(data stored in ACNUC7421 zone)

EMBL: CP000569

ID   CP000569; SV 1; circular; genomic DNA; STD; PRO; 2274482 BP.
XX
AC   CP000569;
XX
PR   Project:PRJNA18221;
XX
DT   27-FEB-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Actinobacillus pleuropneumoniae L20 serotype 5b complete genome.
XX
KW   .
XX
OS   Actinobacillus pleuropneumoniae serovar 5b str. L20
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales;
OC   Pasteurellaceae; Actinobacillus.
XX
RN   [1]
RP   1-2274482
RX   DOI; 10.1128/JB.01845-07.
RX   PUBMED; 18065534.
RA   Foote S.J., Bosse J.T., Bouevitch A.B., Langford P.R., Young N.M.,
RA   Nash J.H.;
RT   "The complete genome sequence of Actinobacillus pleuropneumoniae L20
RT   (serotype 5b)";
RL   J. Bacteriol. 190(4):1495-1496(2008).
XX
RN   [2]
RP   1-2274482
RA   Foote S.J., Bosse J.T., Bouevitch A.B., Langford P.R., Young N.M.,
RA   Nash J.H.E.;
RT   ;
RL   Submitted (09-FEB-2007) to the INSDC.
RL   Institute for Biological Sciences, National Research Council of Canada, 100
RL   Sussex Drive, Ottawa, Ontario K1A 0R6, Canada
XX
DR   MD5; 6efd50116f9c8711d2e33d102e15bd9d.
DR   BioSample; SAMN02603665.
DR   EnsemblGenomes-Gn; APL_2047.
DR   EnsemblGenomes-Gn; APL_2048.
DR   EnsemblGenomes-Gn; APL_2049.
DR   EnsemblGenomes-Gn; APL_2050.
DR   EnsemblGenomes-Gn; APL_2051.
DR   EnsemblGenomes-Gn; APL_2052.
DR   EnsemblGenomes-Gn; APL_2053.
DR   EnsemblGenomes-Gn; APL_2054.
DR   EnsemblGenomes-Gn; APL_2055.
DR   EnsemblGenomes-Gn; APL_2056.
DR   EnsemblGenomes-Gn; APL_2057.
DR   EnsemblGenomes-Gn; APL_2058.
DR   EnsemblGenomes-Gn; APL_2059.
DR   EnsemblGenomes-Gn; APL_2060.
DR   EnsemblGenomes-Gn; APL_2061.
DR   EnsemblGenomes-Gn; APL_2062.
DR   EnsemblGenomes-Gn; APL_2063.
DR   EnsemblGenomes-Gn; APL_2064.
DR   EnsemblGenomes-Gn; APL_2065.
DR   EnsemblGenomes-Gn; APL_2066.
DR   EnsemblGenomes-Gn; APL_2067.
DR   EnsemblGenomes-Gn; APL_2068.
DR   EnsemblGenomes-Gn; APL_2069.
DR   EnsemblGenomes-Gn; APL_2070.
DR   EnsemblGenomes-Gn; APL_2071.
DR   EnsemblGenomes-Gn; APL_2072.
DR   EnsemblGenomes-Gn; APL_2073.
DR   EnsemblGenomes-Gn; APL_2074.
DR   EnsemblGenomes-Gn; APL_2075.
DR   EnsemblGenomes-Gn; APL_2076.
DR   EnsemblGenomes-Gn; APL_2077.
DR   EnsemblGenomes-Gn; APL_2078.
DR   EnsemblGenomes-Gn; APL_2079.
DR   EnsemblGenomes-Gn; APL_2080.
DR   EnsemblGenomes-Gn; APL_2081.
DR   EnsemblGenomes-Gn; APL_2082.
DR   EnsemblGenomes-Gn; APL_2083.
DR   EnsemblGenomes-Gn; APL_2084.
DR   EnsemblGenomes-Gn; APL_2085.
DR   EnsemblGenomes-Gn; APL_2086.
DR   EnsemblGenomes-Gn; APL_2087.
DR   EnsemblGenomes-Gn; APL_2088.
DR   EnsemblGenomes-Gn; APL_2089.
DR   EnsemblGenomes-Gn; APL_2090.
DR   EnsemblGenomes-Gn; APL_2091.
DR   EnsemblGenomes-Gn; APL_2092.
DR   EnsemblGenomes-Gn; APL_2093.
DR   EnsemblGenomes-Gn; APL_2094.
DR   EnsemblGenomes-Gn; APL_2095.
DR   EnsemblGenomes-Gn; APL_2096.
DR   EnsemblGenomes-Gn; APL_2097.
DR   EnsemblGenomes-Gn; APL_2098.
DR   EnsemblGenomes-Gn; APL_2099.
DR   EnsemblGenomes-Gn; APL_2100.
DR   EnsemblGenomes-Gn; APL_2101.
DR   EnsemblGenomes-Gn; APL_2102.
DR   EnsemblGenomes-Gn; APL_2103.
DR   EnsemblGenomes-Gn; APL_2104.
DR   EnsemblGenomes-Gn; APL_2105.
DR   EnsemblGenomes-Gn; APL_2106.
DR   EnsemblGenomes-Gn; APL_2107.
DR   EnsemblGenomes-Gn; APL_2108.
DR   EnsemblGenomes-Gn; APL_2109.
DR   EnsemblGenomes-Gn; APL_2110.
DR   EnsemblGenomes-Gn; APL_2111.
DR   EnsemblGenomes-Gn; APL_2112.
DR   EnsemblGenomes-Gn; APL_2113.
DR   EnsemblGenomes-Gn; APL_2114.
DR   EnsemblGenomes-Gn; APL_2115.
DR   EnsemblGenomes-Gn; APL_2116.
DR   EnsemblGenomes-Gn; APL_2117.
DR   EnsemblGenomes-Gn; APL_2118.
DR   EnsemblGenomes-Gn; APL_2119.
DR   EnsemblGenomes-Gn; APL_2120.
DR   EnsemblGenomes-Gn; APL_2121.
DR   EnsemblGenomes-Gn; APL_2122.
DR   EnsemblGenomes-Gn; APL_2123.
DR   EnsemblGenomes-Gn; APL_2124.
DR   EnsemblGenomes-Gn; APL_2125.
DR   EnsemblGenomes-Gn; APL_2126.
DR   EnsemblGenomes-Gn; EBG00001173657.
DR   EnsemblGenomes-Gn; EBG00001173658.
DR   EnsemblGenomes-Gn; EBG00001173660.
DR   EnsemblGenomes-Gn; EBG00001173661.
DR   EnsemblGenomes-Gn; EBG00001173662.
DR   EnsemblGenomes-Gn; EBG00001173663.
DR   EnsemblGenomes-Gn; EBG00001173664.
DR   EnsemblGenomes-Gn; EBG00001173665.
DR   EnsemblGenomes-Gn; EBG00001173666.
DR   EnsemblGenomes-Gn; EBG00001173667.
DR   EnsemblGenomes-Gn; EBG00001173668.
DR   EnsemblGenomes-Gn; EBG00001173669.
DR   EnsemblGenomes-Gn; EBG00001173670.
DR   EnsemblGenomes-Gn; EBG00001173671.
DR   EnsemblGenomes-Gn; EBG00001173672.
DR   EnsemblGenomes-Gn; EBG00001173673.
DR   EnsemblGenomes-Gn; EBG00001173674.
DR   EnsemblGenomes-Gn; EBG00001173675.
DR   EnsemblGenomes-Gn; EBG00001173676.
DR   EnsemblGenomes-Gn; EBG00001173677.
DR   EnsemblGenomes-Gn; EBG00001173678.
DR   EnsemblGenomes-Gn; EBG00001173679.
DR   EnsemblGenomes-Gn; EBG00001173680.
DR   EnsemblGenomes-Gn; EBG00001173681.
DR   EnsemblGenomes-Gn; EBG00001173682.
DR   EnsemblGenomes-Gn; EBG00001173683.
DR   EnsemblGenomes-Gn; EBG00001173684.
DR   EnsemblGenomes-Gn; EBG00001173686.
DR   EnsemblGenomes-Gn; EBG00001173687.
DR   EnsemblGenomes-Gn; EBG00001173689.
DR   EnsemblGenomes-Gn; EBG00001173690.
DR   EnsemblGenomes-Gn; EBG00001173691.
DR   EnsemblGenomes-Gn; EBG00001173692.
DR   EnsemblGenomes-Gn; EBG00001173693.
DR   EnsemblGenomes-Gn; EBG00001173694.
DR   EnsemblGenomes-Gn; EBG00001173696.
DR   EnsemblGenomes-Gn; EBG00001173697.
DR   EnsemblGenomes-Gn; EBG00001173698.
DR   EnsemblGenomes-Gn; EBG00001173699.
DR   EnsemblGenomes-Gn; EBG00001173700.
DR   EnsemblGenomes-Gn; EBG00001173701.
DR   EnsemblGenomes-Gn; EBG00001173702.
DR   EnsemblGenomes-Gn; EBG00001173703.
DR   EnsemblGenomes-Gn; EBG00001173704.
DR   EnsemblGenomes-Gn; EBG00001173705.
DR   EnsemblGenomes-Gn; EBG00001173706.
DR   EnsemblGenomes-Gn; EBG00001173707.
DR   EnsemblGenomes-Gn; EBG00001173708.
DR   EnsemblGenomes-Gn; EBG00001173709.
DR   EnsemblGenomes-Gn; EBG00001173710.
DR   EnsemblGenomes-Gn; EBG00001173711.
DR   EnsemblGenomes-Gn; EBG00001173712.
DR   EnsemblGenomes-Gn; EBG00001173713.
DR   EnsemblGenomes-Gn; EBG00001173714.
DR   EnsemblGenomes-Gn; EBG00001173715.
DR   EnsemblGenomes-Gn; EBG00001173716.
DR   EnsemblGenomes-Gn; EBG00001173717.
DR   EnsemblGenomes-Gn; EBG00001173718.
DR   EnsemblGenomes-Gn; EBG00001173719.
DR   EnsemblGenomes-Gn; EBG00001173720.
DR   EnsemblGenomes-Gn; EBG00001173721.
DR   EnsemblGenomes-Gn; EBG00001173722.
DR   EnsemblGenomes-Gn; EBG00001173723.
DR   EnsemblGenomes-Gn; EBG00001173724.
DR   EnsemblGenomes-Gn; EBG00001173725.
DR   EnsemblGenomes-Gn; EBG00001173726.
DR   EnsemblGenomes-Gn; EBG00001173727.
DR   EnsemblGenomes-Gn; EBG00001173728.
DR   EnsemblGenomes-Gn; EBG00001173729.
DR   EnsemblGenomes-Gn; EBG00001173730.
DR   EnsemblGenomes-Gn; EBG00001173731.
DR   EnsemblGenomes-Gn; EBG00001173732.
DR   EnsemblGenomes-Gn; EBG00001173733.
DR   EnsemblGenomes-Gn; EBG00001173734.
DR   EnsemblGenomes-Gn; EBG00001173735.
DR   EnsemblGenomes-Gn; EBG00001173736.
DR   EnsemblGenomes-Gn; EBG00001173737.
DR   EnsemblGenomes-Gn; EBG00001173738.
DR   EnsemblGenomes-Gn; EBG00001173739.
DR   EnsemblGenomes-Gn; EBG00001173740.
DR   EnsemblGenomes-Gn; EBG00001173741.
DR   EnsemblGenomes-Gn; EBG00001173742.
DR   EnsemblGenomes-Gn; EBG00001173743.
DR   EnsemblGenomes-Gn; EBG00001173744.
DR   EnsemblGenomes-Gn; EBG00001173745.
DR   EnsemblGenomes-Gn; EBG00001173746.
DR   EnsemblGenomes-Gn; EBG00001173747.
DR   EnsemblGenomes-Gn; EBG00001173748.
DR   EnsemblGenomes-Gn; EBG00001173749.
DR   EnsemblGenomes-Gn; EBG00001173750.
DR   EnsemblGenomes-Gn; EBG00001173751.
DR   EnsemblGenomes-Gn; EBG00001173752.
DR   EnsemblGenomes-Gn; EBG00001173753.
DR   EnsemblGenomes-Gn; EBG00001173754.
DR   EnsemblGenomes-Gn; EBG00001173755.
DR   EnsemblGenomes-Gn; EBG00001173756.
DR   EnsemblGenomes-Gn; EBG00001173757.
DR   EnsemblGenomes-Gn; EBG00001173758.
DR   EnsemblGenomes-Gn; EBG00001173759.
DR   EnsemblGenomes-Gn; EBG00001173760.
DR   EnsemblGenomes-Gn; EBG00001173761.
DR   EnsemblGenomes-Gn; EBG00001173762.
DR   EnsemblGenomes-Gn; EBG00001173763.
DR   EnsemblGenomes-Gn; EBG00001173764.
DR   EnsemblGenomes-Gn; EBG00001173765.
DR   EnsemblGenomes-Gn; EBG00001173766.
DR   EnsemblGenomes-Gn; EBG00001173767.
DR   EnsemblGenomes-Gn; EBG00001173769.
DR   EnsemblGenomes-Gn; EBG00001173770.
DR   EnsemblGenomes-Gn; EBG00001173771.
DR   EnsemblGenomes-Gn; EBG00001173772.
DR   EnsemblGenomes-Gn; EBG00001173773.
DR   EnsemblGenomes-Gn; EBG00001173774.
DR   EnsemblGenomes-Gn; EBG00001173775.
DR   EnsemblGenomes-Gn; EBG00001173776.
DR   EnsemblGenomes-Gn; EBG00001173777.
DR   EnsemblGenomes-Gn; EBG00001173778.
DR   EnsemblGenomes-Gn; EBG00001173779.
DR   EnsemblGenomes-Gn; EBG00001173780.
DR   EnsemblGenomes-Gn; EBG00001173781.
DR   EnsemblGenomes-Gn; EBG00001173782.
DR   EnsemblGenomes-Gn; EBG00001173783.
DR   EnsemblGenomes-Gn; EBG00001173784.
DR   EnsemblGenomes-Gn; EBG00001173785.
DR   EnsemblGenomes-Gn; EBG00001173786.
DR   EnsemblGenomes-Gn; EBG00001173787.
DR   EnsemblGenomes-Gn; EBG00001173788.
DR   EnsemblGenomes-Gn; EBG00001173789.
DR   EnsemblGenomes-Gn; EBG00001173790.
DR   EnsemblGenomes-Gn; EBG00001173791.
DR   EnsemblGenomes-Gn; EBG00001173792.
DR   EnsemblGenomes-Tr; APL_2047-1.
DR   EnsemblGenomes-Tr; APL_2048-1.
DR   EnsemblGenomes-Tr; APL_2049-1.
DR   EnsemblGenomes-Tr; APL_2050-1.
DR   EnsemblGenomes-Tr; APL_2051-1.
DR   EnsemblGenomes-Tr; APL_2052-1.
DR   EnsemblGenomes-Tr; APL_2053-1.
DR   EnsemblGenomes-Tr; APL_2054-1.
DR   EnsemblGenomes-Tr; APL_2055-1.
DR   EnsemblGenomes-Tr; APL_2056-1.
DR   EnsemblGenomes-Tr; APL_2057-1.
DR   EnsemblGenomes-Tr; APL_2058-1.
DR   EnsemblGenomes-Tr; APL_2059-1.
DR   EnsemblGenomes-Tr; APL_2060-1.
DR   EnsemblGenomes-Tr; APL_2061-1.
DR   EnsemblGenomes-Tr; APL_2062-1.
DR   EnsemblGenomes-Tr; APL_2063-1.
DR   EnsemblGenomes-Tr; APL_2064-1.
DR   EnsemblGenomes-Tr; APL_2065-1.
DR   EnsemblGenomes-Tr; APL_2066-1.
DR   EnsemblGenomes-Tr; APL_2067-1.
DR   EnsemblGenomes-Tr; APL_2068-1.
DR   EnsemblGenomes-Tr; APL_2069-1.
DR   EnsemblGenomes-Tr; APL_2070-1.
DR   EnsemblGenomes-Tr; APL_2071-1.
DR   EnsemblGenomes-Tr; APL_2072-1.
DR   EnsemblGenomes-Tr; APL_2073-1.
DR   EnsemblGenomes-Tr; APL_2074-1.
DR   EnsemblGenomes-Tr; APL_2075-1.
DR   EnsemblGenomes-Tr; APL_2076-1.
DR   EnsemblGenomes-Tr; APL_2077-1.
DR   EnsemblGenomes-Tr; APL_2078-1.
DR   EnsemblGenomes-Tr; APL_2079-1.
DR   EnsemblGenomes-Tr; APL_2080-1.
DR   EnsemblGenomes-Tr; APL_2081-1.
DR   EnsemblGenomes-Tr; APL_2082-1.
DR   EnsemblGenomes-Tr; APL_2083-1.
DR   EnsemblGenomes-Tr; APL_2084-1.
DR   EnsemblGenomes-Tr; APL_2085-1.
DR   EnsemblGenomes-Tr; APL_2086-1.
DR   EnsemblGenomes-Tr; APL_2087-1.
DR   EnsemblGenomes-Tr; APL_2088-1.
DR   EnsemblGenomes-Tr; APL_2089-1.
DR   EnsemblGenomes-Tr; APL_2090-1.
DR   EnsemblGenomes-Tr; APL_2091-1.
DR   EnsemblGenomes-Tr; APL_2092-1.
DR   EnsemblGenomes-Tr; APL_2093-1.
DR   EnsemblGenomes-Tr; APL_2094-1.
DR   EnsemblGenomes-Tr; APL_2095-1.
DR   EnsemblGenomes-Tr; APL_2096-1.
DR   EnsemblGenomes-Tr; APL_2097-1.
DR   EnsemblGenomes-Tr; APL_2098-1.
DR   EnsemblGenomes-Tr; APL_2099-1.
DR   EnsemblGenomes-Tr; APL_2100-1.
DR   EnsemblGenomes-Tr; APL_2101-1.
DR   EnsemblGenomes-Tr; APL_2102-1.
DR   EnsemblGenomes-Tr; APL_2103-1.
DR   EnsemblGenomes-Tr; APL_2104-1.
DR   EnsemblGenomes-Tr; APL_2105-1.
DR   EnsemblGenomes-Tr; APL_2106-1.
DR   EnsemblGenomes-Tr; APL_2107-1.
DR   EnsemblGenomes-Tr; APL_2108-1.
DR   EnsemblGenomes-Tr; APL_2109-1.
DR   EnsemblGenomes-Tr; APL_2110-1.
DR   EnsemblGenomes-Tr; APL_2111-1.
DR   EnsemblGenomes-Tr; APL_2112-1.
DR   EnsemblGenomes-Tr; APL_2113-1.
DR   EnsemblGenomes-Tr; APL_2114-1.
DR   EnsemblGenomes-Tr; APL_2115-1.
DR   EnsemblGenomes-Tr; APL_2116-1.
DR   EnsemblGenomes-Tr; APL_2117-1.
DR   EnsemblGenomes-Tr; APL_2118-1.
DR   EnsemblGenomes-Tr; APL_2119-1.
DR   EnsemblGenomes-Tr; APL_2120-1.
DR   EnsemblGenomes-Tr; APL_2121-1.
DR   EnsemblGenomes-Tr; APL_2122-1.
DR   EnsemblGenomes-Tr; APL_2123-1.
DR   EnsemblGenomes-Tr; APL_2124-1.
DR   EnsemblGenomes-Tr; APL_2125-1.
DR   EnsemblGenomes-Tr; APL_2126-1.
DR   EnsemblGenomes-Tr; EBT00001752036.
DR   EnsemblGenomes-Tr; EBT00001752037.
DR   EnsemblGenomes-Tr; EBT00001752038.
DR   EnsemblGenomes-Tr; EBT00001752039.
DR   EnsemblGenomes-Tr; EBT00001752040.
DR   EnsemblGenomes-Tr; EBT00001752041.
DR   EnsemblGenomes-Tr; EBT00001752042.
DR   EnsemblGenomes-Tr; EBT00001752043.
DR   EnsemblGenomes-Tr; EBT00001752044.
DR   EnsemblGenomes-Tr; EBT00001752045.
DR   EnsemblGenomes-Tr; EBT00001752046.
DR   EnsemblGenomes-Tr; EBT00001752047.
DR   EnsemblGenomes-Tr; EBT00001752048.
DR   EnsemblGenomes-Tr; EBT00001752049.
DR   EnsemblGenomes-Tr; EBT00001752050.
DR   EnsemblGenomes-Tr; EBT00001752051.
DR   EnsemblGenomes-Tr; EBT00001752052.
DR   EnsemblGenomes-Tr; EBT00001752053.
DR   EnsemblGenomes-Tr; EBT00001752054.
DR   EnsemblGenomes-Tr; EBT00001752055.
DR   EnsemblGenomes-Tr; EBT00001752056.
DR   EnsemblGenomes-Tr; EBT00001752057.
DR   EnsemblGenomes-Tr; EBT00001752058.
DR   EnsemblGenomes-Tr; EBT00001752059.
DR   EnsemblGenomes-Tr; EBT00001752060.
DR   EnsemblGenomes-Tr; EBT00001752061.
DR   EnsemblGenomes-Tr; EBT00001752062.
DR   EnsemblGenomes-Tr; EBT00001752063.
DR   EnsemblGenomes-Tr; EBT00001752064.
DR   EnsemblGenomes-Tr; EBT00001752065.
DR   EnsemblGenomes-Tr; EBT00001752066.
DR   EnsemblGenomes-Tr; EBT00001752067.
DR   EnsemblGenomes-Tr; EBT00001752068.
DR   EnsemblGenomes-Tr; EBT00001752069.
DR   EnsemblGenomes-Tr; EBT00001752070.
DR   EnsemblGenomes-Tr; EBT00001752071.
DR   EnsemblGenomes-Tr; EBT00001752072.
DR   EnsemblGenomes-Tr; EBT00001752073.
DR   EnsemblGenomes-Tr; EBT00001752074.
DR   EnsemblGenomes-Tr; EBT00001752075.
DR   EnsemblGenomes-Tr; EBT00001752076.
DR   EnsemblGenomes-Tr; EBT00001752078.
DR   EnsemblGenomes-Tr; EBT00001752079.
DR   EnsemblGenomes-Tr; EBT00001752080.
DR   EnsemblGenomes-Tr; EBT00001752081.
DR   EnsemblGenomes-Tr; EBT00001752082.
DR   EnsemblGenomes-Tr; EBT00001752083.
DR   EnsemblGenomes-Tr; EBT00001752084.
DR   EnsemblGenomes-Tr; EBT00001752085.
DR   EnsemblGenomes-Tr; EBT00001752086.
DR   EnsemblGenomes-Tr; EBT00001752087.
DR   EnsemblGenomes-Tr; EBT00001752088.
DR   EnsemblGenomes-Tr; EBT00001752089.
DR   EnsemblGenomes-Tr; EBT00001752090.
DR   EnsemblGenomes-Tr; EBT00001752091.
DR   EnsemblGenomes-Tr; EBT00001752093.
DR   EnsemblGenomes-Tr; EBT00001752094.
DR   EnsemblGenomes-Tr; EBT00001752095.
DR   EnsemblGenomes-Tr; EBT00001752097.
DR   EnsemblGenomes-Tr; EBT00001752098.
DR   EnsemblGenomes-Tr; EBT00001752099.
DR   EnsemblGenomes-Tr; EBT00001752100.
DR   EnsemblGenomes-Tr; EBT00001752101.
DR   EnsemblGenomes-Tr; EBT00001752102.
DR   EnsemblGenomes-Tr; EBT00001752103.
DR   EnsemblGenomes-Tr; EBT00001752104.
DR   EnsemblGenomes-Tr; EBT00001752105.
DR   EnsemblGenomes-Tr; EBT00001752106.
DR   EnsemblGenomes-Tr; EBT00001752107.
DR   EnsemblGenomes-Tr; EBT00001752108.
DR   EnsemblGenomes-Tr; EBT00001752109.
DR   EnsemblGenomes-Tr; EBT00001752110.
DR   EnsemblGenomes-Tr; EBT00001752111.
DR   EnsemblGenomes-Tr; EBT00001752112.
DR   EnsemblGenomes-Tr; EBT00001752113.
DR   EnsemblGenomes-Tr; EBT00001752114.
DR   EnsemblGenomes-Tr; EBT00001752115.
DR   EnsemblGenomes-Tr; EBT00001752116.
DR   EnsemblGenomes-Tr; EBT00001752117.
DR   EnsemblGenomes-Tr; EBT00001752118.
DR   EnsemblGenomes-Tr; EBT00001752119.
DR   EnsemblGenomes-Tr; EBT00001752120.
DR   EnsemblGenomes-Tr; EBT00001752121.
DR   EnsemblGenomes-Tr; EBT00001752122.
DR   EnsemblGenomes-Tr; EBT00001752124.
DR   EnsemblGenomes-Tr; EBT00001752125.
DR   EnsemblGenomes-Tr; EBT00001752126.
DR   EnsemblGenomes-Tr; EBT00001752127.
DR   EnsemblGenomes-Tr; EBT00001752128.
DR   EnsemblGenomes-Tr; EBT00001752129.
DR   EnsemblGenomes-Tr; EBT00001752130.
DR   EnsemblGenomes-Tr; EBT00001752131.
DR   EnsemblGenomes-Tr; EBT00001752132.
DR   EnsemblGenomes-Tr; EBT00001752133.
DR   EnsemblGenomes-Tr; EBT00001752134.
DR   EnsemblGenomes-Tr; EBT00001752135.
DR   EnsemblGenomes-Tr; EBT00001752136.
DR   EnsemblGenomes-Tr; EBT00001752137.
DR   EnsemblGenomes-Tr; EBT00001752139.
DR   EnsemblGenomes-Tr; EBT00001752140.
DR   EnsemblGenomes-Tr; EBT00001752141.
DR   EnsemblGenomes-Tr; EBT00001752142.
DR   EnsemblGenomes-Tr; EBT00001752143.
DR   EnsemblGenomes-Tr; EBT00001752144.
DR   EnsemblGenomes-Tr; EBT00001752145.
DR   EnsemblGenomes-Tr; EBT00001752146.
DR   EnsemblGenomes-Tr; EBT00001752147.
