDDPRPVCVIVDSKGILKDLLHFYRNMEHTKDV
FT                   IVLVSEATPEDYLDYLREREYPFIRRGKDRVDLKGAIRELGERFGISRVVSDTGPDLND
FT                   VLIREGIADTISLIVHPVVVGEGEKKLFGRAGGRTALELRKAVPLEQGTVHLVYAVKK"
FT   gene            430636..431841
FT                   /locus_tag="Memar_0447"
FT   CDS_pept        430636..431841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0447"
FT                   /product="metal-dependent phosphohydrolase, HD sub domain"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: pcu:pc0465 putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase (dGTPase )"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56380"
FT                   /db_xref="GOA:A3CSN0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSN0"
FT                   /protein_id="ABN56380.1"
FT                   /translation="MEIPQSIFDRMERSMADRESLLSRRATRNADYLRRSGCKPEDPVI
FT                   RPPFFRDADRIVHSKAYSRYIDKTQAFYLVENDHITHRVLHVQLVSKIARTIGRALCLN
FT                   EDLIEAIALGHDIGHVPYGHLGEKFLDELCTEHGLGGFRHNVQSVRFLDVVEDCDLTLQ
FT                   VLDGILCHNGEVHAQSLTVEGEARWDSFAEKLARIEAGADALPLTTEGCVVRCADSVSY
FT                   LGRDLADALEVEVIDERDLDDFPENCMNFFGIAGRKKEDFSEVNRRVLDVLIRDIIAGS
FT                   YDADCIAFSAEASACVAAFKEFNMQHIYDNPRLLANQKKIRFMFRYLFDRTLEDIAEER
FT                   EASPVYEDLINAPWASPRYIATAAPEELARDFIAGMTDRYFEWAFQRSILPERVRSRYR
FT                   GW"
FT   gene            431978..432319
FT                   /locus_tag="Memar_0448"
FT   CDS_pept        431978..432319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56381"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSN1"
FT                   /protein_id="ABN56381.1"
FT                   /translation="MNKRILILGLAAALVLTAGCMGLGGPSPRVVEDSMVTDISLSKGL
FT                   GYNVNAVIQNDGGDGDVTVTMKLIDEEKGFVRDEVSTVVSITSGETKKVSLTLDGDLGR
FT                   TYRYSVEVS"
FT   sig_peptide     431978..432046
FT                   /locus_tag="Memar_0448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.535 at
FT                   residue 23"
FT   gene            432392..435580
FT                   /locus_tag="Memar_0449"
FT   CDS_pept        432392..435580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0449"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; SMART: DEAD-like helicases-like; KEGG:
FT                   lbu:LBUL_1663 DNA or RNA helicase of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56382"
FT                   /db_xref="GOA:A3CSN2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSN2"
FT                   /protein_id="ABN56382.1"
FT                   /translation="MRPKHNRVIFLPLPQMGCMEPSPGIYEQVISEYLASKLSGPEKEG
FT                   RVFKDPLARFDPQTVLSRYLAKILRTALQSADEAGASLEEQILICNRLIEHLGTELRDK
FT                   TLEQCKITPEAEVLLALVERNPLSALNITAPTRPETSIAQSSLFTGSPGEPGLVDELRK
FT                   EIRTADRVDLLVSFIKWSGLRLILDDLKEFVRHGNLRVITTSYTGATDIKAVEALAALR
FT                   NTTVRISYDTDRTRLHAKTYTFHRNNGFSTSYIGSSNLSNPAITSGLEWNVKVTEQDSY
FT                   DIIQRIEKTFETYWKDPEFIEYTPESRERLQRALSKERRSEIDLRPIFDIRPYYYQKEI
FT                   LERLKAERELHNNYKNLIVAATGTGKTVISAFDYKSLFQRPGEYPRLLFVAHREEILKQ
FT                   SIQVFRGVLKDQNFGDLLVGGSEPAQIEHLFTSIQSLNSRNLPEITPPDYYDMVIVDEF
FT                   HHAAAPSYQRLLSYYTPGVLLGLTATPERTDNLDILEYFNEKISAEIRLPEAINRKLLA
FT                   PFHYFGVTDVVDLDTVPWKRGTYDPAEISRLYTGNQQRADLIIRAVQDYTTDLHEIIGL
FT                   GFCVSVEHAEYMAAAFRAAGVPAACLHAGSSREERSTIQKRLVDRKIHFIFVVDLYNEG
FT                   VDIPEVNTILFLRPTESLTVFIQQFGRGLRLSDGKECLTVLDFVGNHNKNFPFGERIAA
FT                   LLSPGGKTLVEQVSRDSYSLPKGCYIHFEEKARERVLANIRANITNRATLIRKIRSFED
FT                   ETGEPLTFKKFLQRYSLQPLDIYRRGTFCSLAAEASVYPEVYEDERLFPRAAALRLATL
FT                   NSPEAIRFIRAVLSDPRHHSPAALSDREKNMLALFYYSLNDGFLRDENMGIEEIFSDLF
FT                   AYDEIRREICDLLEYNGAHIEFLPKPVDLGFENALELHSTYTRAQAFAALGHYTLTRKP
FT                   AGGSREGVVYLEDKKADVFLVTLNKTEEHYSPTTMYKDYAVNEDLFHWQSQSTTSASSP
FT                   TGRRYIEHERRGSRVLLFVREYNRVDGVTQPYLFLGTARYVSHEGSRPMSITWELDDPM
FT                   PPGFFLKANKMVVG"
FT   gene            435668..436495
FT                   /locus_tag="Memar_0450"
FT   CDS_pept        435668..436495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0450"
FT                   /product="acetyltransferases and hydrolases with the
FT                   alpha/beta hydrolase fold-like protein"
FT                   /note="KEGG: mhu:Mhun_1567 acetyltransferases and
FT                   hydrolases with the alpha/beta hydrolase fold-like"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56383"
FT                   /db_xref="GOA:A3CSN3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSN3"
FT                   /protein_id="ABN56383.1"
FT                   /translation="MNHRCPAVLVHGWRSHPGIWNRLAPALSDAAVPFWNFDHTAMQGA
FT                   GTETIALALRDYIHAKRKETGYGGPVDIVCHSMGTCIARYLLEVLDGDAQEEDVRQLVG
FT                   IGPPNNGSAMAELFNDPEHGPEVIRRLIGVFVPEDYDPREDTIVQEFRPRSRTVAALRR
FT                   AGTRDDIAYRIALGVNLTANPAFFPAFGGRTWEFGPDGGWRTTYAGDGIVPHSDSHLPG
FT                   AQVDVLPADPANLTRHPEFYCHTMLPRNPEVVARVRDYLAVSSGPGVRNPPRR"
FT   gene            436542..437438
FT                   /locus_tag="Memar_0451"
FT   CDS_pept        436542..437438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56384"
FT                   /db_xref="GOA:A3CSN4"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSN4"
FT                   /protein_id="ABN56384.1"
FT                   /translation="MLVPLGRSEEVLACVHHVVDRLPDRLRCPLHTLLDGRGVRCRLSL
FT                   RCRFLLRCGGGIDDPPPLFKATFSLAHMRGCRSLWDKNLAFLHRPPPAGWMRRFIYPED
FT                   YRGYDMVRVAAIEACGRSLSPDTCRFRVARAVAFVLLFLLAVPLLLGSAFGVSPAAVLA
FT                   LIGSTLLLQAAAAVVGLSLGMHPAAVLVFLTSVAAAVLVGILEICDLFAGRSRMIQGLL
FT                   SKIDAKTGSIDYLKRYGALMLIPVIWIPGIALYGTPVVAWVFQYPRAVSLLCMLAGWAI
FT                   AIVVVMAATMGLVRLAF"
FT   gene            437549..438475
FT                   /locus_tag="Memar_0452"
FT   CDS_pept        437549..438475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0452"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="TIGRFAM: cysteine synthases; cysteine synthase A;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: mba:Mbar_A2422 cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56385"
FT                   /db_xref="GOA:A3CSN5"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSN5"
FT                   /protein_id="ABN56385.1"
FT                   /translation="MGRIYRDLSLTIGSTPLVRLNRITEGIPATVVVKLESFNPMGSVK
FT                   DRIGVAMIEAAEREGKVREGTVIVEPTSGNTGIGLAFVCAARGYRLRLVMPETMSVERQ
FT                   KVLRALGAELVLTPGAGGMAGAIRRAAEIAAEEPDAYFVPQQFENPSNPAIHQRTTAEE
FT                   IWWDTDGEVDVLVAGVGTGGTITGIAGTLKPRRPSFRAVAVEPAESPVLSGGNPGPHRI
FT                   QGIGAGFVPRIYRADLVDEVVRVTSEEAFAMTRRLAREEGILAGISSGAATHAACEVAR
FT                   RPEFEGKLIVVVLPDTGERYLSTGLFD"
FT   gene            438490..439437
FT                   /locus_tag="Memar_0453"
FT   CDS_pept        438490..439437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0453"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG: mac:MA2721 serine O-acetyltransferase /
FT                   hypothetical protein (multi-domain); TIGRFAM: serine
FT                   O-acetyltransferase; PFAM: transferase hexapeptide repeat
FT                   containing protein; protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56386"
FT                   /db_xref="GOA:A3CSN6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSN6"
FT                   /protein_id="ABN56386.1"
FT                   /translation="MGIREDIRTAFDKDPAARSAIEVICCYPGLHAIWAHRIAHAFYRR
FT                   RLYFPARLVSHIARALTGIEIHPGAKIGRRVFIDHGSGVVIGETAEVGDDVLIYMGVVL
FT                   GGTALEQTKRHPTIEDGVVIGSGASVLGPITVGRGAKIGAGSVVVHPVPAGATVVGVPG
FT                   RLAGPKCRKGQERLDRGDLPDPMLRVVSRMLDRQNRIEERLRAMERSGLVGGKRQEEIA
FT                   LEESIRSALKEVIDPEVGIDVVDLGLIKGITVQDSSVLVEMVLTTATCPLVDYLTDRVR
FT                   RRVLDVSGVRDVEIRVFDEPWDWDRFFGQRDVLR"
FT   gene            439769..440560
FT                   /locus_tag="Memar_0454"
FT   CDS_pept        439769..440560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0454"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mma:MM3293 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56387"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSN7"
FT                   /protein_id="ABN56387.1"
FT                   /translation="MNDDLKAAVLERCRKMEIPLVGVAGTERWEKPPFQPWMPEEFYPQ
FT                   SIFPEGRSVVVIGLPVHLPVLETSPSIYYHELYKTVNTLLDQYTYRLASFLNDEGYPSV
FT                   FVPRDGYGSIEVLRENPVAFFSHRHAALLAGLGTFGVNNTLLTPEYGPRVRFGSVITAA
FT                   NLPPDPLLAENLCTRCMLCVHACPAAALDERDYPEGLTDKAACAENSAELARRHISPCG
FT                   ICIKVCPVGEDRRHYGRDAPAADRDPRYRRAREHVQRYGGL"
FT   gene            complement(440577..441266)
FT                   /locus_tag="Memar_0455"
FT   CDS_pept        complement(440577..441266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0455"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /note="PFAM: Conserved TM helix repeat-containing protein;
FT                   KEGG: mbu:Mbur_0269 conserved TM helix protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56388"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSN8"
FT                   /protein_id="ABN56388.1"
FT                   /translation="MTNGDLSAQVFEPVQELARNVILFLPNLIAAIVILIIGWILGRIL
FT                   GKVVSEVLDRVGVDDALRKTSVGQQIERSTMNISHLFDLIVRWFIYLIAILTAVSVLQI
FT                   PALTAAVAAIVAYIPNVVAFLVILIAGFILIDWLIDFLQNMGETQQIQGFGLIAMLLRA
FT                   FLYFVVAILALQQLLLDLSIIYVFVVPIAWGVGIGIGAAIAIIIGLGMRDRAPEMMDQL
FT                   MGKMRKE"
FT   gene            complement(441853..444111)
FT                   /locus_tag="Memar_0456"
FT   CDS_pept        complement(441853..444111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0456"
FT                   /product="efflux transporter, putative,
FT                   hydrophobe/amphiphile efflux-3 (HAE3) family"
FT                   /note="TIGRFAM: efflux transporter, putative,
FT                   hydrophobe/amphiphile efflux-3 (HAE3) family; KEGG:
FT                   mhu:Mhun_1961 hydrophobe/amphiphile efflux-3 HAE3"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56389"
FT                   /db_xref="GOA:A3CSN9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004767"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSN9"
FT                   /protein_id="ABN56389.1"
FT                   /translation="MKNPYEWLAAAINNHTWTVAGVAAAIFIVACFGLSMVSMETSDDA
FT                   YLDKSTPRGALLNHYAETYGSDAIMLIYETDSVRSPEILRYIDHLQEDLRNERYVDEVS
FT                   GVVDLLKQANGGTLPSSTAEIDAIIGQAPPEMVERMLPSDLMTISVIALEPGVTMEAQQ
FT                   QVVGNIKSIIAISEPPPGLTVTVSGNPAFSLEMGEAMGSETGMLILVAMVLMVLAVTLL
FT                   FSHVRYRLLPVGIVAVGLIMTFGFMGLFGIPISMVVVGAFPVLIGIGIDYAIQLHARFD
FT                   EEIRHGTIPEAVWATVTQMGPSILIAMSATALGFIAMFFAPVPMVADFGMVCTIGVVSC
FT                   YVAALIIVPVFAIVTRYRPMKEAAAAGTEPAGGESIIERYDRLLGRLAYTVAKYPIPVI
FT                   LIFATVAAGGFYLDQSVPVSADEKTFVPGDMPALLSLEKLTRVMGSTSTIPVVVLADDV
FT                   LSPETLAWIDQFGVYEQEHNDKITGVTSVATLIREHNGGVLPSTEREVNNIIARIPEET
FT                   LSRYLNGNLEAVLEFSTVDMEMSAARDLVGRIQDDVAWNNPPAGVTVKITGQMEMFAAV
FT                   MDDISESRVYMTVLGFAFILGFLILVYRKFGAVSPVIPIVFIVGWNGAIMYLLGLDYTP
FT                   LTAVLGSMTIGVASEYTILIMERCEEELSRGTEFLDAVQTAVQKIGTAITVSGLTTVFG
FT                   FSALTFSTFNIISNFGIVTVISVGFSLVGAIVVMPAILALMYRLSGRSRAIAAAGVTE"
FT   gene            complement(444108..444674)
FT                   /locus_tag="Memar_0457"
FT   CDS_pept        complement(444108..444674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56390"
FT                   /db_xref="GOA:A3CSP0"
FT                   /db_xref="InterPro:IPR016101"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSP0"
FT                   /protein_id="ABN56390.1"
FT                   /translation="MGSTREPAAGNHTGEAESDIGPRPGCSRFISCPLKILPSSDEPLI
FT                   TRTDVNCATTCNIGSRRGSEETRCRRPAHRKALYKELFFEETGQIWIEAGFLPPADYRR
FT                   AVALLHRLAMDEEPTASLLSSVLTITAKSGKEGRGYRILDPVKLRRTAEEYGIEPGNSS
FT                   DGEIARAVTMAIIGEYGEKTQEARR"
FT   gene            444765..445439
FT                   /locus_tag="Memar_0458"
FT   CDS_pept        444765..445439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0458"
FT                   /product="HTH DNA binding domain"
FT                   /note="PFAM: Bacterio-opsin activator, HTH domain protein;
FT                   KEGG: nph:NP4436A predicted DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56391"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSP1"
FT                   /protein_id="ABN56391.1"
FT                   /translation="MILEVCLKDPLMGMPADAEVLNQAVQHFMDRVESVRLVELLKMNF
FT                   ERGEETVIAEITMKAGYTANDLELPEVLGSLEVLKADGRTYTCFLRCVIQDEFLLEKMR
FT                   EFDLDIIWTLPMYKSRDLYVYTCIGDAENLNKVLLLMSTYGEIQNVIFEEATFSGNNPL
FT                   SRLTPRQRDLLIAAKQYGYYEYPRKINSQQLAEKVGISKATAIEHLRKAEARLIATLLA
FT                   GY"
FT   gene            445857..446609
FT                   /locus_tag="Memar_0459"
FT   CDS_pept        445857..446609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0459"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   mma:MM1554 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56392"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSP2"
FT                   /protein_id="ABN56392.1"
FT                   /translation="MVAEIVPGLRALGMNEYEASVYSTLVGLQKATARDIHEASGVPRG
FT                   RIYEILNDLAQRGFIAVEEGSPTSYYVLEIDVVFDRLKEDYVRTLDETREVLKSLSVKP
FT                   RLPPDSFFILRSGWAIENHLSSLFRRVKKSMVILCYDPAFLRKHYAAIKPLKRKIDLYV
FT                   VVRKKEDYAGINLPIYEARGTVLELLESPAVNESAMGLRKDECSILVDGRDFFVIATAG
FT                   SGRHAVIGSDMPLIGYMQKTIVERLAGA"
FT   gene            complement(446646..447950)
FT                   /locus_tag="Memar_0460"
FT   CDS_pept        complement(446646..447950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0460"
FT                   /product="proteinase inhibitor I4, serpin"
FT                   /note="PFAM: proteinase inhibitor I4, serpin; KEGG:
FT                   tko:TK1782 serine protease inhibitor serpin homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56393"
FT                   /db_xref="GOA:A3CSP3"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSP3"
FT                   /protein_id="ABN56393.1"
FT                   /translation="MNRRVIGLLLLAGLIALGCIGAGCTDIPETTSGQSAPPTEGETPG
FT                   PAAEGAGNVSAGNNRFAADLYRQLASDPDYAGQNIFFSPYSISSALAITYEGARGTTAD
FT                   EIGSVLHLPQNETLRRSGFAGLDAALNSGDENYTLRTANALWAEETYPFLPEYVDTAAR
FT                   WYGANATNLDFAGDSEGSRQTINRWVEEKTEDRIRDLLPAGSIDSMTRLVITNAIYFKG
FT                   TWVKQFDPAETTEEEFRVAPGETVQVQMMHRTDEEAIYGYTETGTLQVLRMPYAHADGT
FT                   ELSMLVLLPREDNLTAAEEALDAETLADLRDSMTDRRVRVVFPKFTLETEYSLPRALAA
FT                   MGMPTAFSYDADFSGMDGTDMLFISEVVHKAFVDVSEEGTEAAAATGVVVNLKCAPGED
FT                   TTPVFRADHPFVFVIVEEDSGTILFAGRVVNPEGS"
FT   sig_peptide     complement(447885..447950)
FT                   /locus_tag="Memar_0460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.585 at
FT                   residue 22"
FT   gene            complement(448221..448293)
FT                   /locus_tag="Memar_R0009"
FT                   /note="tRNA-His1"
FT   tRNA            complement(448221..448293)
FT                   /locus_tag="Memar_R0009"
FT                   /product="tRNA-His"
FT   gene            448680..450461
FT                   /locus_tag="Memar_0461"
FT   CDS_pept        448680..450461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0461"
FT                   /product="translation initiation factor eaIF-5B"
FT                   /note="TIGRFAM: translation initiation factor aIF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; GTP-binding protein, HSR1-related; elongation
FT                   factor Tu, domain 2 protein; KEGG: mhu:Mhun_2489
FT                   translation initiation factor aIF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56394"
FT                   /db_xref="GOA:A3CSP4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004544"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029459"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSP4"
FT                   /protein_id="ABN56394.1"
FT                   /translation="MAKESTIRTPIVCVMGHVDHGKTSLLDRIRGSSVVSTEEGEITQH
FT                   IGATLVPIDAVTRMGGALSKVSVNVPGLLFIDTPGHHAFTTLRARGGALADMAIVVVDI
FT                   NEGFRPQTIEALQILRNYKTPFVIAANKVDRIHGWRVQENQPFLKTFAQQNERVQGMVE
FT                   TKVYELVGKLSDLGFNSERFDRVSDFARNICIVPTSALTGEGLPDILMVLIGLAQRYMT
FT                   ESLKVSADGPGAGTVLEVKEERGLGMTLDLILYDGTLKVGDEIVVAGNDQIIETKVRSL
FT                   LKPRPMSEILIEERFERVKSVTAAAGIKVAAPKLDGVIAGSPLRAVRSGNRDEVIEQVR
FT                   REVQDIEVNLSDVGVIIRADTIGALEALSKELEGHQIQVMRATVGPVTRHDVIEAGTIK
FT                   DPLYSAIIAFNTPVLPDAVDALADTAMSHVSIFEGGVIYQLIDDYVEWRDEKKQELERQ
FT                   KFEKLIMPAKIRILPNCVFRQSNPAVVGVRILGGKLQSGVDLALPNGKKIGRIKQIQAK
FT                   NETVQEAEAGKEVAISIEGPTVGRQINVDDDLYVDIPERHVKVIEREVIDHLSPSLRET
FT                   LEEFTTLKRREDPFWGK"
FT   gene            450578..450976
FT                   /locus_tag="Memar_0462"
FT   CDS_pept        450578..450976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0462"
FT                   /product="SSU ribosomal protein S6E"
FT                   /note="PFAM: ribosomal protein S6e; KEGG: mhu:Mhun_2488
FT                   ribosomal protein S6e"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56395"
FT                   /db_xref="GOA:A3CSP5"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR020924"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSP5"
FT                   /protein_id="ABN56395.1"
FT                   /translation="MADFKIILSDPETGRSYKIDATGPAAGGFVGKRIGDEIDGDVLGF
FT                   AGYTIKITGATDKTGIPSRRDLPGPSRRRLLLSKGVGFHPVMDGERRRKSVRGNEISAD
FT                   IVQINAAVTQSGAKPLAEYFSQPEAAAE"
FT   gene            complement(451040..452038)
FT                   /locus_tag="Memar_0463"
FT   CDS_pept        complement(451040..452038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0463"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: mth:MTH976
FT                   pyruvate formate-lyase activating enzyme related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56396"
FT                   /db_xref="GOA:A3CSP6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSP6"
FT                   /protein_id="ABN56396.1"
FT                   /translation="MQDLESCRLCEWRCGADRLRGERGVCRVGRAEVAATMRSGTLASY
FT                   IVTLLGCCYRCLHCNAYRISQYPDPGWHYVGHVPAAVLVADARERIAAYRGPRIRTIGF
FT                   TGGDPIIHLPYIEEVAAEVERQGLDLGIGISTGGFATEAAMERIVGLCRTIALEIKAWS
FT                   DPVHRALTGAPVGPVLRNAEYLVREGRDRIRVFRTVVIPGMTDREVGRIAAFIASLDPG
FT                   VPYRLIGFRPNNVLYYHPGPSREEMERLSAVCRKAGLEDVAWSGYYPETVPDDVAARAA
FT                   GLTDAYGGEAPAALTGAYAAACGCPTHPRDCGACALRDRCPATLREPWRGR"
FT   gene            452175..452696
FT                   /locus_tag="Memar_0464"
FT   CDS_pept        452175..452696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0464"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   mhu:Mhun_1328 protein of unknown function UPF0066"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56397"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSP7"
FT                   /protein_id="ABN56397.1"
FT                   /translation="MILRPVGFVRSTVQEPFLVAGRDGISMREGPDASRDHVRSVKETV
FT                   SEIVIDENRVALLDGIEEYSHVTVLYWGHKVPEESRSVDHVHPMGRTDIPKTGIFSTCS
FT                   PARPNPVLATVVRLHARRGNVLEVTGLDAVDGSPVIDIKPYVPGQYPKGGVRIPAWMEG
FT                   LMNEVGERRA"
FT   gene            complement(452727..453194)
FT                   /locus_tag="Memar_0465"
FT   CDS_pept        complement(452727..453194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56398"
FT                   /db_xref="InterPro:IPR018716"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSP8"
FT                   /protein_id="ABN56398.1"
FT                   /translation="MSVRIAVAAPFKHMRKDRLQRSEFVFYIAIDRKWMNKEQANQLLE
FT                   RAKAEGLIAVDGGAIRPLFDVAEVSIPLGFKPTSDVLAAAESPYEELIGRIAAATEKPP
FT                   QEVVAELHRIVADNFDGNLRVEAAVIILAKKYGVAFDDKLPALEKSVAKSR"
FT   gene            complement(453191..453613)
FT                   /locus_tag="Memar_0466"
FT   CDS_pept        complement(453191..453613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56399"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSP9"
FT                   /protein_id="ABN56399.1"
FT                   /translation="MRRIYHRFPQSIDLDFELARPFREVLACIARMHDTHTTVRGADGL
FT                   VKERMLVQIADGRTQFLDLNDLAPLAEKVAEAADFRIDLQRTLLTPEKRLPVSENVFFL
FT                   RIVDKGAVTECYVAKEGRLGDLDAMDLRKMLKGACE"
FT   gene            453703..455142
FT                   /locus_tag="Memar_0467"
FT   CDS_pept        453703..455142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0467"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: metallophosphoesterase; 5'-Nucleotidase domain
FT                   protein; KEGG: mth:MTH1492 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56400"
FT                   /db_xref="GOA:A3CSQ0"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSQ0"
FT                   /protein_id="ABN56400.1"
FT                   /translation="MTDHLTLLQVNDSHGYLEPHQELFYAAGPPVYRTAGGYARIAALL
FT                   EDAREERPGTVLAFDCGDTIHGTYPAVRSEGEALVPILNALAFDAMTAHWEFAYGPEQF
FT                   RKVAGRLDYPVLADNCYDDATGDPVFPPYTVCETDSLQVGVIGIAATIVDKVMPDSFSE
FT                   GIHFSLGNAELPGHIARLREEEGVDLVVVISHLGFPQEVKLARETDGIDVLLSGHTHNR
FT                   LFEPAVVNDTVIIQSGCHASFLGRLDLTVENRRVKKFDHELIVVGEEIRPHPEVEEMVE
FT                   GIMEPHREYLSRVVGETRTGLNRNTVLEATMDNLLLQALLDATGAEMAFSNGWRYGAPV
FT                   PPGPVTQNDLWDIIPVNPPVSTVEITGRDLRAMMEENLERTFSRDPYEQMGGYVKRCMG
FT                   VNLYCKMENPAGLRIQEFFAAGKRLDPDAVYSAAFVTGQGVPPKYGKNRQNLDVRAIEA
FT                   LERYLSGGPVSAELRGSVTAV"
FT   gene            455139..455477
FT                   /locus_tag="Memar_0468"
FT   CDS_pept        455139..455477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mth:MTH1491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56401"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSQ1"
FT                   /protein_id="ABN56401.1"
FT                   /translation="MTPSPRVAVHLDEREKAALALRNTKNLLEGLAGVEVEVVAHADGV
FT                   EELRTGSPQAALTAQLADRGVRFVVCENTLRSRNLSEKDFPGYVGTVPSAIVELVVRQA
FT                   EGWQYLRP"
FT   gene            complement(455492..455869)
FT                   /locus_tag="Memar_0469"
FT   CDS_pept        complement(455492..455869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0469"