DR   EnsemblGenomes-Tr; EBT00001752148.
DR   EnsemblGenomes-Tr; EBT00001752149.
DR   EnsemblGenomes-Tr; EBT00001752150.
DR   EnsemblGenomes-Tr; EBT00001752151.
DR   EnsemblGenomes-Tr; EBT00001752152.
DR   EnsemblGenomes-Tr; EBT00001752153.
DR   EnsemblGenomes-Tr; EBT00001752154.
DR   EnsemblGenomes-Tr; EBT00001752155.
DR   EnsemblGenomes-Tr; EBT00001752156.
DR   EnsemblGenomes-Tr; EBT00001752157.
DR   EnsemblGenomes-Tr; EBT00001752158.
DR   EnsemblGenomes-Tr; EBT00001752159.
DR   EnsemblGenomes-Tr; EBT00001752160.
DR   EnsemblGenomes-Tr; EBT00001752161.
DR   EnsemblGenomes-Tr; EBT00001752162.
DR   EnsemblGenomes-Tr; EBT00001752163.
DR   EnsemblGenomes-Tr; EBT00001752164.
DR   EnsemblGenomes-Tr; EBT00001752165.
DR   EnsemblGenomes-Tr; EBT00001752166.
DR   EnsemblGenomes-Tr; EBT00001752167.
DR   EnsemblGenomes-Tr; EBT00001752168.
DR   EnsemblGenomes-Tr; EBT00001752169.
DR   EnsemblGenomes-Tr; EBT00001752170.
DR   EnsemblGenomes-Tr; EBT00001752171.
DR   EuropePMC; PMC1832192; 17355629.
DR   EuropePMC; PMC2175527; 18197260.
DR   EuropePMC; PMC2238223; 18065534.
DR   EuropePMC; PMC2653537; 19239696.
DR   EuropePMC; PMC2953695; 20802045.
DR   EuropePMC; PMC3146884; 21749728.
DR   EuropePMC; PMC3275570; 22347439.
DR   EuropePMC; PMC3497496; 23144372.
DR   EuropePMC; PMC3719588; 23732171.
DR   EuropePMC; PMC4064151; 24369182.
DR   EuropePMC; PMC4097740; 24759717.
DR   EuropePMC; PMC4358398; 25745011.
DR   EuropePMC; PMC4388731; 25849041.
DR   EuropePMC; PMC4843962; 20483193.
DR   EuropePMC; PMC5679336; 29122004.
DR   EuropePMC; PMC5901230; 29615241.
DR   EuropePMC; PMC6008488; 29885806.
DR   EuropePMC; PMC6202450; 30074474.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; CP000569.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2274482
FT                   /organism="Actinobacillus pleuropneumoniae serovar 5b str.
FT                   L20"
FT                   /strain="L20"
FT                   /serotype="5b"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:416269"
FT   gene            63..1547
FT                   /gene="dnaA"
FT                   /locus_tag="APL_0001"
FT   CDS_pept        63..1547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="APL_0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73109"
FT                   /db_xref="GOA:A3MY73"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY73"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMW1"
FT                   /protein_id="ABN73109.1"
FT                   /translation="MTDLLAKFFGSVNRISGKFFTKIYKISTGFSGIITNLFHSFYSLE
FT                   QIVSSLWSDCLNHLQTKVSPTDYSTWLRPLQASFANGELTLYAQNQFVENWVKDKFLAE
FT                   IVDLARFLSKNNDLAVSIRVGIKPAEHRPVSPSTTSSNSKEEVPETNKNFRTGLNESLT
FT                   FENFVQGKSNQLAKAVAQQVADNPGESHCNPFSLYGGTGLGKTHLLHAVGNEILKRNPQ
FT                   ARVVYIHSERFVQDMVKALKGNTIENFKKFYRSLDVLMIDDIQFFANKEASQEEFFHTF
FT                   NSLFERNKQIILASDNFPKNIENIEERIKSRLSWGVSTAIEPPELETRVAILMKKAEER
FT                   GVELPEEVAFFIGQKLRTNVRELEGALNRVIAWRNFTKRQITIDAVREALKDLIASYDH
FT                   LITIENIQKTVAEYYNIKMSDLKSKSRTRSVARPRQMAMALAKELTNHSLPEIGREFGG
FT                   RDHTTVMHACKTINELRDTDSGIQEDYTNLTRKLSS"
FT   gene            1564..2667
FT                   /gene="dnaN"
FT                   /locus_tag="APL_0002"
FT   CDS_pept        1564..2667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="APL_0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73110"
FT                   /db_xref="GOA:A3MY74"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY74"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43744"
FT                   /protein_id="ABN73110.1"
FT                   /translation="MQFTITREQLLKPLQQVCGVLSSRPTLPVINNILLEIEGDRLSLT
FT                   GTDLEVELTTVATLEQAVDFAGKFTIPAKKFLDICRSLPEDSSISVQFEEDRALVRAAR
FT                   SKFNLATLPASDYPNLMDWKPEVDFSIEQSTLARLIDATQFSMANQDARYFLNGMKFET
FT                   EGNLLRTVATDGHRLAVCTMALNQELLTHSVIVPRKAVLELSRLVAVSDETVRLEIGTS
FT                   NLRVSMNGVVFTSKLIDGRFPDYRRVLPRNADRILEAETEVLKRALMRAAILSNEKFRG
FT                   VRLALSENLLKITANNPEQEEAEEIIDVAYQSPEMEVGFNVSYLLDVLNTLKCERVRFN
FT                   LVDASSSCLIEDCDNSTAEYVIMPMRL"
FT   gene            3001..4083
FT                   /gene="recF"
FT                   /locus_tag="APL_0003"
FT   CDS_pept        3001..4083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="APL_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73111"
FT                   /db_xref="GOA:A3MY75"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MY75"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P24718"
FT                   /protein_id="ABN73111.1"
FT                   /translation="MPLSRLIINNFRNLQSLDLELSPNFNFIVGHNGSGKTSLLEAIFY
FT                   LGHGRSFKSHISNRIIHYQAEDFVLHARIDEGQHQWSVGIQKKRSGDTLLKINGEDGNK
FT                   ISDLAHLLPMQVITPEGLTLLNGGPTFRRAFLDWGLFHQYTEFYSCWANLKRLLKQRNA
FT                   ALHQVRSYAELKPWDTELAKLAEIVSQMRANYAEALRPEIEKTCQFFLPELEIGVSFHQ
FT                   GWEKGTDYAEILAQGFERDKAMGYTMIGPQKADFRFRANGLPVEDVLSRGQLKLLMCVL
FT                   RLAQGEYLVAQKERQCLFLIDDFASELDPIKRELLAHRLRESGSQVFVTAITKDQLNQM
FT                   QWQESEQDSLFQVQQGMLTK"
FT   gene            complement(4139..4711)
FT                   /gene="sodC"
FT                   /locus_tag="APL_0004"
FT   CDS_pept        complement(4139..4711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="APL_0004"
FT                   /product="superoxide dismutase [Cu-Zn] precursor"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73112"
FT                   /db_xref="GOA:A3MY76"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY76"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P24702"
FT                   /protein_id="ABN73112.1"
FT                   /translation="MKLTNLALAFTLFGASAVAFAHADHDHKKADNSSVEKLVVQVQQL
FT                   DPVKGNKDVGTVEITESAYGLVFTPHLHGLAQGLHGFHIHQNPSCEPKEKDGKLVAGLG
FT                   AGGHWDPKETKQHGYPWSDNAHLGDLPALFVEHDGSATNPVLAPRLKKLDEVKGHSLMI
FT                   HEGGDNHSDHPAPLGGGGPRMACGVIK"
FT   gene            4894..6006
FT                   /gene="asd"
FT                   /locus_tag="APL_0005"
FT   CDS_pept        4894..6006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="APL_0005"
FT                   /product="Aspartate-semialdehyde dehydrogenase Asd"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73113"
FT                   /db_xref="GOA:A3MY77"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY77"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44801"
FT                   /protein_id="ABN73113.1"
FT                   /translation="MQNVGFIGWRGMVGSVLMDRMVQENDFANINPIFFTTSQAGQKAP
FT                   VFAGKDAGELKNAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWNGYWIDAASALRM
FT                   EKDAIIVLDPVNQHVISEGLKNGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWVSVATYQ
FT                   AASGAGAKNMRELLSQMGELEASVKAELANPASSILEIERKVTAKMREDSFPTDNFGAP
FT                   LAGSLIPWIDKLLESGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFT
FT                   IKLKKDLPLAEIEQIIAAHNEWVKVIPNDKETTLRELTPAKVTGTLSVPVGRLRKLAMG
FT                   PEYLAAFTVGDQLLWGAAEPVRRILVQLTK"
FT   gene            complement(6134..7264)
FT                   /gene="ompP2A"
FT                   /locus_tag="APL_0006"
FT   CDS_pept        complement(6134..7264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompP2A"
FT                   /locus_tag="APL_0006"
FT                   /product="outer membrane protein P2"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73114"
FT                   /db_xref="GOA:A3MY78"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY78"
FT                   /inference="similar to AA sequence:INSD:ABG89242.1"
FT                   /protein_id="ABN73114.1"
FT                   /translation="MKKTALALFASAFMASSASAVELFNLDSTGTKAEFIGSARLKWTS
FT                   TSAKDTYQNGAAVRNHVNKPVQNNGSRFGFRLTQQLGSGVYALGRVEWRLRGADERGVS
FT                   SSQHDLDHIYAHQLYAGLGHKQYGEVTYGNQTVITDEVKQTDIPNTLSLSDGLLVSGAR
FT                   RSVQYVYKGIEGLKVGAYYGGHNQRSNTNMDLSQDRKDVWGFGSIYNHKFDDVQSVQVA
FT                   TGFSRERFERIGSAPAYDRNAYSVGAAYTYDKTTFGVDLERRKTENQSVQGNERTEKEV
FT                   RTLVYHRLTDDWRAYGMYAYKTNRLERAIGRDNNEKKHQFMVGTEYYLPKVVDQLKTKL
FT                   FVEWQATRTKHPEAKVARGVNKSRDYTTVVGFRAYW"
FT   gene            7413..8594
FT                   /gene="lpxB"
FT                   /locus_tag="APL_0007"
FT   CDS_pept        7413..8594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="APL_0007"
FT                   /product="Lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73115"
FT                   /db_xref="GOA:A3MY79"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MY79"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMW5"
FT                   /protein_id="ABN73115.1"
FT                   /translation="MMTKEAPLIALVAGEISGDILGAGLINALKLHYPNARFIGVAGPR
FT                   MIQAGCETLFDMEELAVMGLAEVVKHLPRLLKRRKQVIETMLAEKPDIFIGIDAPDFNL
FT                   TVEEKLKASGIKTIHYVSPSVWAWRQNRVHKIARATNLVLAFLPFEKAFYDRFNVPCRF
FT                   IGHTMADTIALKPNRAEACVGLNLDEAQRYLAILVGSRASEVGFLAEPFLKAAQILKQQ
FT                   YPDLQFLVPLVNDKRIAQFEQIKAQVAPELSVHILKGNARQAMIAAEASLLASGTAALE
FT                   GMLCKSPMVVGYKMKAMTYWLAKRLVKTKYISLPNLLADEMLVPELIQDECNPENLAWY
FT                   LGNYLADDADHRKQRNELKQRFTELHKLIQCDADAQAAQAVVDVLEANTSDQN"
FT   gene            8624..9679
FT                   /gene="sohB"
FT                   /locus_tag="APL_0008"
FT   CDS_pept        8624..9679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sohB"
FT                   /locus_tag="APL_0008"
FT                   /product="putative protease SohB"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73116"
FT                   /db_xref="GOA:A3MY80"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR013703"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY80"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45315"
FT                   /protein_id="ABN73116.1"
FT                   /translation="MWKEILLNYGIFLLELLTLFGIVAVVVMLILEARKQPESGAISIT
FT                   NLTEKYQEQQKSLANFFLSEEAQKQAEKAEKKAAKEKAKAEKKRLKELGEQGEEAPKSR
FT                   LFVLNFTGDVQAHAVSSLRREIDAVISLANKEDEVLLRLESPGGVVHGYGLAASQLQRL
FT                   RTHNIPLTVAVDKVAASGGYMMACVANKIVSAPFAIIGSVGVVAQVPNIHRLLKKHEID
FT                   VDVMTAGEYKRTVTLVGENTEKGKQKFQQELEETHQLFKQFVAQNRPQLDIEKIATGEH
FT                   WFGKQALALDLVDEINTSDDLLLNAIKEKEVIELKFKQKKNLTQRLGEQVELSVENVIA
FT                   KLLHKQRSNMM"
FT   gene            9914..10372
FT                   /locus_tag="APL_0009"
FT   CDS_pept        9914..10372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73117"
FT                   /db_xref="GOA:A3MY81"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MY81"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45056"
FT                   /protein_id="ABN73117.1"
FT                   /translation="MFRGVTSISIDNKGRIAIPTRYRAELREQHEGVLVCTVDIRQPCL
FT                   LLYPLHEWETVEQKLLALSNFEPMQRRIQRVMQGFATECEMDAAGRILLSPTLRQHAQL
FT                   EQQIMLVGQLNKFEIWQDKQWQSQIAEDLALGGSAEMLNCEALKNLSL"
FT   gene            10398..11339
FT                   /gene="mraW"
FT                   /locus_tag="APL_0010"
FT   CDS_pept        10398..11339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="APL_0010"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73118"
FT                   /db_xref="GOA:A3MY82"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MY82"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VP62"
FT                   /protein_id="ABN73118.1"
FT                   /translation="MNDTVHKHITVLLHEAVDGLAIKPNGIYIDGTFGRGGHSRLILSK
FT                   LSEQGRLIATDRDPRAIAEANTINDARFQIVHTAFSAIPEVCEQLGLTGKIDGILLDLG
FT                   VSSPQLDDAERGFSFMRDGPLDMRMDTTKGLSAAEWLAQVSVDDLAWVLKTFGEERFAK
FT                   RIAQAVVSYNKSATDKISRTLQLAQIIADAVPFKDKHKHPATRSFQAIRIFINSELDEL
FT                   EKALQSALSVLAPEGRLSIISFHSLEDRMVKQFMKKNSKGMGVPKGLPILESELNKNIP
FT                   LKIIGKAIMPSEAEIEANPRSRSAVLRIAEKR"
FT   gene            11352..11666
FT                   /gene="ftsL"
FT                   /locus_tag="APL_0011"
FT   CDS_pept        11352..11666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="APL_0011"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73119"
FT                   /db_xref="GOA:A3MY83"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY83"
FT                   /inference="similar to AA sequence:RefSeq:NP_872837.1"
FT                   /protein_id="ABN73119.1"
FT                   /translation="MASNERYPLHQIILDDLTAHNKVALILIIAVVATAIGTIWITHQT
FT                   RLLTAEQGKLVQAQRKLENQYIHLQLEENAKSQKSRVEAAAASFGLQSIKKEQEVILVE
FT                   "
FT   gene            11670..13730
FT                   /gene="ftsI"
FT                   /locus_tag="APL_0012"
FT   CDS_pept        11670..13730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="APL_0012"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73120"
FT                   /db_xref="GOA:A3MY84"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY84"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45059"
FT                   /protein_id="ABN73120.1"
FT                   /translation="MAKSVKLKRKPVAIEPNTEVKKQTNTKNEPSYLPIRFGVVGFFIL
FT                   VMAGMLIAKAAHIQLFDSERLINEANNRSLRTKELPFTRGRILDRNGRFLSISVPMYSL
FT                   TLDPREYFDSKLRRSPERWKLLAMEMGASKSKIEKNVNDFIEKKNTSKEKVAFDPRSIL
FT                   NTKSEDYWTLLAQSTGLDYNTLIQSVRNNPSSAFLMQEISASQLERSKLEAIAKATGEK
FT                   YNDLMARLYKAVRQRFIYIARHEPESIANYAQELKIDGMVLKAESRRFYPLAEEASQLI
FT                   GFTDIDDVHGTEGLERSFDSLLIGKNGRQVIRKDARGNVIENIRDEKQYDPQDVMLSID
FT                   EELQSEVYKKIKEAVIANNAESGTAVLVDVQTGEILAMANAPSFNPNKRDSFKPELMRN
FT                   RAITDTFEPGSTVKPLVVLTALQNGATYRDEVINTRPFVVNGHTIKDVAPRESLSLTGI
FT                   LQKSSNIGVSRLALRMPSTALVDTYSKVGFGKDTGLGLGEQKGTNGDRKRWSDIERATM
FT                   AYGYGLNITPLQLARAYATLGSFGIYRPLSITKVDPPVIGERVLPEKITRDVVHMMESV
FT                   AQKGEGGQKAMVEGYRVAVKTGTARKLEKGQYVEKYIAYTAGVAPASDPRFALVVLINE
FT                   PKAGQYYGGSVSAPLFSSIMGYTLKTRNIKPDNLTDTESAVREIKLEQKVN"
FT   gene            13754..15256
FT                   /gene="murE"
FT                   /locus_tag="APL_0013"
FT   CDS_pept        13754..15256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="APL_0013"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73121"
FT                   /db_xref="GOA:A3MY85"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MY85"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VP59"
FT                   /protein_id="ABN73121.1"
FT                   /translation="MKRLLPFLTELDAWVTELKPLKQMTLDSRQVDEGDLFVALKGHQV
FT                   DGRRFIQKAIEQGAALVLAEADEGQDEIELDAKFAKYNLDRTACKVVLVPNLARILSEI
FT                   AGAFYANPSEKLTLVGVTGTNGKTTSAQLLAQWHNLLGGKSAVMGTIGNGLYGKVQEAA
FT                   NTTGSAIEVQRNLADFVEMGADFCAMEVSSHGLAQYRAEALSYDLAVFTNLSRDHLDYH
FT                   KTMEEYAQAKFRLFSELDTKAQVLNADDEVGREWLAKLPDAVAVSTDASFSSEHKFVKA
FT                   TDVSFSLQGVKIAFESSWGNGELNSRLIGAFNVNNLLTALAGLLVLGHDLPKLIETAPL
FT                   LQGVAGRMECVVSQKNPQNRPLVLVDYAHTPDALEKALQAARLHTEGELYCIFGCGGDR
FT                   DAGKRPMMAAIAEELADKVIATDDNPRTEDNAKIMADILNGFVQVEKVQVIHDREQAIK
FT                   TAIEQANEKDVILIAGKGHEDYQIIGTTKHHFSDQETAAKYL"
FT   gene            15471..16865
FT                   /gene="murF"
FT                   /locus_tag="APL_0014"
FT   CDS_pept        15471..16865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="APL_0014"
FT                   /product="UDP-MurNAc-pentapeptide synthetase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73122"
FT                   /db_xref="GOA:A3MY86"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY86"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45061"
FT                   /protein_id="ABN73122.1"
FT                   /translation="MIKLTTNEIAGILNAQLIGDGNVLVETTSTDTRQAVENGLFFALK
FT                   GENFDAHHYLANAVEQGSVAVVVERECEISVPQIVVKDTRLALGELAKWLKAKLNPKTV
FT                   AMTGSSGKTTVKEMTAKILQKMTACEDEVLYTFGNLNNDLGVPMTLLRLTPQHKFAVVE
FT                   LGANHIGEIAYTTEITQPDACLVNNVAAAHLEGFGSLEGVAQAKGEIYRGLKAGGKAIV
FT                   NQAFYYPQWQKEIGEHELQSFSYIGSDQDSYADFWAENVELGLAGSRFTLHSPQGEIEI
FT                   NLPYLGAHNISNALAATSLSMAVGADLQAVKSGLEQRSQVKGRLYPVEVNDHCLFIDDT
FT                   YNANVDSMKSAVSVLKNYPAFRIFAVGDMAELGGESEACHQQVADFVREANLDLVVSFG
FT                   KQSAVISHDTAHHFTDKQAMHDFLLPIISQKIAEKQPLVLLAKGSRSQKMETLISALCL
FT                   SLGVSF"
FT   gene            16962..18044
FT                   /gene="mraY"
FT                   /locus_tag="APL_0015"
FT   CDS_pept        16962..18044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="APL_0015"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73123"
FT                   /db_xref="GOA:A3MY87"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MY87"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VP57"
FT                   /protein_id="ABN73123.1"
FT                   /translation="MLVWLAEYLVQYNTAFNVVSYITFRAIMALLTAMGIGLWIGPEVI
FT                   RRLQLLKFGQEVRNDGPESHFKKRGTPTMGGIMILIAIGVSTLLWADLRNSYIWFVLFV
FT                   LFGYGAVGFVDDYWKIKRKNTDGLIARWKYFWLSVIALIAVFGIYAVGKDTAATQLVVP
FT                   FFKDVMPQLGIFFIILSYFVIVGTSNAVNLTDGLDGLAIVPTIMVASAFALIAWATGNF
FT                   NFAQYLHIPFVPNAGELVILCTAIVGAGLGFLWYNTYPAQVFMGDVGSLSLGGALGTIA
FT                   VLVRQELLLVIMGGVFVVEALSVILQVGSYKLRQKRIFRMAPIHHHFELKGWPEPRVIV
FT                   RFWIITLMLVLIGLVTLKLR"
FT   gene            18128..19438
FT                   /gene="murD"
FT                   /locus_tag="APL_0016"
FT   CDS_pept        18128..19438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="APL_0016"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
FT                   synthetase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73124"
FT                   /db_xref="GOA:A3MY88"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY88"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VP56"
FT                   /protein_id="ABN73124.1"
FT                   /translation="MQNQYKDKVITVIGLGKTGLSCVEFLADKQAKVQVIDTREKPAGA
FT                   DQLPADVPLHTGGLNSEWLLASDLIVISPGLALATPEIQQAINAGMEVVGDIELFVREA
FT                   KAPIIAITGANGKSTVTTLVTEMAKQAGIKVGMGGNIGVPVLSLLNDEYELFVLELSSF
FT                   QLETTSSLNAVAATILNISEDHMDRYNNSLEEYRLAKLRIYDNAENVIVNGEDRLTYPL
FT                   ETQAVKKLIRFAEHNAEYTMRNGILYSGDDAIIPTKEMLISGRHNEMNSLAAMALAEAA
FT                   GIPREGIVKALQVYGGLNHRFQAVKTNDGVRWVNDSKATNVGSTVAALNGLQVAGTLYL
FT                   LLGGDGKAADFSELKPLINKPNIVCYCFGQDGAQLAALSSQSVLVETMQQAIEQIRPQL
FT                   KKGDMVLLSPACASLDQFKNFEERGQVFVKLAQEVTA"
FT   gene            19440..20618
FT                   /gene="ftsW"
FT                   /locus_tag="APL_0017"
FT   CDS_pept        19440..20618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="APL_0017"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73125"
FT                   /db_xref="GOA:A3MY89"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY89"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45064"
FT                   /protein_id="ABN73125.1"
FT                   /translation="MLERLKTEWDKWVRLTPANSLYDRTLLWLFFGLLVIGFIMVTSAS
FT                   IPVSTRLNNDPFYFAVRDGVYLAAALFAFVTIVQIPTESWEKRNVLFFLVSLAFLVIVL
FT                   IFGRSINGAVRWIPLGPVNFQPAELAKLAIICYFSSFYVRKYDEMRTKRLSFIRPMVIL
FT                   SIFGFLLLLQPDLGSTFVLFMLTFAMLFIMGARVMQFLFLGVTGILLFAFLVLTSEYRL
FT                   KRVTSFMDPFADAYGDGFQLSNSQMAFGQGEFWGQGLGNSIQKLEYLPEAHTDFVMAVV
FT                   GEEFGFIGIVAIVILLSVLSLRALKISRDALKLEARFRGFFAFGIAIWIFIQGFVNLGV
FT                   ASGLLPTKGLTFPLVSYGGSSLVIMSIAIAVLLRIDYENRLELVGHAQIKES"
FT   gene            20773..21828
FT                   /gene="murG"
FT                   /locus_tag="APL_0018"
FT   CDS_pept        20773..21828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="APL_0018"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73126"
FT                   /db_xref="GOA:A3MY90"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MY90"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7U336"
FT                   /protein_id="ABN73126.1"
FT                   /translation="MAKKLLVMAGGTGGHVFPAIAVARELQKQGWEIRWLGTKDRMEAD
FT                   LVPKHGIPIEFIQISGLKGKGIGALLKAPFAIFKAVMQARKIIKNYQPDAVLGMGGYVS
FT                   GPGGIAAKLCGVPVILHEQNAVAGLTNVWLSKIARRVLQAFPTAFPNAEVVGNPVREDL
FT                   AQLEAPEIRFAERGYPINILVMGGSQGARVINQTVPEVAKQLGNNVFISHQVGKGNLGG
FT                   VEEIYQATGNGIAAEFIDDMAQAYSWADLVICRSGALTVCEIAAAGLPAIFVPYQHKDR
FT                   QQYLNATYLADGGAAIIIEQQDFTPQTLLNVLQPLIADRRKLTEMAVKARAKATPTAAQ
FT                   RVAEVIIEQAK"
FT   gene            21880..23307
FT                   /gene="murC"
FT                   /locus_tag="APL_0019"
FT   CDS_pept        21880..23307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="APL_0019"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73127"
FT                   /db_xref="GOA:A3MY91"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MY91"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q4QLF7"
FT                   /protein_id="ABN73127.1"
FT                   /translation="MKNFQDKIKKLVPEMRRVNQIHFIGIGGAGMSGIAEVLLNEGYQI
FT                   SGSDIAEGPVTKRLAEAGAKVFIGHQAENVAGASVVVASSAIDDSNPEVRAAKEARIPV
FT                   IQRAQMLAEIMRFRHGIAVAGTHGKTTTTAMISMIYTEAKLDPTFVNGGLVKSAGKNAH
FT                   LGASRYLIAEADESDASFLHLQPMVSVVTNIEPDHMDTYGGDFEQMKATYVKFLRNLPF
FT                   YGLAVMCADDETVIEIAPQVGRQVLTYGFSEKADYRIEDYQQTGFQGHYTVVCPNGERI
FT                   DVLLNVPGKHNALNATAALAVAKEEGIANEAILAALADFQGAGRRFDQLGSFIRPNGKV
FT                   MLVDDYGHHPTEVDVTIKAARSGWENKRVVMIFQPHRYSRTRDLFDDFVQVLSQVDALI
FT                   MLEVYAAGEAPIVGADSKALCRSIRNLGKVDPILVSDTDQLGEVLDQIIQDGDLILAQG
FT                   AGSVSRISRGLAESWKA"
FT   gene            23415..24326
FT                   /gene="ddlB"
FT                   /locus_tag="APL_0020"
FT   CDS_pept        23415..24326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="APL_0020"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73128"
FT                   /db_xref="GOA:A3MY92"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MY92"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMY2"
FT                   /protein_id="ABN73128.1"
FT                   /translation="MSIKDEKIAVLFGGVSQEREVSLNSGAAVTEALKSLGYNVEGIDT
FT                   KDFPIEKLKEKGIQRVFNILHGGIGENGVLQGALEQMGIPYTGCGVMASAVTLDKFRTK