FT                   /product="SSU ribosomal protein S8E"
FT                   /note="TIGRFAM: ribosomal protein S8e; PFAM: ribosomal
FT                   protein S8E; KEGG: mhu:Mhun_2485 ribosomal protein S8.e"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56402"
FT                   /db_xref="GOA:A3CSQ2"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR020919"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSQ2"
FT                   /protein_id="ABN56402.1"
FT                   /translation="MQWQGRSVRKPSGGRYHTSQGKKRTEIGRAPAETHIGEERRRIVR
FT                   TFGGNQKVRALRLEYATVSNPATGETKKTKIEAVEANSADPNYVRRKLLTKGAIIKTEM
FT                   GRARIVSRPSQDGVVNAVLLA"
FT   gene            complement(455974..456621)
FT                   /locus_tag="Memar_0470"
FT   CDS_pept        complement(455974..456621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0470"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein, P47K; KEGG: mhu:Mhun_2484
FT                   hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56403"
FT                   /db_xref="GOA:A3CSQ3"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSQ3"
FT                   /protein_id="ABN56403.1"
FT                   /translation="MHHIDVHVEKDIYDVNNRLADANAAHLKDHGIRAFDLLGAIGSGK
FT                   TATIERLVPLIRKRGLRAGAIAGDVYGDDDFKRIVALDVPAYNANTGKECHLDAHLVEH
FT                   AIEHLPLDEIDILFIENVGNMVCPTDFRLGAEKRIVVVSSTEGDDVVNKHPMMFRSSNI
FT                   GVINKVDLAGFVGADLDRMEADMRRYNPEMKIFRTNMKTGKGLDELLDAILA"
FT   gene            456675..456947
FT                   /locus_tag="Memar_0471"
FT   CDS_pept        456675..456947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0471"
FT                   /product="signal recognition particle, subunit SRP19
FT                   (srp19)"
FT                   /note="PFAM: Ribonucleoprotein complex SRP, Srp19
FT                   component; KEGG: mhu:Mhun_2483 ribonucleoprotein complex
FT                   SRP, SRP19 component"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56404"
FT                   /db_xref="GOA:A3CSQ4"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR022938"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSQ4"
FT                   /protein_id="ABN56404.1"
FT                   /translation="MSAERILYPCYFDATLERREGRRVAKNIGVKSPDIPAVEAVLRKM
FT                   KVPHRVEEHHHPARWAEHEGRIVAEWEGSKEDLIRKVASGLAARK"
FT   gene            456953..457597
FT                   /locus_tag="Memar_0472"
FT   CDS_pept        456953..457597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0472"
FT                   /product="PHP C-terminal domain protein"
FT                   /note="PFAM: PHP C-terminal domain protein; SMART:
FT                   phosphoesterase PHP domain protein; KEGG: mhu:Mhun_2482
FT                   PHP-like"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56405"
FT                   /db_xref="GOA:A3CSQ5"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSQ5"
FT                   /protein_id="ABN56405.1"
FT                   /translation="MYDLHTHTILSDGELLPTELVRRAAVLGYETLAVTDHADASNLRH
FT                   LVEAVSSVRESARCYGVGLLVGVELTHVPPSLIPAFARDAKKFGADIVVVHGETVVEPV
FT                   APGTNRAACACEYVDVLGHPGLIAIEDARAAAEHGVALEITSRAGHNRTNGHVARVARE
FT                   AGCLLVIDSDTHAPSDLMSKEGRWAVALGAGLTEAESREALSVDINRLLQK"
FT   gene            457936..458949
FT                   /locus_tag="Memar_0473"
FT   CDS_pept        457936..458949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0473"
FT                   /product="Transcription initiation factor IIB (TFIIB)"
FT                   /note="PFAM: Zinc finger, TFIIB-type domain protein;
FT                   Transcription factor TFIIB, cyclin-related; SMART: Cyclin;
FT                   KEGG: mhu:Mhun_2481 transcription factor TFIIB,
FT                   cyclin-related"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56406"
FT                   /db_xref="GOA:A3CSQ6"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSQ6"
FT                   /protein_id="ABN56406.1"
FT                   /translation="MAEVEKLKQLQLQREALKKRGEQKVKETEKKRTEESVQSVCPECG
FT                   SRQLVHDYERAELVCQNCGLVLDEEFIDRGPEWRAFDHDQRMKRSRVGAPMTFTIHDKG
FT                   LSTMIDWRNRDSYGRAISSKNRAQLYRLRKWQRRIRVSNATERNLAFALSELDRMASAL
FT                   GLPRNVRETAAVVYRDAVDKNLIRGRSIEGVAAAALYAACRQCSVPRTLDEIAEVSRVS
FT                   RKEIGRTYRFISRELGLKLLPTSPIDYVPRFCSGLNLKGEVQSRAVEILRQAGERELTS
FT                   GRGPTGVAAAAIYISSILGGERRTQREVAEVAGVTEVTIRNRYKELAEKLDIEIIL"
FT   gene            458962..459033
FT                   /locus_tag="Memar_R0010"
FT                   /note="tRNA-Ala1"
FT   tRNA            458962..459033
FT                   /locus_tag="Memar_R0010"
FT                   /product="tRNA-Ala"
FT   gene            459255..459908
FT                   /locus_tag="Memar_0474"
FT   CDS_pept        459255..459908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0474"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: mhu:Mhun_0253
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56407"
FT                   /db_xref="GOA:A3CSQ7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSQ7"
FT                   /protein_id="ABN56407.1"
FT                   /translation="MKERIKETDQGIQGELDVQYFDRMQRHLRDKGLIATDEIVRSGIA
FT                   GGLALELGPGPGYLGLEWLRKTDGSRLRAVEISRNMIVVAQKNAREYGLASRVEYTLGR
FT                   VEEIPFGDEVFDAVFSNGSLHEWSEPQRAFHEIYRVLKPGGRWYVSDLKRDMNRVVVWF
FT                   MKISVRPVEMRPGLQTSIDAAYTRRELEGILAGTPLKSGQVSENPFGLSIRGTK"
FT   gene            complement(460028..461737)
FT                   /locus_tag="Memar_0475"
FT   CDS_pept        complement(460028..461737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0475"
FT                   /product="Spore coat assembly protein-like protein"
FT                   /note="KEGG: bsu:BG11791 spore coat protein (inner)"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56408"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSQ8"
FT                   /protein_id="ABN56408.1"
FT                   /translation="MLIVLSLLTFFIPPAGGQENTISPDTGVQDLYLFMGWKDLVELYT
FT                   REETSDERLDGYVRLSPDGEDIELEGVRFRGSSSRELPKKSFSIRFNESQEFLFGSDDM
FT                   NLKATYTDPTMMRERLSMDLFHVLGQPAPRTKYFDLYINGVYEGLYVHVERVDGDLLAS
FT                   NGLNPAGTLVADDFRGNFGLPGVDRLSVFGYPIEEQDDPEAFLAETMDSRGEPDWGAVR
FT                   DLVAWVYRTPAGPEFEEGFVERFDEENFIDWLAIHYLIGDVDSFGDDYWLYLDTGDPDA
FT                   EWKVIPWDKDLTFGSHTRRSATVNDYFGYESAIASGWDNDLVEKFLDTPGLRERLNLRM
FT                   AFLMDGVFTEDYYAGQIDVHKEAIGERLNITPGEDAFVLHPQNHHGDLGYLAYHTEAVL
FT                   DFVRLRYRFIERAITPGSGEPYTASVEIPAEPEGSTVSFTDPGGWVIATFEVSEVTEPG
FT                   TITATVNGTPENPGIDRRWEFDAGDADVSGELTLYYRNDVESCCFPIENWFVSDAAVRD
FT                   DRYSQWDLRIVWESESGNRTALATYVNPYSNKASADVSLQGTTRFEVVLPDR"
FT   sig_peptide     complement(461684..461737)
FT                   /locus_tag="Memar_0475"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.847) with cleavage site probability 0.838 at
FT                   residue 18"
FT   gene            complement(461965..463137)
FT                   /locus_tag="Memar_0476"
FT   CDS_pept        complement(461965..463137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0476"
FT                   /product="WD-40 repeat-containing protein"
FT                   /note="SMART: WD-40 repeat protein; KEGG: mac:MA1519
FT                   WD-domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56409"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSQ9"
FT                   /protein_id="ABN56409.1"
FT                   /translation="MKRTALIIALIVALVPAAAGAEGAYHGVSTGGIVNDVAITADGKY
FT                   MVAGTGDGEIVCLQRDGTVPWNASAPGAVTAVAAAGDYVAAGTEGGDVLLFDGNGGRYW
FT                   TKSVTGSVRDLAFAGDGRAIAVAGDRIVLFTNLGKEEWNRAVQPGARSSDTKPYVTSVA
FT                   FTQDGKFIVTGSSNGAILFMNREGNLIWEGLARDVVTAVDVSRDGSVVAAGGRDRALQV
FT                   YGRAGGLPWALPTGAPILALALSGDGKFAVVGKEGGDVECYRPNDDLLWKNRTGSNVIA
FT                   VDVSRRGEAVAAGNAGGTVYLWNGNGDARWSFDAGAAVSAVTLSDNGDYLAAGAGERAY
FT                   IFRTADDPMTAMAEGTGNTTPEPTEAGGAGALIGLLAVAAAGAAGRLRRR"
FT   sig_peptide     complement(463072..463137)
FT                   /locus_tag="Memar_0476"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.611 at
FT                   residue 22"
FT   gene            463273..463743
FT                   /locus_tag="Memar_0477"
FT   CDS_pept        463273..463743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0477"
FT                   /product="C_GCAxxG_C_C family protein"
FT                   /note="TIGRFAM: C_GCAxxG_C_C family protein; KEGG:
FT                   sfu:Sfum_2781 C_GCAxxG_C_C family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56410"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSR0"
FT                   /protein_id="ABN56410.1"
FT                   /translation="MGNRAKEAVSRFMQGYNCAQAVSSVFAGDAGVPEEVVLCAVTGFG
FT                   GGMGHAGGTCGAVSGGVLAIGLLFGSTGVDEKEAKDLTYALTREFIMRFVRKNGTVSCT
FT                   ELLGCDISTDEGLARSREQNLTRTLCPRYVRDAVEILEEVLASVTSGQSTMR"
FT   gene            complement(463715..464821)
FT                   /locus_tag="Memar_0478"
FT   CDS_pept        complement(463715..464821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0478"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: mxa:MXAN_1041
FT                   acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56411"
FT                   /db_xref="GOA:A3CSR1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSR1"
FT                   /protein_id="ABN56411.1"
FT                   /translation="MKTEHPGAVTEAGSIPGGRFSNNFDFLRFAAAAMIVVAHAYALRL
FT                   GYVGIGLYDPVMLMAQAGLAALLVTSGYLITASWESTASPLRFAWKRSLRVIPALVLVI
FT                   LVTLFVIGPLMTSLSPGEYFAALFSPAGLATAPFFEDGSAIGLFQGNPWTYVNGSLWTI
FT                   PVEVMMYGVVAALGIAGLLHRWGAIPALAAVNILVWIYWFDDPRMAKVRFTLYFLAGAY
FT                   LYLHRERIAYRPVVAGVLLLLLGLSAMTPYLTVAAVIAIPYLTIYAAHIPVPSLSTFGR
FT                   PGDFSYGIYIYHYPIQQVLIQTTANTLHLAVLCGVSFLATFVLAFFSWHAVEKRALAAK
FT                   SLGTDDLRRKLRLPSLPESLTAWWIARK"
FT   gene            464890..465675
FT                   /locus_tag="Memar_0479"
FT   CDS_pept        464890..465675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0479"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: gka:GK2132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56412"
FT                   /db_xref="InterPro:IPR011397"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSR2"
FT                   /protein_id="ABN56412.1"
FT                   /translation="MDPLVVATFAAVALLEIAVPLVLGYWFVKKFGLSWRVFGLGALFF
FT                   IIVQIVHAPLVIVTQTPLYLAVLPFGTTTALAALAVYLGLMAGLFEEIGRYLVYRYLFG
FT                   RQKIPLTRENGLLFGTGWGGIESIFVALLVLTSMVSYILLTGDGGAIPLPDDPAIQAEI
FT                   EAVQALTPLDILPGLAERMMTITLHIAWSLMVLAAVVYGRKALLALAVLWHAAVDAAAV
FT                   YLAQTQGILVTEAVIFVFAVLALAYILWEWRRMGVRAAT"
FT   gene            complement(465672..466538)
FT                   /locus_tag="Memar_0480"
FT   CDS_pept        complement(465672..466538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0480"
FT                   /product="thiamine-phosphate kinase"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR
FT                   synthase related protein domain protein; KEGG:
FT                   mhu:Mhun_2605 thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56413"
FT                   /db_xref="GOA:A3CSR3"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSR3"
FT                   /protein_id="ABN56413.1"
FT                   /translation="MDERGLHRLIGTIIDPERLDDDCAVIPCGDRLMVASTDMLHETTD
FT                   FPAGMTDWQIGWMATAVTLSDVASMGAAPGEVLLAVGLDRPERLSGIMEGARDCCTRFG
FT                   AELVGGDLDAHRELTIVSTGLGLVAPEHLVRRRGARPGDVIAVTGPLGEAEAALAGYDR
FT                   HRRELLEPQPRVREGQALGRAGVSAMMDISDGLVLSLHDLLAVNDCGFSVDTARLPLPA
FT                   GVPEDEGRELALYGGGDFELLFTAPPDILPVPGVEARVIGEVIPERTVLADGEPLERRG
FT                   YLHEWKG"
FT   gene            complement(466531..468483)
FT                   /locus_tag="Memar_0481"
FT   CDS_pept        complement(466531..468483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0481"
FT                   /product="Protein of unknown function DUF460"
FT                   /note="PFAM: Protein of unknown function DUF460; KEGG:
FT                   mhu:Mhun_2604 protein of unknown function DUF460"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56414"
FT                   /db_xref="InterPro:IPR007408"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSR4"
FT                   /protein_id="ABN56414.1"
FT                   /translation="MKVFGIDIIKGSVRSRTRRPVYALARVEDGDIQSVEEVTGFRLQR
FT                   LLAAEEPDILAVDSLQEIAADQRELHAFLQALPPATKLVQVTGGEKKESLGKVAARYNI
FT                   SFNKFDPYAEARTTARVAALGAGVEVIAFENTTDIVVSRHRSPGRGGWSQNRYARKIHG
FT                   AVMQKAREIEGRLRGAGLDYEKKETKAFGGYSRVAFRVRAPREMVPVHSSRGADVQVRV
FT                   AGRQLDRIRFEPLSGRPRYLIVGLDPGTTTGIAAVDLDGNLVLLSSSRQMTMSDIVEEL
FT                   YRAGKPLIVASDVREMPYSVEKIRRAFNAIPYTPKQSLSVEAKYDLTAPFSYTNDHERD
FT                   ALSAALDAYRSLQNKFRNIVKRVGPGFDLDEVRARVLRGQPLDTVLADLQGVPAAKKEA
FT                   EPAAEAEPERPVEDERVMALDGMVKRLRSYVQELQDDLRERGREVERLRQDVRRARSAA
FT                   ERKIRRDAELAAKDAAIESLREQLRGERRRSRRLKKRLERMQKVAKLEVSEDYTPLKVL
FT                   ESLTREAVRALQEEIGIAEGDVLYVPRTHGWGRGVVKDLAGTGVRALVVGGEPPDPHLI
FT                   RVAREIDLSLLPAETVSPEIRGRTGAALTGAVEDAVAEWKEEQKEFRREQEAERVEYLV
FT                   KEYRSEREKEVRRGG"
FT   gene            complement(468480..469337)
FT                   /locus_tag="Memar_0482"
FT   CDS_pept        complement(468480..469337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0482"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein of unknown function RIO1; KEGG:
FT                   mhu:Mhun_2603 protein of unknown function RIO1"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56415"
FT                   /db_xref="GOA:A3CSR5"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSR5"
FT                   /protein_id="ABN56415.1"
FT                   /translation="MPVPAEYVRSLHAYELRILLALERLMRRYRWVPLEVLKSATKFSE
FT                   SELSYRLGRLMAMDMVRYEKTPYEGYALVFNGYDSLALHSLTRRGTIQALGTQIGVGKE
FT                   SEVYEAMGLGVVVLKFHRVGQRSFQSARVKRGYMPEAGHCPWIFASSSSAKMEYDALKT
FT                   LHPAVSVPLPIDQNRHVVVMSFVPGVNLSRAALEEPRPILDEILDNVREAYRLGIVHGD
FT                   LSEFNVMVDEKQCWLIDWPQWVEIAHPNAAEILNRDIENILQYFKRKYGIDYAFDEALA
FT                   RVVE"
FT   gene            469387..470418
FT                   /locus_tag="Memar_0483"
FT   CDS_pept        469387..470418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0483"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: mbu:Mbur_0991
FT                   protein of unknown function UPF0021"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56416"
FT                   /db_xref="GOA:A3CSR6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSR6"
FT                   /protein_id="ABN56416.1"
FT                   /translation="MQCSKCRRDAVIFQRYSGLHLCEHHFNRDFEAKAKRAIREHRWIE
FT                   SGDTVAVALSGGKDSSAVLFFLHRLLGERRDVRLMAITVDEGISGYRDPNQARKIAESM
FT                   GVPWVTATFADEYRITLDEIVARKGTGLSCSYCGVLRRALMNRIAREHDVTKFAYGFNL
FT                   DDEAQSVLMNALRGDAERLTRPMREAEGMVPRIKPFMYIPEREVALYAFLHVEGFDLAG
FT                   CPYAGDALRGDVRGILDDYTYRHPATKYSLVNLGEALRGTERPETKMGFGICERCGERL
FT                   PERQELEHREVRDATAGTAGARAPKNDVPSGTEFEHRRCEGAKPCGKICRTCQVLDEVR
FT                   KGG"
FT   gene            470446..470625
FT                   /locus_tag="Memar_0484"
FT   CDS_pept        470446..470625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSR7"
FT                   /protein_id="ABN56417.1"
FT                   /translation="MERNCPDDETAWYGGPWVIAIGGGADGECDVPQERSSTTVRWGGG
FT                   LAPLPCLYPVGLYL"
FT   gene            complement(470913..471635)
FT                   /locus_tag="Memar_0485"
FT   CDS_pept        complement(470913..471635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0485"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: glucose-6-phosphate isomerase; KEGG:
FT                   mhu:Mhun_2600 putative glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56418"
FT                   /db_xref="GOA:A3CSR8"
FT                   /db_xref="InterPro:IPR010551"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSR8"
FT                   /protein_id="ABN56418.1"
FT                   /translation="MNGYWDGPKPEPQVRTIEEMREVLADPGCTSDQPLYFMYRDLAKS
FT                   ESDREWLREHRIRYDITVIPARTLCGEYVKTKGHYHTENPAGELYPEIYEVLEGTGHYL
FT                   LQTRNADDVVMIEGTAGDKILIPPGYGHVTINPGKEDLVMANLVSSEFSSNYGPYAELR
FT                   GAAYYEMEGGALVKNPGYPDAPPVRYCDPVEVPDIGIEKEVGLYDLVGRPRSVAFLNHP
FT                   EQFMEIFSDVTGGCLVMR"
FT   gene            complement(471632..472918)
FT                   /locus_tag="Memar_0486"
FT   CDS_pept        complement(471632..472918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0486"
FT                   /product="S-layer domain-like protein"
FT                   /note="KEGG: mhu:Mhun_0769 S-layer domain-like"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56419"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSR9"
FT                   /protein_id="ABN56419.1"
FT                   /translation="MRWQHVPVLMLLLALLVVPGSAQGVKYLYGSPDLSATISGTNQFA
FT                   PGAETQIAVIISNSGLNTHKIVGSTLLTPDDQPNTAKLVTVGLKSSDTPFTVKTDPQFL
FT                   SDIAGGASATAAFDVKITDSAEPGTYTLPLEVTYTYLADAEEYGSDVLRYNYQQKTQTL
FT                   PLEVRVTPDLQVEVLDVHTGSLNVGTEGYVYMTLKNAGHDTANKAIAMVTRSGASPLIP
FT                   TDGNAYVGTFEPGETVDVKFKVSVADTAEPQSYPLDVAVTYEDYEGKTVTSRPATIGLP
FT                   VGGKIAFEVVSPPSTLYLGQKSILEVVYKNSGAATVYNAQARISAVDPFTSSDDTAFLG
FT                   DLAPGETATARFEVNVDNDGTEKEYGIDSEIRYRDDLDNSKISDTMKVQVALERRQGTL
FT                   FTNPVFLVAVLAVIIGAGYYIFVYRKKQR"
FT   sig_peptide     complement(472844..472918)
FT                   /locus_tag="Memar_0486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.786 at
FT                   residue 25"
FT   gene            472983..473774
FT                   /locus_tag="Memar_0487"
FT   CDS_pept        472983..473774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0487"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   mtp:Mthe_1683 transcriptional regulator, TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56420"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSS0"
FT                   /protein_id="ABN56420.1"
FT                   /translation="MKAPRDVPNALLESLKSLGLTKYEALVYIGLLRTSGATATEVHEI
FT                   SGVPRASVYPVLDRLVQKELVSVSHTTPKRFDAVAPDQGVENLMRRIESDAESARAALD
FT                   VFYREKGLEGRGDRELVWTIYGEENIRTRLAGMFGSAERSVEVLATWDILQGGVLPLLE
FT                   SAPDSVPVDIVTERWEGEQPSRFRLHLLPLAGLRETRLPTENLLPYERSGVFLVDDSRA
FT                   LLWMGAVDGQPSALYSESEGLVLFVRRHITTVTEWAKAAVQ"
FT   gene            complement(473768..474514)
FT                   /locus_tag="Memar_0488"
FT   CDS_pept        complement(473768..474514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0488"
FT                   /product="Protein of unknown function DUF128"
FT                   /note="PFAM: Protein of unknown function DUF128; KEGG:
FT                   mhu:Mhun_2599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56421"
FT                   /db_xref="InterPro:IPR002846"
FT                   /db_xref="InterPro:IPR036984"
FT                   /db_xref="InterPro:IPR038982"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSS1"
FT                   /protein_id="ABN56421.1"
FT                   /translation="MHAPLKFTNHRIEEYALKVTYRPEDDTGKIIYNLSLIESRDLEFA
FT                   LSIMKEAHKRGITISDRLLVAGPGGQVAGYTVPDGRHAVCTMCSITLDALLLQRGIPAS
FT                   PIGGGIVEVDGRVAQRFTSMILYRDTTLDPLEVLISQEATSILDVMRHGKGNILANIRE
FT                   CHMEAEQLLGTVLDELSAIGFSGILDVGAPNVPLLGVPVSPQYIGVAMVGGTNAMAAVR
FT                   EAGKPVVTRALKGLIDIREMDYLDDY"
FT   gene            474731..475696
FT                   /locus_tag="Memar_0489"
FT   CDS_pept        474731..475696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56422"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSS2"
FT                   /protein_id="ABN56422.1"
FT                   /translation="MESGTREKARNVLKRILAAASYDVEEVGDPLDLSAIGSEDALVVL
FT                   CSDDPETIENFDSMTYRLRTGEEDWVCRKLLFTLDSAMQTEDCILWGPDEFVRYAGRAA
FT                   LAEVLGQSLILDLPPAAGAVRRRQIEAAPAAVEEEPEDGPELPHLPVQVPEKRACGIAG
FT                   LHGAAKCRFIPYWNYRYVSTGEREVKDRLVSFDAEGAGAVNAINGLKMEINPDEIERGP
FT                   VPFGSEIVSARLVREDVEEQLVREVVDRLTQRIRFRYEKGDAIFYEEKTLKPDRNNITV
FT                   DLETVYVPVWQVRGGSKIVEVNGFTGEVLSMPMDEGVELL"
FT   gene            475701..477020
FT                   /locus_tag="Memar_0490"
FT   CDS_pept        475701..477020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0490"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A; FAD
FT                   dependent oxidoreductase; KEGG: mhu:Mhun_2635 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56423"
FT                   /db_xref="GOA:A3CSS3"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSS3"
FT                   /protein_id="ABN56423.1"
FT                   /translation="MIVVIGGGPAGRLGAIHLAQAGEEVRLVEQRSIGGQCLHERCMTI
FT                   CALNDVARLVECARTQKDLGILDSVPAVSYPAIRKRICEVQEKLSSVLDAETRRAGVEV
FT                   IYGAVGRLEGSRVFIGDEEVRADAVIAATGSRPAIPEIPGTDLTGVYTYRTLPAMPDLP
FT                   RRMAVIGGGVVAAEFAHIFHAFGVEVEIIARHGLLRDLDEKMRSAALRDLAGIGVREET
FT                   PVASIEGGGRVRSVLLADGEEIEADAVLLATGLVPRSETLQGLEKGPDGAVIVDRRMRT
FT                   SVPGVYAAGDVIGPPYLTPAARREGVVAAENILGRDTVMDYEGIPQAMSLRYDYAFATT
FT                   GDGGVTLSSPAPAGPGSFWDVAGGWAGLAQVRVDPATGRLIGAAAAVPGASILLSYIGY
FT                   LMKQGITVDDFDDIVEVHPSTDGVYGLARYAAGMFKKREE"
FT   gene            complement(477034..478656)
FT                   /locus_tag="Memar_0491"
FT   CDS_pept        complement(477034..478656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0491"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: CBS domain containing protein; DHHA2 domain
FT                   protein; DRTGG domain protein; KEGG: mhu:Mhun_1158
FT                   inorganic diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56424"
FT                   /db_xref="GOA:A3CSS4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSS4"
FT                   /protein_id="ABN56424.1"
FT                   /translation="MGLNKIIIIGHKQPDTDSICSVIGYAELRNRAEPGKYIPARCGEV
FT                   SPEAKFALETFGVEAPAYVASVEPTVSDIPLDTRSVRQDVPTVDVAALMDTYDMRNMPI
FT                   TDGHETLVGLVSEYGLARAYVRKNPREQLSLIPMPLETLARILDARIVVPARETLGEGR
FT                   VYTVIDALHVTLSRMTPDDIAIVGDNEPAQLALISAGVAALIIAEGAPVGERVIDAART