FT                   LMWQAVGLPTADMVVVRRGEAVDSEQIIAKLGLPVFVKPSSEGSSVGVTKVKTVEQLLP
FT                   AVEEALKFDSIVLVEAFLAGKEYSVPVLDGQVLPAVQIIPEGEFYDYHAKYISDNTQYL
FT                   VPALSDDRQAEVAELVKAAYEVVGCRGWSRIDVMEDANGHFNLVEVNTCPGMTSHSIFP
FT                   KSAATVGIPFEKLVERVLELSA"
FT   gene            24467..25120
FT                   /gene="ftsQ"
FT                   /locus_tag="APL_0021"
FT   CDS_pept        24467..25120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="APL_0021"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73129"
FT                   /db_xref="GOA:A3MY93"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY93"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45067"
FT                   /protein_id="ABN73129.1"
FT                   /translation="MYSNWHTWLESLDRSPIRAYALTHKTRFTTNADIRETLSQKPALK
FT                   GYFGQDIQDVKAKLLAISWVRDVVVRKVYPDRLSITLIEHNPVAVWNDVNFLSEQGIVF
FT                   SLPPDRIDKTGFPMLYGPDTEGKVVLEAWSKIKADLKARNLDLSSVSVDNRGSWTITLS
FT                   NNVELRLGRGEWTPKIDRFVTIFPEIDVPEGKKLAYVDLRYEHGAAVGFSPLPK"
FT   gene            25146..26420
FT                   /gene="ftsA"
FT                   /locus_tag="APL_0022"
FT   CDS_pept        25146..26420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="APL_0022"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73130"
FT                   /db_xref="GOA:A3MY94"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY94"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45068"
FT                   /protein_id="ABN73130.1"
FT                   /translation="MTKIAESKIIVGLDIGTSKVVAVVGEVLPDGVINVIGSGSCPAKG
FT                   VDRGGVIDLDAAVNSIQRAIEQAESVSDCQIIGVTLAISGQHITALNESGTVPLSGTVT
FT                   NEDIDAAIHIARSIKLPDGLETLHIIPQEYKVDRLPATKNPVGLSGMRLQAQAHIVACH
FT                   QDWLRNLKNAVERAKLKVDQVVFSGLASSYSVLTEDEKELGVCLIDIGGGTMDILVYTD
FT                   GALRFSKVIPFAGNNVTDYIAQVFTTSRNEAESIKINYGSAVNPPTHNADKKIEVAGLG
FT                   GRMPRTFTKAQVATVTSQCYSDLLKVVENELVQLRHELLQKGIKQELIAGFVLTGGGSQ
FT                   IEDIVECAREIFGSQVRVGYPLNITGLTDYVNKPQYATVLGLLQYSHYNSDEKGNGEIS
FT                   EKVDSILDILSRGLKKVVNVARSNF"
FT   gene            26459..27670
FT                   /gene="ftsZ"
FT                   /locus_tag="APL_0023"
FT   CDS_pept        26459..27670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="APL_0023"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73131"
FT                   /db_xref="GOA:A3MY95"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY95"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P0A9A8"
FT                   /protein_id="ABN73131.1"
FT                   /translation="MFEPIYETTQDAVIKVVGVGGGGGNALNHMVDGNLNNEGVGGVEF
FT                   FSVNTDAQVLRTSSVRQTIQIGANITKGLGAGANPNVGRQAAEEDREALSNMLAGADMV
FT                   FISAGMGGGTGTGAAPVIADIAKSQGSLTVAIVTKPFRFEGNKRMNYAEQGIQELSKHV
FT                   DSLIIIPNDKLLKVLPKNTKMMDAFKAANDILRNAVLGITDMITSPGLINVDFADVKTV
FT                   MSEMGRAMMGTGIAEGEDRAEHAAHDAVASPLLEDVDLSGAKGILVSISSGLDIELNEV
FT                   DVIMDYIHSFAAPDATIVFGTSVYPEMEGKLRVTLVATGIGQAEELTLPRATVVPQPMQ
FT                   QPMQQQGYQQQAQQPQQPAFAQQGYAQPAQFAQPQQAAPKPQQVDSSQVWSPNSIPGFM
FT                   RNGQ"
FT   gene            27704..28624
FT                   /gene="lpxC"
FT                   /locus_tag="APL_0024"
FT   CDS_pept        27704..28624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="APL_0024"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73132"
FT                   /db_xref="GOA:A3MY96"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MY96"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMY6"
FT                   /protein_id="ABN73132.1"
FT                   /translation="MIKQRTLKQATKVTGIGLHSGKKVTLTLRPAPANTGIVYARTDLE
FT                   PAVYFPASAESIRDTQLCTCMINDDGVRISTVEHLNAAMASLGLDNLIVEVDAPEIPIM
FT                   DGSASPFIYLLLDAGIEEQDAPKKFIRIRETVRVEEGDKWAEMKPYSKGLKLDFTIDFS
FT                   HPMISKDVRNFKMELSAENFIHKISRARTFTFMKDVEYLQSIGLALGGSLDNAIVLDEY
FT                   RILNEEGLRYKDELVKHKMLDSIGDLFMCGYNILGDFSAYKSGHGLNNKLLRAILANEN
FT                   AWEFVTFEDKEQAPEGYRIGEQVFI"
FT   gene            28786..30459
FT                   /gene="recN"
FT                   /locus_tag="APL_0025"
FT   CDS_pept        28786..30459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="APL_0025"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73133"
FT                   /db_xref="GOA:A3MY97"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY97"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44496"
FT                   /protein_id="ABN73133.1"
FT                   /translation="MLTHLTVNNFAIVRHLTLELNEGMSVITGETGAGKSIAIDALSLC
FT                   LGYRSESSMIRHGADKADITATFSMQPTSPAYSWLQQHELLDEDNPQECILRRMINQEG
FT                   RSKAFVNNRPLPISQLRELGQYLIHLNGQHAPQLLLKSEYQLEVLDNYAGIHNLLNEMS
FT                   SQYQRWKKLHQQVKNFRQQCQENEARKQLLQYQVDELDEFAIKQGEFEEMEETHSRLSN
FT                   SEALTALSQEVTDLLSESELNVDSMLYKAIRHLEDLVEVDSRYQSALNMLNESLIQVQE
FT                   ASSEVSDLAGKIEQDPDLLNELDIRISKTLQLARKHHVLPENLWQHHEFIQQELQKLVD
FT                   FAGNEEQLIADEQAAHQQSIQLAEQIYQKRLEAGKKLAEQVTAQIKRLSMENGEFFIDV
FT                   QHDAKRLSSNGADDVEFNLRSNLGQQAQPLAKIASGGELSRISLAVQVLTANKLSTPTI
FT                   IFDEVDVGISGLTATTVGKLLRQLGKKCQVLCVTHLPQVASYGHHHFNVQKYVENNQTE
FT                   TQMSLLTQAERVQTLARLLGGSKITDTVLANAQEMLDLVE"
FT   gene            complement(30601..32004)
FT                   /locus_tag="APL_0026"
FT   CDS_pept        complement(30601..32004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0026"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73134"
FT                   /db_xref="GOA:A3MY98"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY98"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P33916"
FT                   /protein_id="ABN73134.1"
FT                   /translation="MALLRIENVGVKTTTGLTLVEPISLSLEQGKNITILGETGSGKSL
FT                   LIQAIMGALPEGLEASGQIFVENGKTENMQLESLWGRTLVMLPQEPRRSLDPIMTIGKQ
FT                   LWESFTFVAKKDKQAAKNEGKKALEHLGLKAWETAYPHQLSGGMAQRASFAVATAAGGK
FT                   ILLADEPTKGLDPKSKANVIQLLKQAYQQQGGLLTITHDIDVAEQLGGEILVMKKGQLL
FT                   EKGAAETLLADPQHPYTKALIAADPIHWQAVENSQNFAKNQPLVSVKNLSVARGKRTLF
FT                   SGLSFGLHQGEILGVVGHSGIGKSTLADVLCGLLKPKSGEVIWHSRQHKKHQVLKLYQD
FT                   PPEAFAPTVSLQTLLDDVINKHKLDRSQIPTLLQQLALAPEILARNAENVSGGELQRVA
FT                   ILRALLLEPVLLFADEVTSRLDPITQKETIELLINQCRQRKCALVIVSHDPYLIEKSCD
FT                   KVIDLTQFV"
FT   gene            complement(32004..32789)
FT                   /locus_tag="APL_0027"
FT   CDS_pept        complement(32004..32789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0027"
FT                   /product="nickel transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73135"
FT                   /db_xref="GOA:A3MY99"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MY99"
FT                   /inference="similar to AA sequence:INSD:ABG89218.1"
FT                   /protein_id="ABN73135.1"
FT                   /translation="MNKMTFSQKIGAIILTILLAFAFLQPYFYPMDIGFQDLGNMLAKP
FT                   DEFAWLGTDHLGRDMLARLASAIRLSFGLSLFSVFCALVAGLLFGILAGFFGGWLDRLF
FT                   SFICDLVMALPGLLLILLFASLSPGSFWTLYLGIALVMWVEFFRVIRAVSQTLASSAEI
FT                   ESSRLMGMGLFYSFKRHLLPRLLPLLVTLSAFSLGNAILALATLGFVNVGLRPPTAELG
FT                   LMMTELFPYYYEAPWIFMQPVVAVFFMVLSLQLLSGRVK"
FT   gene            complement(32792..33739)
FT                   /locus_tag="APL_0028"
FT   CDS_pept        complement(32792..33739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0028"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73136"
FT                   /db_xref="GOA:A3MYA0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYA0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P75798"
FT                   /protein_id="ABN73136.1"
FT                   /translation="MLKIIFRRLLQIILVIWSVGTLTFILTRQLSGDMAYRIAASRYGY
FT                   DQVDSAAADLVRTELGLDQPWWQSYGNWLLDLLQLNLGKSLVTGDSVWSEIAHQFGHTL
FT                   SLALVALVMAIMIGPILGVLAARKENGFFDRFTLVFSTLFRSVPAFIIAIGLITLFSAT
FT                   LRWLPAGGYGKWQHFVLPAFTLALGLSAVSVRVTRAAMLQVKQSEYYQFARLKGLSKWQ
FT                   TFTRHGIRNIAIPVIAYHAVQLVYLIEGVVVVESLFAWPGSGHALVHAIIARDVPMIQG
FT                   TSLVMGGLFVLLNMCADMLSAWIDPRITHKRHGE"
FT   gene            complement(33833..35407)
FT                   /locus_tag="APL_0029"
FT   CDS_pept        complement(33833..35407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0029"
FT                   /product="ABC transporter periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73137"
FT                   /db_xref="GOA:A3MYA1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYA1"
FT                   /inference="similar to AA sequence:INSD:ABG89227.1"
FT                   /protein_id="ABN73137.1"
FT                   /translation="MKKWLLPLLATTLFTVGCEDKSVTQNNPQNNKESEVKNLKNNELT
FT                   QVTVIAPWELNSLHPTQSGVIFQRMNLAETLVEANEKGELIPGLATEWQSNEDATEWTF
FT                   TLRDATFHNGEKVNAQTVAKNFNLLMAQPSILQKAFIQEISALGDNQVKFKLTKSFVPF
FT                   PSFLTHYSTIILADEAFNEKNEVVKLIGTGAFKATKVEAPQKIEAVRFEQYWGEKPKVL
FT                   HANYLASSRSETRVLMAQSDVSSLVFNLDTASVARLKTDPNLTVTSGSIARTIQMKMDA
FT                   AKPFFKDLTIRQALSQAINRKAIAEQVLKIKDGAADQILPKALADWRVENKDESVDIAK
FT                   IKQNLTSAGYQFNSEGKLTDKEGKPFSFTLRTFSDRPELPIIATILQAQWREIGIDVNV
FT                   SVGNSSEIPAGHKDGSLEMALYALNYGKTIDPFGVIVQDYAKGGSDWGVMNWSNEQLAQ
FT                   TLEKIETERDPQKAKQLKQTVSRIIHDELPIIPIVYYQQNVATHNEMKGVTLDTFERRF
FT                   FLEKLTK"
FT   gene            complement(35601..37181)
FT                   /gene="prfC"
FT                   /locus_tag="APL_0030"
FT   CDS_pept        complement(35601..37181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="APL_0030"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73138"
FT                   /db_xref="GOA:A3MYA2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYA2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q4QJL3"
FT                   /protein_id="ABN73138.1"
FT                   /translation="MSYPQEVNKRRTFAIISHPDAGKTTITEKVLLYGNAIQTAGSVKG
FT                   KGSSAHAKSDWMEMEKQRGISITTSVMQFPYNNCLVNLLDTPGHEDFSEDTYRTLTAVD
FT                   SCLMVIDSAKGVEERTIKLIEVTRLRDTPILTFMNKLDRDIRDPMELLDEVESVLKIRC
FT                   APITWPIGCGKLFKGVYHIAKDETYLYQSGQGSTIQEVRIVKGLSSPELDAAVGDDLAN
FT                   QLREELELVQGASNEFDHEAFINGELTPVFFGTALGNFGVDHFLDGLTEWAPKPQARQT
FT                   DVRTVESSEEKFSGFVFKIQANMDPKHRDRVAFMRVVSGKYEKGMKLKHVRIGKDVVIS
FT                   DALTFMAGDRAHAEEAYAGDIIGLHNHGTIQIGDTFTQGEVMKFTGIPNFAPELFRRIR
FT                   LKDPLKQKQLLKGLVQLSEEGAVQVFRPLMNNDLIVGAVGVLQFDVVVSRLKTEYNVEA
FT                   IYEAVNVATARWVECGDAKKFEEFKRKNEQNLALDGGDNLTYIAPTMVNLNLAQERYPD
FT                   INFFKTREH"
FT   gene            37364..37831
FT                   /locus_tag="APL_0031"
FT   CDS_pept        37364..37831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0031"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73139"
FT                   /db_xref="GOA:A3MYA3"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYA3"
FT                   /inference="similar to AA sequence:UniProtKB/TrEMBL:Q81EH6"
FT                   /protein_id="ABN73139.1"
FT                   /translation="MEWFIYALRNTFNYQGRAKRAEFIWFILIYELSDWAIVLIAKLAF
FT                   ALRLIHLSDDLHILNSLLDILLLLPMSSVTVRRLHDLGYSGWWQSYLLTMNIVAMILTY
FT                   LIPKHSLNAMLDTKFGTFWSLLLVIYFIQIFFLIFKRGQPFTNRYGKQPDS"
FT   gene            37878..38393
FT                   /gene="yhaH"
FT                   /locus_tag="APL_0032"
FT   CDS_pept        37878..38393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhaH"
FT                   /locus_tag="APL_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73140"
FT                   /db_xref="GOA:A3MYA4"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYA4"
FT                   /inference="similar to AA sequence:RefSeq:ZP_01219802.1"
FT                   /protein_id="ABN73140.1"
FT                   /translation="MNWFLLVLKKTFNFKDRARRREYGWFYLINILIVITFNILVSVCV
FT                   AIGLEELGIGLNSLSYLYQLLTAVTAISLTARRLHDLGWSGWWQLLPYAVAVMFGIATI
FT                   FSLEKELGGAITGTEYALYGSTVFGGIAVIVFSLLLLFKDGQRFSNKYGEDPKAVKNSN
FT                   EVTNSLTV"
FT   gene            38520..39104
FT                   /gene="pth"
FT                   /locus_tag="APL_0033"
FT   CDS_pept        38520..39104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="APL_0033"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73141"
FT                   /db_xref="GOA:A3MYA5"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYA5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMI1"
FT                   /protein_id="ABN73141.1"
FT                   /translation="MSQIKLIVGLANPGTKYEDTRHNAGEWLINEIARQFNVSLKEEAK
FT                   FFGKVAKINAAGGEVRLLVPTTFMNLSGKAVGALANFYRIKPEEILVAHDELDLPPGVA
FT                   KIKQGGGHGGHNGLKDIIASLGNSNNFYRVRIGIGHPGSKELVAGYVLGKPSPQDQEKI
FT                   NAAVDEAGRCVDLLLKDGITKATNRLNAFKA"
FT   gene            39213..40304
FT                   /gene="engD"
FT                   /locus_tag="APL_0034"
FT   CDS_pept        39213..40304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engD"
FT                   /locus_tag="APL_0034"
FT                   /product="GTP-dependent nucleic acid-binding protein EngD"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73142"
FT                   /db_xref="GOA:A3MYA6"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYA6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMI2"
FT                   /protein_id="ABN73142.1"
FT                   /translation="MGFKCGIVGLPNVGKSTLFNALTKAGIEAANYPFCTIEPNTGVVP
FT                   MPDPRLDALAEIVKPERVLPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVV
FT                   RCFENDDIVHVAGKIDPADDIEIINTELALADLDSCERAIQRLQKRAKGGDKDAKFELS
FT                   IMEKILPVLENAGMIRSVDLDKDELHAIKGYNFLTLKPTMYIANVNEDGFENNPYLDRV
FT                   REIAEKEGAVVVPVCAAIESEIAELDDEEKVEFLQDLGIEEPGLNRVIRAGYRLLNLQT
FT                   YFTAGVKEVRAWTVSVGATAPKAAAVIHTDFEKGFIRAEVIAYDDFIQFKGENGAKDAG
FT                   KWRLEGKDYIVQDGDVMHFRFNV"
FT   gene            40376..40813
FT                   /locus_tag="APL_0035"
FT   CDS_pept        40376..40813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0035"
FT                   /product="putative protein-S-isoprenylcysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73143"
FT                   /db_xref="GOA:A3MYA7"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYA7"
FT                   /inference="similar to AA sequence:INSD:EAO50868.1"
FT                   /protein_id="ABN73143.1"
FT                   /translation="MELKLPPPLLFILSAILIYFLPQAEVYFIPKAFGYLFLLLSAIVG
FT                   LMSVYAFFKEKTAFTPRDPTQTNKLVVQGIYRVSRNPMYLSLVLALIAWGIWLNSYFAI
FT                   LVIAGFMWYVDRFQIIPEERVLVQKFGKDFTDYQTKVRKWL"
FT   gene            complement(40863..41138)
FT                   /locus_tag="APL_0036"
FT   CDS_pept        complement(40863..41138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73144"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYA8"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ABN73144.1"
FT                   /translation="MKKFSLALLAAVTLAACTQDFYADKGNATVLNSKNLSQDAVELTV
FT                   QKDSGEIVTLTRKNDPHAAVGARVNLSEKTEQKDSDLTTIRRYEFK"
FT   gene            complement(41169..41633)
FT                   /gene="slyB"
FT                   /locus_tag="APL_0037"
FT   CDS_pept        complement(41169..41633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyB"
FT                   /locus_tag="APL_0037"
FT                   /product="outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73145"
FT                   /db_xref="GOA:A3MYA9"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYA9"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00731806.1"
FT                   /protein_id="ABN73145.1"
FT                   /translation="MKKFSLAAALFTSLTLVGCANTDIYSGSVYNSSQAKEARSISYGT
FT                   IVSVRDVKIQADNQGVLGTLGGGALGGITGSTIGGGSGRAVATAVGAIAGAVIGSTIEE
FT                   KVSQVSSLEMVIRKDDGKEIVVVQKKEDGFVPGKRVRIVGSNSDLNVSVL"
FT   gene            complement(41660..42256)
FT                   /locus_tag="APL_0038"
FT   CDS_pept        complement(41660..42256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73146"
FT                   /db_xref="InterPro:IPR010393"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYB0"
FT                   /inference="similar to AA sequence:RefSeq:NP_872859.1"
FT                   /protein_id="ABN73146.1"
FT                   /translation="MIQENAKFYEKMTACFGDFSEFQQKIQQIAHLAMLDLSQFEIDHL
FT                   AVRMNEWQTAERWRSILLENSELLKESEVNGRPIALIKLNQPLSFLGQSVSIIELPFPK
FT                   DKVYPQQGWEHIEIVYPMKPNETVEQWVQRTLKQFHLTINANLDLKISQPKVAGERLPN
FT                   PSIAISLKNKTYCNPCCLKLHPYGITEIIHSGSNF"
FT   gene            42435..44081
FT                   /gene="argS"
FT                   /locus_tag="APL_0039"
FT   CDS_pept        42435..44081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="APL_0039"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73147"
FT                   /db_xref="GOA:A3MYB1"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYB1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VP38"
FT                   /protein_id="ABN73147.1"
FT                   /translation="MRQSGKPEFGDYQANGAMGAAKKLGMNPREFAQKILDNADLNGIA
FT                   DKLEIAGPGFINIFLNQAWLANQASEALQAVNFGIKTANPQTIVIDYSSPNVAKEMHVG
FT                   HLRSTIIGDAVVRTLEFLGNKVIRANHVGDWGTQFGMLIAYLEKMENEHASQMELSDLE
FT                   AFYRAAKEHYDSDEVFAEKARNYVVKLQSGDEYCRTMWKKLVDITMHHNQENYDRLNVT
FT                   LSEKDVMGESLYNPMLPEIVADLKAKGLAVEDDGALVVFLEEFKNKDGDPMGVIVQKKD
FT                   GGFLYTTTDIAAAKYRYETLNADRVLVFSDSRQAQHMQQAWLITRKAGYVPESFSLEHP
FT                   FFGMMLGKDGKPFKTRSGGTVKLKDLLDEAVERADKLISERSTDLTAEEKAAVVEAVAI
FT                   GSVKYSDLSKNRTTDYVFDWDNMLTFEGNTAPYMQYAYTRIRSIFNRAGIDVNGLNGEI
FT                   NLTEDKERALAVKLLQFEEALNGVAKDGMPNILCQYLYELAGAFSSFYEACPMLNAEEN
FT                   VKNSRLSLAALTAKTLKQGLDLLGIKTIEKM"
FT   gene            44225..45400
FT                   /gene="yhbZ"
FT                   /locus_tag="APL_0040"
FT   CDS_pept        44225..45400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbZ"
FT                   /locus_tag="APL_0040"
FT                   /product="hypothetical GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73148"
FT                   /db_xref="GOA:A3MYB2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYB2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P42641"
FT                   /protein_id="ABN73148.1"
FT                   /translation="MKFIDEALIRVEAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   YLIADENLNTLIDYRFEKRYAAGRGENGRSAGCTGHRGNDITLRVPVGTRAIDNDTQEV
FT                   IGDLTKHGMKMLVAKGGYHGLGNTRFKSSVNRAPRQKTNGTPGEKRDLLLELMLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVARVGADRSFVVADIPGLIEGAA
FT                   DGAGLGIRFLKHLERCRVLIHLVDIMPIDESDPAQNISVIESELYQYSEKLSEKPTWLV
FT                   FNKIDTIGEEEAQARAQEIAEQIGWEGDYYLISAATGQNVQNLTRDIMDFIEANPREVA
FT                   EENTEADEVKFKWDDYHQQAMQNPIEEDWDNFDDDWSEEDEEGVEFVYTRS"
FT   gene            45475..46086
FT                   /locus_tag="APL_0041"
FT   CDS_pept        45475..46086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73149"
FT                   /db_xref="InterPro:IPR019722"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYB3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44013"
FT                   /protein_id="ABN73149.1"
FT                   /translation="MLNAKSCELFEIPFFQFAQMKKYCPEDIPLIKANYKSEWQKWKAL
FT                   HLEVARQLGMPFAEPHIEKWCNGWQVRAHFFAYYKYEFNRNSAAILSVILNRRCLQVCL
FT                   DWHCYRADRSQISLAQYNQWLEKLDRLQYQDFEVWHGAESEYADFKTLKETDSLSLENE
FT                   EDFWCIGRNIEKADLDQIDIAEFIYQTIRKLLPLYEVCHQ"
FT   gene            complement(46186..46929)
FT                   /gene="rlmB"
FT                   /locus_tag="APL_0042"
FT   CDS_pept        complement(46186..46929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmB"
FT                   /locus_tag="APL_0042"
FT                   /product="23S rRNA (guanosine-2'-O-)-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73150"
FT                   /db_xref="GOA:A3MYB4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYB4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VP36"
FT                   /protein_id="ABN73150.1"
FT                   /translation="MSEQIYGIHAVKAFLDNAPERLIEVLVLKGREDKRLTPLLNELQR
FT                   LGISVQQVNRQTLDNKAQGEVHQGIIAKVVPQKELNEHDLDAILAQKQNPFLLILDGVT
FT                   DPHNLGACLRTADAAGVDAVIVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRE
FT                   LQEQHNIWIVGTAGEATSGIYQAKLTGAIALVMGAEGDGMRRLTREHCDQLISIPMAGS
FT                   VSSLNVSVATGVCLFEIVRQKLAAQ"
FT   gene            complement(47008..48372)
FT                   /gene="pssA"
FT                   /locus_tag="APL_0043"
FT   CDS_pept        complement(47008..48372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="APL_0043"
FT                   /product="phosphatidylserine synthase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73151"
FT                   /db_xref="GOA:A3MYB5"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYB5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44704"
FT                   /protein_id="ABN73151.1"
FT                   /translation="MLILNKPNHAKKQLEALRFIPQTADKVEFLSDSREFKERILTLIK
FT                   NAKKRIYLTALYFEQDEAGQEVLTALYQAKRDNPTLDIKVLVDWHRAQRGRIGEETTSS
FT                   NADWYVKIKQQYNLPTDQEIQFWGVPVNRKELFGVLHLKGFIFDDTLLYSGASINNVYL
FT                   QQFERYRYDRYHVIENKALTDAIVEFADTHILQHDAVNRLDNANRPKTHEIRPLIKAFR
FT                   KYLSAQSYIFNGQPQSDQLSLSPLVGLGRKNALNKTIEALFYQVEDKLTICTPYFNFPL
FT                   SLYKRLNWLLDHGKKAEIIVGDKTANDFYTPPEEKFTMASALPYLYEKNLRAFAKRFDR
FT                   YIQNGQLTVRLWKHGDNSYHLKGVWIDSRYILLTGNNLNPRAWALDAENAVLIYDPKAE
FT                   LSAKAETELTQIRTHTTVLKHYSDLEQINDYPEAVRKLLKRFGRVKLDKVVKMLL"
FT   gene            complement(48524..51340)
FT                   /gene="ileS"
FT                   /locus_tag="APL_0044"
FT   CDS_pept        complement(48524..51340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="APL_0044"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73152"