FT                   RGASVLSTTLDAFSVGKMISLSLPASMIMETDVPTVRMEDSLEYAKSVVSNSKFRTACV
FT                   VGEGGRHIGLVSRTTLMQEVQKSVILLDHNEYSQAVDGIEQADILEIIDHHRLGAISTL
FT                   KPVRFLNDPVGSTSTIVASKFIEACIEPTPSTAGLLLSGILSDTMVMKLSTTTPADIRA
FT                   ADYLAGIAGVDPAEYGPELIRKGMDLDALPKEELLTRDMKRYNLFGKSIMVSQVMTSSF
FT                   AFAETHADEIRAELDRLRTTMGIDCFFALFTNVFSNASDLFAAGDEACITKLDLRDQPV
FT                   RLEGVMSRKKDFIPKFGQMFRQL"
FT   gene            478786..479925
FT                   /locus_tag="Memar_0492"
FT   CDS_pept        478786..479925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56425"
FT                   /db_xref="GOA:A3CSS5"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSS5"
FT                   /protein_id="ABN56425.1"
FT                   /translation="MGTDRPGPVPVLLILACLLVSPAAGAQGNVTVTSVAVEPEVLMPG
FT                   DSGFVTVTVQNTGPSTLLLGRARLYEDGVVPAGEPYPSVGDLGAGLNRTFTFAVRADAP
FT                   DGTYYPRFSLDLRENGTLSHPVPVRVDGTPLEASVADRPDAFAAGREAAIAVQVGNPRP
FT                   NAASGVRVIPEGANFSVTPGSAFIGTLEPDASGTVAFNLTPAAETNVTFRVVWRNGINT
FT                   HAADLVLPVTFGEDKRQADPVITNVEVAVEGGIYRATGDVMNAGLEPARSVIISPGAPA
FT                   TPVDPFRVYVVGTLDSDDISTFEVTFRAGAGVEEIPLVIDYRDGDGNPYSVERPISLEN
FT                   RTAEEGADAGLPAPAVAAVALVAVAAGLAALWYVRRRRR"
FT   sig_peptide     478786..478866
FT                   /locus_tag="Memar_0492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.840 at
FT                   residue 27"
FT   gene            479922..480596
FT                   /locus_tag="Memar_0493"
FT   CDS_pept        479922..480596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0493"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mhu:Mhun_2931 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56426"
FT                   /db_xref="GOA:A3CSS6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSS6"
FT                   /protein_id="ABN56426.1"
FT                   /translation="MSGEPILRFEEVSKIYPLPAGDVVALDRVSLTVDPGEFIAVMGPS
FT                   GSGKSTLLNLMGCLDVPTRGKIYLSGHEISRMSDDDLTRLRRDRIGFVFQQFNLIPLLS
FT                   AVENVEFPIILTTDREESRRRAIEVMRAMHLNDALLTHRPAELSGGEQQRVAIARALVN
FT                   DPDLLLCDEPTGNLDTKTGTAIMEILAEENREGKTVIMVTHDPNVAAYARRTIRIVDGR
FT                   LA"
FT   gene            480596..481795
FT                   /locus_tag="Memar_0494"
FT   CDS_pept        480596..481795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0494"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mhu:Mhun_2932 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56427"
FT                   /db_xref="GOA:A3CSS7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSS7"
FT                   /protein_id="ABN56427.1"
FT                   /translation="MFFSFAARNLRRHWIRSALSIIGIVIGVVAIASLGVMGNSINLLV
FT                   ANVITDVGDTIVITPHTAIGGTFAGDPRTAVDAAIPVREVEEIRRAANPHRTVPVLQGA
FT                   DEVEFGRGESGYTQIIGLASDDIPILLEIADGQYPRQNQPGALVGTYLAAEYDVAPGFR
FT                   LTIGNESIRVAGVLAERGFAADINPDYAIVVPDGWYESHFGARDTYPMVIVRVGNAEEI
FT                   DAVKEAIDSRINRREEIVDVFDSRDMLRQYEEIYQQITVFLLGIGGISLIVAAVNILNV
FT                   MYISVTERIREIGVMRSIGALRREVLRMFLYEAVLLGLIGSIIGGVLSTAFGYLISLAA
FT                   VEVFTAGTTFGENITIFDLSAVGYIVFGMAFGIGTSIAAGFYPAWNASQLAPVDAMRQK
FT                   "
FT   sig_peptide     480596..480712
FT                   /locus_tag="Memar_0494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.731 at
FT                   residue 39"
FT   gene            481811..483004
FT                   /locus_tag="Memar_0495"
FT   CDS_pept        481811..483004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0495"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mhu:Mhun_2932 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56428"
FT                   /db_xref="GOA:A3CSS8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSS8"
FT                   /protein_id="ABN56428.1"
FT                   /translation="MIFFDLAVRNLKRHKVRSVLATVGIIIGVIAIASLGVMGSSLSVL
FT                   FSGMVSDVSDTLLVTPHLAASSGDPFDPRNTLAARISDKNLGLIEKAAGEHRVIPMILA
FT                   SDRLHVRDASGYVTIYAMPAADIPFLLEEEAGIYPQGRSSGVMVGSLLADEFDLHPGSR
FT                   IEVGGERVRVVGIAAERGMGIDINPDYAVIVTEDWYTERHGEQDYSRVVVKVGDLSEIE
FT                   GVKAAIDQQINRRKEVVDVLDSREILEIFYETTDAINIFLLGIGAVSLLVASVSILNVM
FT                   IISVTERTGEIGLMRSIGARKREVLRMFLYESLVLGIAGSIAGGIVSIAVAYYVTTTVA
FT                   EYLTDFAMSAGAGIPVTVVIGYVAFAMAFGTATSIVAGFYPAWKAAQLNPIEALRYE"
FT   sig_peptide     481811..481930
FT                   /locus_tag="Memar_0495"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.910) with cleavage site probability 0.634 at
FT                   residue 40"
FT   gene            483085..483339
FT                   /locus_tag="Memar_0496"
FT   CDS_pept        483085..483339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56429"
FT                   /db_xref="InterPro:IPR021734"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSS9"
FT                   /protein_id="ABN56429.1"
FT                   /translation="MLFVLWYQFEPEHAHQVLELWKHFKFPSDVNVLQRYLLIGRHMSV
FT                   AVFEAPDERSILKITAPFSSYGVAHVVPAMTLEEAIKTV"
FT   gene            483588..484766
FT                   /locus_tag="Memar_0497"
FT   CDS_pept        483588..484766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56430"
FT                   /db_xref="UniProtKB/TrEMBL:A3CST0"
FT                   /protein_id="ABN56430.1"
FT                   /translation="MLQMITWLDKNFSSLQPTRAIIMRALRHLRPADRKKLFSEDIPEM
FT                   RTAEGRWFEAIVYEMILDLSLQTDLVLSVVARGADGPAKVRRAQLGQNGLFYSNIGDVK
FT                   VRGNGQDLAEVDLVLVDHTGALTFGEIITSPADLKEFEAEIRYKKQLFGYLYGQPTVPF
FT                   LLISSVDISRTAVVRRLLKEPDNILLTTPTCEDLKALIRQRDLKRSPTRRVKHEKLVSI
FT                   KDIPPRRPFDYKKLHDERLQSIISTVTSKKGVGELGTPDEIPPIVKKVLFGGLYPSAVR
FT                   MLDARYPIRIKGKTYDPDTIQKQFSKVILAVNIPDYRPIIYLRTRNKKEYLKMVPNKTG
FT                   GFKFESRRTPHMAGFFLWLESVQPSLGAELTRELLDAFPAVHVLESVAERKP"
FT   gene            484825..485484
FT                   /locus_tag="Memar_0498"
FT   CDS_pept        484825..485484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0498"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: mhu:Mhun_1498 multiple antibiotic
FT                   resistance (MarC)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56431"
FT                   /db_xref="GOA:A3CST1"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A3CST1"
FT                   /protein_id="ABN56431.1"
FT                   /translation="MDLITEIAGFVGLTLVAVASITAVMNPASTTAVFTALTEGMTPDE
FT                   RRQVILTTVRISFIVLAFFALTGQLVFSIFNITVPAFQIAGGILLVTVATGMLGSRGES
FT                   YQAGDLENIAIVPLAFPLSCGPGTITAVILLTSAGASSLIAVFLGIAVALVISYVGMLY
FT                   GPRIFAFIGEGGLRVVPKLMAVIVLAIAIQFIISGIAEAMPQLLSNVDFGGDAGTE"
FT   gene            485481..486446
FT                   /locus_tag="Memar_0499"
FT   CDS_pept        485481..486446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0499"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   tte:TTE0754 membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56432"
FT                   /db_xref="GOA:A3CST2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A3CST2"
FT                   /protein_id="ABN56432.1"
FT                   /translation="MTDVQIALIQALQTHATWLEAPMLFFSALGEPEFYLLVILILYWC
FT                   WDTRLGLRLALLMGITGGLNEALKVAFHLPRPYWVSPEVRAFGSHPSFGLPSAHAQGSA
FT                   SFWGLLAADARRRWVWAFAAGTVFLIGGSRVFLGVHFPIDVLVGWTIGAAVLLAFLALE
FT                   GPVGRRVAALPLSGKVLAAFAGSLALAIASFAALAALGDWEVPASWAAGALERSGEPIN
FT                   PLLLLDAVTASGLFFGFAAGAAADRHPGSMCARGKGSVRLFRYAFGILIIGAIWYGLGL
FT                   FVPQDAVPAAYLFQYLRAAVAGAWVSFGAPAFFARYGPGT"
FT   gene            486523..487056
FT                   /locus_tag="Memar_0500"
FT   CDS_pept        486523..487056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56433"
FT                   /db_xref="UniProtKB/TrEMBL:A3CST3"
FT                   /protein_id="ABN56433.1"
FT                   /translation="MILCVVAILFAVLAAHALNAPPGHPAGFVYSALEETGGCLMVSGE
FT                   VYGYALTGGTVDGVALVCDRPDPSRMGAVTCSVRLFVGDMGSVDIGRAALEVATAEGTE
FT                   RLARTAGAPVSPGNWTIARTGHTIPFLQADDDTLLEPGEQFDLVIYPSRPLAPGERFLI
FT                   RIAPPQITPVTDLG"
FT   sig_peptide     486523..486576
FT                   /locus_tag="Memar_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.619 at
FT                   residue 18"
FT   gene            487104..487562
FT                   /locus_tag="Memar_0501"
FT   CDS_pept        487104..487562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0501"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   mhu:Mhun_1615 protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56434"
FT                   /db_xref="GOA:A3CST4"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A3CST4"
FT                   /protein_id="ABN56434.1"
FT                   /translation="MLAEGITLGWMLIVLGAVLLLVEVYQPGFFIAVPATVMIILGVLL
FT                   LLGVDILSSPWGLVVGVLAAIVAASVTVWLYGRLTPGQEPPTTLSRDSLVGLEGTVVVP
FT                   VDPETLVGKVRLGSMEWSARSESGEIPVGRKVIVVRSEGVHVVVKEVV"
FT   gene            487564..488655
FT                   /locus_tag="Memar_0502"
FT   CDS_pept        487564..488655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0502"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: mhu:Mhun_1614 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56435"
FT                   /db_xref="GOA:A3CST5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A3CST5"
FT                   /protein_id="ABN56435.1"
FT                   /translation="MLFTGEGPLTGLITVFLIIVIIIIFARGVVIVQPYEQGLQIRLGR
FT                   YIGRMNPGFRWVVPLITVVKKLDLRTEVMDVPRQEVITKDNSPTNVDAIVYVRIIDPEK
FT                   AYFEVMNYRSATVALAQTSLRGIIGDMELDEVLYNRDVINARLRDILDRETDAWGVKVE
FT                   RVEIKEVDPVGAVKQAMTEQTAAERERRAAILRADGEKRAAILKAEGSRQSIILEAEGE
FT                   RQSKILRAEGERLSKILQAQGEAQGLRILSVGARPLDKRAITVLSLDALKKMAEGQATK
FT                   IIFPFELSSIVKQAAEYLGATTEAPEVPEGGELPPEDILGEIPGRDVVRTAEEAVKSID
FT                   TDIGVEMQKKSRDLIGKGEDEGL"
FT   gene            complement(489003..490334)
FT                   /locus_tag="Memar_0503"
FT   CDS_pept        complement(489003..490334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0503"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: mhu:Mhun_1215 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56436"
FT                   /db_xref="GOA:A3CST6"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A3CST6"
FT                   /protein_id="ABN56436.1"
FT                   /translation="MNWLQILLLLVAAYLLIAYYIRERGLFKEHVMFFGPILAIKTERV
FT                   GFFDWFRKFGTVLRAYATLGVLLVVVVSAFMTLALLVAVPQYLVHTPEPTGIYDPRNLL
FT                   AIPGVNQAIPITAAVFLGLLLTIVIHEFGHAILARVENMRVKSMGLLIAVIPIGAFVEP
FT                   DEEDVEAARGMPKIRMFGAGITNNIVFGLACFAAMFLLFGMAAPLAVPLVQGVYQDYPA
FT                   ADAGIPGYSIITGVNGVPVASQEEIAAIMDGTRPGETVTLTAAKDGVESTYTLTLSEWP
FT                   EALNGDRDSGFMGVYYYSAPAVKEHIGNIADLGLLAPLYLTIAPIDAFIQGNTQQLGIL
FT                   LTDTPEQIAWEEPFPLFWGTVHLLFWTGWFNLLVGMFNAIPIVPLDGGYMMKEGVERFF
FT                   ERRGWSQYAQRVVASISGFVTVMLILLITMPMIVAALRFVLTMG"
FT   gene            complement(490375..490992)
FT                   /locus_tag="Memar_0504"
FT   CDS_pept        complement(490375..490992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0504"
FT                   /product="RNase HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="KEGG: mhu:Mhun_1216 ribonuclease HII; TIGRFAM:
FT                   ribonuclease HII; PFAM: ribonuclease HII/HIII"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56437"
FT                   /db_xref="GOA:A3CST7"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A3CST7"
FT                   /protein_id="ABN56437.1"
FT                   /translation="MDEAGKGSVLGPMVVAAVGCREIEDLATLPIRDSKVLRPKQREAL
FT                   YEILFRDFSIAIVTIDAAGIDDARSRMSMNTCVAELHAEALMSLQPEYAYVDACDVNAE
FT                   RYGRTVAELLDYPCEIVAEHHADARHKVVGAASVVAKVTRDRAIRELEQQYGAIGSGYP
FT                   SDPATIEFLRGYIRSHGSPPACARRSWKTVTNLCQTTMQDFT"
FT   gene            491035..491724
FT                   /locus_tag="Memar_0505"
FT   CDS_pept        491035..491724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0505"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: hma:rrnAC0754 Trk potassium uptake system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56438"
FT                   /db_xref="GOA:A3CST8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A3CST8"
FT                   /protein_id="ABN56438.1"
FT                   /translation="MLTVESRWMYTIIIGLGGIGRNLTAIAVNAGDSVVVIDQDEERAS
FT                   DILEHYDVLAITGNATDKSVLEDAGIDRADALVATTSDDAVNLMTCWLAKRYEVGNVVS
FT                   IVNQKEHSDLFNEVGVRISENPDELVATRLYYWAKSPNLQQVASIPGGTIFEIVADEGA
FT                   PIVDHEIRELEVRDFVFIAIRRAGGDLIIPSGTVRIRPGDVITVFTKKEAETETLKTLN
FT                   KQLIRSG"
FT   gene            complement(491716..492912)
FT                   /locus_tag="Memar_0506"
FT   CDS_pept        complement(491716..492912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0506"
FT                   /product="2,3-di-O-geranylgeranylglyceryl phosphate
FT                   reductase"
FT                   /EC_number="1.3.99.-"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase, FAD-binding; FAD dependent oxidoreductase;
FT                   Lycopene beta and epsilon cyclase; KEGG: mhu:Mhun_1123
FT                   geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56439"
FT                   /db_xref="GOA:A3CST9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR023590"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CST9"
FT                   /protein_id="ABN56439.1"
FT                   /translation="MKNNYDILIIGGGPAGALAAKTAAEAGNTVCLIEKRAAIGTPVRC
FT                   AEGIGKELLKEFIKPDPRWIAADIERARIISPNGTAISLEQDRAGNEVGYVLDRKIFDR
FT                   ELVWQAAEAGADVIVKTRATAPIMENGAVRGAKVLSVGIPADIRAEVVIAADGTEAQFA
FT                   RRAGLDTVVPLREMMSCAQYLMTDIDIDAGSTDFYLGNEIAPEGYLWVFPKGNRTANVG
FT                   IGISGRKSRDGSRAKDYLDRFVAKNFPNGKTIEAIAGGVPVCRPLACTVADGLMVAGDA
FT                   ARVVDPITGGGIGNAMYTGRLAAQVASKCIAAGDCSKEALMPYDAEWRASKMGTVLERN
FT                   YKVKEYFVTLDDAKLNTLAESIAQSSLKEFSVLGLIKELIKRNPKLLLELKALKDTLS"
FT   sig_peptide     complement(492853..492912)
FT                   /locus_tag="Memar_0506"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.829) with cleavage site probability 0.343 at
FT                   residue 20"
FT   gene            complement(492902..493087)
FT                   /locus_tag="Memar_0507"
FT   CDS_pept        complement(492902..493087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0507"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mba:Mbar_A3421 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56440"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSU0"
FT                   /protein_id="ABN56440.1"
FT                   /translation="MSTMLRINRDKCGYCGTCVAVCPEDALELIDVYLSLERECIACGI
FT                   CARACPLGALEVIHEE"
FT   gene            493268..493798
FT                   /locus_tag="Memar_0508"
FT   CDS_pept        493268..493798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0508"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /note="TIGRFAM: precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; KEGG: mac:MA4263
FT                   precorrin-8W decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56441"
FT                   /db_xref="GOA:A3CSU1"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSU1"
FT                   /protein_id="ABN56441.1"
FT                   /translation="MGLKGGPTQDEVMAVSLAKLGILPGDRVADIGCGTGKIAVAASKT
FT                   AERVYAIDRRSEAIAYARAEAARAGAENIEFFEGDAVEILPDLGALDAAFVGGSRRLPE
FT                   VLDLLADRVRGKIVVNAVMVGTLHEAIASMQRLGIFEEAVHLQVSRSAGIAGGVMFKPI
FT                   NPVYIVVGGAGCS"
FT   gene            493789..494406
FT                   /locus_tag="Memar_0509"
FT   CDS_pept        493789..494406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0509"
FT                   /product="cobalt-factor II C20-methyltransferase"
FT                   /EC_number="2.1.1.151"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: mhu:Mhun_3210
FT                   uroporphyrin-III C/tetrapyrrole (corrin/porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56442"
FT                   /db_xref="GOA:A3CSU2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSU2"
FT                   /protein_id="ABN56442.1"
FT                   /translation="MLVGVGLGPGDPELLTLRAVRLLREASAVFVPGNLAYDLVRPYRP
FT                   DAVVLNFPMTNDEDYIRTCMEENADRIAPHAADGLSVFGILGDPNFYSTFSRLCEVIAA
FT                   RYPEVAFATEPGISSITAFASVANVPVAGGFLVSDGNGPESRIFMKVRKPAALAASLSE
FT                   EGYSEFVLVERMFMPEQRVYRGGDLPEKSDYFSILFARRPHA"
FT   gene            494399..495115
FT                   /locus_tag="Memar_0510"
FT   CDS_pept        494399..495115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0510"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: mhu:Mhun_3211
FT                   precorrin-4 C11-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56443"
FT                   /db_xref="GOA:A3CSU3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSU3"
FT                   /protein_id="ABN56443.1"
FT                   /translation="MLKFSIVGAGPGAPDLITVRGMDLLRRADVLIYAGSLVNPALVEE
FT                   SGAGVRLDSWGMTLDEIVDAIEEHVRAGKLVVRLHSGDPALYGAIVEQMAELERRGIEA
FT                   EIVPGVSSLFAAAAALKTQFTLRDVSESLIVTRPAGATLESDLIPELSRLGQTMVVFLG
FT                   TERMEEILARVECPPDTPAAVVYHASWPDQKVVRGTVADIAQKARAAGIERTALIVIGR
FT                   VVDPATSGFGRSVLYS"
FT   gene            495112..495984
FT                   /locus_tag="Memar_0511"
FT   CDS_pept        495112..495984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0511"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein; KEGG: mhu:Mhun_3212 cobalamin (vitamin B12)
FT                   biosynthesis CbiG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56444"
FT                   /db_xref="GOA:A3CSU4"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSU4"
FT                   /protein_id="ABN56444.1"
FT                   /translation="MTGTVVIALERFLPDARRIADALGADVLSYGPDVFRAAFAGYGRI
FT                   VALMSAGIAVRGIAPLLTDKWRDPAVVVVGPDLRYAVPVVGGHHGGNDLARELAALGIE
FT                   PVITTATETRGRESVEGLAARTGCEIVNRDSTRAVNAAMLDGDVPLYAVAGPGFVVAGP
FT                   GVSLLVRKGEHVVGVGCRKGVDAAEVEEAVRRALREAGIAPDEVLVYATTAKKRGEAGL
FT                   LDAVANLGGNLVFLDDGTLNAQEAPSPSRAPLIGLAGVAEPAALAIAKRKVLVLVKQTY
FT                   GGVTVAIAR"
FT   gene            495953..496750
FT                   /locus_tag="Memar_0512"
FT   CDS_pept        495953..496750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0512"
FT                   /product="precorrin-3 methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: mhu:Mhun_3213 precorrin-3B
FT                   C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56445"
FT                   /db_xref="GOA:A3CSU5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSU5"
FT                   /protein_id="ABN56445.1"
FT                   /translation="MVVSLLQSHDSGGGRLYIVGTGPGNLLQMTPRALKALGEADCVIG
FT                   NGFYLDLVEPMLAGKEVVRSSMGKEVDRAAKALDLARDRVVAMVSGGDAGVYGMASIVL
FT                   EVAERSGSTVAVAVVPGITAAVSAAARLGSPLSGDYVTMSLSDLLTPREEIERRLDLAF
FT                   RMRVPVVLYNPRSRGRPHNLDAAVGIARRHLLETTPVGVIKNAYREGEERLITTLGEFE
FT                   DHFAFVDMHSIVFIGGEETRIWRDENGARGIITPRGYHRKYVY"
FT   gene            496698..497378
FT                   /locus_tag="Memar_0513"
FT   CDS_pept        496698..497378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0513"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; KEGG:
FT                   mhu:Mhun_3214 precorrin-8X methylmutase CbiC/CobH"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56446"
FT                   /db_xref="GOA:A3CSU6"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSU6"
FT                   /protein_id="ABN56446.1"
FT                   /translation="MREESSRPGDTTGNTYTDLAAVTPEAYAIASASRNLARERVGNTT
FT                   LEDRIRQRCSVAVGDFAMADLMRFSGDPVDAGVAALARRAPIIVDIRMVQAGILKRGHA
FT                   SEILCALDYGEDLARERGITRTSAGFLALRDRLEGAIVVIGNAPSALLVVCDLIREGVR
FT                   PALVVGTPVGFVNAAESKEELRIVDVPSVSNAGTRGGTPVAVAAMNEIITIHAEREGHA
FT                   GPGY"
FT   gene            497359..498372
FT                   /locus_tag="Memar_0514"
FT   CDS_pept        497359..498372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0514"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiD
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiD
FT                   protein; KEGG: mhu:Mhun_3215 cobalamin biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56447"
FT                   /db_xref="GOA:A3CSU7"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSU7"
FT                   /protein_id="ABN56447.1"
FT                   /translation="MRDPVTDFEYPAAWVAACRSPDLLDDVRRGLAVLTASGTVLRRGF
FT                   STGTTAAAACKAAILSLACDTVREVDVTLPCGIAVRLAVDGYRGQASCRKDAGDYTADV
FT                   TGGLEFVAMAAPSLSGGVQFVPGEGIGSFARDTPRHRRGTPAISAPALDCIRRSIDEAV
FT                   EEADLSGTTVILTIPRGAEVAQKTLNPRVGVHGGISVLGTTGFVEPWDDHMTEGVIDRI
FT                   ARAPGAVVLTTGRLGLRYSRLLFPEHEAILVGNKLEEALRAVEGDAVICGLPGLILKFM
FT                   NPDVLSGTGCVTVEELSATPLWEETVRRELAAFRARYPRVRVVIVDRDGRIIGEPP"
FT   gene            498369..498941
FT                   /locus_tag="Memar_0515"
FT   CDS_pept        498369..498941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0515"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating)"
FT                   /EC_number="2.1.1.132"
FT                   /note="TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   mhu:Mhun_3216 precorrin-6y C5,15-methyltransferase, subunit
FT                   CbiE"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56448"
FT                   /db_xref="GOA:A3CSU8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSU8"
FT                   /protein_id="ABN56448.1"
FT                   /translation="MKIVGVGCGPGMLTAEAASTIAGASLVYGSARAIALARDAIPAGS
FT                   EVHEIEDYRGLRSLPAHAVVLSTGDPMLAGLGYLPGDVVPGISSLQVAFARLKVPLARA
FT                   AVVSAHGKDHDRAIAEAREEVVRGKVVFLIADPAFDVGALAAALPPRIRLAVCEDLGYP
FT                   AERIAAGTAGEPPAPRGELYVVVAGAF"
FT   sig_peptide     498369..498422
FT                   /locus_tag="Memar_0515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.658) with cleavage site probability 0.541 at
FT                   residue 18"
FT   gene            complement(499436..499750)
FT                   /locus_tag="Memar_0516"