FT                   /db_xref="GOA:A3MYB6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYB6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VP34"
FT                   /protein_id="ABN73152.1"
FT                   /translation="MIDYKNTLNLPETGFPMRGDLAKREPDMLKNWYDKNLYQKVRESS
FT                   KGKKSFILHDGPPYANGNIHIGHAVNKILKDIIMKSKTALGFDTPYVPGWDCHGLPIEL
FT                   KVEGIVGKPNEKISAAEFRQACRDYAKEQVEGQKADFIRMGILGDWDNPYLTMNFDTEA
FT                   HIIRTLGKVIANGHLYKGSKPVHWCLDCGSSLAEAEVEYEDKVSPSIYVRFKAIDSAAV
FT                   EAKFNAVGKGSGQISAVIWTTTPWTLPSNKAISINPEFDYQLVQFGDERVVLVKDLVES
FT                   VQKAVGVESVEVLGEVKGDALELMQFQHPFYDYSVPLILGDHVTTDGGTGLVHTAPDHG
FT                   QDDFVVSKKYNIEMAGLVANDGKFISSTPFFAGLGVFESNEKVLEKLKEVGALLKLERI
FT                   KHSYPHCWRHKTPIIFRATPQWFIGMETQGLREQALGEIKSVRWIPSWGEARIDTMVAN
FT                   RPDWCISRQRTWGVPMTMFVHNETEELHPRTLEILESVAKRVEEKGIQAWWDLDPVEVL
FT                   GEEDAKNYRKVPDTLDVWFDSGSTYASVVEARPEFNGNSTDMYLEGSDQHRGWFMSSLM
FT                   LSTATNGKAPYKQVLTHGFVVDEKGRKMSKSLGNVIVPSEVWNKNGADILRLWVASTDY
FT                   TGEIAVSHNILNSAGESYRRIRNTARFLLANLNGFDPKRDLVKPEEMIALDRWAVSCAL
FT                   EAQNDIKEAYDNYQFHTVVQRLMRFCSIEMGSFYLDIIKDRQYTTKADSLARRSCQTAL
FT                   WHIAEALVRWMAPILSFTADEIWSYLPQVEGRSEFVFTEEFYEGLFGLTEADKLDDAYW
FT                   QQILKVRAESNRVLEQARKDKVIGSGLEAKVTLYANNEIRAMLEQLGNELRFVLITSQA
FT                   IIKPLSEADVAEGEMAGLAVKVERAEGEKCPRCWHFATDIGTHTEHSSVCGRCVENVAG
FT                   EGEKRSFA"
FT   gene            complement(51401..52363)
FT                   /gene="ribF"
FT                   /locus_tag="APL_0045"
FT   CDS_pept        complement(51401..52363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="APL_0045"
FT                   /product="riboflavin biosynthesis protein"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73153"
FT                   /db_xref="GOA:A3MYB7"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYB7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44957"
FT                   /protein_id="ABN73153.1"
FT                   /translation="MQLIRGLYNLANHKDLAKGSVISIGNFDGVHLGHQNILARLCDQA
FT                   LERNLPSVVMLFEPQPREFFANKQANSTACIAPARLMRLRDKLKYLEQAGVDFVLCVRF
FT                   NERFANLSADAFIRELLVKQLRVRYLSVGDDFRFGANRTGDFALLRNAGLKYRFAVEDS
FT                   QTLNHAEQRVSSSLIRTALQQDDLVLAEKLLGKPYSICGRVAHGNKLGRTIGFPTANIM
FT                   LNRLVTPLQGVFAVQIQTQTGRHNGIANVGNRPTINGTKPLLEVHIFDFNRSIYGEAIE
FT                   VFFIRKIRNEVKFPDFEALKAQIEKDREQAFEFFKHFAN"
FT   gene            52696..53976
FT                   /gene="nadR"
FT                   /locus_tag="APL_0046"
FT   CDS_pept        52696..53976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadR"
FT                   /locus_tag="APL_0046"
FT                   /product="transcriptional regulator NadR"
FT                   /EC_number="2.7.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73154"
FT                   /db_xref="GOA:A3MYB8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006417"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYB8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44308"
FT                   /protein_id="ABN73154.1"
FT                   /translation="MTNFAYLQQKRKQLKMKVNDVCEQAGVTRAYFNQLVSGKIKNPSA
FT                   NKLKALHQVLNIVEDMNQRVGVIFGKFYPVHTGHIHMIYEAFSKVDILHVVVCTDAERD
FT                   LQLFKDSKMKRMPTNEDRLRWMQQIFKYQQKQIFIHHLKEDGIPSYPNGWQGWADRVKE
FT                   LFNEKNIRPSLVFSSEVQDKEPYEKYLDLEVHLVDPKRESFNVSATKIRNNPFQYWRFI
FT                   PKEVRPFFVKTIAILGGESSGKSVLVSKLANVFNTTSAWEYGREFVFERLGGNEQAMQY
FT                   SDYPLMALGHQRYIDYAMKHAHKVALIDTDYITTQAFCIQYEGKSHPFLDSMIKEYPFD
FT                   VTILLSNNTKWVDDGMRSLGSVKQRQRFQQLLKKLLEKYNVPYIEIESPSYLDRYNQAK
FT                   EVVEAILKEEEIPLQFKQYNHTTEDKE"
FT   gene            53973..54671
FT                   /locus_tag="APL_0047"
FT   CDS_pept        53973..54671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0047"
FT                   /product="hypothetical diadenosine tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73155"
FT                   /db_xref="GOA:A3MYB9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR017056"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYB9"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00203083.1"
FT                   /protein_id="ABN73155.1"
FT                   /translation="MILFAGDPHGSYRHLYPVLQEYKGEEIALVILGDLQLTTPDELDK
FT                   LSQYCDVWFIHGNHDSKTVAAFDSIWNSEWKTRSLHGKVVDIQGVKIAGLGGVFRGHIW
FT                   MPPNRPMFFDPIHYCQYCPQERIWRGGLPLRHRTSIFPSDVEILEGLQADILITHEAPR
FT                   PHPQGFAVINQLAKKMGVNKIFHGHHHDNFDYRPINRNKHCDIFNIGFRSLADINGNYL
FT                   IVGVDDRENR"
FT   gene            54844..55560
FT                   /gene="arcA"
FT                   /locus_tag="APL_0048"
FT   CDS_pept        54844..55560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="APL_0048"
FT                   /product="aerobic respiration control protein ArcA"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73156"
FT                   /db_xref="GOA:A3MYC0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYC0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P0A9Q3"
FT                   /protein_id="ABN73156.1"
FT                   /translation="MQNPQILIVEDELVTRNTLKSIFEAEGYEVFEATDGTEMNAILAQ
FT                   QEINLVIMDINLPGKNGLMLARELRENTKIALMFLTGRDNEVDKILGLEIGADDYITKP
FT                   FNPRELTIRARNLLHRTMNEKEKTTKDIVQTDSYRFNGWELDVNSRSLITPEGVVNKLP
FT                   RSEFRALLHFCENPGKIQTREDLLLKMTGRELKPHDRTVDVTIRRIRKHFEDHPNTPEI
FT                   IVTIHGEGYRFCGELE"
FT   gene            55612..56130
FT                   /locus_tag="APL_0049"
FT   CDS_pept        55612..56130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73157"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYC1"
FT                   /inference="similar to AA sequence:RefSeq:NP_872869.1"
FT                   /protein_id="ABN73157.1"
FT                   /translation="MKNLTVLALAGLFSASAFAAPVGNTFTGVGVGVDLTTVKYKVDGV
FT                   KGKQSTGPALVVDYGMDYGDNFVGVVQGKVKVGSTKVFSDVKQKTKYTVAYQQGYRVAS
FT                   DLLPYVKVDVAQSKVGDTNFRGYGYGAGAKYAVSSNVEVGAEYTRSNLRKSGAKLKGNE
FT                   FTANLGYRF"
FT   gene            complement(56285..57073)
FT                   /locus_tag="APL_0050"
FT   CDS_pept        complement(56285..57073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73158"
FT                   /db_xref="GOA:A3MYC2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYC2"
FT                   /inference="similar to AA sequence:RefSeq:YP_088427.1"
FT                   /protein_id="ABN73158.1"
FT                   /translation="MDYSVGKQTYQQLANKYQCSVRTIQRYLEKAPKAFLKAPQNKYLN
FT                   LIIDTTFFHRDFGVMVFIDSLSTKVVYHQIVKTEKDIYYKKAINHLREKGYIIQSITCD
FT                   GRRGLLKDLMNTPTQMCQFHLVAIVMRALRKKHQSHAGRELKTIIKTLKVSSKNEFYLK
FT                   IHHWKIKYKAFLEERSDKPNEKGKYPYKHRNVRSAYTSIKRYMDYIFTYEKYPELNIEK
FT                   TTNRIEGLFKELKDKLRPHSGLTRKHKILFIQDFLNKKSR"
FT   gene            complement(57311..57847)
FT                   /locus_tag="APL_0051"
FT   CDS_pept        complement(57311..57847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0051"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.45"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73159"
FT                   /db_xref="GOA:A3MYC3"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYC3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45314"
FT                   /protein_id="ABN73159.1"
FT                   /translation="MDLTQIKLVITDVDGVLTDGGMYYTAEGEVMKRFHVHDGLGMKML
FT                   QTCGVQVAILSGGDSALLRKRIDVLKVPLFKLGKMEKRSACFELMKEAGVTAEQTAFIG
FT                   DDTLDLPAFEVCGLAIATRNAHDYVKAKADWILEKAGGEGAFREVSDRILQAQGFEEIY
FT                   ATADGFLTVAEKMAQ"
FT   gene            57902..58597
FT                   /locus_tag="APL_0052"
FT   CDS_pept        57902..58597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73160"
FT                   /db_xref="GOA:A3MYC4"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYC4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44506"
FT                   /protein_id="ABN73160.1"
FT                   /translation="MSISQNLSEIKQQIQQISQQCGRDNVRLLAVSKTKPVEAIEEAIA
FT                   AGQTAFGENYVQEGVEKIAYFAQQPNLEWHFIGALQSNKTRLVAENFDWIQTVDRLKIA
FT                   ERLSAQRSANKAPLNVLIQINISDEASKSGIQPEELDELAKAISQLPNLRLRGLMAIPK
FT                   PESEPEQQKIALRKMQQLFDRLQDEFEGIDTLSMGMSDDMAAAIECGSTMVRIGTAIFG
FT                   ARDYSAKSV"
FT   gene            58930..60636
FT                   /gene="typA"
FT                   /locus_tag="APL_0053"
FT   CDS_pept        58930..60636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="APL_0053"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73161"
FT                   /db_xref="GOA:A3MYC5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYC5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44910"
FT                   /protein_id="ABN73161.1"
FT                   /translation="MDSNDLEKERGITILAKNTAINWNDYRINIVDTPGHADFGGEVER
FT                   VLSMVDSVLLVVDAFDGPMPQTRFVTQKAFAHGLKPIVVINKVDRPGARPDWVVDQVFD
FT                   LFVNLGATDEQLDFPIIYASALMGVAGLEHEDLAEDMTPLFQAIVDHVEPPKVELNAPF
FT                   QMQISQLDYNNYVGVIGIGRIKRGSIKPNQTVTVIDSEGKTRNGKIGQVLGHLGLQRYE
FT                   ASEAFAGDIIAITGLGELNISDTICDINNVEALPALSVDEPTVSMFFCVNTSPFCGQEG
FT                   KYVTSRQILERLNKELVHNVALRVEETPNPDEFRVSGRGELHLSVLIENMRREGYELAV
FT                   SRPKVIYKEENGKKQEPFEQVTIDIEEQHQGAVMEALGIRKGEVKDMIPDGKGRTRLEY
FT                   VIPSRGLIGFRNEFMTMTSGTGLLYSSFSHYDDVKPGEIGQRKNGVLISNATGKALAYA
FT                   LFGLQERGKLMIDHGVDVYEGQIIGIHSRGNDLTVNCLQGKKLTNMRASGKDDAIVLTT
FT                   PVRLSLEQALEFIDDDELVEVTPQSIRVRKRLLTENDRKRAGRTTTSTSTK"
FT   gene            60795..61058
FT                   /gene="grxA"
FT                   /locus_tag="APL_0054"
FT   CDS_pept        60795..61058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxA"
FT                   /locus_tag="APL_0054"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73162"
FT                   /db_xref="GOA:A3MYC6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011902"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYC6"
FT                   /inference="similar to AA sequence:RefSeq:NP_439681.1"
FT                   /protein_id="ABN73162.1"
FT                   /translation="MFVEIYGRMTCPYCTRAKALAEKMKGELADFDFKFIDMIAEGISK
FT                   EDLEPRVGKPVATVPQIFLDNVHVGGCTDFQALVKEKFGIEV"
FT   gene            complement(61124..61840)
FT                   /gene="rph"
FT                   /locus_tag="APL_0055"
FT   CDS_pept        complement(61124..61840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="APL_0055"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73163"
FT                   /db_xref="GOA:A3MYC7"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYC7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9AES0"
FT                   /protein_id="ABN73163.1"
FT                   /translation="MRPNNRELNQVRPVKITRHYTRYAEGSVLVEFGETKVLCNATVEE
FT                   TVPRFLKGQQQGWVTAEYGMLPRSTHSRMQREAAKGKQGGRTMEIQRLIARSLRAVVDL
FT                   KALGERTVTVDCDVIQADGGTRTAAITGACVALHDAMSKLVADGVLKENPMKGLVAAIS
FT                   VGIVDGNAVCDLEYVEDSNAETDMNVVMVEDGRLVEVQGTAEGEPFSHMELLQLLDLAH
FT                   QGINQLLDAQRKALAL"
FT   gene            62044..62907
FT                   /gene="yicC"
FT                   /locus_tag="APL_0056"
FT   CDS_pept        62044..62907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicC"
FT                   /locus_tag="APL_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73164"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYC8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44726"
FT                   /protein_id="ABN73164.1"
FT                   /translation="MIYSMTAFAHLEIKKEWGNAVWEIRSVNQRFLETYFRLPEQFRNL
FT                   EMTLRERLRASLTRGKVECSLRIELSNNQNSELALNKAYAEKVISSLQTLRGIAGEGEI
FT                   NLVDILRYPGVVDAQTQDLDQIGQDLLAGFEQILADFIAMRGREGANLQALIQQRLDTI
FT                   AEIATKVQAQMPEILQWQKDKLQQRFDELNLQLDPQRLEQEMVLTAQRVDVAEELDRLQ
FT                   LHVKETTNVLKKGGAVGRKLDFMMQELNRESNTLASKSINADVTNSAVELKVLIEQMRE
FT                   QIQNLE"
FT   gene            62916..63803
FT                   /locus_tag="APL_0057"
FT   CDS_pept        62916..63803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73165"
FT                   /db_xref="GOA:A3MYC9"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYC9"
FT                   /inference="similar to AA sequence:RefSeq:NP_872893.1"
FT                   /protein_id="ABN73165.1"
FT                   /translation="MTCECSKISNSHPNLCVQLSQYRLIEIAGVDAEKYLQGQLTCDVA
FT                   KLAEGEHTLTCHCDPKGKMSALIRLYRQAADKFIAMIHADLLPEALNQLKKYAVFSKVT
FT                   FTELDTPIYGVTSGEILAKLCENTTALVIPQGQKRAIVWGETLETNADSQLWDLIDIQD
FT                   GIPMLLKANQFELIPQATNLQAVENAISFSKGCYIGQETVARAKYRGANKRAMFTLVGK
FT                   FDGEVSLPEIGGSVEMQFGENWRATGTILNSVAYQNKLWLQVVMNNDVEADSAFRINGV
FT                   PLAICDLPYSFKDA"
FT   gene            complement(63853..64113)
FT                   /gene="yfhL"
FT                   /locus_tag="APL_0058"
FT   CDS_pept        complement(63853..64113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhL"
FT                   /locus_tag="APL_0058"
FT                   /product="putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYD0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44746"
FT                   /protein_id="ABN73166.1"
FT                   /translation="MALLITHKCTNCDMCLPECPNEAISIGDDVYVIDPVLCTECVGHY
FT                   EKPTCQKVCPITNCIIPDSEHQETQEELWERFVMIHHPDKI"
FT   gene            complement(64259..64888)
FT                   /gene="narP"
FT                   /locus_tag="APL_0059"
FT   CDS_pept        complement(64259..64888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narP"
FT                   /locus_tag="APL_0059"
FT                   /product="nitrate/nitrite response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73167"
FT                   /db_xref="GOA:A3MYD1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYD1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44845"
FT                   /protein_id="ABN73167.1"
FT                   /translation="MTEAYKILLIDDHPLMRQGIRQILELEDNFVIVGEASNGTDGISI
FT                   ALDTNPDLIILDLNMKGISGLDTLRALRKHGIDSRIVVLTVSDEQSDVFALMDAGVDGY
FT                   LLKDSDTAELVENIRKAAQGETVLSDSVRQHLLDRRPENDPLSVLTDRERDVLQWIATG
FT                   MSNKQIASQLFISEETVKVHIRNLLRKLNVHSRVAATVLYLEQQKG"
FT   gene            65092..67230
FT                   /locus_tag="APL_0060"
FT   CDS_pept        65092..67230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0060"
FT                   /product="putative N6-adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73168"
FT                   /db_xref="GOA:A3MYD2"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR017244"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYD2"
FT                   /inference="similar to AA sequence:RefSeq:YP_087939.1"
FT                   /protein_id="ABN73168.1"
FT                   /translation="MTTQITYFATAARGFEEMLKTELEQICQAECKVTQGGVHFTTTQR
FT                   GAYQALLHSRLASRILLPLVTTKIFSDLDLYATIVGINWAYIFDPRDTFFVDFNGTNRE
FT                   IRNTQFGAMRVKDGVVDYFERKGFTRPTVDKDHADIRIHVYLDRENMVVSLDLSGDALH
FT                   MRGYREDTGKAPLRETLAAAIVLRSGWQKGTPLVDPMCGSGTLLIEAAQMQAGIAPQLH
FT                   RKHWGFNAWKGHQQAVWKEVLEQAYLQQNEEIQPLFFGFDLDHRVLAKAKQNAKNAGVA
FT                   HLIQWQQGDIAALKNPCPEQVGTVICNPPYGERLGTTPALIALYSVFGQRLKQQFSGWN
FT                   ASIFSGEPELLNCLRLRSHRQFKAKNGPLDCLQKNYQISERTAAEQQADELKFEQNAQV
FT                   APDFANRLAKNIKKIEKWAKQQGINAYRLYDADLPEYNLAVDRYDDHIVVQEYAAPKNI
FT                   DEQKARQRLLDAVSATLYVTGVETNKLVLKVRQKQKGTNQYEKLANKGDYFYVTEYGAK
FT                   LWVNLTDYLDTGLFLDHRLTRKMVGQMAKGKTFLNLFAYTGSATIHAALNGAKSTTTVD
FT                   MSNTYLNWAEQNLELNNLPLRNNRLFQADCLQWLAECRERFELIFVDPPTFSNSKRMED
FT                   SWDVQRDHIKLMTQLKRILTTDGTIVFSNNKRGFKMDFEGLAELGLQAENISHKTLPLD
FT                   FERNPQIHNCWIIRHIEN"
FT   gene            67288..67767
FT                   /gene="yibK"
FT                   /locus_tag="APL_0061"
FT   CDS_pept        67288..67767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yibK"
FT                   /locus_tag="APL_0061"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73169"
FT                   /db_xref="GOA:A3MYD3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYD3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44868"
FT                   /protein_id="ABN73169.1"
FT                   /translation="MLDIVLYEPEIPQNSGNIIRLCANCGFRLHMIEPLGFAWDDKKLR
FT                   RSGLDYHEFVDIQKYKNFEDFLERAKPKRLFALTTKGEPNHSEVSYELGDFLMFGPESR
FT                   GIPMTILDNLPMSQKIRVPMCKDSRSMNLSNTVAVVVYEAWRQFGYQGSVPRQPI"
FT   gene            complement(67907..68854)
FT                   /gene="mipB"
FT                   /locus_tag="APL_0062"
FT   CDS_pept        complement(67907..68854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mipB"
FT                   /locus_tag="APL_0062"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73170"
FT                   /db_xref="GOA:A3MYD4"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYD4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q65PZ8"
FT                   /protein_id="ABN73170.1"
FT                   /translation="MSQLDALREMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP
FT                   QYASLIDDAVAYAKARSDDKAQLLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDT
FT                   KATIEKARQIMKLYNDAGISNDRILIKIASTWQGIRAAEVLEKEGINCNLTLLFSQAQA
FT                   RACAKAGVYLISPFVGRILDWYKAAEKKEYAPAEDPGVISVTNIYNYYKQYGYQTVVMG
FT                   ASFRNVGEITEIAGCDRLTIAPPLLKELAESNAPLVRKLEYKGEVKTRPAPLTEAEFYW
FT                   QHNQDPMAVEKLAEGIRKFAVDIEKLEAMLAAKL"
FT   gene            69354..70891
FT                   /locus_tag="APL_2109"
FT   rRNA            69354..70891
FT                   /locus_tag="APL_2109"
FT                   /product="16S ribosomal RNA"
FT   gene            70978..71054
FT                   /locus_tag="APL_2047"
FT   tRNA            70978..71054
FT                   /locus_tag="APL_2047"
FT                   /product="tRNA-Ile"
FT   gene            71106..71181
FT                   /locus_tag="APL_2048"
FT   tRNA            71106..71181
FT                   /locus_tag="APL_2048"
FT                   /product="tRNA-Ala"
FT   gene            71448..74342
FT                   /locus_tag="APL_2115"
FT   rRNA            71448..74342
FT                   /locus_tag="APL_2115"
FT                   /product="23S ribosomal RNA"
FT   gene            74508..74619
FT                   /locus_tag="APL_2121"
FT   rRNA            74508..74619
FT                   /locus_tag="APL_2121"
FT                   /product="5S ribosomal RNA"
FT   gene            75007..76602
FT                   /gene="dppA"
FT                   /locus_tag="APL_0063"
FT   CDS_pept        75007..76602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA"
FT                   /locus_tag="APL_0063"
FT                   /product="periplasmic dipeptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73171"
FT                   /db_xref="GOA:A3MYD5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYD5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P23847"
FT                   /protein_id="ABN73171.1"
FT                   /translation="MQKYFSLSALALVLFSNTVFASPKTFTYCIESSPAFLNPQIGTDG
FT                   ATLDVAQALYNRLIDFEPGTTNLVPSLAEKWDISADGKTYTFYLRKGVKFHKNKEFTPS
FT                   RNFNADDVLFVFNRQLNKYNYFHNVSGGNYEFFLGMDMPNIIEKVEKVDTYVVKFHLKV
FT                   PNAPFLANLAMDFASISSSEYADQMLKAGTPEKVDTAPIGTGPFEFAGLQKDAYVRFKA
FT                   FDDYWQGRAKLDRLVFSVTPDATVRYAKLQKNECQAMPYPNPADIAQMKADTNLQVLEK
FT                   SGLNIGYITFNLDKKPLDNQKVRQALNYAVNKQAILESVYQGTGSAAKNPMPPTIWGYN
FT                   DEIQDYEYNPEKAKALLKEAGLENGFDTELWAMPVSRPYNPNARRMAEMVQEDWKQIGV
FT                   NAKIVSFEWGEYLKRMEQGEHSTGMMGWTGDNGDPDNFLNTLLSCNAVKQGSNYAHFCD
FT                   QSYNDLVTQAAQESDKAKREALYKQAQVIFKQQAPWLPIAHSTTYFPMRKEVKGYTVSP
FT                   FLSHNFYRVELENN"
FT   gene            76770..78371
FT                   /gene="dppA"
FT                   /locus_tag="APL_0064"
FT   CDS_pept        76770..78371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA"
FT                   /locus_tag="APL_0064"
FT                   /product="periplasmic dipeptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73172"
FT                   /db_xref="GOA:A3MYD6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYD6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P23847"
FT                   /protein_id="ABN73172.1"
FT                   /translation="MKKLTKLSLLSLAIAASSSALAAPKTFVYCLEASPTYLNPQFATD
FT                   GGTLDATSQAIFNRLVDFAKGETTVIPSLAEKWDVSEDGKSYTFYLRKGVKFHSTKDFK
FT                   PSRDFNADDVLFSFNRQLDPNHPYHKISGGNYEYFIGMDMGNIIQNVEKVDDYTVKINL
FT                   KVPNAPFLANIAMDFASIFSAEYADKLLKAGTPEKLDQNPIGTGPFQFVDYQKDAQIRY
FT                   KGFDQYWAGKPAIDRLVFAITPDASVRMAKLQKGECHAAPYPNPADLEALKKDPNINLM
FT                   TKPGLNIGYLHFNTQKKPFDDVKVRQALNHAINKDAIIQSVYQGSGEKAKNPIPPTMWS
FT                   YNDDVKDYDYNPEKAKALLKEAGLEKGFDTEVWAMPVSRPYNPNARRMAELIQEDWKKV
FT                   GVNAKIVSYEWGEYLNRMRDGEHTTGMMGWNGDNGDPDNFLNTLLSCAAVKQGSNYAKF
FT                   CHKDFDKLMTDAVQTTDKAKRTELYKQAQVLFKEQAPWVTIAHSTTYFPVRKEVKGYVI
FT                   SPFSLHNFYGVDLEAK"
FT   gene            78499..79503
FT                   /gene="dppB"
FT                   /locus_tag="APL_0065"
FT   CDS_pept        78499..79503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="APL_0065"
FT                   /product="dipeptide transport system permease protein DppB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73173"
FT                   /db_xref="GOA:A3MYD7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYD7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45096"
FT                   /protein_id="ABN73173.1"
FT                   /translation="MFSFILKRLLMVIPTFLAITLITFALVHLIPGDPIEIRMGERGLD
FT                   PAVHAQMMAQLGLDLPLPEQYFNYIKGIFQGDLGNSFRNNEPVLKEFFTLFPATVELAF
FT                   FALLWSLVFGIFLGVIAAVKKDSWISHTVTTLSLTGYSMPIFWWGLILILYFSTPLGLP
FT                   ASGRLPSEYWIEAETGFMLYDTWVSDEPGAFIAAIKSLILPSIVLGTIPLAVVTRMTRS