FT   CDS_pept        complement(499436..499750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A3088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56449"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSU9"
FT                   /protein_id="ABN56449.1"
FT                   /translation="MTFREIDDDLWGIVRRHLPPQKPHIGRPRRDPRNLFNGVLYVLTT
FT                   GCAWSDVPAKYGTKSTVHRYHLELCRRGAYEAIFLDLLRSGYEFRKKESAAADLAASTA
FT                   "
FT   gene            complement(499808..500806)
FT                   /locus_tag="Memar_0517"
FT   CDS_pept        complement(499808..500806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0517"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: mhu:Mhun_1945 DNA adenine methylase; TIGRFAM:
FT                   DNA adenine methylase; PFAM: D12 class N6 adenine-specific
FT                   DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56450"
FT                   /db_xref="GOA:A3CSV0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSV0"
FT                   /protein_id="ABN56450.1"
FT                   /translation="MRDTGNANALQDQPFLQHSPRWKRSMATRTARPFLKWAGGKAQLL
FT                   DAFTARVPRELAEGTLPVFVEPFMGGGAVYFHFNSTFAFRECHLFDINEELVLAYSVVK
FT                   NDVSGLIEYLRDVEEKFLSKDDSGRREYYYAVRDTFNRERKEVDFTRYGEAWVERAGRF
FT                   IFLNRTCFNGLFRVNSRGGFNVPFGRYKKPKILHEEVLRADSLAFRNTTIHLGDFTQAE
FT                   PYISESTFVYFDPPYRPLNRTSSFTQYSKNRFSDEEQRRLAEFYACCDAKGARLMLSNS
FT                   DPKNADPEDGFFDDLYAGYRIDRVPARRAINCDGTKRGEVREIIVMNYRPA"
FT   gene            complement(501048..502028)
FT                   /locus_tag="Memar_0518"
FT   CDS_pept        complement(501048..502028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0518"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   mhu:Mhun_2937 DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56451"
FT                   /db_xref="GOA:A3CSV1"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSV1"
FT                   /protein_id="ABN56451.1"
FT                   /translation="MRSEEINGNIFYNGDCIAGARAHIPDDSVDLIVTDPPYGINGDRL
FT                   HQHYNRDEAFVVDGYVEVPASDYGEFSQRWIQEAERILRPGGSIYIVSGYTNLYHILHA
FT                   LRGTHLREVNHIIWRYSFGVYTSRKYVSSHYHVLFYEKPGGDRTFNLESRYGTGERGPK
FT                   NGSLNYRDREDVWCINREYKPGQAKNKNELPTELLVKMIQYSSNEGDLVCDMFLGGFTT
FT                   AKVAVGLNRRATGFEISERVFDLKIAELRDTRPGWLLSTLRTPETGEPANRGRPWTETD
FT                   REILVSRFAALIESGETKKRAVEILGSELGRGRWAIEKMLKKRSD"
FT   gene            502202..503797
FT                   /locus_tag="Memar_0519"
FT   CDS_pept        502202..503797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0519"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: nph:NP4696A signal-transducing histidine
FT                   kinase; PAS/PAC domain protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56452"
FT                   /db_xref="GOA:A3CSV2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSV2"
FT                   /protein_id="ABN56452.1"
FT                   /translation="MAHSEDPGSALHTAAPERVAHERMAAILAENEALRHENAVLQSVK
FT                   DAFQESEKRYRRLFEDDLTGDFLTDADGLILACNPAFVRMFGFASIEGALGTNILELYE
FT                   DPRDRETLLARLQRDGKVENEGRIRKRRDGTRLHVVENVVGYFSADGELLETQGYVYDD
FT                   SERKRAEEALRESEGRFRAVLENSLDAAYRRNLRADRYDYISPAIEEILGFTPEEMSAV
FT                   NLEEVMERIHPDDRPPVEAELNAAAASGKGLLIYRFLTKNGEYRWLEDHLMVICDPGGR
FT                   PLYRGGIVRDITGRKEAEVELARVHRDLESAHRETNLYLDILTHDIGNTENVSNLYAEL
FT                   LVDSIRGEAAVYVVNLKRSIAKSIEILGIVSKIRRIHAGPPELRSVDLDAVIRTEIDHF
FT                   PAVPITYEGALCEVVADDLLCEVFTNLIGNAVKHGGPGVAVIVRVEEQNGEVLVTVADT
FT                   GRGVPDDQKEEIFHRYERKQRGVGEGLGLYLVQILIDRYGGRIWVEDRVPGHPEEGAAF
FT                   VFLLREADSVPARP"
FT   gene            complement(503955..504824)
FT                   /locus_tag="Memar_0520"
FT   CDS_pept        complement(503955..504824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0520"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="KEGG: sat:SYN_00659 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56453"
FT                   /db_xref="GOA:A3CSV3"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSV3"
FT                   /protein_id="ABN56453.1"
FT                   /translation="MLSGILSFFQGILMSSYVYVCIIAALAILVAGCVADQPAATNAAA
FT                   VDGDAAALLIRLQSDITAALEDLDDRLAYAAYDLRETDLSGDDAHAILANLSATDPSIV
FT                   DCTVSDADATIITVEPAAYRGVEDTEIQNQSHVRHILATKRPMMSEMITVAEDIPATVI
FT                   IAPIFTNESRFTGFASIVFRPEDLIAGVAGPAANGTPYQVMVIQTDGRVLYDTDPTQIG
FT                   KMTFEDPLYADYPDLLDVARRVAGERYGTAAYGFAADGGQAVQKEITWTTAGLHGVEWR
FT                   VAVIRAVE"
FT   sig_peptide     complement(504717..504824)
FT                   /locus_tag="Memar_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.647) with cleavage site probability 0.554 at
FT                   residue 36"
FT   gene            complement(504842..505558)
FT                   /locus_tag="Memar_0521"
FT   CDS_pept        complement(504842..505558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0933 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56454"
FT                   /db_xref="GOA:A3CSV4"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSV4"
FT                   /protein_id="ABN56454.1"
FT                   /translation="MSADDTTNIPRPEGYKALLANPYLTGPIKFVLPIVIALAIFAALY
FT                   LIEPYQQFLVISGLLAAYFVPPAGKESIIPIAIVMGYPWWLVTLAIFLLDVAVSLFVVW
FT                   NFDLALKIPLIGRVLESGMTAGRNYTDARPWIRRFSTIGLVLFVFFPLQGTGAMNGAIV
FT                   GRLLGLEKARVFACVCTGSLASSLIIAFGSDVLLDVYQQNHALGIGILAAIVVAVLAAV
FT                   AGLKLREKRLRERSPR"
FT   gene            505670..505936
FT                   /locus_tag="Memar_0522"
FT   CDS_pept        505670..505936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56455"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSV5"
FT                   /protein_id="ABN56455.1"
FT                   /translation="MTPVPVTRSPRALPVVDAGTRESALCTIANVATALETLREVRKHV
FT                   RGDHKRRLDDVAVVLRVAALDAQATYAITDEEARSFIRDCRSR"
FT   gene            complement(505914..507176)
FT                   /locus_tag="Memar_0523"
FT   CDS_pept        complement(505914..507176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccr:CC3273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56456"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSV6"
FT                   /protein_id="ABN56456.1"
FT                   /translation="MEPSAYTGKNAAEARDMDAVARFYVKCALWLGAHDQVFVDAYFGP
FT                   AAVRDEALMVTVPPDRIAGYAADLLATLDRIDPDRLEGAGRMRHTHLREMIRALEARAG
FT                   ILAGESTTFNAETEALYGVAAQEDDPAWYDDLHAALDASLPGNGDLPVRYRAFMDSFVI
FT                   PSGRLEPVFAAAFAESRRRTAERLPLPAGERLEIGYAAGEPWEAYIRYLGDGASLIRVN
FT                   ADLPVTVDRALAYACHEGYPGRHTMRVIREAALVRARGWIEHAVVTLASPLATVAEGAA
FT                   VLGEEMIFPAPERARFFEEVLFPQAGFETADAALFDAVVTASAALNLTGNARVARGYLG
FT                   GALPREEASLLLQNVLLLDPKAAQARIRFIEESRAYPVALNEGYRIVRDYVGDGPDRWE
FT                   RFIHALTDPLLPGELTSNDSP"
FT   gene            507276..507827
FT                   /locus_tag="Memar_0524"
FT   CDS_pept        507276..507827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0524"
FT                   /product="CTP:2,
FT                   3-di-O-geranylgeranyl-sn-glycero-1-phosphate
FT                   cytidyltransferase"
FT                   /EC_number="2.7.7.-"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   mhu:Mhun_1815 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56457"
FT                   /db_xref="GOA:A3CSV7"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSV7"
FT                   /protein_id="ABN56457.1"
FT                   /translation="MMHESLRQVVHLIFGLGIAGFVLLFDRDLVLSVLVLALFAGFILS
FT                   DAISRGYTIPVVSPIIAGLERRDAAPGKGALFFALGALFCIAFFAQEVAFMGLVVLSLL
FT                   DSVTTLAGVRFGRIRAYNHKSLEGTLAGFAATAIVLSLLVPPGVALPTAAAAAVAELAS
FT                   PVDDNLVVPVVACIALTLLL"
FT   gene            507903..508580
FT                   /locus_tag="Memar_0525"
FT   CDS_pept        507903..508580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56458"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSV8"
FT                   /protein_id="ABN56458.1"
FT                   /translation="MKRIIAAVMIVFLLLPGFAAAAPGNGSLGGEQVGNSETNTTPGGE
FT                   QWVGAEENTTLRAEENVPDRQRVRTGENETAGDRVRASENTSPRWGEDVPDRNRVRLAV
FT                   HALLGAENRTGGIGENVSAIAREINNSVQKTFEAEEQIRARHGFMRFLFGGDAEAARLI
FT                   EEEAQRNRERAAELGYLIGNCTCDDATRAMLQEQVRTIEQEQDRLRVLASEEMQVRGLF
FT                   SWR"
FT   sig_peptide     507903..507968
FT                   /locus_tag="Memar_0525"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            complement(508595..509578)
FT                   /locus_tag="Memar_0526"
FT   CDS_pept        complement(508595..509578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0526"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   mta:Moth_1683 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56459"
FT                   /db_xref="GOA:A3CSV9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSV9"
FT                   /protein_id="ABN56459.1"
FT                   /translation="MEAVIPGEQESALKEKTARLSVASNTLLVAAKLAVGVSIGSVGII
FT                   SEAIHSAIDLIAATIAYFSVRQSARPPDECHTFGHGKYESISGLLEAVLILAAALLIIN
FT                   EAARNLLGGEETLNVEGLGLGIAVMLLSAGVNFYVSSRLMTVAKKTESIALESDAWHLR
FT                   TDVYTSAGVVVGLVLIRVTGLVVLDSLIALAVAAIILRAAFDLIRRSFEDLVDRSLPAD
FT                   EENRIREIISGHCTDAIGFHRLRTRRSGPNRFVDFHLVVPRTATLEEAYGVVKRVEADV
FT                   KQEFPRTNVTIRVQPCTGEDCSDCGIFTTCPECNRLEHCGREKERE"
FT   gene            complement(509658..511157)
FT                   /locus_tag="Memar_0527"
FT   CDS_pept        complement(509658..511157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0527"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: pyruvate kinase; KEGG: mba:Mbar_A0175 pyruvate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56460"
FT                   /db_xref="GOA:A3CSW0"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSW0"
FT                   /protein_id="ABN56460.1"
FT                   /translation="MMLEEVLQRISEQAKRKRMSLPDHKTKIVCTIGPASRSRETLSRM
FT                   LLAGMNVARLNLSHGSFDEHRENIRNIRTAAEDTGLPVTILLDLPGPKIRIGDLAYEPL
FT                   ELHKGETVTLTTTPASSDPSRIPVDFDQFPQLVSEGSTIFLNDGFLQLQVDEVAENEVR
FT                   ATVVIGGPLLSRKGMSLVGGGGIVALSAVTDRDLECIEFGLAEGLDTFSISFIERAEDI
FT                   LKAREYAARSGKSIKVIAKIERQEALANLDEILRETDGVMIARGDLGVQTPIEEVPAVQ
FT                   KRIIQKANILGRPAITATQMLMSMTDNIRPTRAEVTDVANAILDGTDAVMLSEETSIGK
FT                   YPVETVAMMAKIARSTEEKRSLVGAGCSPLDYFRRGKGREEITVNDVVSLNVIEALDAL
FT                   GIHYVLTPTRSGSTPRNISRFKPGAWILAFTRNPSTFKFLAFSYGVSPFLIRSEKEYWH
FT                   GAILDSIRDSGLISPGERVVLTEGVSPGREGTDSLIILTVD"
FT   gene            complement(511249..512457)
FT                   /locus_tag="Memar_0528"
FT   CDS_pept        complement(511249..512457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0528"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="KEGG: mtp:Mthe_0577 cobalt ABC transporter, ATPase
FT                   subunit; TIGRFAM: cobalt ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56461"
FT                   /db_xref="GOA:A3CSW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSW1"
FT                   /protein_id="ABN56461.1"
FT                   /translation="MTTPLLEADNIAYTYQNGPTALAGVSVRIEAGSKTALVGPNGAGK
FT                   STLLLMLNGMLRPASGVIRFDGRPLAYDNRSLRDLRRRVGFVFQNPDVQIVAPTVEADV
FT                   AFGPVNLGLPPDAVRQAVRDALGYVGLRGYEKRPPHHLSGGEKKRVAIAGILAMEPAVL
FT                   VFDEPTSALDPASSEEVMELLDELASGGRTVLVSTHDVELAYRWADSVVLMERGSVLAR
FT                   GPPEEVFSDHALLATARLKPPALLDLYNELNLRRVIDRGVPPKSVLEFTDRIERAMHGH
FT                   TPAGDGGGRIYLCNADRTGGDEVRALVEHGTVDHVGAMGTRAKEFANRERILLDYTYGV
FT                   IDKCILKALIGENSLIITTGGMVEHVHRRIGEYSAESGRTLAVTPVREPEEIPPPNDER
FT                   IPS"
FT   gene            complement(512454..513230)
FT                   /locus_tag="Memar_0529"
FT   CDS_pept        complement(512454..513230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0529"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   mtp:Mthe_0578 cobalt ABC transporter, inner membrane
FT                   subunit CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56462"
FT                   /db_xref="GOA:A3CSW2"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSW2"
FT                   /protein_id="ABN56462.1"
FT                   /translation="MYEVLEDFAQTNNLRETSPALKLFIGTASILLCVSSHAPFAPLLV
FT                   AASMSTAVLALAKIPARFYAKLLLVPVSFAAMSIVVVLFITGGGAVLLEVPDLPLAITA
FT                   GGANLALLLLARVFGGMCSLYFIALTTPMTEIFDILRKLRVPAVLIDLAMLTYRFIFIL
FT                   IEEAGQIYRSQVMRLGYGRFRESVRSFGMLGGALFIRTWESGEALVLAMDARCYDGRLG
FT                   IAGETRQISAPALAGGLLYLSAVFAVSLSTGGLVIV"
FT   gene            complement(513263..513562)
FT                   /locus_tag="Memar_0530"
FT   CDS_pept        complement(513263..513562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0530"
FT                   /product="Cobalt transport protein CbiN"
FT                   /note="PFAM: Cobalt transport protein CbiN; KEGG:
FT                   mja:MJ1090 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56463"
FT                   /db_xref="GOA:A3CSW3"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSW3"
FT                   /protein_id="ABN56463.1"
FT                   /translation="MKYGMELAVAALIVIFAAVFLFQDAAIQATLGDGEEAWGGADGEA
FT                   AGLIEDSGYEPWIEPFWEPPSGEIESLLFALQAAIGAVIIGYIFGYWQGNRKAA"
FT   sig_peptide     complement(513485..513562)
FT                   /locus_tag="Memar_0530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.919) with cleavage site probability 0.616 at
FT                   residue 26"
FT   gene            complement(513559..514251)
FT                   /locus_tag="Memar_0531"
FT   CDS_pept        complement(513559..514251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0531"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiM; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiM protein; KEGG:
FT                   mac:MA3554 cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56464"
FT                   /db_xref="GOA:A3CSW4"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSW4"
FT                   /protein_id="ABN56464.1"
FT                   /translation="MHIMEGFLPSPWWEIWILISLPFVAIGVYQLNRLVRERRETLPLL
FT                   AVAGAFVFVLSSLKIPSFNGSCSHPTGTGLGGILFGPCIAAVLGLIVLVFQAVFLAHGG
FT                   ITTLGANVFSMGIAGPAVAYLVYKAGTRAGANTYATVFIAAALADLVTYVVTSVQLALA
FT                   FPGTVGFLGAFTAFAAIFAVTQVPLAIIEGAIIMLVFKYIVQLKPEILTRLNLLSESTV
FT                   QKLREAAA"
FT   gene            514384..515715
FT                   /locus_tag="Memar_0532"
FT   CDS_pept        514384..515715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0532"
FT                   /product="cobyrinate a,c-diamide synthase"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; KEGG: mtp:Mthe_1001
FT                   cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56465"
FT                   /db_xref="GOA:A3CSW5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSW5"
FT                   /protein_id="ABN56465.1"
FT                   /translation="MRHIPVIVVAGTHSGCGKTTLASGLMAALAARGLAVQPFKVGPDF
FT                   IDPTHHSAICGRTSRNLDPFMMGEAGVRETFVRATAGADIAVVEGAMGLFDGLEGTDTA
FT                   STAHVAKILDAPVLLVVDAGGASRSVHAMIRGYAGFDPAVRVAGTILNRIGSPRHLAMI
FT                   EETKSLPVYGGIPRRTDLAVESRHLGLAMAAETGMMARFGAVVEETCDLSGIIDLARSA
FT                   PPLPAPAGIPGLPEAEVRIGVARDAAFCFYYADNLDRLVRAGAEPVFFSPMTDRLPDAD
FT                   ALYLGGGYPELHAEALSSSRCREDVRSAVDDGMPVYAECGGLVYLTERLTTGEGDHPMA
FT                   GVLPAATEMTGRIQALGYVEARVAGAAPVLAPGSAFRGHEFHYSRLDCARDARFALELL
FT                   RGRGIDGGRDGLIAQNAVGQYTHAYFPEGFAERLVEAAGAYRRT"
FT   gene            complement(515762..516319)
FT                   /locus_tag="Memar_0533"
FT   CDS_pept        complement(515762..516319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0997 blue (type 1) copper domain"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56466"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSW6"
FT                   /protein_id="ABN56466.1"
FT                   /translation="MIAGCVQPAGNETVTPGTTPGLTETPMETEEETPAMTETPMETET
FT                   PMETETPMETETPAATATTMTMETETPMETETPAATTTTVAAGVTETPPGTPAALVADE
FT                   TVSITESGYVPDTLTVPVGTTVGWTNDASTNQTVSATGATGFFNSGLLAPGDSYSYTFN
FT                   GADNYTYQSQTTGITGTIIVTA"
FT   gene            516750..517598
FT                   /locus_tag="Memar_0534"
FT   CDS_pept        516750..517598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0534"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: pca:Pcar_0309
FT                   predicted oxidoreductases of the aldo/keto reductase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56467"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSW7"
FT                   /protein_id="ABN56467.1"
FT                   /translation="MEAPGRRRFGKTGREVTAVGLGGEGVLRTYGRHAEAKAVIMEALD
FT                   QGIAYFDSAKAYAGSEGYYGEVWRNRPDLRASVFQASKSARRANADAEMDLQETLQRMG
FT                   VETLDLWQIHDVRSFPDIREIEGPSGALEAFVEARESGVVRHIGVTGHHDPDVLAHAVE
FT                   NWPVDAVMMPVNPVEEAIGGFLDRVLTAAREQGVAVIGMKVLGGSNYLVPDAGVTPEVL
FT                   VRYALAREVSVAIVGCSTPAEVRALAAAGRSGPLPDDEAAALVEAFRPHARELAYYRGF
FT                   R"
FT   gene            517692..518903
FT                   /locus_tag="Memar_0535"
FT   CDS_pept        517692..518903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0535"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   fra:Francci3_3232 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56468"
FT                   /db_xref="GOA:A3CSW8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSW8"
FT                   /protein_id="ABN56468.1"
FT                   /translation="MTTEKPHRLRTLRNRIAASPDAILVLVVLVIFMDMMIYGLLIPVF
FT                   PQYAPRLGVGESVIGIIFGIYAGMLLLFSIPMGLLSDRVGRRPLIVAGMLLLALATALF
FT                   GFSTTITHLVAARTVQGVSAAATWSAGLALLADTCDPARLGEKMGVALSAVGVGTILGP
FT                   VAGGLLFEYAGYTATFLIPAALAASVGLAVLAVPVRTCRRESGPHRSPMLPRGSLLSLA
FT                   ACAVVIVAVSGTYGVFDPYLPVYLHAVFSASPATIGVVFAVLAVAAILAQPAAGRIFDR
FT                   YGGSRYLIGGGLLLAGGATVAAMQAGSLPLTAAAVFVLGVALSCALVPTMPLLADIYRD
FT                   HGSQGAAYGMYNTFFAIGLSAGPFAGAVLAGRWPLPAIFLGLAAFLGVTGILSGLAFGR
FT                   LTQR"
FT   gene            518929..520086
FT                   /locus_tag="Memar_0536"
FT   CDS_pept        518929..520086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0536"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: mmp:MMP0075
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56469"
FT                   /db_xref="GOA:A3CSW9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSW9"
FT                   /protein_id="ABN56469.1"
FT                   /translation="MDIAMLPEFFRRYAAELLIAFFALIFLVGAFCEIGGEAGAFLTSA
FT                   LDVALFVILAMLVYLATRHPAFRWIAVLWLLIMVAGLAALAVGFGAIAILPAEMLETEE
FT                   IDPETVDLAMAVEVVLLLLGALVAGFASLVGLSRRFRGWLAGYLPFDPDSLLHTVALVV
FT                   ILAMILIPPVPLLVAGVPPFLSETFLDLLLESGDLLANTVTLNAYTLFWTLIGSFFIAG
FT                   ACVRRTPRETLERLGLVRPTGKEIAFAVGAGLVLVAAFHFIDMALAMLVGWLGLPVTDM
FT                   EAVNLLFAGTLTLPGVIMASVAAGFGEEVSIRGLLQPRFGILLPALLFASLHAFQYSWD
FT                   GLISVFIAGIAFAYIRRYSNTTTSAITHTVYDLVLFSMMLVGMSI"
FT   gene            complement(520148..520339)
FT                   /locus_tag="Memar_0537"
FT   CDS_pept        complement(520148..520339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA1938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56470"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSX0"
FT                   /protein_id="ABN56470.1"
FT                   /translation="MKRYPRETFDDVIRRLMNTAEDEEPLSAEAIRGIEESLEDIKAGR
FT                   LYTLEEARTELQAVWDTQ"
FT   gene            complement(520534..520620)
FT                   /locus_tag="Memar_R0011"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(520534..520620)
FT                   /locus_tag="Memar_R0011"
FT                   /product="tRNA-Ser"
FT   gene            complement(520658..521566)
FT                   /locus_tag="Memar_0538"
FT   CDS_pept        complement(520658..521566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0538"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="PFAM: PUA domain containing protein; pseudouridylate
FT                   synthase TruB domain protein; KEGG: mhu:Mhun_2268
FT                   pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56471"
FT                   /db_xref="GOA:A3CSX1"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR026326"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSX1"
FT                   /protein_id="ABN56471.1"
FT                   /translation="MTGQERFVPESGIVVVDKPRGPSSHQVAAWVGGILGRRVGHAGTL
FT                   DPQVSGVLIVMFGGAVRLAPVLLSHNKEYVCLMRLHGDASRESVEQAAKEFTGRIYQRP
FT                   PRKSAVKRSLRIRKIQEIEILDMDGRLVLFRVRCDAGTYIRTLCVHLGYALGTCAHMEE
FT                   LRRIRSGSFDETTIVTLHELADAVAAAREGNHEPLQGMILPPAAAVADLAKVVVRDTAV
FT                   DAVCHGAVLAGVGVVGKEGGFAKGETVAIVTERGELVGLGKGLVNSSALKPGEPGFVVA
FT                   PTTVLMRPGTYPRGWKARTGS"
FT   gene            complement(521571..522251)
FT                   /locus_tag="Memar_0539"
FT   CDS_pept        complement(521571..522251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0539"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   mhu:Mhun_2267 uroporphyrinogen-III synthase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56472"
FT                   /db_xref="GOA:A3CSX2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSX2"
FT                   /protein_id="ABN56472.1"
FT                   /translation="MKIAITRLENKAAGDRALCATYGHDCYTVSPLRADLRPDRIDTFV
FT                   EAVHRGEFDCLFFSSALPAAVVGPKLERWPRVIAIGPKTAEVLRGFGIEAEVLPTFYSR
FT                   DFVPYLGDWLRGRTVGIPRADVPNPDLLDAIAAAGGTVREERVYALVPTGTELALDAAD
FT                   AALFTSAMSYREARWRPRDDLLLIAIGEITADAMRAGGHPPAVVGDGSLAGTLEALNLH
FT                   AEGR"
FT   gene            522341..523552
FT                   /locus_tag="Memar_0540"
FT   CDS_pept        522341..523552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0540"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112,
FT                   transmembrane; KEGG: mhu:Mhun_2266 protein of unknown
FT                   function DUF112, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56473"
FT                   /db_xref="GOA:A3CSX3"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSX3"
FT                   /protein_id="ABN56473.1"
FT                   /translation="MLSGIVLGTVFGIGCGAVSGLVPGIHANTMAGVLLSLQALLLAWF
FT                   DPVFVASAMFSTLVTHTFLDCVPSTFLGIPDADTSLAVLPAHALCLEGRGEEAVRISAL
FT                   GSAAGVALSLPLALAFVLVLPSLQPAIDWGIGLVILAVAGYLIVVSESPGWALAVFAVS
FT                   GILGLFSLGYAFLSWPAGGESGVLMPLLSGLFGVAVLLKASHGAMPAQHFPGIELPRDA
FT                   IRRGSLLGSAAGALVGWLPGLSSATANALLTSVVGYDSNPREYILATSAANTVNAFLGL
FT                   AAFYAVSRTRNGVMAAIGALEEMPPATAILLAGAMAAVGAYLLTLLFSRTAGRFSGLNV
FT                   TSLNYGVIAFVVCLSLFLCGPFGGLVLLLATAVGYVPSLVNVRRVYCMGAIMVPVMAYS
FT                   FGLA"
FT   gene            523601..524461
FT                   /locus_tag="Memar_0541"
FT   CDS_pept        523601..524461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0541"
FT                   /product="rRNA biogenesis protein Nop56/Nop58"
FT                   /note="PFAM: Pre-mRNA processing ribonucleoprotein, binding
FT                   region; KEGG: mhu:Mhun_2265 pre-mRNA processing
FT                   ribonucleoprotein, binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56474"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSX4"
FT                   /protein_id="ABN56474.1"
FT                   /translation="MLQRYWFGDVDEEGCRAAGTDPAALAERAATLRTGMDSFVPIDWE
FT                   VARDCGVVRTRAEYVDLLRSVCTTLARKKIAQSYQGRDVELLQMVRMLDELDNVINLLQ
FT                   ERAAEWYQVTNPSFSRKYRSLPAKKMLGIIRKGARGGLSDVADEIDRLAGTRSRLMREV
FT                   SARADEVMPNTSALIGGLVAARLLSKAGGLPALARMPGSTIQVIGSERALFSHLRGGTP
FT                   PPKHGIIFQHRRVHNAPRPVRGRVARVLAAKLAIAARLDYYRGEAVPEFLKDAQARIDE
FT                   AGVEA"
FT   gene            524461..525063
FT                   /locus_tag="Memar_0542"
FT   CDS_pept        524461..525063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0542"
FT                   /product="rRNA 2'-O-methyltransferase fibrillarin"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: fibrillarin; KEGG: mba:Mbar_A0804 fibrillarin"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56475"
FT                   /db_xref="GOA:A3CSX5"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSX5"
FT                   /protein_id="ABN56475.1"
FT                   /translation="MKWLGNVLVSPGEGGVYGERTLDGYRVWDPYRSKLAALYTLGGGV
FT                   ELTPEMRVLYLGAANGTTVSHVADYVETVYAVEFAPRPMQDLLEVARRRRNIVPIMADA
FT                   SRPEEYAPFMEAVDLVYQDVAQPNQVEIAERNLVFLKPGGHLVLMLKTRSVDVRRDPAE
FT                   VLAGARTGLEERLDIADVRWLDPYHHDHAAIVCSRRE"
FT   gene            525095..525829
FT                   /locus_tag="Memar_0543"
FT   CDS_pept        525095..525829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0543"
FT                   /product="protein of unknown function DUF1614"
FT                   /note="PFAM: protein of unknown function DUF1614; KEGG:
FT                   mtp:Mthe_0756 protein of unknown function DUF1614"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56476"
FT                   /db_xref="GOA:A3CSX6"
FT                   /db_xref="InterPro:IPR011672"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSX6"
FT                   /protein_id="ABN56476.1"
FT                   /translation="MDRVVFNPFSPLMLLFFFGLLVLFLLAVIVFPILFLTAIGATFTR
FT                   LGFSWWQALFILFLTLIGSFINIPVSTLEGRPGVPAYDRYAVMYGRLYRIPQQAQRTVL
FT                   AINVGGALIPVAISLYLLYESVVISGGYHLFALALAGVAVVTVVTKLVARPVPGLGIAT
FT                   PFFIPPLAALFAALILSLFAGGVPAAAVIIAYVSGTLGTLIGADLLNLHHLAELGAPTA
FT                   SIGGAGTFDGIFLTGIIAALLA"
FT   sig_peptide     525095..525217
FT                   /locus_tag="Memar_0543"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.762 at
FT                   residue 41"
FT   gene            complement(525938..526375)
FT                   /locus_tag="Memar_0544"
FT   CDS_pept        complement(525938..526375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0544"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   mth:MTH304 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56477"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSX7"
FT                   /protein_id="ABN56477.1"
FT                   /translation="MTGKIRDTAIRIKLQEMTESVDMVKEHLPDSADSFRQLGIIKDGI
FT                   YKRAEYAIENVFDICAILNADLHLGVPGTDENILDNLVQHGVLAAATRQNVKAMKGFRN
FT                   VVVHRYGAIDDALAFSILKEHISDFALFRQEVEHVLQSVNE"
FT   gene            complement(526372..526758)
FT                   /locus_tag="Memar_0545"
FT   CDS_pept        complement(526372..526758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0545"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: mth:MTH305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56478"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSX8"
FT                   /protein_id="ABN56478.1"
FT                   /translation="MNHFVRHALERLKTVEGFEKVRFIILYGSVAEGRAREGSDIDLCV
FT                   YYDGDREEAARFRFAALSELADDRYDIQIFSHLPLYVRTEVLRGKVVHCPDERFLYDVA
FT                   YRTIREFDDFKHRLYDYIGKEAMA"
FT   gene            complement(526955..527185)
FT                   /locus_tag="Memar_0546"
FT   CDS_pept        complement(526955..527185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0546"
FT                   /product="YcfA family protein"
FT                   /note="PFAM: YcfA family protein; KEGG: tth:TTC1705
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56479"
FT                   /db_xref="GOA:A3CSX9"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSX9"
FT                   /protein_id="ABN56479.1"
FT                   /translation="MPEHRIRPISWNQLVKNLQALGFEGPCRGGRHPFMVKGDLVLTIP
FT                   NPHRSEIGVDLLVRILRQAGISREEWSRLTG"
FT   gene            complement(527172..527432)
FT                   /locus_tag="Memar_0547"
FT   CDS_pept        complement(527172..527432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0547"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   mac:MA2134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56480"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSY0"
FT                   /protein_id="ABN56480.1"
FT                   /translation="MILEYINAALEHARYEIIEDDEPYYGEIPELSGVFATGRTLEECR
FT                   RNLAGVIDEWLIIRLRRGLPIPPIAGRTVGEIVRVDTGAGA"
FT   gene            complement(527553..528383)
FT                   /locus_tag="Memar_0548"
FT   CDS_pept        complement(527553..528383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0548"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   SMART: AP endonuclease, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56481"
FT                   /db_xref="GOA:A3CSY1"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSY1"
FT                   /protein_id="ABN56481.1"
FT                   /translation="MVEYNLGCTVRIDDEGTLALLAGLYEEGAIRHIQVQAVPLARQFF
FT                   RERLDRIAASGIPVVVHAPHHGHGVNPCAPAAYDDRPLAVIKAYIEEAMSRTLEAADTL
FT                   GAETIVLHAGRYEPGGRSAAEDTFADFLDRNADPRLTLENLPAVYAGYPLLGNTAEDLA
FT                   ALAGNKITRFCLDFPHLACTANYRHLSFAEELERFEGLNVALHHLSNIRCGSITDEHLE
FT                   LDRPDGGLDLAAVFARLRRHAGVPTTLEYKEDSADVYARQVKVFAGLWEDRAGE"
FT   gene            complement(528433..528505)
FT                   /locus_tag="Memar_R0012"
FT                   /note="tRNA-Gln2"
FT   tRNA            complement(528433..528505)
FT                   /locus_tag="Memar_R0012"
FT                   /product="tRNA-Gln"
FT   gene            complement(528558..529283)
FT                   /locus_tag="Memar_0549"
FT   CDS_pept        complement(528558..529283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0549"
FT                   /product="thymidylate synthase"
FT                   /note="PFAM: thymidylate synthase; KEGG: mja:MJ0511
FT                   thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56482"
FT                   /db_xref="GOA:A3CSY2"
FT                   /db_xref="InterPro:IPR014620"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSY2"
FT                   /protein_id="ABN56482.1"
FT                   /translation="MRIIRAPTLARAHELAVRTVLEKGWVLDTENDEATIECEELALEV
FT                   ESPESVPMASPASRFQQRFLDVYADNLLHGSDAKFEYDYHRRLFDWGEQLMVNGEDVHV
FT                   DQIDYIARKLEQAANSRRAVAVTWNPVVDENLDDCPCLQLVQCLLRNGKLQMKVVFRSN
FT                   DILSAAGSNMYALVRLQKMIADRLGVPCGRYTHIALVPHIYYRRDLNDIEPFCKSGTEI
FT                   RPVAEVCRACGKCPRSSGA"
FT   gene            529781..532102
FT                   /locus_tag="Memar_0550"
FT   CDS_pept        529781..532102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0550"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56483"
FT                   /db_xref="GOA:A3CSY3"
FT                   /db_xref="InterPro:IPR024277"
FT                   /db_xref="InterPro:IPR026371"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSY3"
FT                   /protein_id="ABN56483.1"
FT                   /translation="MKSMTKLMVVAMVLAAALVVAPAAARVVSSSGTTVYVGEEQLNFA
FT                   GFGASGQVDQLVHFTNFGDRSIDKTIQADSVGNITELTRAAVGTTTGPYYVFAVGEDPS
FT                   TATPAGYVNVQYPDATLGVVLSSNTQESVDGKSVTRETPVAFKLTNNLNGLAGTGATMR
FT                   IEVTLPGGGVTTQFGNQPLGSIAVNGTTALVNPVDLANAEAGTYTAIAKWPSGSDFYGK
FT                   DFDSNSVTFEVLTKSLAITSNKDSVVRGNSFTVTITGESAKMYNLYVKDVSGLALSEYP
FT                   AIVAGQNGVTVNNVTYRAGVGISDVNATVVTNAGGTRTVQFNTNTSTDDRQFTLRVEDP
FT                   GDFSTYDEVKVRVEQGDVTITASGTGVYYIGEEVTLSGTCTDNATTVHLFMTGPNLNSN
FT                   GVKLDTIEEVENNVTSSFTTADVKADDTWSLKWNTGDIQRSLDAGGYTIYAVSKPLNKA
FT                   RLSDAKYATTSIQLRSGFITATSSGAVVAKGDDLTLTGTAQGDPDSVRVWIFGKNLQLT
FT                   DESATVEDDGSFEYELTNTQDLTAGQYFVVIQHPMMNKVFDIYSGATNWINGTDDSGFA
FT                   PVRIGGLQASDAATAVITALDSPNIDDTYVKLTFVVQEANIWIDAIGDKAAGSTFTITG
FT                   TTNLAVGDTLNIEVTSSAFQPTTKSEASGFGSVAGVTEVKQGDGANTWSFEVDGTSFKP
FT                   DQYIVTVESIETDTTATASFNVVEAVPTTQATPTSTATGEVTPTATATTEATPTTTPGF
FT                   GALLALAGLGAVAFLVLRRD"
FT   sig_peptide     529781..529858
FT                   /locus_tag="Memar_0550"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.907 at
FT                   residue 26"
FT   gene            532337..533860
FT                   /locus_tag="Memar_0551"
FT   CDS_pept        532337..533860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0551"
FT                   /product="AMP phosphorylase"
FT                   /EC_number="2.4.2.-"
FT                   /note="KEGG: mhu:Mhun_2262 thymidine phosphorylase;
FT                   TIGRFAM: putative thymidine phosphorylase; PFAM: glycosyl
FT                   transferase, family 3; Pyrimidine nucleoside phosphorylase,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56484"
FT                   /db_xref="GOA:A3CSY4"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013466"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017713"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSY4"
FT                   /protein_id="ABN56484.1"
FT                   /translation="MKLTVKLLDIENRGVLLHCTDARSMRVRDGDRVQIVDEATGKTAQ
FT                   AHVDTTGSLIEPGVIGVYRPVNATLAVDEGTPVEVRGAERPASLEHIKKKMDGGRFTKD
FT                   DTVDIVRDIVDDVLSPGEITAYVTASYINGLDMDEVEYLTRATVETGERLHFTRHPIVD
FT                   KHSIGGVPGNKITLLIAPIIAASGLLIPKTSSRAITGAGGTADLMEVLAPVSFPALEVQ
FT                   QMTEKVGGAIVWGGATNIAPADDKIITYEYPLRIDARGQMIASVMAKKFAVGADLVVID
FT                   IPVGRNTKIATAQEGRKLAREFIDLGERLGMRVECALSYGESLVGHTIGPNLEVREALA
FT                   VLEGATEPNSLIQKSLSLAGIALEMAGKAGPGQGARAAADILRSGKALEKMRQIIEIQG
FT                   GDPNVKAEDIVPGECRFDVNAPQDGYVIELNNSALVTLARLAGSPYDHGAGLLVHAKKG
FT                   TRVRKGDPIFTIYADREWRLERAIEVGRTLMPVLVEGMVLERIPHERWV"
FT   gene            533901..535295
FT                   /locus_tag="Memar_0552"
FT   CDS_pept        533901..535295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56485"
FT                   /db_xref="GOA:A3CSY5"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSY5"
FT                   /protein_id="ABN56485.1"
FT                   /translation="MKKSRLAIAILISCVLLCCTAQAVTLRISVADDKTDDALADASIY
FT                   IDGDYVGSTNSAGIYSYVHSGKKDLYLKVVRKGYRNWVEYVDYDATRVGVDMIREDATL
FT                   TFELYDAGTLKPIVGGVVRVTGNDYSDSEVSGSSGIVNFPVKANELYNVEIRASGYHDL
FT                   SKTVQMESSGRTVQCLLFSNDILGVQVLDAETSTPLKDVEVYIDNARAGVTDADGRLQL
FT                   HLERAKRYSFRVTAPDYQPYQESRYLEVDDVFLPVRLSKSEYPVSITVFNEATKPVEGA
FT                   EIYLNGTLQGKTSQYGRFMLSNIQAGTYEIVVQASGYEDWRLTRQISGQGEDIVAELDY
FT                   DRASVTIRAQDPDLNPVAGAVVVIDGQVVGVTDGLGHLNTALVTNKAYAVTAACDGYRN
FT                   ISVNADIPLGTAEFTVPLVMEQDFNVWVLVAGVGVVAAVLLGAVMVVRRRRAGRNRSKS
FT                   RGRDSL"
FT   sig_peptide     533901..533972
FT                   /locus_tag="Memar_0552"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 24"
FT   gene            535562..538570
FT                   /locus_tag="Memar_0553"
FT   CDS_pept        535562..538570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0553"
FT                   /product="von Willebrand factor, type A"
FT                   /note="PFAM: von Willebrand factor, type A; Ig domain
FT                   protein, group 1 domain protein; KEGG: mbu:Mbur_1492 von
FT                   Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56486"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSY6"
FT                   /protein_id="ABN56486.1"
FT                   /translation="MNGWTYVCLVVGLLFLAAPASALIPDDITLSTDKPWLVAGNGETA
FT                   TVTILVTNGTSADPVSGVDIDLAVDGEYGSISPARVTTGSDGEATATFRHGTLSGTATI
FT                   TATVSEGVDVPLTGSVDQQIDHAAAHKIANLWYEPKVTAGETTEIVVRMVDEYGNLVDS
FT                   RNVAETVFFMVGSPACFVNGTDEITVPVDAAGNVTATLRVDTTAGGNVVLIQPPSPLVL
FT                   KSFTITGEGGLPAAITQEITPSSGSVPADGKTKVSFTYTLLDEYGNPSGEQGLWVNATL
FT                   KRLSQPDEYESRLLNTNSYGQVMITYGPEDSVGMAIITATAAVNESVSISEDVEFTSTD
FT                   PTNMLLSASPQSMPSRDVKDDSVSRIRAKVMDVRGNPVEGETVTFDIVSMNSSPYVQPQ
FT                   DPVLAAASGVTDIDGYATVEFHPGAFTTDPDVAGWSDTATGKATVRATWGNVSRDIELT
FT                   WKNYPYLSVETEVSPETVAVNDTVDVTIRLKGDGWALQPDPIDVVLCTDRSGSMLKDYP
FT                   DRMVKAMDASRIFNVQIDHGRDRLGLVSFGGQGQTNIIQYSQNVGGWLGRDSGTWDDLS
FT                   YRTANYGNNRYYTEYATLDLGLSDDQSAINTTIAGMIPDSGTPMRYGIYKAITELKDNG
FT                   RSDAVKAVVVLGDGEYNYYGDPLARGTGRTTKFDWSNTQNDYTYFSDLGAAEQRMSTYA
FT                   NNHNVRLYMISFSDDIVNGSHTWNTMETLASETGGTHYHAPSDSDLAQVYTEIAGELKT
FT                   EAGVDTELDVVFENVEVNGNLTTGTSVFDYVNEENVSTTIESWIDNETVHHYEIIPRHT
FT                   RDDTPNWTAANPHLPFNIGTVRLGQTWETTFRLAVKTEGNINIFGPGSTISFNNGTDSL
FT                   ELPDTFITAVPLNNTGMDFAALVIDNLVFTGTMPIDEFLPVAWDLNYTGLYDVTEDVFY
FT                   SNDNEYTWVKFDTLSATNTTTGGTSTLDVRGLLPGEYTIWVRGSAPDTADSSQKITMDV
FT                   HAGATGGSYIRIQ"
FT   sig_peptide     535562..535630
FT                   /locus_tag="Memar_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(538838..538909)
FT                   /locus_tag="Memar_R0013"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(538838..538909)
FT                   /locus_tag="Memar_R0013"
FT                   /product="tRNA-Arg"
FT   gene            538965..539390
FT                   /locus_tag="Memar_0554"
FT   CDS_pept        538965..539390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0554"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: mhu:Mhun_2260 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56487"
FT                   /db_xref="GOA:A3CSY7"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSY7"
FT                   /protein_id="ABN56487.1"
FT                   /translation="MILSSSEIDRRRENGDLVIEPYHPESRQPASYDLRAAEGTVLSRG
FT                   VCTLVPSLERVELPRDLAATLRCRSSFARRGVLLGGGFVDPGFRGQLTLCLTNTGAEEI
FT                   RLAAGDRIVQMILQEVLNGDRLYQGRYQDSVGTVHTR"
FT   gene            539387..540355
FT                   /locus_tag="Memar_0555"
FT   CDS_pept        539387..540355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0555"
FT                   /product="Ribonuclease R winged-helix domain protein"
FT                   /note="PFAM: Ribonuclease R winged-helix domain protein;
FT                   KEGG: mhu:Mhun_2259 protein of unknown function DUF128"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56488"
FT                   /db_xref="InterPro:IPR002846"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036984"
FT                   /db_xref="InterPro:IPR038982"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSY8"
FT                   /protein_id="ABN56488.1"
FT                   /translation="MTPSIRSERKYLEILRILAESHEPLGAKRLSEKMAERGFVLSDRA
FT                   VQYYLQYLDEMGFTEKAGNRGRLLTEAGIAESESALVDQRLGFIISRLEQLAFRSTFDP
FT                   ATATGSVAYNLSFVREEDLPGVTAAFDEVAAAGYGFLNAYRIVDSDPRIPDGHAGIMTA
FT                   CSVTLDGVLQKMGIPTRLEYAGRIAVDENGSAGFLDLIGYRGTSVDPLHLFISAGLTSI
FT                   NRLVTTRAGVALANVRAVPAAARYRVEVTVGLMEKCGFTFPAGGGIGEFNLPKHPYRLS
FT                   VVALSGMNMVGNAIEKGYAIKTEIGAGTVPFEKIADATGSR"
FT   gene            complement(540339..542294)
FT                   /locus_tag="Memar_0556"
FT   CDS_pept        complement(540339..542294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0556"
FT                   /product="Cell division GTPase-like protein"
FT                   /note="KEGG: mhu:Mhun_2258 cell division GTPase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56489"
FT                   /db_xref="GOA:A3CSY9"
FT                   /db_xref="InterPro:IPR032907"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSY9"
FT                   /protein_id="ABN56489.1"
FT                   /translation="MRVLTIGLGGAGSRVVDQLYDHDRRSRVYCMSAVAIDIDPNSLLQ
FT                   LRHLPDPARIFFPRVDISDYAHVTDVIDIEEVMTRLQSLDTMEIDAILFCCGLGGSVID
FT                   IAPLIIDEIRKSYVEPIFALAILPCLEEGKRVSAKAADDLDVLQELVDAVILFDNETWS
FT                   QKIKAATAAAEAENTGVIGQLRQFPIGSDPRTHYSMLNERIARQIGLLLRAGEFNESGL
FT                   DVAEVVLDAGEVLNTLKGNGFVAVGYATERLPTGLLNVLHRRQSLKDFIQGSQEKAARI
FT                   ISLAKKAVYEDVSVPCDLTSADKALVLIAGPSAELSMKGFQTVRKWIDRSIAGLEMRSG
FT                   DYPVKNTSFVGIIIVLSGITNIPRVEELRDIRTEYQLECEEERLRAEEEVRLREEEAAR
FT                   ATGAAPQVPDDEGARGFASPLESAYLEEIEYMAGPTTPEKDEMITLPGSGGSGRKRKDD
FT                   TIDMLPKAEAKQDEGPVVLPPKPGGKEIDLTGSASITSSVPAPKNATFGLKGISIEKTG
FT                   PKDDAVTYSTSLKPVQRPKEGALSADAGTLDRGIQRPKEGAFTGDHVTLGNGMQRPKDG
FT                   LFEEAGLHVREGMPLPKDGSLDQNSRGFARSGPRPKDVGPSRGKLEVIDTAARQKNRNE
FT                   EKEPDDDTDDGITWIQ"
FT   gene            542638..543645
FT                   /locus_tag="Memar_0557"
FT   CDS_pept        542638..543645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0557"
FT                   /product="methylenetetrahydromethanopterin reductase"
FT                   /EC_number="1.5.99.11"
FT                   /note="PFAM: luciferase family protein; KEGG: mhu:Mhun_2257
FT                   coenzyme F420-dependent
FT                   N(5),N(10)-methenyltetrahydromethanopterin"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56490"
FT                   /db_xref="GOA:A3CSZ0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019946"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSZ0"
FT                   /protein_id="ABN56490.1"
FT                   /translation="MRCIALTTYGIEFVPGAINVKQVVNYTKLAESKDIDYAWITNHYN
FT                   NRHAYPTLAMIAANTDSIKMGPGIMNTFTDTPAAIASFMATLNEISDGRAVLGIGPGDL
FT                   STLPKLAIDPVKPVGHLKEGVEQIRKLLAGEEVKKSGNLEFFDYDGAKLTGVTLPGKKG
FT                   IPVYIGAQGPKVLELAGTIGDGALINASNPKDFDVAIPIIKKAMEAVDKKKFDVGAYTA
FT                   MSIDRDEKKARNAAKIVAAFIAAGSPPALLQRHNLNLDNVAKIKEALGRFDFKTVGGLV
FT                   GDAEIDAFTIAGTPDMVKQKCEDLTKAGVTQIIFGSPLGPDMTNSIRLLGKYIV"
FT   gene            543794..544723
FT                   /locus_tag="Memar_0558"
FT   CDS_pept        543794..544723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0558"
FT                   /product="galactose-1-phosphate uridylyltransferase-like
FT                   protein"
FT                   /note="KEGG: mhu:Mhun_2256 galactose-1-phosphate
FT                   uridylyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56491"
FT                   /db_xref="GOA:A3CSZ1"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSZ1"
FT                   /protein_id="ABN56491.1"
FT                   /translation="MFTTREILTERGILQYRRESLTGIRCRISPVRVERQIDTVPAMPS
FT                   SREGCPFCPDAIDSSTPTFEDGSRLRCGESVTFPNLYPFAGRHVVTVITPDHGPGRFDA
FT                   RCLADAISGTATALARTPGYASINWNNLPSAGASIVHPHLQGIADAEPTRLAELYISGG
FT                   RRYLADRGRLYWDDLVERERCSERFLFENEIFWSANPVPLGEREVRGILPISTLEELEP
FT                   YIEPLADGILRVVDFYRSLGTHAFNASIFFDAPGTAGQGHRAFCSIIARLNPNTFSMCD
FT                   SAFMERLHLEPVILTLPEDLGALFRAKS"
FT   gene            544750..546171
FT                   /locus_tag="Memar_0559"
FT   CDS_pept        544750..546171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0559"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mhu:Mhun_0468
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56492"
FT                   /db_xref="GOA:A3CSZ2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSZ2"
FT                   /protein_id="ABN56492.1"
FT                   /translation="MTEPRGFLVGGEWRTSTDILDVRFPYTGEVVGRVCLAGSDDVEDA
FT                   LRCAERGFSLTRRLPAHRRSEILYNLADLIRERSAELTGTIMLEAGKTRALAESEVVRA
FT                   RETIEVSAEEARRIDGTILPLDWNAAGEGRVGCLRRFPLGPVLAITPFNFPLNLACHKL
FT                   GPAIGAGDSVVLKPASATPISSLMLGEMALDAGIPPEAVSVVPCHTDLAERMVRDDRVA
FT                   CVSFTGSPAVGWHLREIAGRKRVGLELGGNAAVVVHEDADIPFAAGRIVAGAFSNAGQT
FT                   CIAVQRVYLHRPIYEEALALLVERARALTTGDPREPGTDVGPMISAPAAETAFAKVEDA
FT                   IAGGAKVLVGGTRDGPLFKPTILVDTTPDMAVNRTEVFAPVVTVAPYETFEEAIAFAND
FT                   TEYGLQAGIFTHDSRRIAQAFEELRVGGLVVNDISTFRMDHAPYGGVRGSGIGREGPKY
FT                   AIEEMTEERMMIFSP"
FT   gene            546453..546875
FT                   /locus_tag="Memar_0560"
FT   CDS_pept        546453..546875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56493"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSZ3"
FT                   /protein_id="ABN56493.1"
FT                   /translation="MSTEGAEEEAGGRAGWGLDISYEVETGEGGDPPSPPDGGRAPFLR
FT                   NVALPVSPSSHLTVLTLTAFAPRTFGARTPAVPAVVPPYGDSPTVHCTGFFLYFSCVVA
FT                   STRNPSGFSRSGSSHLTALTLRFFAPDGAHAPVLRT"
FT   gene            complement(546882..547166)
FT                   /locus_tag="Memar_0561"
FT   CDS_pept        complement(546882..547166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56494"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSZ4"
FT                   /protein_id="ABN56494.1"
FT                   /translation="MVFRDYLDIGASHKVRRVKRLEHEHRYVRVTTVRSAMVRNAMVRN
FT                   AMVRNAMVRNAMVRNAMVRNAMVRKNRSVSAVRCEEPERERRQVRRTGA"
FT   gene            complement(547257..548099)
FT                   /locus_tag="Memar_0562"
FT   CDS_pept        complement(547257..548099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0562"