FT                   SMLEVLGEDYIRTAKAKGLNTTRIVIVHALRNALIPVVTVVGLIVGQLLSGAVLTENIF
FT                   SWPGIGKWIIDAINARDYPVLQGSVLIIATIIILVNLTVDLIYGVVNPRIRHH"
FT   gene            79581..80471
FT                   /gene="dppC"
FT                   /locus_tag="APL_0066"
FT   CDS_pept        79581..80471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="APL_0066"
FT                   /product="dipeptide transport system permease protein DppC"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73174"
FT                   /db_xref="GOA:A3MYD8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYD8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P51000"
FT                   /protein_id="ABN73174.1"
FT                   /translation="MSSTTLSAPAPKTPLQEFWYYFCQNRGAVIGLAFITLVFFAAVFA
FT                   GWVAPFDPIEQNRSALLLPLAWMEGGNSTYLLGTDDIGRDILSRIIYGARLSVFIGLVI
FT                   VILSCVFGVILGLLAGYYGGVIDIVIMRFVDIMLAIPSLLLTIGVVTILGPSLINAAIA
FT                   IAIVSIPSYVRLTRASVMSEKNRDYVVASRVAGAGVLRLMFIVILPNCLAPLIVQMTMG
FT                   ISNAILELAALGFLGIGAQPPTPELGTMLAESRGFMQSANWLVTIPGLAILSLVLAFNL
FT                   MGDGLRDALDPKLKQ"
FT   gene            80482..81468
FT                   /gene="dppD"
FT                   /locus_tag="APL_0067"
FT   CDS_pept        80482..81468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="APL_0067"
FT                   /product="dipeptide transport ATP-binding protein DppD"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73175"
FT                   /db_xref="GOA:A3MYD9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYD9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P0AAG1"
FT                   /protein_id="ABN73175.1"
FT                   /translation="MALLTVDQLSVHFGDEKAPFKAVDRISYTINEGEVLGIVGESGSG
FT                   KSVSSLAIMGLIDFPGRVAANSLEFNGNNLLALKPKEKQKIVGADVSMIFQDAMTSLNP
FT                   SYTVGFQIMEALKVHQGGSKAARRERAIELLTMVGIPDPQSRLEVYPHQLSGGMSQRVM
FT                   IAMAIACNPKLLIADEPTTALDVTIQAQIIDLLLELQRKENMALILITHDLALVAESAH
FT                   RIIVMYAGQVVEEGKAELIFKAPLHPYTQALLKALPEFAEGKSRLQSLPGVVPGRYDRP
FT                   QGCLLNPRCPYATDKCRTSEPELRVLNGRQVKCHFPLDENGVPTTQQ"
FT   gene            81481..82470
FT                   /gene="dppF"
FT                   /locus_tag="APL_0068"
FT   CDS_pept        81481..82470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF"
FT                   /locus_tag="APL_0068"
FT                   /product="dipeptide transport ATP-binding protein DppF"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73176"
FT                   /db_xref="GOA:A3MYE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYE0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45094"
FT                   /protein_id="ABN73176.1"
FT                   /translation="MTDLQKNEQNAPLLDAKKLKKYYPVKQGLFAKPKTVKAVDGVSFQ
FT                   LERGKTLAVVGESGCGKSTLVRMLTMIESPTEGELFYKGQNFLVNDKETAALRRKKIQI
FT                   VFQNPYSSLNPRKKVGSILEEPLLINTDLSAAERKAKVLEMMSKVGLKPEFYDRYPHMF
FT                   SGGQRQRIAIARGLMLNPDVVVADEPVSALDVSVRAQVLNLMMDLQEDMGLSYVFISHD
FT                   LSVVEHIADEVMVMYLGRVVEQGETKAIFSNPRHPYTQALLSATPRLNPEQRRERIKLT
FT                   GELPSPLNPPKGCAFHARCRLATEKCKAEQPQLKNYENGTKIACFMVE"
FT   gene            complement(82543..82953)
FT                   /gene="psiE"
FT                   /locus_tag="APL_0069"
FT   CDS_pept        complement(82543..82953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiE"
FT                   /locus_tag="APL_0069"
FT                   /product="phosphate-starvation-inducible protein PsiE"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73177"
FT                   /db_xref="GOA:A3MYE1"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYE1"
FT                   /inference="similar to AA sequence:RefSeq:YP_248412.1"
FT                   /protein_id="ABN73177.1"
FT                   /translation="MNISEKFPETITKLLRNILSVLLIILAIVLIIALVKVTYGLCVMI
FT                   ITSGATVPYALAEQIVMFFLYFGFLGLISQYFKSGYHFPLRYFIYAGITAMLRLIIVDH
FT                   ESATNTILFAGAILLMVIALCLVLYSDKLRNI"
FT   gene            complement(83031..83663)
FT                   /locus_tag="APL_0070"
FT   CDS_pept        complement(83031..83663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73178"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYE2"
FT                   /inference="similar to AA sequence:RefSeq:YP_349855.1"
FT                   /protein_id="ABN73178.1"
FT                   /translation="MKVFHRHAHIFFIGGAADLEPYYFVGPLHNITIAQKKLARQVKKY
FT                   LAHHANIHFHSLSYNRVYYLSDIELNVLVKIQSQDLIYIIGHSLGGWNAAHLARILKDK
FT                   GYRVRILATLDPVGEGTLVWMGSNIFKNPEPKPLADFWINIQAENDDLDLSDIVAQIGR
FT                   QWLLSDEPDINEKLYIHHSDAQRMLRHKLHTGKSIMDYIIENIRQLL"
FT   gene            complement(83718..84062)
FT                   /locus_tag="APL_0071"
FT   CDS_pept        complement(83718..84062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73179"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYE3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:O30825"
FT                   /protein_id="ABN73179.1"
FT                   /translation="MIQRIDVSKRFSEVAIYNGVAYLAGQVPTDDSQDAYQQTKQVLAE
FT                   IDKCLAKANTDKSKILIATVYLANMAYYDEMNRAWDEWAAENNAPPRAAVEARLANPNW
FT                   KVEIVVTAAI"
FT   gene            complement(84149..85186)
FT                   /gene="ilvE"
FT                   /locus_tag="APL_0072"
FT   CDS_pept        complement(84149..85186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="APL_0072"
FT                   /product="branched-chain-amino-acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73180"
FT                   /db_xref="GOA:A3MYE4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYE4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P54689"
FT                   /protein_id="ABN73180.1"
FT                   /translation="MALKDLDWANLGFSYIKTDYRFIAHWKDGKWDEGQLTTDNTLHIH
FT                   EGSTALHYGQQCFEGLKAYRCKDGSINLFRPEENAKRMQGTARRLLMAEVPTELFVRAC
FT                   KEVVKANQDWLGPYGSGATLYLRPFLIGVGDNIGVKAAPEYIFSVFCCPVGAYFKGGLA
FT                   PSNFITTDYDRAAPVGTGGVKVGGNYAASLLPHELAVQQGTATRKFADAIYLDPKTHTK
FT                   IEEVGAANFFGITKDNKFITPASESILPSITKYSLLHIAKERLGMETIEGDVYIDQLDQ
FT                   FAEAGACGTAAVITPVGGIQHKDNFHVFYSETEVGPVTKRLYAELTGIQFGDVEAPEGW
FT                   IVKVE"
FT   gene            complement(85329..85655)
FT                   /gene="ydhD"
FT                   /locus_tag="APL_0073"
FT   CDS_pept        complement(85329..85655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhD"
FT                   /locus_tag="APL_0073"
FT                   /product="monothiol glutaredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73181"
FT                   /db_xref="GOA:A3MYE5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYE5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45085"
FT                   /protein_id="ABN73181.1"
FT                   /translation="METIDTIEKIKKQIGENPILLYMKGSPKFPSCGFSARAGEAVINC
FT                   QVPFGYVDILTNPDIRAELFANWPTFPQLWVEGELVGGCDIVLEMFQKGELQTLLKEVA
FT                   AKHA"
FT   gene            complement(85727..86392)
FT                   /gene="recR"
FT                   /locus_tag="APL_0074"
FT   CDS_pept        complement(85727..86392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="APL_0074"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73182"
FT                   /db_xref="GOA:A3MYE6"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYE6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44712"
FT                   /protein_id="ABN73182.1"
FT                   /translation="MDSSLYCGYPLLIFNYPFLFMQISPLLENLMEALRALPGVGPKSA
FT                   QRMAYHLLQRNRSGGINLSKALNEAMTHIGHCRSCRTFTEEDECNICKNPRRQMSGQLC
FT                   VVEMPEDIQAIEQTGQFSGRYFVLMGHLSPLDGIGPREIGLDLLQSRLENESFHEVILA
FT                   TNPTIEGDATANYIAEMCRIHNVKVTRIAHGIPVGGSLEMVDGTTLSHSFAGRRDVSL"
FT   gene            complement(86403..86732)
FT                   /gene="ybaB"
FT                   /locus_tag="APL_0075"
FT   CDS_pept        complement(86403..86732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="APL_0075"
FT                   /product="uncharacterized protein YbaB"
FT                   /note="pubmed:14742511"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73183"
FT                   /db_xref="GOA:A3MYE7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYE7"
FT                   /inference="similar to AA sequence:INSD:AAR95696.1"
FT                   /protein_id="ABN73183.1"
FT                   /translation="MFGKGGLGGLMKQAQQMQERMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRIEIDPSLMEDDKEMVEDLVAAAFNDAVRRAEEMQKEKMASVTAGMQLPPG
FT                   MKFPF"
FT   gene            complement(86901..87767)
FT                   /gene="tonB2"
FT                   /locus_tag="APL_0076"
FT   CDS_pept        complement(86901..87767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB2"
FT                   /locus_tag="APL_0076"
FT                   /product="protein TonB2"
FT                   /note="pubmed:14742511"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73184"
FT                   /db_xref="GOA:A3MYE8"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYE8"
FT                   /inference="similar to AA sequence:INSD:AAR95695.1"
FT                   /protein_id="ABN73184.1"
FT                   /translation="MKKKHSRIGLTGSILIHTAIFGGLASMVTHSHSDDLPQEETMSME
FT                   LVAALLEQPQVAVAQEEPAPPEPPEPEKVEVEPEPEPEAEAIPELKPQPKPKEKPKEKP
FT                   KEKPKPKEPPKPKEKEKPKKEKVKDKPIKALEKGPEAKQGIVAKAIPNAVQGTQLRAGI
FT                   PNGKPEGNPNGLSANGSQNGAVGGSGSGASGSEIGAYKAALQRALQRRANNAYPTREKM
FT                   MRKTGVVTIGFTVSSSGELINVKVLNSSGNGNLDNAAVKAAQSTKVSPPPAGFPSNVTV
FT                   PVKFSIE"
FT   gene            complement(87777..88166)
FT                   /gene="exbD2"
FT                   /locus_tag="APL_0077"
FT   CDS_pept        complement(87777..88166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD2"
FT                   /locus_tag="APL_0077"
FT                   /product="biopolymer transport protein ExbD2"
FT                   /note="pubmed:14742511"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73185"
FT                   /db_xref="GOA:A3MYE9"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014171"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYE9"
FT                   /inference="similar to AA sequence:INSD:AAR95694.1"
FT                   /protein_id="ABN73185.1"
FT                   /translation="MKKFDEINIIPFIDIMLVLLAIVLVTASFISQGKIPVNIPKATTT
FT                   QAMKADELAKLLTITENNEFYFNDQPITKEALTSEIATWDKTQKVTLKVDGAVAFEKFV
FT                   ELTDVLSANEIKNVAIVTKKDTSKK"
FT   gene            complement(88211..88663)
FT                   /gene="exbB2"
FT                   /locus_tag="APL_0078"
FT   CDS_pept        complement(88211..88663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB2"
FT                   /locus_tag="APL_0078"
FT                   /product="biopolymer transport protein ExbB2"
FT                   /note="pubmed:14742511"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73186"
FT                   /db_xref="GOA:A3MYF0"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014172"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYF0"
FT                   /inference="similar to AA sequence:INSD:AAR95693.1"
FT                   /protein_id="ABN73186.1"
FT                   /translation="MEQMLELLQGHVDYIILGLLLLMSVVLVWKIIERVLFYKQLDVTK
FT                   YDTLQDLEIDTTRNLTTISTIGANAPYIGLLGTVLGILLTFYHLGHSGGDIDAASIMVH
FT                   LSLALKATAAGILVAIPAMMFYSGFNRKVDESKLKWQAIQARKANQ"
FT   gene            88851..89177
FT                   /gene="glpE"
FT                   /locus_tag="APL_0079"
FT   CDS_pept        88851..89177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpE"
FT                   /locus_tag="APL_0079"
FT                   /product="thiosulfate sulfurtransferase GlpE"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73187"
FT                   /db_xref="GOA:A3MYF1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYF1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q6T893"
FT                   /protein_id="ABN73187.1"
FT                   /translation="MSETFTEISPHQAWELIENEGATLADIRDGRRYAYSHPQDAFHLT
FT                   NESYGRFLDEVDYEEPVIVMCYHGVSSRNTAQFLVEQGFDRVYSVKGGFDGWERSGLPI
FT                   ETAY"
FT   gene            89221..90066
FT                   /locus_tag="APL_0080"
FT   CDS_pept        89221..90066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0080"
FT                   /product="putative thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73188"
FT                   /db_xref="GOA:A3MYF2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYF2"
FT                   /inference="similar to AA sequence:RefSeq:NP_872919.1"
FT                   /protein_id="ABN73188.1"
FT                   /translation="MNYFVNVTESNFSEVWNAATQVPVVFNFISPREVASLEMDSLLRR
FT                   LADENPAQFLLATVNCDEQQALAAQFRIQTIPTMYLFSGGQPVDMIQGAISEQEMRVRL
FT                   ANILPKEEELKFNQALELLQDQCYEEALPLLKSAWEMTDKKNSDFALLYAETFIVMKKV
FT                   EEAREILKQIPIQDRDSRWNGLQAQIELLEQANESPELQQLQADYANNKTPEIAIRLAN
FT                   QLHQAHKNEEALVLLFDWLKADLNSANGEVKSQFLAILSALGNDPIVPKFRRQLYSLLY
FT                   "
FT   gene            complement(90141..90548)
FT                   /gene="dhaM"
FT                   /locus_tag="APL_0081"
FT   CDS_pept        complement(90141..90548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaM"
FT                   /locus_tag="APL_0081"
FT                   /product="PTS-dependent dihydroxyacetone kinase,
FT                   phosphotransferase subunit DhaM"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73189"
FT                   /db_xref="GOA:A3MYF3"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYF3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P37349"
FT                   /protein_id="ABN73189.1"
FT                   /translation="MVNLVIVSHSKQLGEGVAEITRQMAQGSCKIAVAAGIDDPENPIG
FT                   TDAVKIMNAIEEVFSEDGVVIFVDLGSAILSAETAIDLLEPEKAEKVVISYAPLVEGAF
FT                   AAAVAAAGGDDLASVLQEANEAAALKQQQAV"
FT   gene            complement(90557..91183)
FT                   /gene="dhaL"
FT                   /locus_tag="APL_0082"
FT   CDS_pept        complement(90557..91183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaL"
FT                   /locus_tag="APL_0082"
FT                   /product="PTS-dependent dihydroxyacetone kinase,
FT                   ADP-binding subunit DhaL"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73190"
FT                   /db_xref="GOA:A3MYF4"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYF4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P76014"
FT                   /protein_id="ABN73190.1"
FT                   /translation="MAISKQQILQWLENCNQVMTEQRDFLTQLDTEIGDGDHGLNMQRG
FT                   FSKALEKIATVSDKDIGTILKTVGMTLLSQVGGASGPLYGTLFIKGSQVANGKEQLTFE
FT                   ELVSIFKAGVEGIIARGRAEPGDKTLCDVWLPLLDELAQADHSQPEAVLLNQAVEKAEN
FT                   FAKATVPMTAKKGRASYLGERSVGHADPGATSSYYLIKALAEAVK"
FT   gene            complement(91185..92255)
FT                   /gene="dhaK"
FT                   /locus_tag="APL_0083"
FT   CDS_pept        complement(91185..92255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaK"
FT                   /locus_tag="APL_0083"
FT                   /product="PTS-dependent dihydroxyacetone kinase,
FT                   dihydroxyacetone-binding subunit DhaK"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73191"
FT                   /db_xref="GOA:A3MYF5"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYF5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P76015"
FT                   /protein_id="ABN73191.1"
FT                   /translation="MKKLINSIETVLQEQLTGFAKAHPTITLNTEPTYVRRADAPVAGK
FT                   VALISGGGSGHEPMHAGFVGKGMLDGACPGAIFTSPTPDQMFECGLNVDSGEGVLLLIK
FT                   NYTGDVLNFETATELLADSGVKVATVLIDDDVAVKDSLYTAGRRGVANTVLLEKLLGAA
FT                   ADKGYNLSQLAELGYKLNNAGHSIGVALGACTVPAAGKPSFTLAENEMEFGVGIHGEPG
FT                   IERRPFENLDKTVRQMFETLIAHGDYERTVRRWDNDTQQWNEVLDKKQALQKGDRVIAL
FT                   VNNLGAVPLSELYGVYNVLADCCEQFGLTIERNLVGSFCTSLDMQGVSITLLKVDDETL
FT                   ALWDAPVNTPALRWGE"
FT   gene            92425..93378
FT                   /gene="trxB"
FT                   /locus_tag="APL_0084"
FT   CDS_pept        92425..93378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="APL_0084"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73192"
FT                   /db_xref="GOA:A3MYF6"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYF6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43788"
FT                   /protein_id="ABN73192.1"
FT                   /translation="MTVKHAKLLILGSGPAGYTAAVYAARANLNPVLVTGMQQGGQLTT
FT                   TDEIENWPGEYEHTTGTGLMDKMLKHAEKFNTEIVFDHINSVDLSKRPFTLKGDINTFT
FT                   CDALIIATGASAKYLGLPSEEAFKGKGVSACATCDGFFYRNKPVAVVGGGNTAVEEALY
FT                   LANIASEVHLVHRRDSFRAEKILLGRLQKRVEEGKIILHTDRTVEEVLGDNMGVTGVRL
FT                   ASTKDESKEEIKVDGFFVAIGHAPNTAIFDGQLELDNGYIKVKSGLEGNATATSVAGVF
FT                   AAGDVMDHNYRQAITSAGTGCMAALDAERFLDALEA"
FT   gene            93486..94238
FT                   /gene="kdsB"
FT                   /locus_tag="APL_0085"
FT   CDS_pept        93486..94238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="APL_0085"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73193"
FT                   /db_xref="GOA:A3MYF7"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYF7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNY6"
FT                   /protein_id="ABN73193.1"
FT                   /translation="MNFTVIIPARYASSRLPRKPLLDIAGKPMIQHVWEKAQQAGATRV
FT                   IIATDHPEIEATAKAFGAEVCMTSDQHNSGTERLAEVIEKMQIADDEIIVNVQGDEPLI
FT                   PPVIVSQVAENLDRCQVNMATLAVKLTTKEELFNPNAVKALADKNGMALYFSRAPIPFA
FT                   RDHFADCDDAFVASQNYLRHIGIYAYRAGFVKQYVAWQPTQLEQLESLEQLRALWYGEK
FT                   IHIELAKQAPQVGVDTQEDLERVRRILA"
FT   gene            94362..94787
FT                   /locus_tag="APL_0086"
FT   CDS_pept        94362..94787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73194"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYF8"
FT                   /inference="similar to AA sequence:RefSeq:YP_088128.1"
FT                   /protein_id="ABN73194.1"
FT                   /translation="MLGNILGSIASSVLSGGNGNQSTALQLIQALLQSQGGVEGVIAKL
FT                   QQGGLDDLLKTWISADEENAPVSGEQIANVFGQENLQAAAQEAGVEEKDAGDLLAEFLP
FT                   KIVDTLTPDGQLPDLQNLNTNDLLAQAAKGVLGKLFS"
FT   gene            complement(94861..95631)
FT                   /gene="nudC"
FT                   /locus_tag="APL_0087"
FT   CDS_pept        complement(94861..95631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudC"
FT                   /locus_tag="APL_0087"
FT                   /product="NADH pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73195"
FT                   /db_xref="GOA:A3MYF9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYF9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q4QNB3"
FT                   /protein_id="ABN73195.1"
FT                   /translation="MKSYWVLVHHFDLALKDDEIPFGTAEQLGLVGFAKLQVGEYQNSP
FT                   VFLVQLNEQAVENLQNFTMVNLRSQIALPEELAHLLHRAVSLNHFLNTHKFCGKCGAHT
FT                   ELADNEIAIHCPNCQHRSYPTISPSIIVAVRRGRQILLANHLRHKGTIYTTLAGFVEAG
FT                   EAIETTVQREVWEESGLKIKNIRYFGSQPWAFPNSLMLSFLADYDSGEITLQEEEIFDA
FT                   KWFDCDQPLPELPPEGTIALELIKETLKICREEG"
FT   gene            complement(95649..96344)
FT                   /gene="rluE"
FT                   /locus_tag="APL_0088"
FT   CDS_pept        complement(95649..96344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluE"
FT                   /locus_tag="APL_0088"
FT                   /product="ribosomal large subunit pseudouridine synthase E"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73196"
FT                   /db_xref="GOA:A3MYG0"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYG0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9CKK7"
FT                   /protein_id="ABN73196.1"
FT                   /translation="MFKAKFNQKNKARSATNKPNLQNRTKKRPLKPQLSFEDTVVVLFN
FT                   KPFDVLTQFTDEQGRQTLKDFIPIPQIYPVGRLDRDSEGLLLLTNNGEVQHRLANPKFE
FT                   KQKTYLAQVEGIPQAADLAKLEKGVELKDGLTKPAKAKAISAPNYEWQTAPKIRERKTI
FT                   PTSWIELKIHEGKNRQVRRMTAHIGFPTLRLIRIGLGQFQLGELNSGEYRVLDEKEKRQ
FT                   LFQQIDLKI"
FT   gene            complement(96348..97166)
FT                   /gene="rhaT"
FT                   /locus_tag="APL_0089"
FT   CDS_pept        complement(96348..97166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaT"
FT                   /locus_tag="APL_0089"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73197"
FT                   /db_xref="GOA:A3MYG1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYG1"
FT                   /inference="similar to AA sequence:RefSeq:NP_245398.1"
FT                   /protein_id="ABN73197.1"
FT                   /translation="MHFTAIFFGASGIFGALIKSRPDTLVLGRVMIALVCISLYFIWKK
FT                   QALVKLTRRELFSQILSGVLLAAHWITFFTAVQVGGVALATLGFASFPAFVALFEMLFF
FT                   REKLSYREGFLLVAITIGLILVTPEFTFGNQATLGLLWGVLSALVYGVLAVVNRKTMSK
FT                   LSGTQTSWWQYLVAMLILLPFSTTSLLNAPALDWFWIFCIGFFCTTLAYTLFVSSLDTI
FT                   NARTASMIISLEPVYAIAIAWLCFNEVPTLTMLIGGAIILLSVAWANLKK"
FT   gene            complement(97196..97660)
FT                   /locus_tag="APL_0090"
FT   CDS_pept        complement(97196..97660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73198"
FT                   /db_xref="GOA:A3MYG2"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYG2"
FT                   /inference="similar to AA sequence:RefSeq:NP_872925.1"
FT                   /protein_id="ABN73198.1"
FT                   /translation="MPFLFILFGIFLYIYFEISLLVSIGSQIGVLPLILLLIGISALGL
FT                   WFVKLRGIYAIYSVRNELSQGKIPTQAVIGSLLFILAGIFLIIPGFLSDIIAILLMLPV
FT                   TRHIAERYLMRFFKARVRFSHFSSGQFSQQDNNTFDAEFERKQDQDKWIK"
FT   gene            complement(97683..99014)
FT                   /gene="pepQ"
FT                   /locus_tag="APL_0091"
FT   CDS_pept        complement(97683..99014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="APL_0091"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73199"