FT                   /product="methylenetetrahydromethanopterin dehydrogenase"
FT                   /EC_number="1.5.99.9"
FT                   /note="PFAM: methylene-5,6,7,8-tetrahydromethanopterin
FT                   dehydrogenase; KEGG: mhu:Mhun_2255
FT                   methylenetetrahydromethanopterin dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56495"
FT                   /db_xref="GOA:A3CSZ5"
FT                   /db_xref="InterPro:IPR002844"
FT                   /db_xref="InterPro:IPR036080"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSZ5"
FT                   /protein_id="ABN56495.1"
FT                   /translation="MVVKVGIAKLGNIASGVMGELLLDERADREDMITFMATSGTKLQP
FT                   EDIERVVSNMKAWGPDFCIVVSPNGVLPGPTQAREDLAAAGIPCIVITDDVTTKKEQFE
FT                   ALKASNFGYIIMKADAMIGARREFLDPIEMADYNGNLVKVLALTGAFRKMQMELDKVID
FT                   QVKAGKKGADLALPKVVMTSDKAVDGEFSNPYALAKARAAYEIAQSVAGVNVKGCFMTK
FT                   EWEKYIPIVASAHEMMRQAMLLCEEARTLEKGVDAVIRKPHKKTGEIVSKTALISKPE"
FT   gene            548239..548643
FT                   /locus_tag="Memar_0563"
FT   CDS_pept        548239..548643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0563"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="PFAM: sigma-70 region 4 domain protein; KEGG:
FT                   mhu:Mhun_2254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56496"
FT                   /db_xref="GOA:A3CSZ6"
FT                   /db_xref="InterPro:IPR004645"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR018384"
FT                   /db_xref="InterPro:IPR029291"
FT                   /db_xref="InterPro:IPR036657"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSZ6"
FT                   /protein_id="ABN56496.1"
FT                   /translation="MKQGLLTDRQKEVLRYRKKGLTQQQIAEIIHTSKANVCTIEKAAL
FT                   ENISRARETLEFLYTLDAVHLCTLESGLDLLKAPEYIYAEAEKQGLKVKYDTISLINRL
FT                   RDANPERFRGRQVREDVEIYINKDGDLYFG"
FT   gene            549452..550465
FT                   /locus_tag="Memar_0564"
FT   CDS_pept        549452..550465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0564"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: mhu:Mhun_2253
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56497"
FT                   /db_xref="GOA:A3CSZ7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSZ7"
FT                   /protein_id="ABN56497.1"
FT                   /translation="MPKINRPRRGSLAYSPRKRAKSPVPRYGSWPEYTGAPAVQGFAGY
FT                   KVGMTHVIMVDDHKSSPTEGKDVMVPVTVVEVPPMRVAGVRAYGEDTYGKHALTEAWTT
FT                   DLDEELSRRINVPKNHDTAAALEAVKAAVGEGKVSELYALAYTRPMELTGVPKKVPDLM
FT                   EMRIAGGSLEDQIAYAAEILGKEITISGNLEVGEYVDVTAVTTGKGTEGPVKRWGVQVR
FT                   KRKHSRGGKKRHIGNLGPWHPHHVRWQVPQMGQMGYQQRTEFNKRILKIGADGDEITPA
FT                   GGFLHYGLVRGPYVLIKGSVPGPNKRLVRIRSAIRQGEHTVRTPAINFVSVQSQQG"
FT   gene            550472..551221
FT                   /locus_tag="Memar_0565"
FT   CDS_pept        550472..551221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0565"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: mhu:Mhun_2252
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56498"
FT                   /db_xref="GOA:A3CSZ8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013000"
FT                   /db_xref="InterPro:IPR019970"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CSZ8"
FT                   /protein_id="ABN56498.1"
FT                   /translation="MKAQVRTLTGEIAHEIDLPEIFREEYRPDLIKRAVLALQSTRFQP
FT                   HGTNPYAGMRTSAESWGSGRGAAQVPRLKNGSRVARVPQATGGRAAHPPKVEKILVKEI
FT                   NRKEKRKALRSAVAASTYPDLVRERGHLFEGDLPLVFEDRFEEVTRTGDVIAALTALGV
FT                   YADVERAKGSRKVRAGRGTMRGRRYKQRKSVLIVTGGEPLRAARNLAGVDAVAVDQLNA
FT                   ELLAPGTQAGRLTIWTESAIRRLEEFS"
FT   gene            551218..551466
FT                   /locus_tag="Memar_0566"
FT   CDS_pept        551218..551466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0566"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: mhu:Mhun_2251
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56499"
FT                   /db_xref="GOA:A3CSZ9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="InterPro:IPR019985"
FT                   /db_xref="UniProtKB/TrEMBL:A3CSZ9"
FT                   /protein_id="ABN56499.1"
FT                   /translation="MILKHPFVTEKATMMLEGESKLQFIVQRDATKQDIKRELESAFEQ
FT                   EVANVRTMMTMKGEKKAIVTFADAKAAEEILSRLGIM"
FT   gene            551478..552197
FT                   /locus_tag="Memar_0567"
FT   CDS_pept        551478..552197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0567"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: mhu:Mhun_2250
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56500"
FT                   /db_xref="GOA:A3CT00"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR023672"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT00"
FT                   /protein_id="ABN56500.1"
FT                   /translation="MAHRIIAQNRGKGGPTYRAPSHRYKAALRHAGKNDALVSGNVIDI
FT                   EHDPARHAPIALARLDSGEKIYVLATEGLGVGDTVSWGTGGTVKNGNTLPLGEIPVGAY
FT                   VCNIEARPNDGGKFVRSSGVQALVIGKADDGRVGIRMPSGKNKWFNGACMATVGIVAGG
FT                   GRGEKPFVKAGKKHFHVRSSSERWPRVKGVCMNVIDHPFGGGGHQHCGRPKTVARGTSP
FT                   GRKVGHVAARRTGKWKK"
FT   gene            552208..552621
FT                   /locus_tag="Memar_0568"
FT   CDS_pept        552208..552621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0568"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: mhu:Mhun_2249 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56501"
FT                   /db_xref="GOA:A3CT01"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT01"
FT                   /protein_id="ABN56501.1"
FT                   /translation="MAKKTQKRMPRRREEFTYRGYSVADLQQMALSELLPLMPARARRK
FT                   FDRGLSREHEKLLADLRSGDENIRTHLRDMIIMPEMVGRSIEIHNGKEFQKVEIQPEAV
FT                   FHYLGEFALTRRRVAHGSAGIGATRSSKYVPLK"
FT   gene            552627..553088
FT                   /locus_tag="Memar_0569"
FT   CDS_pept        552627..553088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0569"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: mhu:Mhun_2248 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56502"
FT                   /db_xref="GOA:A3CT02"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT02"
FT                   /protein_id="ABN56502.1"
FT                   /translation="MARTGYSATIEGENVARAKANELPVSPKHSIEIARFIKNMTTTEA
FT                   KAYLTDVVALKKAIPFKRFNRNVAHKRGLSKWPAGRYPVKAAEAYIRLLESVEKNAEYI
FT                   GLDVENLRIDHAAANTGRGLRAFFPRAMGRATPKRRETVNIEIVVTEVA"
FT   gene            553088..553792
FT                   /locus_tag="Memar_0570"
FT   CDS_pept        553088..553792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0570"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: mhu:Mhun_2247 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3-C-terminal
FT                   domain protein; KH, type 2 domain protein; KH, type 1,
FT                   domain protein; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56503"
FT                   /db_xref="GOA:A3CT03"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027488"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT03"
FT                   /protein_id="ABN56503.1"
FT                   /translation="MAIEKKFITDGVRNVRVEKFLTKELKRAGYGGMDIARTPLGTQVT
FT                   IFAEKPGIVIGKGGKQVRQLTQDLATDYDIESPQVEVQQVQNPNFNAQIMAERLANALE
FT                   RGWYFRKAGSSTIRRIMESGALGCEVIVAGKLTGSRSRTQKFTEGYIKHCGEPSETIVE
FT                   KGYALAIKKLGTIGVQVKIVPPDARLPDAFDVLEPEPKKAPAEPIEPEEVGDDVFEEEF
FT                   EETSEEEYVEEV"
FT   gene            553793..553996
FT                   /locus_tag="Memar_0571"
FT   CDS_pept        553793..553996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0571"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: mhu:Mhun_2246
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56504"
FT                   /db_xref="GOA:A3CT04"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT04"
FT                   /protein_id="ABN56504.1"
FT                   /translation="MAIFRAREVKQLSDTELLEQEQKLSLELIQERGKVSAGGATENPG
FT                   RIREVRRTIARIRTEQNARRSA"
FT   gene            553993..554265
FT                   /locus_tag="Memar_0572"
FT   CDS_pept        553993..554265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0572"
FT                   /product="ribonuclease P protein subunit Rpp29"
FT                   /EC_number="3.1.26.5"
FT                   /note="PFAM: Ribonuclease P, Rpp29; KEGG: mhu:Mhun_2245
FT                   ribonuclease P subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56505"
FT                   /db_xref="GOA:A3CT05"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR023538"
FT                   /db_xref="InterPro:IPR036980"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT05"
FT                   /protein_id="ABN56505.1"
FT                   /translation="MISPQNVLRHELIGLDVLVVRASNPGHAGVSGRVTDETRNTLVIL
FT                   TGRGEKQIPKRFSVFRFRLPDGTTVDVDGSSLETQPERRIGMRIR"
FT   gene            554279..554605
FT                   /locus_tag="Memar_0573"
FT   CDS_pept        554279..554605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0573"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: mhu:Mhun_2244
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56506"
FT                   /db_xref="GOA:A3CT06"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019978"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR028333"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT06"
FT                   /protein_id="ABN56506.1"
FT                   /translation="MARNIGLDVPIPETECEDVNCPFHGTLPVRGQVITGKVVSDRMNG
FT                   TVVVEREFLHYVKKYKRYEKRRSRYHAHSTPCINAGVGDVVRIAECRPLSKTTNFVVVE
FT                   VMTE"
FT   gene            554602..555000
FT                   /locus_tag="Memar_0574"
FT   CDS_pept        554602..555000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0574"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="PFAM: ribosomal protein L14b/L23e; KEGG:
FT                   mhu:Mhun_2243 ribosomal protein L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56507"
FT                   /db_xref="GOA:A3CT07"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019971"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT07"
FT                   /protein_id="ABN56507.1"
FT                   /translation="MKAMQAKIPRALATGSRMVCSDNTGARLVEVVSVDRYHGVRRRQP
FT                   CLGLGDVATVSVKKGTPDMRRKLEKAVVIRQKKEIRRPNGIRLSFEDNAMVLINERGEP
FT                   KGTEIKGAVPREIAERFPKIASMATTIV"
FT   gene            555013..555378
FT                   /locus_tag="Memar_0575"
FT   CDS_pept        555013..555378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0575"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="KEGG: mhu:Mhun_2242 ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56508"
FT                   /db_xref="GOA:A3CT08"
FT                   /db_xref="InterPro:IPR005756"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT08"
FT                   /protein_id="ABN56508.1"
FT                   /translation="MVRIVSKQPRKQRKARYNAPNHTRGRFLSAALSPELRGKYNSRRT
FT                   RVVKGDTVKVLRGDFAGDEGVVDAVDMKACRLVVHGVMVTKADGTEVPRPVDPSNVQIT
FT                   KLNLKDKLREERLGGGA"
FT   gene            555378..556106
FT                   /locus_tag="Memar_0576"
FT   CDS_pept        555378..556106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0576"
FT                   /product="SSU ribosomal protein S4E"
FT                   /note="PFAM: KOW domain protein; Ribosomal protein
FT                   S4E-like; Ribosomal protein S4E, central; SMART: KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein; KEGG:
FT                   mhu:Mhun_2241 ribosomal protein S4E"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56509"
FT                   /db_xref="GOA:A3CT09"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT09"
FT                   /protein_id="ABN56509.1"
FT                   /translation="MSKYLKRLVAPGSWHIPKKVQKFVMKTAPGPHNAGALPVGVWLRE
FT                   HIGLAQNASEVKKILHQRDVLVNGRACKDSRMGLGVFDIVSIPKLGKHYRIQLDVKGNL
FT                   VAIEIPAESAKTRLCKIRNKTTVKGGKVQLNFAFGANVLADNTYKAKDSVVVTLGTDGE
FT                   DRFRIVDHFPYAEGNVAMIVGGKHSGKVGRIVEIIRTASSVPNHVILTDDSAGERFETI
FT                   EEYVFMVGRSAIAPELEASA"
FT   gene            556103..556606
FT                   /locus_tag="Memar_0577"
FT   CDS_pept        556103..556606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0577"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: mac:MA1085
FT                   ribosomal protein L5p"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56510"
FT                   /db_xref="GOA:A3CT10"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR022804"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT10"
FT                   /protein_id="ABN56510.1"
FT                   /translation="MTAMKDIYIDKVVVHMGVGESGERLVKAEDLVKQITGQKPVRTIA
FT                   KRTQPAFGIRKGAPIGCKVTLRRENAEKFITTALDIIERRLAPSQFDRTGNVSFGIEEH
FT                   TDFPGMSYDPTIGIYGMDVNVVLEYKGARIARRSVERRKLPADQKVNKEEAIAFMCENY
FT                   RVEV"
FT   gene            556610..556789
FT                   /locus_tag="Memar_0578"
FT   CDS_pept        556610..556789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0578"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: mhu:Mhun_2239
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56511"
FT                   /db_xref="GOA:A3CT11"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023676"
FT                   /db_xref="InterPro:IPR039744"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT11"
FT                   /protein_id="ABN56511.1"
FT                   /translation="MAEESGAPATGANVRKFGRGANECRICGRKQGLVRKYGIYFCRQC
FT                   FREWASKMGFKKMN"
FT   gene            556801..557193
FT                   /locus_tag="Memar_0579"
FT   CDS_pept        556801..557193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0579"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: mhu:Mhun_2238
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56512"
FT                   /db_xref="GOA:A3CT12"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT12"
FT                   /protein_id="ABN56512.1"
FT                   /translation="MARLNPIADAMSTIKNAGDAGKGEVIVEPASKLLGAMLRVMQENG
FT                   FISGFEFIDDGRGGQFRVQLSGTINKCGAISPRFPVAMADMEYWESQYLPAKNFGILIV
FT                   STSKGVISHAEARNEGIGGQLLGYVY"
FT   gene            557209..557733
FT                   /locus_tag="Memar_0580"
FT   CDS_pept        557209..557733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0580"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: mhu:Mhun_2237
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56513"
FT                   /db_xref="GOA:A3CT13"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019907"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT13"
FT                   /protein_id="ABN56513.1"
FT                   /translation="MAITRQVEIPPGVDVTLDGGVLTVSGPKGTLVRDMRFPQIDLMVE
FT                   GGEVVVSTASEKKRILAMTGTLEAHAKNMIRGVADGYEYRMKVVYSHFPIQLKQQGNRL
FT                   EITNFLGEKQPRIAKIIEGVTVKIGNDEVTITGIDKEKVGNTAANIEHATRITKRDPRV
FT                   FQDGIYITERV"
FT   gene            557739..558173
FT                   /locus_tag="Memar_0581"
FT   CDS_pept        557739..558173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0581"
FT                   /product="LSU ribosomal protein L32E"
FT                   /note="PFAM: Ribosomal protein L32e; KEGG: mhu:Mhun_2236
FT                   ribosomal protein L32e"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56514"
FT                   /db_xref="GOA:A3CT14"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="InterPro:IPR018263"
FT                   /db_xref="InterPro:IPR036351"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT14"
FT                   /protein_id="ABN56514.1"
FT                   /translation="MDETRRLIRVRTRHNKPAFKRRGLHRKAKLADVWRRPRGLHNKQR
FT                   RQFSAKGALPRPGYGSPAAVRGMHPSGYAEVRVFTPADLVELNPETQAVRIAGSVGNRK
FT                   RGAIQERALELGLKVLNAKDLTPVAEAPAATEEEEVNEDE"
FT   gene            558166..558618
FT                   /locus_tag="Memar_0582"
FT   CDS_pept        558166..558618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0582"
FT                   /product="LSU ribosomal protein L19E"
FT                   /note="PFAM: Ribosomal protein L19e; KEGG: mhu:Mhun_2235
FT                   ribosomal protein L19e"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56515"
FT                   /db_xref="GOA:A3CT15"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR015973"
FT                   /db_xref="InterPro:IPR015974"
FT                   /db_xref="InterPro:IPR023638"
FT                   /db_xref="InterPro:IPR035970"
FT                   /db_xref="InterPro:IPR039547"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT15"
FT                   /protein_id="ABN56515.1"
FT                   /translation="MSDLASQKRIAAAILKCGVNRVWFDPERQADIEGAISRNDLRELI
FT                   GEGAISAHPVKGNSRGRARIRMAKRSYGHRKGPGRRKGAAGARGSSKRSWIRKIRAQRR
FT                   TLREMREEGTIERSLYRLMYRRASGGQFRSVAHLEAQIEITAGRMK"
FT   gene            558618..559145
FT                   /locus_tag="Memar_0583"
FT   CDS_pept        558618..559145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0583"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="PFAM: ribosomal protein L18P/L5E; KEGG:
FT                   mhu:Mhun_2234 ribosomal protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56516"
FT                   /db_xref="GOA:A3CT16"
FT                   /db_xref="InterPro:IPR005485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT16"
FT                   /protein_id="ABN56516.1"
FT                   /translation="MATGPRYFVPFRRRHEGKTDYYKRMSLLSSGTPRMVVRKTNRQII
FT                   VQLVVPEVEGDSTLVAAYSAELAGYGYEGSTASTPAAYLTGMLFAVKALNAGYGEAILD
FT                   IGLARAKPGARVFAALKGAVDAGLDVPYGESILPDEERLKGAHIAEYAPERAGDLVTNV
FT                   EAVALAIKKELV"
FT   gene            559147..559764
FT                   /locus_tag="Memar_0584"
FT   CDS_pept        559147..559764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0584"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like; KEGG:
FT                   mhu:Mhun_2233 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56517"
FT                   /db_xref="GOA:A3CT17"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT17"
FT                   /protein_id="ABN56517.1"
FT                   /translation="MAYVQEEWIPLTGLGRMVAAGEITSIDEVLASGRPIKEPQIVDLL
FT                   LPDLEDEVLDINMVQRMTDSGRRVKFRTVVVVGNRNGYVGFGQGKDVQVGNAIQKAIVN
FT                   AKLNLIKVSRGCGSWECGCETAHSIPIEVTGKAGSVKVTLKPAPQGIGLVTGDIPKKVL
FT                   MLAGIKDVWAFNRGQTRTTINYAKATFEALKQTNMVRIGGTE"
FT   gene            559764..560225
FT                   /locus_tag="Memar_0585"
FT   CDS_pept        559764..560225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0585"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="TIGRFAM: ribosomal protein L30P; PFAM: ribosomal
FT                   protein L30; KEGG: mhu:Mhun_2232 ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56518"
FT                   /db_xref="GOA:A3CT18"
FT                   /db_xref="InterPro:IPR005997"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT18"
FT                   /protein_id="ABN56518.1"
FT                   /translation="MYAVVQVRGVVKTNHEIKDTLKMLRLHHVNHCVLVPDTPAYLGMI
FT                   RKVKDFVAYGEVDKDTLATLLRTRGRLTGDEKLTDEYVRAHTPYADIDEFAAALCDGEM
FT                   SFRDLVEIKPVLRLHPPRKGYKTIKRTFQQGGALGYYGPQINDLLYKMR"
FT   gene            560231..560656
FT                   /locus_tag="Memar_0586"
FT   CDS_pept        560231..560656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0586"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15; KEGG: mhu:Mhun_2231
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56519"
FT                   /db_xref="GOA:A3CT19"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR027386"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT19"
FT                   /protein_id="ABN56519.1"
FT                   /translation="MPVNKRSKYRGSRTCGGGTHKNRRGAGNRGGRGRAGQRDHRFSHF
FT                   YLKGEIANGKHGFVSKTSEPVSALDVGEIDQMAEALLREGLATQEGDLIALDAAELGID
FT                   KVLGGGRVTHKMSISAREFSERARMKIEEMGGQATTV"
FT   gene            560677..562110
FT                   /locus_tag="Memar_0587"
FT   CDS_pept        560677..562110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0587"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: mhu:Mhun_2230 SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56520"
FT                   /db_xref="GOA:A3CT20"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT20"
FT                   /protein_id="ABN56520.1"
FT                   /translation="MGDLLDRFEPILAAMPAVRGPEGHVHFKNKLMWTLAILLLYFSLT
FT                   NIDIFGLSPQSQDLFGMYRALLAGASGSLLHLGIGPIVTASIVLQLLKGAGLLQIDTSE
FT                   ARGQVMYMGLQKLLIFVMIIVEAFPMVASGMMLPDPSVATQFFGGNMLTVSLLIFLQVC
FT                   LGGLLVVLMDEVVTKWGVGSGVGLFIVAGVSQGLVNGFLNWQTGTDPFPIGFFPRLFAI
FT                   GTSGASFLEYFGTDLLALVTTIAIFMVIVYVESTRIEIPLAHTAVRGARARFPVKLIYA
FT                   SVLPMILVRVLQANIQMIGMFLSNAGINIFGEFQGQMPTSGLMWYIAPINAPQDWMWWL
FT                   SDLGHAPWEIMLRMGIDVTVMVVGGAIFALFWVKTAGLDSKDVARQIQRSGMQIPGYRR
FT                   SEQVLVKYLDRYIPRITVIGGVFIGLLSVVANLFGVIGAVGGTGLLLAVSITYRLYEEV
FT                   ASQQIMEMYPFMRSFFGKE"
FT   gene            562354..562932
FT                   /locus_tag="Memar_0588"
FT   CDS_pept        562354..562932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0588"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="KEGG: mhu:Mhun_2229 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56521"
FT                   /db_xref="GOA:A3CT21"
FT                   /db_xref="InterPro:IPR023477"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT21"
FT                   /protein_id="ABN56521.1"
FT                   /translation="MLGKKVVVTGVPGVGKTTVINGAMERLATEGVAYKAVNFGTFMFE
FT                   VAKKENLASDRDEMRKLEKDVQKRLQQAAATGIAAMSGEANIIIDTHSTVKTPTGFLAG
FT                   LPEWVLRELMPDIVVLVETDPDQILMRRLGDASRARDMEGYRAIAEHQEFNRAVSAAYA
FT                   MYTGCTIKIVRNENFLLEQGIDDLVSVLR"
FT   gene            562939..563559
FT                   /locus_tag="Memar_0589"
FT   CDS_pept        562939..563559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0589"
FT                   /product="protein of unknown function DUF106,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF106,