FT                   /db_xref="GOA:A3MYG3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYG3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P21165"
FT                   /protein_id="ABN73199.1"
FT                   /translation="MKQLFTQHIKRLQQVVQTILETNFLSGLWIHSGTARYHFLDDQTA
FT                   PFKINPHFNYLFPFPTAENCWLFLDGKNKPTVYFYAPNDYWHTPPVAPTDAFFADEFQW
FT                   VILQDSQEIAKFIQNPTACTFIGEDENLAESLGFNQINPQKVLNQFHFERSIKSEFEIE
FT                   AIYQAQFAALKGHQAAKQAFFEGKSEFEINLAYLKASQQSDLNVPYGNIVAINQHSAIL
FT                   HYTQLDYAPNPQQQSFLIDAGATIHGYASDITRTYAADPNSEFAAMIKQMEQYKYRIID
FT                   QLTVGVNYLSYHTQMQQWIAEMLYEYDFVRLTPEQIFEEGISRAFLPHGLGHLLGLQVH
FT                   DAAGFQQNPRGTRKSPPEVYPSLRCTRDLAENMVLTIEPGFYFIDMLLNPLQNSPLARH
FT                   INWQKIAEFKQFGGIRTEDNIVMRSQGAENLTQKAEIELQLSDH"
FT   gene            99038..99277
FT                   /gene="sirA"
FT                   /locus_tag="APL_0092"
FT   CDS_pept        99038..99277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirA"
FT                   /locus_tag="APL_0092"
FT                   /product="sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73200"
FT                   /db_xref="GOA:A3MYG4"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYG4"
FT                   /inference="similar to AA sequence:RefSeq:NP_872926.1"
FT                   /protein_id="ABN73200.1"
FT                   /translation="MTDIKIDQTLDTLGLRCPEPVMLTRKTIRNMAEGEVLLIVADDPA
FT                   TTRDISSFCEFMDHQLLNSETENTPYRYWVKKGL"
FT   gene            complement(99327..99767)
FT                   /locus_tag="APL_0093"
FT   CDS_pept        complement(99327..99767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73201"
FT                   /db_xref="GOA:A3MYG5"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYG5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44831"
FT                   /protein_id="ABN73201.1"
FT                   /translation="MYDLNELRQETDEIIENLLNDGSDPEALYIIEHHVAHRDFDKLEK
FT                   LVVDAYKLGYEISEAEEVEEENGKVIFVCDIVSEVNLNADIITAQQKELLPLIEKVGAE
FT                   YEGWGTYFEDPNAEDDEYGEDGEFFDDQDEDFEFDQEEITRH"
FT   gene            complement(99769..100389)
FT                   /gene="engB"
FT                   /locus_tag="APL_0094"
FT   CDS_pept        complement(99769..100389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="APL_0094"
FT                   /product="putative GTP-binding protein EngB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73202"
FT                   /db_xref="GOA:A3MYG6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYG6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNY0"
FT                   /protein_id="ABN73202.1"
FT                   /translation="MLKLNYHKTHFLTSAPDIRHLPEDNGVEIAFAGRSNAGKSTALNA
FT                   LTNQKNLARTSKTPGRTQLINLFEVEPNCKLVDLPGYGYAAVPEQMKIQWQKALGEYLQ
FT                   KRECLRGVVILMDIRHPLKDLDQQMIEWAVSAQLPVLLLLTKADKLSQSARSKTVKMVR
FT                   EAILPFQGDIQVEAYSALNKVGIDKLSGKLDSWFAEQFLNQGA"
FT   gene            complement(100684..101100)
FT                   /locus_tag="APL_0095"
FT   CDS_pept        complement(100684..101100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73203"
FT                   /db_xref="GOA:A3MYG7"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYG7"
FT                   /inference="similar to AA sequence:RefSeq:NP_872929.1"
FT                   /protein_id="ABN73203.1"
FT                   /translation="MIWYKALFSFQGRLNRQGFWIGFAINFIFLFMVANFWLNATDFNL
FT                   ISLLPLALSLYSLSAVIIKRLHDRNRSGKAVIMAFVPVVCYGVSLSAQDTIQWLLGIMM
FT                   PMFIGTMLLLEWGVFRGNPQANQYGEKGLSIKLR"
FT   gene            complement(101138..101968)
FT                   /locus_tag="APL_0096"
FT   CDS_pept        complement(101138..101968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0096"
FT                   /product="zinc transporter family protein ZIP"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73204"
FT                   /db_xref="GOA:A3MYG8"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYG8"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00539163.1"
FT                   /protein_id="ABN73204.1"
FT                   /translation="MFDLFLSLNPILQAFIAGLFTWGCTIFGAAFVYFFKTVNRKLLDV
FT                   MMGFAAGVMIAASFWSLLAPALEYAEPSYGSLAWLPAAVGFLAGGFFLRMIDKVVPHLH
FT                   LSKPLTDAEGMPKFKQGLSKSMLLFLAITIHNIPEGLALGVTFGALASNVADHQAMLTG
FT                   AIGLAIGIGLQNIPEGSSLSLPIRGEGKSRKQAFLWGAMSAIVEPIAAVIGAAFVLSMT
FT                   AILPYALAFAAGAMIFVVVEELIPESQSGGNTDIATLGLMVGFVIMMVLDVALG"
FT   gene            complement(102119..103954)
FT                   /gene="ilvD"
FT                   /locus_tag="APL_0097"
FT   CDS_pept        complement(102119..103954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="APL_0097"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73205"
FT                   /db_xref="GOA:A3MYG9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYG9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q65QD4"
FT                   /protein_id="ABN73205.1"
FT                   /translation="MPILRSATSTQGRNMAGARALWRATGMKENDFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDMGKLVAEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRDLIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAVFVSGGPMEAGKTKLSDQLIKLD
FT                   LVDAMMKSADKTVCDDDVDAIEKSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSML
FT                   ATHADRKELFLTAGRQIVELCKRYYEQDDASVLPRSIATKAAFENAMSLDIAMGGSTNT
FT                   VLHLLAAAQEAEVDFTMADIDRLSRKVPCLSKVAPNTNKYHMEDVHRAGGIMAILGELE
FT                   RADLLHSDTRTVLGMTIGEQIAKYDITLTKDEAVHKFFRAGPAGIRTTKAFSQDCRWDT
FT                   VDDDRQNGCIRSKEFAYSQDGGLAMLTGNIALDGCIVKTAGVDESILKFTGDAIVFESQ
FT                   EEAVEGILGGKVRAGHVVIIRYEGPKGGPGMQEMLYPTTYLKSIGLGKECALLTDGRFS
FT                   GGTSGLSIGHCSPEAASGGTIGLVRDGDKIAIDIPNRSIQLLVSDEELAVRRAEQDTKG
FT                   WKPANRQREVSMALKMFGHFATSADKGAVRDKTKL"
FT   gene            complement(104072..104290)
FT                   /gene="ilvM"
FT                   /locus_tag="APL_0098"
FT   CDS_pept        complement(104072..104290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvM"
FT                   /locus_tag="APL_0098"
FT                   /product="Acetolactate synthase isozyme II small subunit
FT                   (AHAS-II)"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73206"
FT                   /db_xref="GOA:A3MYH0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYH0"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00133384.1"
FT                   /protein_id="ABN73206.1"
FT                   /translation="MQRYDLTLKAEKRPETLERILRVVRHRGFEVLTLNAQNCGNQFEI
FT                   TLSVQSERAIELLTYQLSKLIDVTVIE"
FT   gene            complement(104311..105810)
FT                   /gene="ilvG"
FT                   /locus_tag="APL_0099"
FT   CDS_pept        complement(104311..105810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="APL_0099"
FT                   /product="Acetolactate synthase isozyme II large subunit
FT                   (AHAS-II)"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73207"
FT                   /db_xref="GOA:A3MYH1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYH1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P00892"
FT                   /protein_id="ABN73207.1"
FT                   /translation="MAAIGYARATGKVGVCIATSGPGATNLITGLGDAALDSIPVVAIT
FT                   GQVASHLIGTDAFQESDVLGLSLACTKHSFIVQNIEELPEIIARAFQIAQRGRPGPVLV
FT                   DIPRDIQLALTSAKPIVYEKQAVEAQNQDLLNEAKTLLANAKRPVLYVGGGVGMAGGVQ
FT                   AVRNFLKVTNIPSVSTLKGLGTITIDDPLYMGMIGMHGTKAANYAVQECDLLIACGARF
FT                   DDRVTGKLDTFAPHAKVIHIDIDIAEINKLRKVEVALRGDLVEAVNTLAQPLDIDPWRE
FT                   DVKRLKADLDFQYVDNAGEGDINAKALLNTLSQRKPKNAIITTDVGQHQMWSAQHLQHF
FT                   APENFITSAGFGSMGFGLPAAVGAVKARPQDPVILVTGDGSIMMNIQELGTLKRGHLPV
FT                   KIVLLDNQRLGMVRQWQSLFFHGRHSNTILDDNPDFVVLASAFGIQGERIEKASEVSDA
FT                   LDRLLNAKGAYLLHVCIPEEDNVWPLVPPGACNADMLDDEI"
FT   gene            106390..107871
FT                   /gene="nrfA"
FT                   /locus_tag="APL_0100"
FT   CDS_pept        106390..107871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfA"
FT                   /locus_tag="APL_0100"
FT                   /product="Cytochrome c-552 precursor"
FT                   /EC_number="1.7.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73208"
FT                   /db_xref="GOA:A3MYH2"
FT                   /db_xref="InterPro:IPR003321"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017570"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYH2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9CPL4"
FT                   /protein_id="ABN73208.1"
FT                   /translation="MATIAMLGCLSSAAWAEEKPAQTPSLTDKALKHEKLGVVVESANH
FT                   KFAEKYPLQYNSWKATSESTDRGSALAADPRYVVLWAGYAFAKDYNKPRGHYYAITDVR
FT                   EILRTGAPKDENDGPQPMACWTCKGPDVARLIEEKGERGYFDPKWAKYGAEIVNSIGCA
FT                   DCHDTTSKEFEEGKPALRVARPHVLRALETVGWKFEDLDKHGKRTAVCANCHVEYYFKG
FT                   KTDVTFPWDKGVDVDSIEKYYDEIQFADWTHALSKAPMLKTQHPDFEIWSQGVHGKNGV
FT                   TCIDCHMPKVKDKDGKVYTDHKIGNPFDQFDATCKTCHEQSKETLEKRVKEHKHQVKEA
FT                   MIRLEDQLVKAHFEAKAAWEAGATQEEMKDILTAIRHAQWRWDYSAAGHGSHMHAPDVM
FT                   LHVIASGIDRAADARAQLGVVLAKHGVTTPVAIPDISTKEKAQKAIGLDIPKDQAAKDE
FT                   FLRTVVPQWDAEARKKGLLPAEEPKAVVAPKAEAK"
FT   gene            107892..108539
FT                   /gene="nrfB"
FT                   /locus_tag="APL_0101"
FT   CDS_pept        107892..108539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfB"
FT                   /locus_tag="APL_0101"
FT                   /product="cytochrome c-type protein NrfB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73209"
FT                   /db_xref="GOA:A3MYH3"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017564"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYH3"
FT                   /inference="similar to AA sequence:INSD:ABG89216.1"
FT                   /protein_id="ABN73209.1"
FT                   /translation="MKNIISKAGRAIALQAVAFASFLAISTASQADMPQQPKPLWTQQA
FT                   SDAQIAEDARRDPNKYCVQCHESANATGKPFHHAGKHFQKDAKSPNTGEQVTCVSCHGN
FT                   ISENHRKGVKDVMRFNPHGKASNPSLERSVHEQNQVCVACHTADKLREKFWAHDTHAAK
FT                   ISCTNCHELHPEKEPMKGIEEKQRIKLCVDCHTKVQKGEFNTPAKTEVKETK"
FT   gene            108539..109216
FT                   /gene="nrfC"
FT                   /locus_tag="APL_0102"
FT   CDS_pept        108539..109216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfC"
FT                   /locus_tag="APL_0102"
FT                   /product="nitrate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73210"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017567"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYH4"
FT                   /inference="similar to AA sequence:INSD:AAP95321.1"
FT                   /protein_id="ABN73210.1"
FT                   /translation="MTCTRRDFVSGAGAIAVVASTGLATSVTLATEKEEKKIRYAMVHD
FT                   ETSCIGCTACMDACRTTNKVPEGVSRLEIIRSEPYGEFPNVEYEFFRQSCQHCTNAPCV
FT                   AVCPTGASFVDPETGIVDVHSDLCVGCQYCIAVCPYRVRFIHPEKKSADKCNFCRDTNL
FT                   AEGKQPACVEACPTKALTFGDMNDHNSEVYKKVRENPVYRTKVALGTEPNLYHIPFGKG
FT                   EHR"
FT   gene            109216..110184
FT                   /gene="nrfD"
FT                   /locus_tag="APL_0103"
FT   CDS_pept        109216..110184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfD"
FT                   /locus_tag="APL_0103"
FT                   /product="nitrite reductase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73211"
FT                   /db_xref="GOA:A3MYH5"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017566"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYH5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45014"
FT                   /protein_id="ABN73211.1"
FT                   /translation="MNSYIPFQTPNLVWDSTIAIYLFLLGISSGAVQLAIAYRNSGAKI
FT                   AKNSDNWVIRSAAILGTLPTLIGLTLLIFHLTKPWTFWKLMFNYNGTSVMSMGVMLFQV
FT                   YMAVLVVWIAIMFKDWLAVLVNRYLPMFKFVLPLVDFAETRLLKAIEFVLFVLAAVLGA
FT                   YPGFLLSALISYPMLNNPVLPALFLASGTSSGIAATFLVILLAGKLSGESNEVHFMHKF
FT                   EVPIMVTELGLLVAFFVGLHFGGADKQLALQNALSGFWGTIFWVGVFFIGILIPLVANI
FT                   FGSHSLKHNVKFIILVSIFDLIGVLCLRYFILYAGQLTVAS"
FT   gene            110472..119936
FT                   /locus_tag="APL_0104"
FT   CDS_pept        110472..119936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0104"
FT                   /product="autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73212"
FT                   /db_xref="GOA:A3MYH6"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYH6"
FT                   /inference="similar to AA sequence:RefSeq:YP_087940.1"
FT                   /protein_id="ABN73212.1"
FT                   /translation="MNKIFKVIWSHVTQTFVVVSELTRSKSKAKASVSDVKKNGVSSLI
FT                   TLGLKLSLMSSLLSPSISTVYAAITIDKMDSYRFRDGTTINYATNSGTAKAGTGGSFSA
FT                   YNYENPGNMNYEKQNNATVYSGTIKASSGIAIGENATTETTIGGKVAYSSGVAIGDFSK
FT                   ATGGLSFALGAYSQATDIGATVIGTAGLASGFNSLAMMRQSAAKANYAMAIGTASWADA
FT                   TASLAMGASATAKGVQSIAIGSSDMLAQDGGNGRALTKYDGTNNTEASGARSVAIGTTA
FT                   RTSADDAIAIGTGAKALNTNTISIGTGNTVTGANSTAIGGPTTISGTGSHSLGNDNTIP
FT                   DDNSTVIGNNNKLSEGDSGQSTSDGSHVVGNNVQIRGENSLAFGNNAMVGDANNEGVSG
FT                   TVNATAIGTSATAKGENALAVGTGAKASKTNNTAIGTSATITKDAGEDNIAFGSGATVT
FT                   RGKNSIVMGTNSKSEATNGSSIAIGDGATIGNGVTSESVIPETQTSSTETADDGTTTQT
FT                   DTATDGLDSNEVSSQGMTVSTSTTEVKTTTVTPKDGTTGPKITTVETDTVKTTGVDNDG
FT                   IRINTTKIVTTTTPDGPTTVVENGEVSLTSGGLNNGGNRAINIAAGVNATDAVNVSQLE
FT                   AAKTHYYSVKTTTEQANFNNDTATGENSIAAGPNVWAQGVQSAVFGSPAGASSDKATAV
FT                   GNDAWAPGVQSTAIGSGVVAGGKGSVVIGSAENTEKTVPTAEAENRVAIGTHAVVTKAD
FT                   AVAIGHNSGAVNVNTTAIGSGANASGEHSTALGNKASSSGNNATALGVEANASGQESNV
FT                   LGYKANSNGYRAMALGTLSNAAGTMAIALGSQSNASGIKAQAFGSNAIASAEDAIAMGS
FT                   NANANAVSGVALGNRSMASGVSGVALGDGAASNAQQSISIGKSARTTATNSIALGNASL
FT                   ATADSAIAMGNSSSAVGSNGIAVGAKSKALKDNAIALGNNATVTANNALALGLNSVAYS
FT                   DNAIVLGTTSKATGSHAVAIGTGASAYRQNSIAMGKDSSTGGDFAVALGDSANAAAENT
FT                   LALGKNAVADKKDSVALGNNAYTGDVIATESATLAGQVYEFAGKAPIGTVSVGNQGNER
FT                   TITNVAAGRISSTSTDAINGSQLYAVSEVASRGWNIQANGDKASQVAPGASVQFIDGTN
FT                   IDITRDGNNITIATAANVVTTDTDKYVTGGKVAYDNQGNGTTTLTLKDGTEAQVTGAKN
FT                   NFVTKSETATDGKKATLTRNDGGTVDIDLTNTVNQAVTEATDKGTKYAGDKADTGAAAN
FT                   EFGRKLGETTNVKGGAQGELSDNNIGVVSNGVDTLTVKLAKALSGLTSATFGSDATDQT
FT                   VINKDGVTINSTTPDKTVSLTETGLNNGGNKITNVAEGKAGTDAVNVDQLTKAITDSAY
FT                   NWNISDGTNNTAVPDSGTVAVKGSANADSVNTVGVVTELEGTNVKVDLSQKAKDDIANG
FT                   QKHSSVAGDTNFVVTQTTTNPEGGKQYDIKLADKVVIGKDKPVTIDGTNGTVSGLTNTT
FT                   WDPNTTYTGGQAATQEQLKSVSDVVQNGWNIQANTDTATKVAPGDTVKFIDGENIKITR
FT                   AGNDITVATAKDVKFDSVKVGDKVSINNDGINAGDTKVTNVTNGTLAADSKDAVNGSQL
FT                   YATNQNVTNNAANITKNADNIAKGTVYAGDRLDAAVTGKTNNFTRALGEQTNVVGGATG
FT                   ELSDNNLAVISNGTDTLTVKLAKSLTDLTNATFGSTDTDKTVINKDGVTISSGKPEKEV
FT                   SLTDKGLNNGNNQITNVTSGLVKRDGSSVELSKAEGDVLTNAVNVGDLKTTVTNLTEEG
FT                   KGGGFGLTAEDNKDVKADLGKTVKVQGDGSVKTTIVEKDGQSALQVGLTENVTVGGQDK
FT                   PGTITVKGENSKDGVAINSKDGSIGLTGAPGKDGQDAQATIKVVDGTKGLDGNNGKDGE
FT                   SKTRIVYEKPNGGGTEEIATLNDGLNFVGDKGQVIQKKLNETLAIKGNLDVNATVTDKN
FT                   LRVDNDKDQNGELIIKMAKSLTDLTNATFSSDDSNTVIGGNGLTITPKAGDEVSLTDKG
FT                   LNNGNNTIINVAPGVNGTDAVNKDQLDGVNATANAGWNLTTNGDNTNASNVAPNSTVDL
FT                   ANTDGNIVITKAGNNVTFDLNNNLTVGGPGKDGKDGVDGQLGVQGKDGKTGVALNGKDG
FT                   TIGINGKDGSNGSITVKQGKPGVDGKDGETKTRIVYETKDETGKPTTEEVATLNDGLKF
FT                   VGDTGEVIAKKLNETLAIKGNLTATAAVTDKNLRVDNENGRLIVKMAKSLTDLTNATFG
FT                   SDNSNTTIGGNGVTITPKGGDASNTVSLTDKGLNNGNNQVTNVSTGLKDRDGNNVTLAN
FT                   ASGDVLNNAVNVGDLKDSVNNLTNATTGGFGLTDEKGNDVKADLGKTVTVQGDGSVKTE
FT                   VVEKDGKKALQIGLTNNVTVGNDKEPGTITVKGENGKDGVSISGKDGISIKGENGQDAV
FT                   SINGKDGNGAIAVNGKDGKTGVGLDGANGTIGINGKDGSNGTITLAKGEPGVDGKDGKT
FT                   RIVYETKTPDGKTVTEEVATLKDGLKFVGDDGKIITKELNETLTIKGNLSTTAAVTDKN
FT                   LRVDNVDGALIIKMARTLTDLTNATFTNAGGDKSVVDGNGLTITPINGGKTVSLTTKGL
FT                   DNGGNKVINVAAGDVNATSTDAVNGSQLYAVSEVANKGWNIQTNGSNTTNVKPGDTVNF
FT                   ANGDNIAITNDGTKVTVGLAKDVDLGEDGSIKAGDTLVNNEGVKVGDNVSLTKDGLTAG
FT                   DVKISATTGINAGNKQITNVASGLGGKKLSEAEGDTLTNAANIGDLQTAVSSVTDASQG
FT                   GGFGLADDKGQEVKQNLGKTIPVKGDGKNIITVVKDGALTVNLNKDVDLGKDGSVTTGN
FT                   TKVSDKGVSFADSLVNLTSNGLDNGGNKVTNVKAGDVNANSTDAVNGSQLYATNQNVTN
FT                   VQNEVAKGWNIEAGTVDGGKVFNASKTKVAMGDTVGVKAGKNIEITQDGSNIAIATSAN
FT                   PTFETVTTESVKVGKGDNTVAIETVTDKHGSALKVSGADGKSETRINNVADGKADNDAV
FT                   NVRQLRGVAQNVANIDNRVSKLDKRVRGIGANAAAASSLPQVYIPGKSMVALAGGAYSG
FT                   ASAVAVGYSRASDNGKVILKVNGTANSAGHYSGGVGVGYQW"
FT   gene            complement(120177..121406)
FT                   /gene="uraA"
FT                   /locus_tag="APL_0105"
FT   CDS_pept        complement(120177..121406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uraA"
FT                   /locus_tag="APL_0105"
FT                   /product="putative uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73213"
FT                   /db_xref="GOA:A3MYH7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYH7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9CPL9"
FT                   /protein_id="ABN73213.1"
FT                   /translation="MTNHQTISTPKQVFVGLQMLFVAFGALVLMPLITGLDPNTALLTA
FT                   GIGTLLFQLCTKGQVPIFLASSFAFIAPIQYGVQQWGIPTTMGGLVFTGFVYFALSALV
FT                   KWKGANILEKLFPPVVVGPVIIIIGLGLAPTAVDMALGKGTTIEPNTALLISMATLITT
FT                   LIVAVFAKGLMKLVPIMFGIVVGYILSLIFGIIDFSSVTNAAWFSLPKLTTPEFKLEAI
FT                   LYLLPIALAPAVEHVGGIMAISSVTGKDFMTKPGLHRTLLGDGVATSAAAFLGGPPNTT
FT                   YAEVTGAVMLTKNFNPRVMTFAAIWAIAISFCGKVGAFLQTIPGVVMGGIMMLVFGSIA
FT                   AVGMSTLIRAKVDMGEARNLCIVSVVMTFGIGGMLINVGEFSLKGISLCAIAAIIMNLL
FT                   LPKEAAKKAE"
FT   gene            complement(121566..125171)
FT                   /gene="putA"
FT                   /locus_tag="APL_0106"
FT   CDS_pept        complement(121566..125171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="APL_0106"
FT                   /product="bifunctional protein PutA"
FT                   /EC_number="1.5.99.8"
FT                   /EC_number="1.2.1.88"
FT                   /note="Includes: Proline dehydrogenase;
FT                   Delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73214"
FT                   /db_xref="GOA:A3MYH8"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYH8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:O52485"
FT                   /protein_id="ABN73214.1"
FT                   /translation="MPTNIYPLLPSSAVLRENISRHYRIDEAELVQQLLIEAETETLQP
FT                   EIKNLARKLIEKVRTNRQKASGVDALMHEFSLSSQEGIALMCLAEALLRIPDQVTRDKL
FT                   IKDKIAKGDWKSHIGNSPSLFVNASAWGLVFTGKLLSLNQQALSSSLNQLISKAGEPVI
FT                   RKGIDFAMRLLGKQFVTGETIQLALKNSEARFNKGFRFTYDMLGESAFTEQDAQHYYQD
FT                   YVNSIHAVGAASKGLGVYHSSGVSVKLSAIHPRYSLAQYDRVMDELYPRLRDLFLLAKR
FT                   YNIGLNIDAEEANRLEISLDLIDRLLSEPELADFDGIGIVVQAYQKRCRSVIDYLIAKA
FT                   RENNRKLMIRLVKGAYWDSEVKLAQTESASGYPVFTRKVHTDLNYVACAKKLLAAQDVV
FT                   FPQFATHNAQTLATIYHLAKGKRFEFQCLHGMGETLYDQVVGKENLNIQCRVYAPVGSY
FT                   QTLLAYLVRRLLENGSNSSFVNQIVDENVSIDKLLEDPVAKAGITAGTMHPKTPLPIKL
FT                   FADRKNSAGYELSDMHHLVQLGAQLNALADHNQYRAVPQIAEQFYQGSQRKVIYNPADQ
FT                   TQIVGEVTYANETDVEKAFAIAEQNQTAWQATPAEQRAAILEKIADLMESNMPTLFDLA
FT                   VREAGKTLNNAIAEVREAVDFCRYYANQVKRNPQAYQNPRGIIVAISPWNFPLAIFTGE
FT                   VVSALVAGNVVLAKPAEQTSLMAHYAVELFYQAGVPKSVLQCLPGSGAEIGNKLTADPR
FT                   VDGVIFTGSTETAKTINRNLQKHSKIIPLIAETGGQNALIMDSSALGEQVVADVLNSAF
FT                   DSAGQRCSALRVLYLQEDVADHILTMLKGAMAELRVGKPQLLNTDIGPVIDRTAQSRLL
FT                   AHIEKMKAVAKSYYQVPIAAEVEQNGIFVPPTLLEIDHISQIEHEVFGPVLHVIRFNAD
FT                   RFEQIIDDINSTGFGLTSGLHSRIDATIDQWLDKVHAGNLYVNRNTVGAVVGVQPFGGM
FT                   GLSGTGPKAGGPLYLQRLVKSEAWTLADLEGEAVIETDKLAQAVRQTLTGEQQSEALAL
FT                   LQTLRQKSPLAQVYKMQGITGENNYLRFEARPMIAVSNGSLFAQIKALIAIAVCGSKAV
FT                   VKKDSPLAEYAHQFAEYLMVTDDFNNLSALSVMIVLEPLSTQERQHYAECNGSILTYVE
FT                   SLELALSLLPLVHEKSISINTAAAGGNATLMSEMD"
FT   gene            complement(125274..126788)
FT                   /gene="putP"
FT                   /locus_tag="APL_0107"
FT   CDS_pept        complement(125274..126788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putP"
FT                   /locus_tag="APL_0107"
FT                   /product="sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73215"
FT                   /db_xref="GOA:A3MYH9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYH9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45174"
FT                   /protein_id="ABN73215.1"
FT                   /translation="MFNFDPTTITFIIYIIGMIAIGFIAYRVTNNLSDYILGGRRLGSF
FT                   VTALSAGASDMSGWLLMGLPGAVYSSGLIEGWLAVGLTIGAYLNWKLVAGRLRSHTEHS
FT                   GDALTLPEYFHNRFNDETRIIKILSAIIFLLFFAVYCASGVVAGARVFENLFGVPYENA
FT                   IWYGAVATILYTFIGGFLAVSWTDTIQASLMLFALILTPVFVIINVGGFEVMQETIAKA
FT                   GELAQKDYNDIFAGTTVLGVLSLLAWGLGYFGQPHIVVRFMAAESVKSLEKARRISMTW
FT                   MIICLAGAIGIGYFGMAYFFTHPEQATVVNQNKEQIFIELAKLLFNPWIAGVLLSAILA
FT                   AVMSTLSAQLLICSSAITEDLYKGILRPSATDKELVWLGRIMVLAVAALAIYIAQDPNS
FT                   QVFGLVKDAWAGFGSAFGPVVLLSLFWKRMNGFGAISGMLVGALIVYFWKDITLWANLP
FT                   EVYSMIPGFILATLAIVLVSLITPPPSKKVTDTFERADKAYLAELQ"
FT   gene            complement(127363..128148)
FT                   /gene="iclR"
FT                   /locus_tag="APL_0108"
FT   CDS_pept        complement(127363..128148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iclR"
FT                   /locus_tag="APL_0108"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73216"
FT                   /db_xref="GOA:A3MYI0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYI0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44996"
FT                   /protein_id="ABN73216.1"
FT                   /translation="MTDKESAGSQTLVRGLKLLELLSQYPNGCPLAQLSELANLNKSTV
FT                   HRLLQSLQQEGFVRPAPTTGSYRLSTKCLAIGQRALSSLNILHIAAPHLEALNLKLGET
FT                   VNFAMREGNHAILIYKLEPTTGMMKTRAYIGQRLQLYCSGMGKLFLAYDKAEYIPHYWE
FT                   IQHDTIQQLTPNTITTVPAMNAELEKIRRQQFAMDDEENEMGVSCIACPIFDHQGQVNY
FT                   AISISLSTARLKQVGIDTLRSELQTTAHKISEELGWIFP"
FT   gene            complement(128145..128720)
FT                   /locus_tag="APL_0109"
FT   CDS_pept        complement(128145..128720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73217"
FT                   /db_xref="GOA:A3MYI1"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYI1"
FT                   /inference="similar to AA sequence:RefSeq:YP_718897.1"
FT                   /protein_id="ABN73217.1"
FT                   /translation="MQSHSVQTRRQLRQSILNERAKLALEQQSIASFNLIPQALALINQ
FT                   YHTEHIALYLPFNSEISPLPLIERLQQQNKSLYLPILHPFAKGHLFFQQYDAETLFITH
FT                   KFGMQQPKPDVRKVKPLNEIEMIFTPLLACDKSGNRLGYGGGFYDRTLALTPQAISVGL
FT                   AYPFQFVENLPTEPWDIPLNHLIIGDIK"
FT   gene            complement(128991..129311)
FT                   /locus_tag="APL_0110"
FT   CDS_pept        complement(128991..129311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73218"
FT                   /db_xref="GOA:A3MYI2"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYI2"
FT                   /inference="similar to AA sequence:RefSeq:NP_873491.1"
FT                   /protein_id="ABN73218.1"
FT                   /translation="MSANYIEVQIFGQVLRLHCPPDQQENLLASAQRLEERVALLKDQS
FT                   GIIQLEKVLAIVALNLNYELEQEKQKNANNKAVLESCIHQLDNSLSKLLSGSSVAINQE
FT                   SV"
FT   gene            129389..129940
FT                   /locus_tag="APL_0111"
FT   CDS_pept        129389..129940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73219"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYI3"
FT                   /inference="similar to AA sequence:RefSeq:NP_873492.1"
FT                   /protein_id="ABN73219.1"
FT                   /translation="MAITQSTEFNQLIAQLQIAESAAEVHGFLSGLIAGGVQDESWKTL
FT                   TYQFLNDGHAFSQAPLAELSAFYRQLSESFDEANTLFSLWTPHNEDGFAVADAIADWTS
FT                   QFLLGLGLAQPKLSRETDEICEALDDLEEISKLGYNEDDDNNELLEAGEEVVEYLRVLT
FT                   LFLHSHFALNVKTSEKPQLH"
FT   gene            130046..131110
FT                   /gene="hemE"
FT                   /locus_tag="APL_0112"
FT   CDS_pept        130046..131110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="APL_0112"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73220"
FT                   /db_xref="GOA:A3MYI4"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYI4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P57964"
FT                   /protein_id="ABN73220.1"
FT                   /translation="MNQLKNDRYLKALLREPVDMTPVWMMRQAGRYLPEYKATRAEAGD
FT                   FMALCRNADLACEVTLQPLRRYALDAAILFSDILTVPDAMGLGLSFGAGEGPKFARPIE
FT                   NKAQVDNLPIPDPESELQYVMNAVRTIRRELKGEVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKIKKMMYADPKILHALLDKLADSVILYLNAQIKAGAQAVMVFDTWGGVLAHNEYKEF
FT                   SLRYMHKIVDGLIRENEGRKVPVTLFTKGGGLWLEAIAETGCDAVGLDWTVDIADARRR
FT                   VGHKVALQGNMDPSVLYAQPERIELEVKQILAGFGQGSGHVFNLGHGIHQDVPEQSPKV
FT                   FVDAVHEYSKQYHK"
FT   gene            131234..131824
FT                   /locus_tag="APL_0113"
FT   CDS_pept        131234..131824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73221"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYI5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44709"
FT                   /protein_id="ABN73221.1"
FT                   /translation="MRNPIHKRMERFESWQHLTFMACLCERMYPNYQLFCDVTQQPEKA
FT                   KIFQNILNLIWEFLTIKGTKINFDNQLEKLEEIIPDVNDYDFFGVLPAQEACEALSELL
FT                   HGIIAGSSLEQAVRISQISLGTVASYLEMQNEKELNEQELKNSEEIQDELDVQWQIYRL
FT                   LNECEARDIELILGLKEDIRTSGISNIGLKFNQ"
FT   gene            131960..132232
FT                   /gene="hupA"
FT                   /locus_tag="APL_0114"
FT   CDS_pept        131960..132232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="APL_0114"
FT                   /product="DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73222"
FT                   /db_xref="GOA:A3MYI6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYI6"
FT                   /inference="similar to AA sequence:RefSeq:NP_873494.1"
FT                   /protein_id="ABN73222.1"
FT                   /translation="MNKTELIDAIAAGAELSKKDAKAALEATLNAISESLKNGDTVQLI
FT                   GFGTFKVNERNARTGRNPRTGEEIKIAASKVPAFVAGKALKDLVK"
FT   gene            complement(132285..133136)
FT                   /gene="thyA"
FT                   /locus_tag="APL_0115"
FT   CDS_pept        complement(132285..133136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="APL_0115"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73223"
FT                   /db_xref="GOA:A3MYI7"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYI7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMH2"
FT                   /protein_id="ABN73223.1"
FT                   /translation="MKQYLDLCHRIVNEGKWVENERTGKRCLTVINADLTYNVATGEFP
FT                   LVTTRRSFWKAAIAELLGYIRGYDNAADFRKLGTKSWDANANQNLAWLANPYRKGEDDM
FT                   GLVYGAVGRNFPKADGGSVDLLRQIVDDLKKGVDNRGEIYTFYHPGVFHMGCLRPCLYS
FT                   HHFSLLDGTLYLNSTQRSADVPLGLNWNMIQCYTFLALMAQITGHKAGQAFHKIVNAHI
FT                   YEDQLELMRDVQLKRKPLASPKLWINPAIKSLEDLETWVTLDDFKVEGYEYHPAIQYPF
FT                   SV"
FT   gene            133224..133808
FT                   /locus_tag="APL_0116"
FT   CDS_pept        133224..133808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73224"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYI8"
FT                   /inference="similar to AA sequence:RefSeq:NP_873496.1"
FT                   /protein_id="ABN73224.1"
FT                   /translation="MKKLMKPIFVCLTLAVLTACSSKSSWTRLNDSEVDQKSYAIAYGA
FT                   TAQTYADRVNESYDIDSFMNGVDDWYNKKVNLPVEQIRAMILNRLMDHNIYAYYSGVLY
FT                   AADLQGNFNHLDPSCWDLVQTPSMTQGIHDAMLDIQKNKVRGDEYIKNGVEQILHLCVK
FT                   TMVEDEHKQEVNSKAKGKKSAKAAQKQKSAK"
FT   gene            133904..134914
FT                   /gene="bioB"
FT                   /locus_tag="APL_0117"
FT   CDS_pept        133904..134914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="APL_0117"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73225"
FT                   /db_xref="GOA:A3MYI9"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYI9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44987"
FT                   /protein_id="ABN73225.1"
FT                   /translation="MTTYNLRLKAKSELTPHPTAQYWRKCQVEELFEMPFMELIFKAAQ
FT                   VHREHFDPQAIQLSTLLSIKTGGCPEECEYCPQSARYDTGLEKQVMMDVEEIVEKAKIA
FT                   KARGASRFCMGAAWRGPKPKDIKVVSEIIGAVKALGLETCGTFGLLEDGMAEDLKQAGL
FT                   DYYNHNLDTDPERYNKIVHTRNHDDRMDTLGKVRHAGLKVCCGGIVGMNETRPERAGLI
FT                   ASLANLDPQPESVPINQLIKVEGTPLENAEDLDWTEFVRTIAVARITMPKSYVRLSAGR
FT                   TSMPEAMQTLCFMAGANSIFYGEKLLTTCNPEEDSDRLLMDKLDLYPLAYEPSDA"
FT   gene            complement(134978..135187)
FT                   /gene="cspC"
FT                   /locus_tag="APL_0118"
FT   CDS_pept        complement(134978..135187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC"
FT                   /locus_tag="APL_0118"
FT                   /product="cold shock-like protein CspC"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73226"
FT                   /db_xref="GOA:A3MYJ0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYJ0"
FT                   /inference="similar to AA sequence:RefSeq:NP_873498.1"
FT                   /protein_id="ABN73226.1"
FT                   /translation="MSKATGIVKWFNSTKGFGFITPDQGGKDIFVHFSGIVGSNFRTLE
FT                   EGAKVEFEVQDSERGPSAVNVKTL"
FT   gene            135550..136098
FT                   /gene="proQ"
FT                   /locus_tag="APL_0119"
FT   CDS_pept        135550..136098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proQ"
FT                   /locus_tag="APL_0119"
FT                   /product="proQ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73227"
FT                   /db_xref="GOA:A3MYJ1"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYJ1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMG8"
FT                   /protein_id="ABN73227.1"
FT                   /translation="MSEQQVKIQNGNKTNPSVKEVITYLAEKFPLCFSVEGEAKPLKVG
FT                   LFQDLAEALANDEKVSKTLLRQALRTYTMSWRYLACCKANVQRVGLQGEEAGIVDEAQA
FT                   EHAAQTLTVAKEAYAARKAEQRKEQRKEFFKKKAQEEKAKKNAANQVKKTPRVAKEASV
FT                   KATAESLAALTSKFGKGNK"
FT   gene            136190..138202
FT                   /gene="prc"
FT                   /locus_tag="APL_0120"
FT   CDS_pept        136190..138202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prc"
FT                   /locus_tag="APL_0120"
FT                   /product="tail-specific protease precursor"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73228"
FT                   /db_xref="GOA:A3MYJ2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR020992"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040573"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYJ2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45306"
FT                   /protein_id="ABN73228.1"
FT                   /translation="MKINQLSRLIAICFGTIVSSAFAVEPQIQESALVTPKPTEQHSLS
FT                   TKRVTARLTQSHYHKFKLDDEFADKIFNRYMDWLDGAHNTFLQSDIDEMRAKYAAKLDD
FT                   ELYEGKLDSAFEIYDLMTKRRYGRYKYALSLLDKEPNLKGSDQIENDREKAAFPATVEE
FT                   ANQLWEQRVKNDVINLYLKDKKWPEIKKTLIKRYNLAIKRLTQIKADDVLQTYLNAFAR
FT                   EIDPHTSYLSPRAAKAFQESMNLSLEGIGATLAMEDDVTTIKSLVPGAPAARSKKLVVG
FT                   DKIVGVGQDNDEIEDVIGWRLDDVVDKIKGKKGTKVRLEIEPEKGGKTKVITLVRDKVR
FT                   LEDSAAKLTVDKINGKNVAVIKISTFYIGLTNDVRKLLDEMKTKKVDGLIIDLRENGGG
FT                   SLTEVVELTGLFIKDGPVVQVRDAFNRIKVHEDPEADKSLYDGKIMVMINRHSASASEI
FT                   FAAAMQDYNRAIIVGQQTFGKGTVQQSRSLNFVYDLDQEPLGFIQYTIQKFYRIDGGST
FT                   QLKGVEADIKFPEIINAEKTGESFEDNALPWDKIPAASYQEAGHARDAVSALTAKHEER
FT                   IAKEPEFITLNEDIAIRKERDARKYSSLNLEERLKEDRADEAKRLKDLNARFAREGKKA
FT                   IKNIDALPKDYEAPDFFLKEAEKMMVDWLEIDKKS"
FT   gene            138299..139864
FT                   /locus_tag="APL_0121"
FT   CDS_pept        138299..139864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73229"
FT                   /db_xref="GOA:A3MYJ3"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYJ3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44285"
FT                   /protein_id="ABN73229.1"
FT                   /translation="MSKAKTFKLLPLVMLSSVVLAETNATHLQAASTENATVNHATSDA
FT                   ILPQLSFSAQQARAAELAKRADYVFEQEQIRLEEERKLQEAVLKVKQTVGDNQLLLTKS
FT                   VAKIYLDNDYASMWNDKHAEKQFLKEYALFAASGVSSKSAKALQQILNHPEGLGRDILL
FT                   TDGFLDYLYYNKNVYKNANQWLYNLGSYSPKSPSSEQINQWVESTKNDDSAQFVANLVP
FT                   RNHIYQETVQRVLAMSAGDNTKKVAKAKKTKTPEPATATGNDTFYKLALNAQRLRIIPS
FT                   FNNGIFVNIPSYQLFYFRDGQLALQSKVIVGRDDRRTPVMYSKLSNVVVNPPWNIPPTI
FT                   LNKDIVPKLAKNPGFADAAGYEIFDGKGNKINPRSVNWAQYVNSKNLPYRIRQKAGDDS
FT                   ALGRFKFNMPSSDAIYLHDTPNRGLFGKTDRALSSGCVRVERSDDLASILLKEAGWSMD
FT                   KKQKVLASQKTTSANIRSDNPVYLYYVTAWVENGKVYTLPDIYKFDTSIPKNAVNWSKV
FT                   KSVI"
FT   gene            140036..140590
FT                   /locus_tag="APL_0122"
FT   CDS_pept        140036..140590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73230"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYJ4"
FT                   /inference="similar to AA sequence:RefSeq:NP_245208.1"
FT                   /protein_id="ABN73230.1"
FT                   /translation="MNQINVQRRKWLSLGGLVLGASLLPSKVMALLSTPTPLALRFRNI
FT                   NTGDTYAATFSNGSLSSGDLGKLNYLMRDRYTNQVKRIDPMLFVKLNQIQQRLGFRNAE
FT                   VLVLSGYRSAQTNARMHRTRRGVASNSYHIRGQAVDFRISGVPLAKLKAAAESLHNGGV
FT                   GYYPRSNFVHVDTGPVRTWRG"
FT   gene            140608..141237
FT                   /locus_tag="APL_0123"
FT   CDS_pept        140608..141237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0123"
FT                   /product="glyoxalase II family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73231"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYJ5"
FT                   /inference="similar to AA sequence:RefSeq:NP_873509.1"
FT                   /protein_id="ABN73231.1"
FT                   /translation="MFNLQIIPVSAFQQNCSVIWDDNKNAAIIDAGDDADKIIQFVESQ
FT                   NLKVQKLLLTHGHLDHIMAVEKVRDHFGVEVYGSHIDDKPLFEQLPQMCEMFGIPPVKA
FT                   FLPDHWLSEDDRVEVGALRFSVRHLPGHAPGHIGFFDFENKIAFSGDVLFKDSIGRTDL
FT                   YLGNLDVLLNTIRTKMFDLDDDFIVVAGHGPHTTIGREKQHNPFLK"
FT   gene            complement(141240..141989)
FT                   /locus_tag="APL_0124"
FT   CDS_pept        complement(141240..141989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73232"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYJ6"
FT                   /inference="similar to AA sequence:RefSeq:NP_873510.1"
FT                   /protein_id="ABN73232.1"
FT                   /translation="MNALDWLESQQQAVVFCKNLAGLTACSQQIQLASGERFVLRQQND
FT                   RATTFGINYTQEVQILRYLTRLTFTPKVYYHNENSSLLTWIEGNTANCFSSSLLNKLAL
FT                   QLAELHLFPITESLPKLDLAKRCQFLWQKLPVTKQATLRFRPPFQTIQPFTLAICHHDL
FT                   HLGNFIEKNDRLYLIDWEYSAVSDPALEIAMLFSANPAINQQQQTEFLRIYLQETQFNE
FT                   GKFKRKMAEYHSAIYQLNQLWFTILEP"
FT   gene            complement(141986..142360)
FT                   /locus_tag="APL_0125"
FT   CDS_pept        complement(141986..142360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73233"
FT                   /db_xref="InterPro:IPR010824"
FT                   /db_xref="InterPro:IPR038483"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYJ7"
FT                   /inference="similar to AA sequence:RefSeq:NP_873511.1"
FT                   /protein_id="ABN73233.1"
FT                   /translation="MKQLKSYWSLAVFSLFLTACGSNPQSYIKGKSAPIVNVEAQIATQ
FT                   IEIDAKSEKVSVTNLTEYPLNLSYKLFWYDNQGITQTNNNISMQPWLSLWLNGKQSQTL
FT                   SLEKPTAESSNYRIYLRGNR"
FT   gene            complement(142362..142727)
FT                   /locus_tag="APL_0126"
FT   CDS_pept        complement(142362..142727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0126"
FT                   /product="HIT-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73234"
FT                   /db_xref="GOA:A3MYJ8"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYJ8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44956"
FT                   /protein_id="ABN73234.1"
FT                   /translation="MSNTTFEETIFSKIIRKEIPAAIVYQDELVTAFRDISPQAPTHIL
FT                   IVPNKLIPTVNHVEAEDELALGRLFTVAAKIAKEEGIAEDGYRLIVNCNVHGGQEVFHI
FT                   HMHLVGGEPLGKMLNNK"
FT   gene            complement(142799..143629)
FT                   /gene="yfeD"
FT                   /locus_tag="APL_0127"
FT   CDS_pept        complement(142799..143629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeD"
FT                   /locus_tag="APL_0127"
FT                   /product="putative iron transport system membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73235"
FT                   /db_xref="GOA:A3MYJ9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYJ9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44660"
FT                   /protein_id="ABN73235.1"
FT                   /translation="MNELVLWFVEPFAFEFMQTALFTAVLVASVCAVLSCYLILKGWSL
FT                   MGDAISHAVLPGVVISSLLGLPLAIGAFTSGLFCAISVGYLKENSRLKEDTIMGIMFSG
FT                   LFALGIVLFTALPSDQHLTHLLFGNLLGVTQNELIQTIIICTLTFSVIIFKRKDFLLYC
FT                   FDSNHAKVIGLPVKRLHYGLLALLALTIISAMQVVGVILVVAMLIAPGITAYQLSNRFD
FT                   YMLAIAMTIAISSSALGTILSYHIDAATGPTIILIQSIVFVIVLISKHFQKRKR"
FT   gene            complement(143622..144476)
FT                   /gene="yfeC"
FT                   /locus_tag="APL_0128"
FT   CDS_pept        complement(143622..144476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeC"
FT                   /locus_tag="APL_0128"
FT                   /product="putative iron transport system membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73236"
FT                   /db_xref="GOA:A3MYK0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYK0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44661"
FT                   /protein_id="ABN73236.1"
FT                   /translation="MLELLLEPFQYNYMQKAIFVSMGVGVVCAFLSAFLMLKGWSLIGD
FT                   ALSHAVVPGVAIAYALKLPYAFGAFFSGILAALAILWVKSITRIKEDAVIGFIFTTFFA
FT                   LGMFIVSLNPTSVDVNAIVMGNILGIADEDLWQVAIIIGLSLLGLIFFWKDLLLTFFDE
FT                   HHALSVGLSPLRYKILFFTLLSACVVVALQTVGAILVIAMVVTPGATAYLLTDKFPRLV
FT                   IIAILIGSLSSGIGAYLSYFLNGATGGVIVCLQTCIFLLAFCFAPKYGLISQKRKRLGA
FT                   INE"
FT   gene            complement(144477..145070)
FT                   /gene="rnhB"
FT                   /locus_tag="APL_0129"
FT   CDS_pept        complement(144477..145070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="APL_0129"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73237"
FT                   /db_xref="GOA:A3MYK1"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYK1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMF2"
FT                   /protein_id="ABN73237.1"
FT                   /translation="MSTNFIYPNAHLIAGVDEVGRGPLVGAVVTAAVILAPNNPIEGLA
FT                   DSKKLSEKKRLLLAEEIKAKALCWSLGRAEPEEIDRLNILHATMLAMQRAVAGLNIQPD
FT                   FVLVDGNRIPTLPMPAQAVIKGDSLVAEISAASILAKVARDQEMAELDVQYPEYGFAKH
FT                   KGYPTKLHFEKLEQFGATPFHRKSFAPVKKILGL"
FT   gene            complement(145093..146127)
FT                   /gene="engC"
FT                   /locus_tag="APL_0130"
FT   CDS_pept        complement(145093..146127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engC"
FT                   /locus_tag="APL_0130"
FT                   /product="putative GTPase EngC"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73238"
FT                   /db_xref="GOA:A3MYK2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYK2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMF1"
FT                   /protein_id="ABN73238.1"
FT                   /translation="MSKRRLTQNQQRRIKSNHHKKIAKPELEWQDEMLGEVQQGIVVTR
FT                   HAKHADVETEQGEIYRCNLRRTLKNVVVGDQVSWRKGNEQLQGISGVIEAIYPRKNELS
FT                   RPDYYDGIKVMAANIDQIIIVSAVLPTLSLNIIDRYLVICETAKIPALIVLNKIDLLSE
FT                   SERQEVQKQLAIYENIGYETLCLSADTGENMEKLDRYLSRGTSIFVGQSGVGKSSLINQ
FT                   LLPEVNALTGAVSDISGLGQHTTTSSRLYHLPQGGNLIDSPGIREFGLWHLEPEQITLG
FT                   YREFQSVLGTCKFRDCKHKSDPGCAVREAVEKGEINAIRFENYHRLIESRDETKSQRHF
FT                   RTEE"
FT   gene            146637..147527
FT                   /gene="gcvA"
FT                   /locus_tag="APL_0131"
FT   CDS_pept        146637..147527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvA"
FT                   /locus_tag="APL_0131"
FT                   /product="glycine cleavage system transcriptional
FT                   activator-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73239"
FT                   /db_xref="GOA:A3MYK3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYK3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45099"
FT                   /protein_id="ABN73239.1"
FT                   /translation="MNKRLPPLNALKAFESAARHLNFTKAADDLFVTQAAVSHQIKLLE
FT                   DFLGVSLFHRRNRLLELTEIGAQYFEEIQPLLEQIAVATEKVKLKNSRQILSISTTPSF
FT                   GMHWLVPRLNKFHKKYPDIEVRLTTASQDEGLLGKDIDVAIYYGSGNWQNLEAIELVQA
FT                   RIMILASPEYLRDHPITKPEDLEGKNLIHVCSHTKWKQMAEHLNLNNLEVESGPMYSNT
FT                   SMGMQAAKHGQGVVVANRILAQNAIEEGSVIEAFTTDVYDEKAFYVVYPPQMAEIAKVK
FT                   HFVEWITHEIKGSYK"
FT   gene            147527..148207
FT                   /locus_tag="APL_0132"
FT   CDS_pept        147527..148207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0132"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73240"
FT                   /db_xref="GOA:A3MYK4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYK4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P0A8Y1"
FT                   /protein_id="ABN73240.1"
FT                   /translation="MKYDWVLFDADETLFSFNSYLGLTSMLKRYGIEFTREDYEAFQAV
FT                   NKPLWVAYQNNEITAQDIQTRRFAKLSAQTGIDALQLNQELMAEMALVSKPLDGVTAML
FT                   EQLYGKVKMGIITNGFTELQQKRLANTHTEKFFEIVVVSEQIGAAKPDRQVFDYAFTLM
FT                   EQEDKTKVLMVGDTLASDVLGGNNAGIDTCWFNHSKSKNETQIRPTYEISSMDQLIEIV
FT                   KGTE"
FT   gene            148207..149190
FT                   /gene="cysB"
FT                   /locus_tag="APL_0133"
FT   CDS_pept        148207..149190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysB"
FT                   /locus_tag="APL_0133"
FT                   /product="HTH-type transcriptional regulator CysB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73241"
FT                   /db_xref="GOA:A3MYK5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037423"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYK5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45105"
FT                   /protein_id="ABN73241.1"
FT                   /translation="MKLQQLRYIVEIVNQNLNITEAAETLYTSQPGISKQVRLLESELG
FT                   INIFERNGKHIKGLTPAGEKIVAIARELLVKAQSIKSVAEEQTRPNRGVLRIATPNTQA
FT                   RYVLPPIIEKFKAKYPEVSLQLHQGSPSQIYDALMAGEVDLAITTEAQHLFEDAILLPC
FT                   YLWNRSVIVKPDHPLVKFVNQSENLTVEELGKYDLITYTFGFTGQSDLDHAFNKEGILP
FT                   HIVFTATDADVIKTYVRLGLGVGIMASMAHTPADSDLVAIDASHLFQSSMTQIAFKRGT
FT                   FLRNYMYDFINYFSPHLTKMQVEKAEQLRESNAILRLFESTKLEEK"
FT   gene            149191..149835
FT                   /locus_tag="APL_0134"
FT   CDS_pept        149191..149835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73242"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYK6"
FT                   /inference="similar to AA sequence:INSD:ABG89194.1"
FT                   /protein_id="ABN73242.1"