FT                   transmembrane; KEGG: mhu:Mhun_2228 protein of unknown
FT                   function DUF106, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56522"
FT                   /db_xref="GOA:A3CT22"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR038978"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT22"
FT                   /protein_id="ABN56522.1"
FT                   /translation="MVDLKKHGPTIALLFTMLVMLSYSVEWIRVTVGSAMDVVLGPFID
FT                   TLGVPFFVMILILSSITGLYSSLVQKYTIDYEKMQETQAKMKVFQKEFREAQLSGDEKR
FT                   IKKLQGRQERMMQDQLDISRQQFTPMAIILVLSVPIFFWLLLRLPEIGASPAIETGIVL
FT                   PFLGAVSLSGFAFWIVPAWILWYMICSLTISQVIRKALNIGGL"
FT   gene            563559..564104
FT                   /locus_tag="Memar_0590"
FT   CDS_pept        563559..564104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0590"
FT                   /product="cytidylate kinase, putative"
FT                   /note="TIGRFAM: cytidylate kinase, putative; KEGG:
FT                   mhu:Mhun_2227 cytidylate kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56523"
FT                   /db_xref="GOA:A3CT23"
FT                   /db_xref="InterPro:IPR011892"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3CT23"
FT                   /protein_id="ABN56523.1"
FT                   /translation="MRITISGPPGSGTTSLARYLAGKHGLDLISAGEVFRQLAKEHGMD
FT                   LADFGKFAENDPSVDRMIDARQKEIGEAAENIIIEGRLSGRMVGNADLRIWLSASLSCR
FT                   ARRIAGRDGMDEEGARAYTENRQRSEATRYRNYYGIEIDDLSPYDIVLSSETFGVDALG
FT                   TIVDAAIACLARQQAADL"
FT   gene            complement(564101..564745)
FT                   /locus_tag="Memar_0591"
FT   CDS_pept        complement(564101..564745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0591"
FT                   /product="V-type ATPase, D subunit"
FT                   /note="TIGRFAM: V-type ATPase, D subunit; PFAM:
FT                   H+-transporting two-sector ATPase, D subunit; KEGG:
FT                   mhu:Mhun_1185 V-type ATPase, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56524"
FT                   /db_xref="GOA:A3CT24"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT24"
FT                   /protein_id="ABN56524.1"
FT                   /translation="MPVDDIKPTRAGLLIVRRRMALAERVHRLLSMKLDGMMLDLVGLT
FT                   EQAARERQELEEKYAGAREMVAVAAMMEGATGVLLAALSVEAYPSYTTGHRNVFGVRLP
FT                   DLEPVMVRKTLDQRGYGILGTSSVIDDAADAYEELLEAIIATAELEGGIKHLLDDIEKT
FT                   RRRVNALEFKIIPELEEARRFIENQRDEMERQEWTRLRRIKKIKAKRTGGL"
FT   gene            complement(564756..565883)
FT                   /locus_tag="Memar_0592"
FT   CDS_pept        complement(564756..565883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0592"
FT                   /product="H+-transporting two-sector ATPase, C (AC39)
FT                   subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, C (AC39)
FT                   subunit; KEGG: mhu:Mhun_2767 H+-transporting two-sector
FT                   ATPase, C (AC39) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56525"
FT                   /db_xref="GOA:A3CT25"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR014272"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT25"
FT                   /protein_id="ABN56525.1"
FT                   /translation="MPAPGVTSPSCIYACTRFRVRRTTLLPREEYLRLMQMSIPGVIGY
FT                   LSRREDYKHHILDLAHDFSGAQLIEEAVNHNLAESFRHAMATAPGDLHTLTGEYLNRWD
FT                   IANVMAILRGTVHDIPRRQIRDLLVPAGELDGTLLDRLLNVTNCGEAIEELQGWRLYPV
FT                   LAEYYRVCGEKGVFARIEDELYRQYYADLLGLAATGCSGCQELNGYLRFEIDITNMRNL
FT                   LRLHCAEEACDLATIDRTMISGGRIPIALFRRLYGIETEGEFVNAFLSTDIVPVLAQAV
FT                   RELRQDPEFSSTDAAELVWQRWHRRRRPVHEVEMAVTRVRLHHLEALSRRHPFSVLPVL
FT                   AYLERKKYEVANLRAIARGKAFDLAPERIWQYIVL"
FT   gene            complement(566034..566495)
FT                   /locus_tag="Memar_0593"
FT   CDS_pept        complement(566034..566495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0593"
FT                   /product="transcription activator, effector binding
FT                   protein"
FT                   /note="PFAM: transcription activator, effector binding;
FT                   KEGG: swo:Swol_1364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56526"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT26"
FT                   /protein_id="ABN56526.1"
FT                   /translation="MPRVSNIELLRKREQPTISIRTRAKVEDLPMLIGEGYGRMADYLK
FT                   ELGELLSDVPYVAYHNMDMQDLDVEMGFPVSKILPEKGKIQSGSIPESNVVFCMHRGAY
FT                   GEMASTYEEMADWIEKNGLTPAGTVYEYYYNGPEYPESELLTMIVMPLL"
FT   gene            566663..567655
FT                   /locus_tag="Memar_0594"
FT   CDS_pept        566663..567655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0594"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   rxy:Rxyl_0478 histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56527"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT27"
FT                   /protein_id="ABN56527.1"
FT                   /translation="MPYSVVTGDLFSAHDAPGHPESQARLDAALAGVPADARRIAPERA
FT                   TVDDLALVHTERHIEGVRSFCRECPPGRARYLDPDTYVTAGSFDAALYATGAAWQAVER
FT                   ALDGEHSFALVRPPGHHAAPDRAMGFCLFNNVAVATAKALLSIGRVAVVDWDLHHGNGT
FT                   EEAFYTSDRVFYCSVHQAGIFPGTGWPEERGAGPGAGYTVNVPLVSGSTGADYALVFSR
FT                   VFVPMLRWFEPDVVVVSAGQDALFDDPLGSLLLLPEDFGALAGMLVDATPAPLALVLEG
FT                   GYGRSHAGAIGAIVAALDGARFNPAGGGAKASTRHLVEAYAGRRHAVPL"
FT   gene            567691..568281
FT                   /locus_tag="Memar_0595"
FT   CDS_pept        567691..568281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0595"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2759 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56528"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT28"
FT                   /protein_id="ABN56528.1"
FT                   /translation="MTMNCIADHILIVTGALLLIALAAAPAVSAVLVYPGSELALTGTS
FT                   TGSDTVYLFVTGPNLPPAGGRLDNPHTAVRSGDPGSFTRVTVGSDDRWTYRWRTGEAGL
FT                   DPGTYTVYAVEAPVDRRNLAGHGYMTIPVTLGSPPGTTVTGTAVPATPPVETATPTATV
FT                   PVTAPAPEPTTAAPPLAALMTAGAAVAAAILRR"
FT   sig_peptide     567691..567780
FT                   /locus_tag="Memar_0595"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.668 at
FT                   residue 30"
FT   gene            568438..569004
FT                   /locus_tag="Memar_0596"
FT   CDS_pept        568438..569004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM2386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56529"
FT                   /db_xref="GOA:A3CT29"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT29"
FT                   /protein_id="ABN56529.1"
FT                   /translation="MKSRDIAIVGILLAIGAIIRYMSLLIPGPIVSNLVIAFYCLAIIL
FT                   IAPTFREALGIGVVAGVVCALLSHSIFPPANLISEPIGAVACLGVYLVLRDRFVLAPAV
FT                   TTLLATFASGFSFILISILAVAPTVLDKFGTLEAFLAVTVPIVLITAGVNAAVAQALEM
FT                   PASRALMRGAREKAPGRDSRPVDES"
FT   gene            568994..570523
FT                   /locus_tag="Memar_0597"
FT   CDS_pept        568994..570523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0597"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mac:MA1418 putative cobalt transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56530"
FT                   /db_xref="GOA:A3CT30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT30"
FT                   /protein_id="ABN56530.1"
FT                   /translation="MSPETGGEIALSLRGVSYTYPGSETPALDRISLEIGRGEIVFVTG
FT                   PTGAGKTTLCLAASGILHHEYGGTLDGAIAILGKSVRDYQNMGEIGRHVGVVFDDADAQ
FT                   LIFTTVEEEVASGLENLGLSREEMQRRLREVMEATGIADLADRAPHTLSGGQKQRVAIA
FT                   ATIALGTKILILDEPTAELDTEATGAVSALLRRLSGEGTAVLIVEQKLGDLAAIADRMV
FT                   VVEGGAIVREVLPEQMAEDACLQHPAGDGARPPAPAAAPPGAPPVISVRGLVHRYDGVV
FT                   AVRDLDLEVASGEIVAVVGENGSGKTTLVKHFNGLLRPTEGSVTVDGLDAATVPIAELA
FT                   RHVGLVFQNPDTMLFAETVAEEVAFGLRNIDPGASEEPVDAALREVGLIHRKTAYPRSL
FT                   SRGERQRLAIACVIAMKPNVIVLDEPTTGLDTRESGRVMEILGRLRQDGHTIIMVTHDM
FT                   RLGEEYADRTVRMEQGRIIHDSGIYEEEPCPKSCSTSPGRAPFTASTRSPN"
FT   gene            570454..571239
FT                   /locus_tag="Memar_0598"
FT   CDS_pept        570454..571239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0598"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: mac:MA1419
FT                   cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56531"
FT                   /db_xref="GOA:A3CT31"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT31"
FT                   /protein_id="ABN56531.1"
FT                   /translation="MSEIMQYVTRESAFHRLHPLTKLIFAVVVVALAVLTSDTVMLTAL
FT                   AGAVVAIAIVSGLARDLLRQVPLLISLAASLLALTVLTIRSGEIVCYLVPQSIPVIGGA
FT                   LPVTAGAIDLALAMSLRFAAMLFAFQLLVISTQPRDLVHVMDRLRMPVDYTLMFLIALR
FT                   FIPSLQLEGKRIHEAQLARAYNPGNGLAGKIRGLFPIIIPLVSNSLGKATILGLTIDLR
FT                   GYRSGRRTPMRDLSLGRADVAGICCMGVVVAGYLAVLLV"
FT   gene            571246..571644
FT                   /locus_tag="Memar_0599"
FT   CDS_pept        571246..571644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56532"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT32"
FT                   /protein_id="ABN56532.1"
FT                   /translation="MCGGSPPAAFEFYIGGSAGPSLYVRLADGRLLYEWASAGGYSGVV
FT                   TEASPAPEEWGRFREAVDRLGVREWEQEYVSAHSCCDVTYWHLRMEMDGWNTVVRGANA
FT                   YPGSDGPEISKQFWEFLAAVKHLIGREP"
FT   gene            complement(571649..572383)
FT                   /locus_tag="Memar_0600"
FT   CDS_pept        complement(571649..572383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0600"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: mja:MJ1614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56533"
FT                   /db_xref="GOA:A3CT33"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT33"
FT                   /protein_id="ABN56533.1"
FT                   /translation="MNEIGCSTCCLMDRTLEEALGLISSRTNLAEILSDGPHNLFRFEE
FT                   VCRSFDLRYTVHAPVADINIASENERLRRAAVRVLLDLAAVCDRIGAERLVVHPGHVWG
FT                   EEMRVVAQAALDRSLDDLAAVQQEVNVRFAVENMGAWEICFFRSPEFLDRLANRNLGFA
FT                   LDVGHAHTNGNLASFLEQGTAIHVHLHDNRGSRDDHLACGDGNIDLCRVMAALPPGVTK
FT                   VVEPNTFQDYERSLEHLKGLSP"
FT   gene            complement(572392..573456)
FT                   /locus_tag="Memar_0601"
FT   CDS_pept        complement(572392..573456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0601"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   mhu:Mhun_0260 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56534"
FT                   /db_xref="GOA:A3CT34"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT34"
FT                   /protein_id="ABN56534.1"
FT                   /translation="MQTTRLIHSLASLVVLLLLAGTAGATPVPLEEPLATADGGERSVA
FT                   VTDDSGKTVLIRGAPQRIVSLAPSNTEILYALGLDDRIVAVTERCDYPPATADKPKVGG
FT                   FSTVNIEKVIAMEPDLIFAAPANTDEVIDRLRSLGMTVVTLDPQTIDGVLHDIELAGRA
FT                   TGQEEEASRLIEELRARMGVVAGEVAESRTEQPSVAHVIWHDPLWVCGQGTFQNEVITI
FT                   AGGTNAFGPVDGWSIVSLEAFITTNPDYILVSSGSGMDRDGYDAIYNYIINEPRLQRLD
FT                   AVRNDRVYVIDADVVSRGSPRIVDALEEVAGHLHPETTGTGTPKPTGTVQSPGFGAITL
FT                   ICALSAAVLLLQKR"
FT   sig_peptide     complement(573379..573456)
FT                   /locus_tag="Memar_0601"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            complement(573607..574863)
FT                   /locus_tag="Memar_0602"
FT   CDS_pept        complement(573607..574863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0602"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mhu:Mhun_0258 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56535"
FT                   /db_xref="GOA:A3CT35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT35"
FT                   /protein_id="ABN56535.1"
FT                   /translation="MKPIEIIDIDVSYGAKKILEAITFHADAGEILGIVGPNGSGKTTL
FT                   LKAMSRVVARDNGEILLDDRDLDSLGHRELARRVAVVPQDISIGFDYTVRDVVMMGRHP
FT                   YIGRFASETARDVKICDHAMHLANVAALAGASVHDISGGERQRVLIARALAQEPTILLL
FT                   DEATSNLDVSHQVEILNIIRDLAGEITVVSVFHDLNLAAYYCDRLLLLKDRKVYAAGAP
FT                   GAVLTRENIREIFGMEMLVKPHPLTGKPYVLPVYMHQSSAGANRRVHVVCGGGTGSDIL
FT                   HLLHAAGFTVTCGVLNVLDTDYGTAMHLGLPCVVEPPFHGITPESLSGLRKCLDSADAV
FT                   IVTAMPIGRGNLDNLRVLLDYPAKSVVFYARDHTTRMEDCTGGEAGAVLANLEARGALR
FT                   VEGAEELLARLSRDGSDRD"
FT   gene            complement(574860..575810)
FT                   /locus_tag="Memar_0603"
FT   CDS_pept        complement(574860..575810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0603"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   mhu:Mhun_0259 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56536"
FT                   /db_xref="GOA:A3CT36"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT36"
FT                   /protein_id="ABN56536.1"
FT                   /translation="MRRTAPIIIATLICALLISMASAVALGPSGLALGSLLTSDNAWMI
FT                   LWEIRLPRVIAAALVGCGLAVAGTAMQALFRNPMADPYIIGTSSGGALGATLAIVLFAG
FT                   TGRTVLAFAGAMIATFTVYFIARRGGKIPVETLLLSGVALATLLSALLSFLMYTAGRSL
FT                   HQIMFWLMGGFWNISWNDVIVALLILIGAAGIYLFARDLNILALNEEDATHLGVNVERA
FT                   KQILLALSAFVTGIAVAVAGSIGFIGLITPHVMRLIVGPDHRFLFPAAALAGAILLVWA
FT                   DALTRTFTSDMPVGILTACFGAPFFIYLLRSRMKA"
FT   sig_peptide     complement(575733..575810)
FT                   /locus_tag="Memar_0603"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.728 at
FT                   residue 26"
FT   gene            575959..576924
FT                   /locus_tag="Memar_0604"
FT   CDS_pept        575959..576924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0604"
FT                   /product="elongation factor Tu, domain 2 protein"
FT                   /note="PFAM: elongation factor Tu, domain 2 protein; KEGG:
FT                   mhu:Mhun_2296 elongation factor Tu, domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56537"
FT                   /db_xref="GOA:A3CT37"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT37"
FT                   /protein_id="ABN56537.1"
FT                   /translation="MGNLNVAVLGPVGYAKDLGKKGTESDITFYNLKKGEDTVTVIEPT
FT                   RYPERLAPLFYAASMADAALVVVSEITPMLGEWVLMLNEAGVERGYIVLRNYLTPEDVA
FT                   PLLRGTVLEHYAFVDTDPIALRDLLLGEAHTRSSVPSAAGVVGTIPIDHHFNVRGIGTV
FT                   ILGGVVRGGIRKHDTLKVYPGEQAITVRSIQKHDDDFDWAAEGDRVGLALKNIESDDLD
FT                   RGFVLSNDPAIRLGAKVEARATLVRYWPAPLTAGTVLHLGHWMQFIPARVEAVRDDGDW
FT                   RQPTLTLVLERDLVYLPGDAAVLHYLEGGKLRIAGHIELA"
FT   gene            complement(577137..578174)
FT                   /locus_tag="Memar_0605"
FT   CDS_pept        complement(577137..578174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0605"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit H"
FT                   /EC_number="2.1.1.86"
FT                   /note="TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, MtrH subunit; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase, MtrH subunit;
FT                   KEGG: mhu:Mhun_2175 N5-methyltetrahydromethanopterin"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56538"
FT                   /db_xref="GOA:A3CT38"
FT                   /db_xref="InterPro:IPR023467"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT38"
FT                   /protein_id="ABN56538.1"
FT                   /translation="MFKFEKEQTVHDFNGTKIGGQPGEYPTVLGASIFYNKHEVVLDDH
FT                   TGKIDKEKAEALWNRCQELSDITGIPHFIQIIGEFGEAFESYIDWFCSIDDKTAFLMDS
FT                   SVPAALAHACEYVTQAGIADRAIYNSINGSILPENIEALAKSDVNAAIVLAFNPGDPSV
FT                   AGREKVLTEGGVAGQEMGMLEIAEKCGITRPILDTAATPLGLGSGGSYREILACKAIHG
FT                   LPTGGAYHNMTVSWTWLKRWKGTKKTPSQQLAGLEGKEGLVEQLLHHYLGGTDGLRQAA
FT                   WSAPDIGCNMIASTLGADLIMYGPIENVEAMITAQAYTDIVVLEAARDFGIEPQVDTHP
FT                   LFRLI"
FT   gene            complement(578190..578927)
FT                   /locus_tag="Memar_0606"
FT   CDS_pept        complement(578190..578927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0606"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit A"
FT                   /EC_number="2.1.1.86"
FT                   /note="TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, subunit A; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase, subunit G;
FT                   Tetrahydromethanopterin S-methyltransferase subunit A, N
FT                   terminal domain protein; KEGG: mhu:Mhun_2174
FT                   tetrahydromethanopterin S-methyltransferase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56539"
FT                   /db_xref="GOA:A3CT39"
FT                   /db_xref="InterPro:IPR005778"
FT                   /db_xref="InterPro:IPR005866"
FT                   /db_xref="InterPro:IPR030688"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT39"
FT                   /protein_id="ABN56539.1"
FT                   /translation="MVEKKSPASGWPIVQGDFHTGDAQSCVGVVTMGSHLDEQGICDAG
FT                   AAIAGSCKTENLGLEKIIANVISNPNIRFILCCGTEVKGHLSGQSFIALHEGGVSGGKI
FT                   VGAQGAIPFIENLSDDAISRFQEQIEIVNIMESEDMGAIKAKIDELKARDPGAFGAEPM
FT                   IVEVKEAGGAAEVAVAGANPQFLEIEERLNAIEERIEFVDAEIAQRVGRKIGRDIGILY
FT                   GLVAGLIVFMMLLVLLPKLIGYL"
FT   gene            complement(578929..579138)
FT                   /locus_tag="Memar_0607"
FT   CDS_pept        complement(578929..579138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0607"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit F"
FT                   /EC_number="2.1.1.86"
FT                   /note="TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, F subunit; KEGG: mhu:Mhun_2173
FT                   tetrahydromethanopterin S-methyltransferase, subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56540"
FT                   /db_xref="GOA:A3CT40"
FT                   /db_xref="InterPro:IPR013347"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT40"
FT                   /protein_id="ABN56540.1"
FT                   /translation="MAEEVTQAGPIRMTSINRMMDSIRYKAQILARTTKLESGIMGMGI
FT                   LGFAIGLIVAVLLIVIPALLLGAI"
FT   gene            complement(579144..579866)
FT                   /locus_tag="Memar_0608"
FT   CDS_pept        complement(579144..579866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0608"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit A"
FT                   /EC_number="2.1.1.86"
FT                   /note="TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, subunit A; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase subunit A, N
FT                   terminal domain protein; KEGG: mhu:Mhun_2172
FT                   tetrahydromethanopterin S-methyltransferase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56541"
FT                   /db_xref="GOA:A3CT41"
FT                   /db_xref="InterPro:IPR005778"
FT                   /db_xref="InterPro:IPR030688"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT41"
FT                   /protein_id="ABN56541.1"
FT                   /translation="MVEKKSPASGWPIVQGDFHTGDAQSCVGVVTMGSHLDEQGICDAG
FT                   AAIAGSCKTENLGLEKIIANVISNPNIRFILCCGTEVKGHLSGQSFIALHEGGVSGGKI
FT                   VGAQGAIPFIENLSDDAISRFQEQIEIVNIMESEDMGAIKAKIDELKARDPGAFGAEPM
FT                   IVEVKEAGGAAEEATGEVQPLSGELALVHARMKVIERMVTDIGYRNKFAAGVYSGKIEG
FT                   LMIGLIVSFVILGFILLG"
FT   gene            complement(579880..580164)
FT                   /locus_tag="Memar_0609"
FT   CDS_pept        complement(579880..580164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0609"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit B"
FT                   /EC_number="2.1.1.86"
FT                   /note="PFAM: Tetrahydromethanopterin S-methyltransferase
FT                   subunit B; KEGG: mhu:Mhun_2171 tetrahydromethanopterin
FT                   S-methyltransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56542"
FT                   /db_xref="GOA:A3CT42"
FT                   /db_xref="InterPro:IPR008690"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT42"
FT                   /protein_id="ABN56542.1"
FT                   /translation="MAYVQVLPEFGLVVDPMVGIVTTAGVSYTPVLEQVTELEKITDDL
FT                   VGMLSGEGNFLASFPNREGVLNVAGGVTAFWYGMAIGLLVAGVVVLGLL"
FT   gene            complement(580165..581016)
FT                   /locus_tag="Memar_0610"
FT   CDS_pept        complement(580165..581016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0610"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit C"
FT                   /EC_number="2.1.1.86"
FT                   /note="PFAM: Tetrahydromethanopterin S-methyltransferase,
FT                   subunit C; KEGG: mhu:Mhun_2170 tetrahydromethanopterin
FT                   S-methyltransferase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56543"
FT                   /db_xref="GOA:A3CT43"
FT                   /db_xref="InterPro:IPR005865"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT43"
FT                   /protein_id="ABN56543.1"
FT                   /translation="MSVKIEVGAGGIPHNQVLIFGLVGSLVLIYLTYLNTYFQTQYFAF
FT                   FGGLAAVAALIWGTDTIKHLCSYGLGTGVPSAGMIALGSGVIAALFGATTGILAPIVTV
FT                   IIAAIIGAVAGLMANHVVRMDIPVMVISLIELAIVGAMTVLGLAAMACGSFEFLNMITG
FT                   TVSFLGFTMLTYETSVIGGSIIAVIFMLGAIAIQHSFNACLGPGEQQDRTLTLAAECGF
FT                   LSMITVAIISFAFIGLLPALVALVISIIGWLYTYTKYIALSKRDAYAWLDAQPIMEPKG
FT                   GA"
FT   gene            complement(581017..581868)
FT                   /locus_tag="Memar_0611"
FT   CDS_pept        complement(581017..581868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0611"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit D"
FT                   /EC_number="2.1.1.86"
FT                   /note="KEGG: mhu:Mhun_2169 tetrahydromethanopterin
FT                   S-methyltransferase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56544"
FT                   /db_xref="GOA:A3CT44"
FT                   /db_xref="InterPro:IPR005779"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT44"
FT                   /protein_id="ABN56544.1"
FT                   /translation="MSALGGPKQTGGIQPPTAMGIVLSIVLIIVALGLAYYLVQMAGVL
FT                   ALVGIIIGGVLVAFGVHFVPVGGAPAAMGQSPGIATGVAMLAAGAGLAGLFGGAWAAPF
FT                   GLAVALAGGAVGGGLLMAITCTMVNVIYIFGMGIPAASGKVDKDPITGDTFPEYKSQGT
FT                   EGHGLPFISWVGGVIGGALGGLGGTLIYLELLDVYQAQLPVILDATVEQIAPVAISLAG
FT                   VFAVAMFLINAVLAAYNITGTIEGPHDPKFKRFPRAIIAAAVASAIAGFFAIALLELVG
FT                   VF"
FT   gene            complement(581865..582770)
FT                   /locus_tag="Memar_0612"
FT   CDS_pept        complement(581865..582770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0612"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit E"
FT                   /EC_number="2.1.1.86"
FT                   /note="KEGG: mhu:Mhun_2168 tetrahydromethanopterin
FT                   S-methyltransferase; TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, subunit E; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase, subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56545"
FT                   /db_xref="GOA:A3CT45"
FT                   /db_xref="InterPro:IPR005780"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT45"
FT                   /protein_id="ABN56545.1"
FT                   /translation="MEEIVFGIGITALAGALATVAGAAEDTESDIGSQGDPNSQVQLAP
FT                   QMGYIHRIFNKAVAGEPPAYGLWVALGAGLAWAFMAMQINPILAIVLGSALAVFVQGVY
FT                   ATTAYLGRTASLAKFGQPVYIDILKSMTTVTMAHAFVAIFTTVAMCHLMISALGHPFPL
FT                   PLLGLVWGIALGAAGSATGNPFYGKERQYQEQKFGAGVPISASGNIVRYAEAGQRNSLD
FT                   NGFFSAKLGGPASGICFGLIVFFELWRTVVFEELNIWGPIIVGIVVILIFAIIDRYIEV
FT                   WARKNFGPYTAPEAPEEASS"
FT   sig_peptide     complement(582699..582770)
FT                   /locus_tag="Memar_0612"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.971 at
FT                   residue 24"
FT   gene            complement(582965..584671)
FT                   /locus_tag="Memar_0613"
FT   CDS_pept        complement(582965..584671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0613"
FT                   /product="methyl-coenzyme M reductase, alpha subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="PFAM: methyl-coenzyme M reductase, alpha subunit
FT                   domain protein; KEGG: mhu:Mhun_2148 coenzyme-B
FT                   sulfoethylthiotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56546"
FT                   /db_xref="GOA:A3CT46"
FT                   /db_xref="InterPro:IPR003183"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR009047"
FT                   /db_xref="InterPro:IPR015811"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR016212"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT46"
FT                   /protein_id="ABN56546.1"
FT                   /translation="MAKIERTQKLFLKSLKEKFQGQDVESETTEFYKFNGYHQSPRKEE
FT                   FVKASRAVEMDRGISMYDPVRCHLGGIPLGQRQLMTYEVSGTGVFVEGDDLHFVNNAAM
FT                   QQMWDDIRRTVIVNMDLAHQTLQKRLGKEVTPETINEYLHVLNHAMPGAAVVQEHMVET
FT                   HPGLVDDCYVKVFTGDQELADDLEPQFVLDVEKLFPAKQAEALSAAVGKSLWQAIHIPT
FT                   TVSRTCDGGTTSRWSAMQIGMSFIGAYRMCAGEAAVADLSYAAKHAGVIQMASHLPARR
FT                   ARGPNEPGGIGFGLFSDIVQANRKYPNDPAKASLEVVGAGTMLFDQIWLGSYMSGGVGF
FT                   TQYATAAYTDNILDEFTYYGMDYIKDKYKVDWKNPSADDKVKPTYDTVNDIATEVALNG
FT                   MEQYEQYPTMMEDHFGGSQRAGVLAAACGLSSSIATGNSNAGLNAWYLCMLLHKDGWSR
FT                   LGFFGYDLQDQCGSANTLSIRGDEGAIGEVRGPNYPNYAMNVGHQGEYAAIVGGAHYGR
FT                   GDAWSFDPRVKICFADPALKFDFAEPRREFAKGAIREFMPAGERSLIIPAR"
FT   gene            complement(584677..585441)
FT                   /locus_tag="Memar_0614"
FT   CDS_pept        complement(584677..585441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0614"
FT                   /product="methyl-coenzyme M reductase, gamma subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="PFAM: Methyl-coenzyme M reductase, gamma subunit;
FT                   KEGG: mhu:Mhun_2147 methyl-coenzyme M reductase, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56547"
FT                   /db_xref="GOA:A3CT47"
FT                   /db_xref="InterPro:IPR003178"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR036994"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT47"
FT                   /protein_id="ABN56547.1"
FT                   /translation="MAYKPQYGPGTSKVAANRRKQMDPNQKLEKMRDVTDEDIVLILGH
FT                   RAPGAAYPTAHPPLAEQQEPDCPIRKIVTPTEGAKAGDRVRYIQFADSMFFAPSQPYQR
FT                   TYTECYRFRGIDPGTLSGRQIVECRERDLEKYSKELIETELLDPARTGIRGATVHGHSL
FT                   RLAENGMMFDMLQRSVLGEDGIVRYVKNQIGEPLDRAVAVGKPLDEKWLKAHTTIFHSL
FT                   GGSAYRDDKEYIEYVQRIHTLRTKYGFLPKEA"
FT   gene            complement(585459..586082)
FT                   /locus_tag="Memar_0615"
FT   CDS_pept        complement(585459..586082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0615"
FT                   /product="Methyl-coenzyme M reductase operon protein C"
FT                   /note="PFAM: Methyl-coenzyme M reductase operon protein C;
FT                   KEGG: mhu:Mhun_2146 methyl-coenzyme M reductase operon
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56548"
FT                   /db_xref="GOA:A3CT48"
FT                   /db_xref="InterPro:IPR007687"
FT                   /db_xref="InterPro:IPR026327"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT48"
FT                   /protein_id="ABN56548.1"
FT                   /translation="MPIGRVTQVVDCRESMGMGKGGGLAQRGTISETRSPDVIVIGMSP
FT                   GRRHVTKPVCDITSGLRREGAEFSVTTLVLNAGSGVPADSPVAGHVLGAYFGLTEKEIA
FT                   QIEQHKVAILHHGNVRSHVVQKVRFILEHTDIRAIVVSQVPIDFEDLAKEGVRTAAVMP
FT                   PPDRTKTKGIVMDIVSGVTRGQTPGREKLAEVIRAVMKVLKSPT"
FT   gene            complement(586084..586560)
FT                   /locus_tag="Memar_0616"
FT   CDS_pept        complement(586084..586560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0616"
FT                   /product="Methyl-coenzyme M reductase, protein D"
FT                   /note="PFAM: Methyl-coenzyme M reductase, protein D; KEGG:
FT                   mhu:Mhun_2145 methyl-coenzyme M reductase, protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56549"
FT                   /db_xref="GOA:A3CT49"
FT                   /db_xref="InterPro:IPR003901"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT49"
FT                   /protein_id="ABN56549.1"
FT                   /translation="MTEAIYPQVRIVSARFLRPDTVEQLLNRLVRIGGILRMSLTGQNL
FT                   PATVPYGPARGKPNPHPDRKVIRVGDQEVQLEVQVGAVILELEDESYIPAIEEAVDEVF
FT                   ASKDFSCAVQKGRFMKTTPTVSDYAKYGPDADREVLGLVDPRKKGGPVIIQGNK"
FT   gene            complement(586578..587882)
FT                   /locus_tag="Memar_0617"
FT   CDS_pept        complement(586578..587882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0617"
FT                   /product="methyl-coenzyme M reductase, beta subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="PFAM: Methyl-coenzyme M reductase, beta subunit;
FT                   KEGG: mhu:Mhun_2144 methyl-coenzyme M reductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56550"
FT                   /db_xref="GOA:A3CT50"
FT                   /db_xref="InterPro:IPR003179"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR022679"
FT                   /db_xref="InterPro:IPR022680"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT50"
FT                   /protein_id="ABN56550.1"
FT                   /translation="MAKYKETIDLYDDAGKQLKSGVPLEKISPLVNPATRKLIDLTKRT
FT                   IAVNLGGIQEGLKTGKVAKGYVLGREMNLDIIGNKDAIIGKIKEMVQVEEGDDTNIREF
FT                   GGGKLILVEVPKTRLEAASTYDAAITSVASATTFSLVEQFDIGAFDAAMVKAAVWGGYP
FT                   HTMDLTGANVTSILSIPQNNEGLGYALRNIPVNHAVMITGKNAMQGAALSSTFEQAGMF
FT                   EMGNAIGPFERAQLLTYAYQGLNANNLVYDLVKKNGATGTIGTVVQSLVERAIEDKVIT
FT                   PGKKGGYFQFYNTKDPMLWNAYAAAGTMAATMVNCGAGRFAQAVSSTLLYFNDLLEHET
FT                   GLPGCDYGRVMGTAVGFSFFSHSIYGGGGPGIFNGNHVVTRHAAGVAIPCVVAAAALDA
FT                   GTQMFSPESTSKVYGDTFGQVDVFNKPIQQIAKGV"
FT   gene            complement(588246..589052)
FT                   /locus_tag="Memar_0618"
FT   CDS_pept        complement(588246..589052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0618"
FT                   /product="formylmethanofuran dehydrogenase, subunit C"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: glutamate synthase, alpha subunit domain
FT                   protein; KEGG: mhu:Mhun_1981 formylmethanofuran
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56551"
FT                   /db_xref="GOA:A3CT51"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR017550"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT51"
FT                   /protein_id="ABN56551.1"
FT                   /translation="METVTLTIKNQPDLYLEADNITPDAFAGKKAEEIADLHVYVGREQ
FT                   HRLGEFFEVSGNAGATPEETKIVVNGDLSRVKYIGMKMTGGEVVVNGNADMYVGAWMQG
FT                   GKITANGNVDAFAGTGMKGGELVINGNAGNYLGAAYRGDWRGMQGGKITVTGNAGSDIG
FT                   TFMNGGEIVIGGDVDVHVATHAEGGKIVIKGNAKSRLGGQMVEGEIYVLGDIDVMMPGF
FT                   AYREDVDVDMDGIKGRFALYEGDLGERHRKRKGQTIYAKLYQRIEA"
FT   gene            complement(589065..590771)
FT                   /locus_tag="Memar_0619"
FT   CDS_pept        complement(589065..590771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0619"
FT                   /product="formylmethanofuran dehydrogenase, subunit A"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: mhu:Mhun_1982
FT                   amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56552"
FT                   /db_xref="GOA:A3CT52"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012027"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT52"
FT                   /protein_id="ABN56552.1"
FT                   /translation="MAEYLIKNGFVFDPVQGIKGDAVDVAIKDGKIVETTALSSPKVID
FT                   ATGKTVMAGGVDVHAHVAGPKVNTGRNFRPEDKLFTYKPKNGIERMQGGFSVPTTIRTG
FT                   YNYARMGYTTVMEAAMPPLYARHTHEEMRDTPILDQGAYPVFGNNWFVLEYLKNHEIEN
FT                   AAAYIAWLLRVTKGYAVKVVNPGGTEAWGWGLNCENVHDPVPYFDITPAQIIKGLIEAN
FT                   EYLGLPHSMHMHANNLGNPGNYTTTLDSFKLSEGIKPNSKFGRDQVMHHTHVQFHSYGG
FT                   DSWANMESKAKEIMDYVNSHDNITIDIGQVTLDETTTMTADGPFEHHLTELNHLKWANA
FT                   DVELETAAGVVPYVYSPNIKVCGIQWAIGLELALLAKDPMRVFITTDHPNAGLFIRYPR
FT                   IMKWLMSTEAREQQFDAFKHKDKVIDATNLAGIDRELGLYEIAQMTRAGTAKSLGLSHL
FT                   YGGLAPGLEADVAVYDFNPNEPYVPDDIEKAFLNAEHVFKAGVQVVKDHEIASNGNKRT
FT                   LWVNAKVNENPQVMRDVKEKFLRYYTVNLNNYEVAGHYLPNSYVIEVDATE"
FT   gene            complement(590775..592088)
FT                   /locus_tag="Memar_0620"
FT   CDS_pept        complement(590775..592088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0620"
FT                   /product="formylmethanofuran dehydrogenase, subunit B"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: molybdopterin oxidoreductase; KEGG:
FT                   mhu:Mhun_1983 molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56553"
FT                   /db_xref="GOA:A3CT53"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR016457"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT53"
FT                   /protein_id="ABN56553.1"
FT                   /translation="MTKTVTDVICPFCGTLCDDLEVVVSDDGEELLEVYNACAIGAEKF
FT                   LHSQAKDRITRPRMRQEDGSWKEISYDEAIEYTARMLTEAKKPLMYGWSSTNCEAQAVG
FT                   SEIGEAVGAVMDNTATVCHGTSLIAVQDIGIPSCTLGEVKNRADRILFWGCNPAHAHPR
FT                   HMSRYSIFPRGFFTGKGHAGRKMIVVDPRPTDTASMADVHLQIEQGRDYELLNALRVAF
FT                   KGEKLPDVVAGIPKEKIYEVAETLKSGRFAIIFFGMGVTQSLGKNHNIDEAIAVTRDLN
FT                   EYTKAAIMPMRGHYNVTGSGQVWGWLFGFPYAVDLSRGFARYNPGETTSNDLLRRDEVD
FT                   AVFVLGSDPGAHFPFSSVKKIYNRPSVVIDPHETPTTEVCKVHVPVAFVGVEVGGCAYR
FT                   MDNVPIETRKVVEPPEGMMTDEEFLKRVLGRVKEIQGV"
FT   gene            complement(592085..592486)
FT                   /locus_tag="Memar_0621"
FT   CDS_pept        complement(592085..592486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0621"
FT                   /product="formylmethanofuran dehydrogenase, subunit D"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: molydopterin dinucleotide-binding region;
FT                   KEGG: mhu:Mhun_1984 molydopterin dinucleotide-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56554"
FT                   /db_xref="GOA:A3CT54"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR012040"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT54"
FT                   /protein_id="ABN56554.1"
FT                   /translation="MAIRVNLITGRTIQQGVSMEAGKEKPAYTTACGIIELDPADFKKL
FT                   GVYRNTNVRVTSSYGSVIVKAVDATQGPHPGVAYIPMGPWANMVVNPNTYSTGMPTFKG
FT                   TPVEVEVAKNEPVLGSLELVRKGCRGELA"
FT   gene            complement(592513..592938)
FT                   /locus_tag="Memar_0622"
FT   CDS_pept        complement(592513..592938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0622"
FT                   /product="F420-non-reducing hydrogenase subunit D"
FT                   /note="PFAM: methyl-viologen-reducing hydrogenase, delta
FT                   subunit; KEGG: mhu:Mhun_1842 methyl-viologen-reducing
FT                   hydrogenase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56555"
FT                   /db_xref="GOA:A3CT55"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT55"
FT                   /protein_id="ABN56555.1"
FT                   /translation="MADENWKPKIIAIICNWCSYAGADLAGGARIQYPPDIRAVRVMCT
FT                   GRIDPLFILKAFQDGADGVLVSGCHFGDCHYLEGNFKAAKRMFLLKSVLKNIGLDDKRL
FT                   RMTFVSASEGAKWGTVMTDVVTTINELGPSPLKEFAR"
FT   gene            complement(592939..594957)
FT                   /locus_tag="Memar_0623"
FT   CDS_pept        complement(592939..594957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0623"
FT                   /product="CoB--CoM heterodisulfide reductase subunit A"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mhu:Mhun_1838 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56556"
FT                   /db_xref="GOA:A3CT56"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT56"
FT                   /protein_id="ABN56556.1"
FT                   /translation="MAEVKNKEARIGVFVCHCGTNIAGTIDVEAVKEYARTIPNVVVAD
FT                   NYAYMCSTPGQNMIADAIKEHNLTGVVVAACTPRLHEPTFRNATAAGGLNPFRFEMANI
FT                   RDQNSWVHMHQPEEATDKAKDAIRIAVAKASLLEDLIPKSVPVEKAAMVVGGGVGGMQA
FT                   ALDLANAGIKTYLVEKNPTIGGRMSQLDKTFPTLDCSQCILTPKMVDVYRNENIELLTY
FT                   TEVESVEGYIGNFDVTLRKKARGVLTPAEAEARGIVGGGCTGCGDCATVCPVIKPNPFE
FT                   LGMAPRKAVYIYHPQVSPLIYTVDFDACVKCGLCVEACGEKKAIDLEAEDELITVKVGT
FT                   AILATGYDIFPIEKKFEWGYKNYDNVITSLEFERLICASGPTGGHLIRPSDGDTPKRIA
FT                   FVLCAGSRDNTGVGKPYCSRFCCMYSLKHAHQIIEKIPGAVPYIFYMDIRSFGKMYEEF
FT                   YYRIQNEGAKFIRGRVANITEDPVTKNLHVNAEDTLLGRPIDMEVDMVVLAAAIEPAAE
FT                   TEKTRRLFGVSCSQDGWLLEAHPKLNPCGTTTAGVYLAGVCQGPKDIPDTVAQAEGAAS
FT                   AASIPIHRGEVELEPYFAVCLEDKCAGCGLCVNQCPYSALSLVEKDGRTVMQVTEAKCK
FT                   GCGTCGGFCPGGAIWMQHFATPQIVAQIDAFLLGGEQ"
FT   gene            complement(594969..595871)
FT                   /locus_tag="Memar_0624"
FT   CDS_pept        complement(594969..595871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0624"
FT                   /product="CoB--CoM heterodisulfide reductase subunit B"
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region domain protein; KEGG: mhu:Mhun_1837
FT                   protein of unknown function DUF224, cysteine-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56557"
FT                   /db_xref="GOA:A3CT57"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017678"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT57"
FT                   /protein_id="ABN56557.1"
FT                   /translation="MSGNNHQYAFFLGCIAPNRYPGIEAAAIRTSKNVGIDLLPLKGAS
FT                   CCPAPGAFGSIDLNIWYAMAARNVVLAEQMGMDITLICNGCYKSIYEVNEKLKHNDELR
FT                   DGVNEVLKEIDMEFKGTIDVWHLAELYYDPKIVGVKKIAESVKRPLTGAKIAVHYGCHL
FT                   MKPGKERHFGDTENPMWIEELVAALGAEPVQYRNKMQCCGAGGGVRGYDLTHALDITNE
FT                   KLINLQEVGADALTEVCPFCQLQYDRGQVEIQDKFGITWGLPVLHYNELLGLAQGMNPD
FT                   ELALDLHAIDVEPFLKKIL"
FT   gene            complement(595876..596457)
FT                   /locus_tag="Memar_0625"
FT   CDS_pept        complement(595876..596457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0625"
FT                   /product="CoB--CoM heterodisulfide reductase subunit C"
FT                   /note="KEGG: mhu:Mhun_1836 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56558"
FT                   /db_xref="GOA:A3CT58"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017680"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT58"
FT                   /protein_id="ABN56558.1"
FT                   /translation="MAVKKDYKDQKLAEKLRDRKYYIPDSNPEFIKEVEKIGQTAAHMC
FT                   YQCGTCTGSCPSAPRSSYRIRLFMRKAILGLEEEILTDPDLWLCTTCYSCTDRCPRDLA
FT                   PTDAIMAMRNLAARRDIVPRNFLQTVQLIYKSGHGVPNNDANRAARKKLGLEEEPETTH
FT                   KYPEYLPGIRKIIDHYGLKDRADKILSEGE"
FT   gene            complement(596468..597637)
FT                   /locus_tag="Memar_0626"
FT   CDS_pept        complement(596468..597637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0626"
FT                   /product="formylmethanofuran dehydrogenase, subunit F"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mhu:Mhun_1835 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56559"
FT                   /db_xref="GOA:A3CT59"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT59"
FT                   /protein_id="ABN56559.1"
FT                   /translation="MALFPKYSKTRDGQNVVMEQRLLKAVNNLILNAETCTGCGICVDA
FT                   CPEEAIVLGPVGATRRGAIDYAEPVDVNPEKCSYCGVCVVMCPFNAMTLKIDGEERLPI
FT                   LEQEGFPTYDMVTTIDEEKCDRCTICEEVCPRDAINRDVPAFEGGDEAGKPRETALQTR
FT                   TTFTVDTEKCDVCGICGELCPSITVVRKPANPETGKVEGDVQWEETTCDGCTICVEACP
FT                   QDAITLEREVISSKLPGKVDIEQDNCCTCTWCVQSCPQEAITVEKIFEGDLEIHPEKCP
FT                   GGCSTCVEVCPCNALYLPSPLPAKDMKGEIEANIAINKDFCILCGACVNACPSEDALVL
FT                   RRTGIRMQEKDSDLFKKIKEKLLTPRTSRVKETAPGEVEVKVLGEAEEA"
FT   gene            complement(597653..597925)
FT                   /locus_tag="Memar_0627"
FT   CDS_pept        complement(597653..597925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0627"
FT                   /product="formylmethanofuran dehydrogenase, subunit G"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mhu:Mhun_1834 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56560"
FT                   /db_xref="GOA:A3CT60"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT60"
FT                   /protein_id="ABN56560.1"
FT                   /translation="MAFALHINMERCTGCNNCVVACPVDALELYTEDPATKEKIYKVRD
FT                   GKAVILDFNSELCAGCGVCVQACPYGVIKLVGPWESRAKTRKVEA"
FT   gene            598542..599450
FT                   /locus_tag="Memar_0628"
FT   CDS_pept        598542..599450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0628"
FT                   /product="formylmethanofuran-tetrahydromethanopterin
FT                   formyltransferase"
FT                   /EC_number="2.3.1.101"
FT                   /note="PFAM: formylmethanofuran: tetrahydromethanopterin
FT                   formyltransferase (Ftr); KEGG: mhu:Mhun_1808
FT                   formylmethanofuran--tetrahydromethanopterin
FT                   N-formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56561"
FT                   /db_xref="GOA:A3CT61"
FT                   /db_xref="InterPro:IPR002770"
FT                   /db_xref="InterPro:IPR014053"
FT                   /db_xref="InterPro:IPR022667"
FT                   /db_xref="InterPro:IPR023447"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT61"
FT                   /protein_id="ABN56561.1"
FT                   /translation="MELNGVTIDDTYAEAFPTWVARPIITAVTEEWAYKAAVEAVGFAT
FT                   STIGCPAEAGIDCFVSPDETPDGRPGYAIMICASKKKLKEQVVERLAECVLTAPTTAVF
FT                   DGLSDVVAEVPEKLPVKLHFFGDGYEEKREVGGRTVWAIPIMEGEYIGEEEFGAVKGVA
FT                   GGNFFIMGENQMAALTAAQAAVDAISGVCGVITPFPGGIVASGSKVGSNKYKFMGASTN
FT                   EAYCPTLRDKVENSKVPEGVKAIYELVIDGVDEDSIKTAMAEGIRAATRVPGVKFISAG
FT                   NFGGSLGPFKFELKDVLAEYL"
FT   gene            600366..601322
FT                   /locus_tag="Memar_0629"
FT   CDS_pept        600366..601322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0629"
FT                   /product="tRNA(Ile2) 2-agmatinylcytidine synthetase"
FT                   /note="KEGG: mth:MTH1391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56562"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT62"
FT                   /protein_id="ABN56562.1"
FT                   /translation="MITLTPDEVRARFGRLFSMKFLAMVDQNAGLAEIREHCRARGTIE
FT                   WDAANRVRAKGAVQSCHVEGTTMTMIARLGVSPANFGAAGQEIGGQALEGVEVVGDEVV
FT                   TTWAGIAGAGVGVAACLPQAPGVIRAEYPTEDDLKIGGARVCRVRIVSPLYEKVTIGID
FT                   DTDTREEGATWVLALKCAEGCTIPGVEYLDMRLVQLNPAVPKKTTNCVGSALNFAVRPG
FT                   KVDELLEYVRDFIEAEAVSNDTGIAVYRGIAFAEESPYLKRVKTELLTVDDAEAEAARM
FT                   GVRFIDSTGRKGRIGALGAVLWGNKGVEAAGLYGETL"
FT   gene            601306..602199
FT                   /locus_tag="Memar_0630"
FT   CDS_pept        601306..602199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0630"
FT                   /product="tRNA(Ile2) 2-agmatinylcytidine synthetase"
FT                   /note="PFAM: domain of unknown function DUF1743; KEGG:
FT                   mhu:Mhun_1804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56563"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR017674"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT63"
FT                   /protein_id="ABN56563.1"
FT                   /translation="MEKLSDPYTIRYPQIVAVADESGGLVELVEFFDCTGGAMWVKRHY
FT                   AQSPLVRSVRTVGSTNRYLLSTGSADLALEGSVFPAGIAAVAVEEGEIAVTYRGLGGGG
FT                   VGASVCRAGARGVVRCVSDPAGGGRLAGSTVWLPRLERVIVGIDDTDTPEEGATWTLAH
FT                   NIARAVEDDRSRYLSHTIVQLYPVPYRTKNCVAIACEFATSDPEGLIRNYRDLLEEYTL
FT                   SDETGMAVWRGFDPSPLEEFGCRVKRGEVSADDLAALDSEHLSVVMDGRGVIGAVAAIP
FT                   FYTRYEEALALWNGSG"
FT   gene            602208..603152
FT                   /locus_tag="Memar_0631"
FT   CDS_pept        602208..603152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Memar_0631"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mhu:Mhun_1803 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Memar_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABN56564"
FT                   /db_xref="GOA:A3CT64"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:A3CT64"
FT                   /protein_id="ABN56564.1"
FT                   /translation="MLGTGSVRLSGEPADEYVSRSAAGPTAGTPGSLFFSPVAGRRVRA
FT                   GIDDTSPIEIVHLGDGAADLLVDGEVVAGRLEPAALHCPRQAYITVSGTCIFCCRYCPV
FT                   PALPGRRKEVDEIVRMVGSVADRIDAISITSGVASSIEEEEAYVLEVVAALRPFNLPIG
FT                   VSIYPCPGTPARLHALGVAEVKFNIEAATPELFTAMCPGLSWEGVWESLSTSVTLFGRG
FT                   RVYSNVIVGLGETDEDLERVMEDLAAIGVIPVLRPLTPAASLAGMPRPSAERLLSLFEV
FT                   HGRILRRAGLDPRRALTMCS