FT                   /translation="MGFIKKIALSFVAIFALISTAWADDFNIKYSSNYLMPAYVHFKNG
FT                   GGQYSIQSKINVPLYNIVFSAKGTERNGQFNMLSYRDTRNGKTYALAEIDSSTVKYGKA
FT                   KDPLKQEALTMPTFDLFTTAFQLSYYDQLPTSFQTTNGKKLYPTPNVKLHKVQKAVTVK
FT                   GQTYQEITYSFKTSDHKAITVKKYVGEKFPRYISYNRDGDNYELTFDSFVK"
FT   gene            complement(149916..150965)
FT                   /gene="ansB"
FT                   /locus_tag="APL_0135"
FT   CDS_pept        complement(149916..150965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansB"
FT                   /locus_tag="APL_0135"
FT                   /product="probable L-asparaginase periplasmic precursor"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73243"
FT                   /db_xref="GOA:A3MYK7"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYK7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43843"
FT                   /protein_id="ABN73243.1"
FT                   /translation="MKLKKLALSAVLSMAISSVYAAELPNITILATGGTIAGSGQSAVS
FT                   SAYQAGQLNIDTLIEAVPEMKTLANIKGEQVVKIGSQDMSDEVWLKLAKTVNSQCANTD
FT                   GFVITHGTDTMEETAYFLDMTVKCDKPVVLVGAMRPATEKSADGPLNLYNSIVVAKDKK
FT                   SAKRGVLVAMNDVVLGARDVTKTSTTAVQTFSSPNFGTLGYIHNSKVDYERAPESKHTL
FT                   NTPFTIDNLNELPKVGIIYAYSNMPTEPLKALLDAGYQGIVVAGVGNGNMNAANLALLE
FT                   QAAKNGVAVVRSSRVPTGYTTRDAEVDDSKYGFAASGTLNPQKARVLLQLALTQTKDIN
FT                   TIQQYFEDF"
FT   gene            151269..152906
FT                   /gene="pyrG"
FT                   /locus_tag="APL_0136"
FT   CDS_pept        151269..152906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="APL_0136"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73244"
FT                   /db_xref="GOA:A3MYK8"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYK8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNV5"
FT                   /protein_id="ABN73244.1"
FT                   /translation="MATNYIFVTGGVVSSLGKGIAAASLASILEARGLNVTIMKLDPYI
FT                   NVDPGTMSPTQHGEVFVTQDGAETDLDLGHYERFIRSKMSKANNFTSGKIYSEVLRKER
FT                   RGDYLGATIQVIPHITNEIKERVIEGGKGRDVVIVEVGGTVGDIESLPFLEALRQLAVD
FT                   VGREKTLFMHLTLVPYIPTAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAIPSNERK
FT                   KIALFCNVPERAVISLKDVDSIYRIPELLKSQGLDTFVCDRFRLDCPEADLSEWEQVLY
FT                   RQANPTGEVTIGMVGKYVELPDAYKSVNEALKHAGLTNRLTVNIKYIDSQDIETKGVEL
FT                   LHGLDAILVPGGFGYRGVEGKIRTAQYARENKIPYLGICLGMQIALIEYARNVAGLTQA
FT                   NSSEFDKDCPQPVVGLITEWQDESGNVETRSDESDLGGTMRLGAQQCHLIEGTKAREVY
FT                   GAETIVERHRHRYEVNNTLLPQIEAAGLKVSGLSADRKLVEIIEIPNHPWFIAAQFHPE
FT                   FTSTPRDGHPLFAGFVAAAKAYQDSHKA"
FT   gene            153009..153515
FT                   /locus_tag="APL_0137"
FT   CDS_pept        153009..153515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73245"
FT                   /db_xref="GOA:A3MYK9"
FT                   /db_xref="InterPro:IPR019275"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYK9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43947"
FT                   /protein_id="ABN73245.1"
FT                   /translation="MADPHIKSPMDFWDYFTLIMYRLGFVVASIMVLLLPYQTEWASLG
FT                   LLIAGTMLASSLHLYLKRFRFIFQFVAWIGLLCQIFGLPIFALGAMLLVVGGLSYKEYF
FT                   CFRVFGLNAQPLLVAVIWLAILLDQMLLLQISSGISGILLVVLSIQKWRMPLHFDIGDK
FT                   TKFEV"
FT   gene            complement(153561..154163)
FT                   /gene="leuD"
FT                   /locus_tag="APL_0138"
FT   CDS_pept        complement(153561..154163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="APL_0138"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73246"
FT                   /db_xref="GOA:A3MYL0"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYL0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44438"
FT                   /protein_id="ABN73246.1"
FT                   /translation="MAGLKQHSGLVVPLDAANVDTDAIIPKQFLQAITRVGFGKHLFHE
FT                   WRYLDAEETRLNPDFVLNFPQYQGATILLTRKNLGCGSSREHAPWALADYGFKVMIAPS
FT                   FADIFYNNSLNNHMLPIRLSEEEVEEIFQWVWANEGKQIHIDLEAMTVTVGDKIYRFEL
FT                   DEFRRHCLLNGLDNIGLTLQHEDAITAYESKIPAFLR"
FT   gene            complement(154174..155583)
FT                   /gene="leuC"
FT                   /locus_tag="APL_0139"
FT   CDS_pept        complement(154174..155583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="APL_0139"
FT                   /product="3-isopropylmalate dehydratase large subunit 2"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73247"
FT                   /db_xref="GOA:A3MYL1"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYL1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q65V07"
FT                   /protein_id="ABN73247.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAAGETPILYINRHLIHEVTSPQAFDGLR
FT                   VAGRQVRQIGKTFGTMDHSISTQVRDVNKLEGQAKIQVLELAKNCEANGISLFDMQTKE
FT                   QGIVHVMGPEQGLTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQARA
FT                   KSMKVEVRGKVNPGITAKDIVLAIIGKTTMAGGTGHVVEFCGEAIRNLSMEGRMTVCNM
FT                   AIEFGAKAGLVAPDETTFAYLKDRPHAPKGKDWDDAVEYWTTLKSDDDAVFDSVVVLEA
FT                   KDIAPQVTWGTNPGQVIGIDQVVPNPQEMADPVTKASAEKALAYIGLDANTDMKNIPVD
FT                   QVFIGSCTNSRIEDLRAAAAVMKGRKKADNVKRVLVVPGSGLVKEQAEKEGLDKIFIEA
FT                   GAEWRNPGCSMCLGMNDDRLGEWERCASTSNRNFEGRQGRNGRTHLVSPAMAAAAAMFG
FT                   KFVDIRHVELN"
FT   gene            155925..157040
FT                   /locus_tag="APL_0140"
FT   CDS_pept        155925..157040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73248"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYL2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44509"
FT                   /protein_id="ABN73248.1"
FT                   /translation="MILKLDIPTAQTIVKRTMQIIPNSVNVMDEEGIIIASGDPSRLGE
FT                   RHTGAVIALRKKQSVEIDENLAKQWNYEAREGLNLPIAYLGKTVGVIGISGKPNEVRQY
FT                   GELVKMAAELIVEQSVLLAKERWQQRYKEEFIRQLLRGALSEAEITQQAVFFKLDSTKP
FT                   LVAMIIKMEQPDAEKLQLLLNHLELNSKHIALAVMDLDKLVLLKTEDEFTHLCKDRGLL
FT                   SLLPEHNRHQEYKIVVGAKVTHFHQASFSYQSALHTLSYAEQLRLKKQILLFSDYKLPA
FT                   LLADFAKTWQSEELLSPFKILLAQDGKATLFKSLQQYFLSNCDLAHASEKLFIHPNTLR
FT                   YRLEKIEQITSLSFNKIEDKFILYLGASLLK"
FT   gene            157168..158430
FT                   /locus_tag="APL_0141"
FT   CDS_pept        157168..158430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73249"
FT                   /db_xref="GOA:A3MYL3"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYL3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q57493"
FT                   /protein_id="ABN73249.1"
FT                   /translation="MVTVTAIGAVVALSVAIVLILKKVPPAYGMLIGALVGGLIGGADL
FT                   SQTVSLMIGGAQGITTAVMRILAAGVLAGVLIESGAASTIAETIVKKLGETRALLALVL
FT                   STMILTAVGVFVDVAVITVSPIALALAKRSDLSKPAILLAMIGGSKAGNIMSPNPNAIA
FT                   ASDAFHLPLTSVMAAGIIPAIFGIILTYFLAKCLINKGSKVADGEVSANSSQNLPAFLP
FT                   AIAAPLCAIILLALRPIADIKVDPLIALPLGGLVGALAMGKLKQVNQFATSGLLKMSPV
FT                   AVMLLGTGALAGIIANSGLKDVLIEALTASGLPSYLLAPISGALMSLATASTTAGTVVA
FT                   SNVFSATLIELGVSALASAAMIHSGATVLDHMPHGSFFHATGGSVNMDIKERLKLIPYE
FT                   TAVGLIMAIVSTLVFGVFKLF"
FT   gene            158441..159574
FT                   /gene="glxK"
FT                   /locus_tag="APL_0142"
FT   CDS_pept        158441..159574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="APL_0142"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73250"
FT                   /db_xref="GOA:A3MYL4"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYL4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44507"
FT                   /protein_id="ABN73250.1"
FT                   /translation="MKIVIAPDSFKESLTALEVAQSIEGGFRRIFPDAQYIKVPMADGG
FT                   EGSVQSLIDATKGELLEVEVTAPLGNKVIGFLGVSGDKQTAFIEMAAASGLHLVPFEQR
FT                   NPLKTTSFGTGELIKKALDLGVNKILLGIGGSATNDGGVGMLQALGASFKNAAGEEIGF
FT                   GGEQLQQISRISLENLEPRLQSVEFEVACDVNNPLCGERGASAVFGPQKGATPEMVQTL
FT                   DNALAHFADVALAQQGIAVAERAGAGAAGGMGGGLLLLPNVQLKAGVQIIIEATRLAEH
FT                   IRDADLVITGEGRMDAQSIAGKTPVGVAKTAKQFNVPVIAIVGCLREDYNVVYQHGIDA
FT                   VFPIIRQLNSLEETLKQGRENLESSAENVARLIKLKM"
FT   gene            159593..159865
FT                   /locus_tag="APL_0143"
FT   CDS_pept        159593..159865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0143"
FT                   /product="putative acylphosphatase"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73251"
FT                   /db_xref="GOA:A3MYL5"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYL5"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00733427.1"
FT                   /protein_id="ABN73251.1"
FT                   /translation="MQQKLFIVTGHVQSVGFRFFTLQEAGKIGIKGYVKNRPEGSVEVV
FT                   AVGSDAQMAAFRNWLQKGPPTSVVCNLIEQSYQGSEQFEHFEIRR"
FT   gene            complement(159936..161495)
FT                   /locus_tag="APL_0144"
FT   CDS_pept        complement(159936..161495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0144"
FT                   /product="predicted ATP-dependent endonuclease of the OLD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73252"
FT                   /db_xref="GOA:A3MYL6"
FT                   /db_xref="InterPro:IPR022602"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYL6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P75828"
FT                   /protein_id="ABN73252.1"
FT                   /translation="MYLQQIEISGFRGINHLSLTLRPNMVLIGENAWGKSSLLDALSHI
FT                   FNVKDELYQFSEQDFHLRDHQQAQPIKLCFTFCEEENETFGQNEENHYYDIFHLNDAGL
FT                   QHVYLQISGTLTDQGVKTEYQFLDSQGVRLDIDNLQQVVRSVISHTPVYRFRDARLNKF
FT                   ANLEALSQSDNLAQSELADELRALSFLLKYYFLSTHTNKHHPNSMLDTSQLWNKVKSLC
FT                   QRLKQNNDQQLIQQVRTQLSSLFVLNQKHNQIKTPIILFEDLEARLHPRMIAIFWELVT
FT                   YLPVQRITTTNSMELLSQVPLREISRLVRYRDRTEAYSLARSSLGKEDLRKLTFHIHYN
FT                   RGLALFSRAWILVEGETEVWILTELANLLDINLEMEGIRIVEFAQCGLRPLIKYAKAMG
FT                   IEWYVLTDGDQAGEKYADIAKSMLQEDEHPSKRLTVIPRQDIEHFFYHEGLREVFVHLA
FT                   RWQPRDHKYPTKTIIKRAIQYTSKPDLAIAISSEIKQRGNQAIPRLFKKLFIKVLRLIK
FT                   EQ"
FT   gene            complement(161499..162878)
FT                   /locus_tag="APL_0145"
FT   CDS_pept        complement(161499..162878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73253"
FT                   /db_xref="InterPro:IPR021826"
FT                   /db_xref="InterPro:IPR027820"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="InterPro:IPR037153"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYL7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P0ADS0"
FT                   /protein_id="ABN73253.1"
FT                   /translation="MAVHCVNPKGSLDQLSHLEMELLTKNAQGNLYSLYRNCSLAVLNS
FT                   GAVTDDSRALLNQYPDFDINLLTKEKGVSLELHNPPKSAFVDGKMIVNIQYHLFAVLRD
FT                   IVFVNALYQYIGQHTSPQEDNKYITNLVFSILRNAKALEIGSDPNLIVCWGGHSINQTE
FT                   YQYCRAVGTELGLRQFNIVTGCGTGVMEAPMKGATIGHANQRYKHSRFIGITEPSIIAS
FT                   EPPNPIVTELIIMPDIEKRLEAFVRMGHGIVIFPGGPGTLEELLYILGVKLNPANKAQK
FT                   LPVILTAPKESADYFTAIDRFIGETLGKEAQQMYEIIIDDPILVAQRMAKAMKEIKQQR
FT                   LELADSYSFNWSLHISDEFTHPFEPTHQNMSDLNLHFDQPTERLAANLRRAFSGIVAGN
FT                   IKPATQDLIEQFGPFQLQGDRKLLDKIDRLLQTFITQHRMKLPTGEAYKPCYQILPNTE
FT                   K"
FT   gene            complement(162938..163915)
FT                   /gene="dusA"
FT                   /locus_tag="APL_0146"
FT   CDS_pept        complement(162938..163915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="APL_0146"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73254"
FT                   /db_xref="GOA:A3MYL8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYL8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNV2"
FT                   /protein_id="ABN73254.1"
FT                   /translation="MQNQFYRGRFSVAPMLDWTTRHCRYFHRQFSRHALLYTEMITAPA
FT                   IIHAKYDLLEYDPSENPVALQLGGSDPAQLAHCAKLVEERGYAEINLNVGCPSDRVQNG
FT                   MFGACLMAKADLVADCIKAMQDAVQIPVTVKHRIGIDDLDSYEFLCDFIEKVQPYSNDF
FT                   IVHARKAWLSGLSPKQNREIPPLDYERVYQLKRDFPHLNISINGGIKTIEEIKRHLAFV
FT                   DGVMVGREAYQNPSLLGEIDSQIFGENRPLVTAREAVEKMLPYIAVQTQKGVYLNHIVR
FT                   HMLGAFQNCKGARQWRRHLSENATKQGAGVEVVEQALSFVQESN"
FT   gene            164268..165245
FT                   /locus_tag="APL_0147"
FT   CDS_pept        164268..165245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0147"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73255"
FT                   /db_xref="GOA:A3MYL9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYL9"
FT                   /inference="similar to AA sequence:RefSeq:ZP_01215781.1"
FT                   /protein_id="ABN73255.1"
FT                   /translation="MSRNLFEKRLNIKPYEYPELLEFKDAIRHSYWLHTEFNFTGDIQN
FT                   YRIDINDHERHVLTRAMLAISQVEVNVKRFWGELYRYFPKPEMDDVGGTFAESEVRHKD
FT                   AYSFLLEKLGLNEMFSQIQDIEPLMNRIRYMESFMKDKDAGKGEFVLSLVLFSLFVEHI
FT                   SLFGQFLIMMSFNKHKNLFKGISNAVEATSKEEEIHGKFGIALYEILREEHSELFTPEF
FT                   FEDLKTLSSQAFEAECGILDWIFEEGDLSFISREEVENYIRSRYNNSLMTLGLEPPYDV
FT                   NPELLKETEWFDIEILSTKETDFFNKRSTDYSKKMKQITADDLF"
FT   gene            165232..166896
FT                   /gene="rnr1"
FT                   /locus_tag="APL_0148"
FT   CDS_pept        165232..166896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr1"
FT                   /locus_tag="APL_0148"
FT                   /product="ribonucleoside-diphosphate reductase large chain"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73256"
FT                   /db_xref="GOA:A3MYM0"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013350"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYM0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P50648"
FT                   /protein_id="ABN73256.1"
FT                   /translation="MTYSNSRPDFEWLNEDSRLFLQRGYLLEGTTALDRIRFIAEHAER
FT                   KLGIEGYADKFYHYMGRGYFSLSSPIWSNFGLDRGLPISCFGSYIGDSIHEIMVTTAEV
FT                   GMMSKIGGGTSAYFGDIRPRGSVIRNNGKSDGSFNFSKLFDTVIDVISQGTSRKGQFAG
FT                   YIDIEHGDIDEWLDIHTEGNPIQLMYYGVCVGHDWLESMKAGDPYKRQLWAKLLQRKTE
FT                   TGIPYLFFKDNANAGRPDVYKDKNMTVHASNLCTEIMLPSSSDESFVCCLSSMNLLYFD
FT                   EWKDTDAPEVLTYFLDVVMSEFIEKSKDMPFLERANRFATRHRALGLGVLGWHSYLQSH
FT                   NIAFDSFQAMQKNNLIFKTLQEKTLKASQELAKRFGEPELLKGYGRRNTTLMSIAPTKS
FT                   SSFILGSVSPSVEPFKSNYYVKDLAKIKTVYKNPFLEKLLQEKGLDTEEIWESILHNDG
FT                   SVQHLEQLTDEEKEVFKTFSEISQLSVIQQAAQRQKYIDQGQSINIMVHPATPARDLNQ
FT                   LYLTAEELGLKSIYYQYSMSAAQVFNRNLLSCSSCEG"
FT   gene            complement(167032..167631)
FT                   /locus_tag="APL_0149"
FT   CDS_pept        complement(167032..167631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73257"
FT                   /db_xref="GOA:A3MYM1"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYM1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNV0"
FT                   /protein_id="ABN73257.1"
FT                   /translation="MEQQETIHISISEAAQTHFRRLLEQQEENTNIRIFVVNPGTPNAE
FT                   CGVSYCPPNAVEETDTQFEYNGFSAFVDEISLPFLDEAEIDYVTDPMGSQLTLKAPNAK
FT                   MRKVADDAPFIERLDYVIQTQVNPQLASHGGRVTLIEVTEDKYAILQFGGGCNGCSMVD
FT                   VTLKEGIEKQLLAMFPDELAGVKDVTEHQRGEHSYY"
FT   gene            168086..169435
FT                   /gene="nqrA"
FT                   /locus_tag="APL_0150"
FT   CDS_pept        168086..169435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrA"
FT                   /locus_tag="APL_0150"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit A"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73258"
FT                   /db_xref="GOA:A3MYM2"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYM2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNU9"
FT                   /protein_id="ABN73258.1"
FT                   /translation="MITIKKGLDLPIAGTPAQVIHNGNTVNEVAMLGEEYVGMRPSMKV
FT                   REGDVVKKGQVLFEDKKNPGVVFTAPASGTVVTINRGEKRVLQSVVIKVEGDEQITFTR
FT                   YEAAQLASLSAEQVKQNLIESGLWTAFRTRPFSKVPALDAIPSSIFVNAMDTNPLAADP
FT                   EVVLKEYETDFKDGLTVLTRLFNGQKPVYLCKDADSNIPLSPAIEGITIKSFSGVHPAG
FT                   LVGTHIHFVDPVGATKQVWHLNYQDVIAIGKLFTTGELFTDRIISLAGPQVKNPRLVRT
FT                   RLGANLSQLTANELNAGENRVISGSVLSGATAAGPVDYLGRYALQVSVLAEGREKELFG
FT                   WIMPGSDKFSITRTVLGHFGKKLFNFTTAVHGGERAMVPIGAYERVMPLDIIPTLLLRD
FT                   LAAGDTDSAQNLGCLELDEEDLALCTYVCPGKNNYGPMLRAALEKIEKEG"
FT   gene            169440..170672
FT                   /gene="nqrB"
FT                   /locus_tag="APL_0151"
FT   CDS_pept        169440..170672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrB"
FT                   /locus_tag="APL_0151"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit B"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73259"
FT                   /db_xref="GOA:A3MYM3"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYM3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNU8"
FT                   /protein_id="ABN73259.1"
FT                   /translation="MGLKNLFEKMEPAFHKGGKYEKWYTLFEATYTILYTPGTVTRKDS
FT                   HVRDALDSKRMMIIVWLALFPAMFWGMYNVGHQALLATNHLGTLADTIANNWHYGFADA
FT                   LGATLTADAGWGSKMFLGATYFLPIYLTIFLVGGFWEVVFAMVRKHEINEGFFVTSILL
FT                   ALIVPPTLPLWQAALAATFGVVVAKEVFGGVGKNFMNPALAGRAFLFFAYPAQISGDLV
FT                   WTAADGFSGATALSQWAQGGQGALKHVVTGQEITWMDAFLGNIPGSIGEVSTLMLIIGA
FT                   AIIVFTRIASWRIIAGVMVGMAATATVFNLIGSDTNPLFSMPWHWHLVLGGFALGMFFM
FT                   ATDPVSAAFTNKGKWWYGALIGVMCVVIRVANPAYPEGMMLAILFANLFAPIFDYLVVQ
FT                   GNIKRRKAKAA"
FT   gene            170675..171448
FT                   /gene="nqrC"
FT                   /locus_tag="APL_0152"
FT   CDS_pept        170675..171448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrC"
FT                   /locus_tag="APL_0152"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit C"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73260"
FT                   /db_xref="GOA:A3MYM4"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYM4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNU7"
FT                   /protein_id="ABN73260.1"
FT                   /translation="MAKFNKDSVSGTLTVVVLLSFICSLIVAGAAVLLKPTQDIQKVLD
FT                   KQKNILQAAGLMQPNTNVQETYAKFIEPKIVDLATGDYVEGVKNFDAKAAAKDPAQNVA
FT                   INPADDKANIKVRAKYAEVYLVKDEAGKVNQVVLPMYGNGLWSIMYGFVAVQPDANTVN
FT                   GITYYEQGETAGLGGEIANPNWQKNFVGKKLFNANNEVALTVAKGASEDKDHGIDGLSG
FT                   ATLTSNGVDGSFKYWFGANGFGPYLAKFKAAMGAN"
FT   gene            171448..172071
FT                   /gene="nqrD"
FT                   /locus_tag="APL_0153"
FT   CDS_pept        171448..172071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrD"
FT                   /locus_tag="APL_0153"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit D"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73261"
FT                   /db_xref="GOA:A3MYM5"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYM5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNU6"
FT                   /protein_id="ABN73261.1"
FT                   /translation="MASNNLKKLLLSPIADNNPIALQILGICSALAVTTQLQTAVVMAI
FT                   AVSLVTAFSSMFISMIRNYIPNSIRIIVQMAIIASLVILVDQILRAYAYELSKQLSVFV
FT                   GLIITNCIVMGRAEAFAMKSGPVESFVDGIGNGLGYGAMLIIVAFLRELIGSGKLFGVT
FT                   ILQTVQDGGWYQANGLFLLAPSAFFIIGFVIWGIRTWKPEQVEK"
FT   gene            172073..172669
FT                   /gene="nqrE"
FT                   /locus_tag="APL_0154"
FT   CDS_pept        172073..172669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrE"
FT                   /locus_tag="APL_0154"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit E"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73262"
FT                   /db_xref="GOA:A3MYM6"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYM6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNU5"
FT                   /protein_id="ABN73262.1"
FT                   /translation="MEHYLSLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAV
FT                   IVVLGIAVPANQLVYTHVLKDGALVEGVDLSFLNFITFIGVIAALVQILEMILDKFFPA
FT                   LYSALGIFLPLITVNCAIFGGVSFMVQREYNFTESVVYGLGAGTGWMLAIVALAGLTEK
FT                   MKYSDVPAGLRGLGITFITVGLMALGFMSFSGIQL"
FT   gene            172680..173909
FT                   /gene="nqrF"
FT                   /locus_tag="APL_0155"
FT   CDS_pept        172680..173909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqrF"
FT                   /locus_tag="APL_0155"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit F"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73263"
FT                   /db_xref="GOA:A3MYM7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR010205"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYM7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNU4"
FT                   /protein_id="ABN73263.1"
FT                   /translation="MDSNFIFGIIAFTALVLVLAVIILFAKSKLVDSGDITISINNDPE
FT                   KGITLPAGGKLLGALASKGIFVSSACGGGGSCGQCKVQVKSGGGEILPTELSHISKKEA
FT                   KEGWRLACQVNVKSSMDVELPEEIFGVKKWECTVISNDNKATFIKELKLQIPEGEEVPF
FT                   RAGGYIQIEADPHTVNYKDFDIPKEYHEDWDKFNLWRYVSKVDEHIIRAYSMASYPEEK
FT                   GIIMLNVRIATPPPRNPDVPPGQMSSYIWSLKPGDKVTISGPFGEFFAKETDNEMVFIG
FT                   GGAGMAPMRSHIFDQLKRLKSKRKMSFWYGARSKREIFYQEDFDQLAAENDNFVWHVAL
FT                   SDALPEDNWTGYTGFIHNVLYENYLKNHEAPEDCEYYMCGPPVMNAAVIGMLKSLGVED
FT                   ENILLDDFGG"
FT   gene            174116..175147
FT                   /gene="apbE"
FT                   /locus_tag="APL_0156"
FT   CDS_pept        174116..175147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbE"
FT                   /locus_tag="APL_0156"
FT                   /product="thiamine biosynthesis lipoprotein ApbE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73264"
FT                   /db_xref="GOA:A3MYM8"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYM8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44550"
FT                   /protein_id="ABN73264.1"
FT                   /translation="MKLKSILIFAISAIFLTACNKAPEQITLKGKTMGTTYTVKYIDNG
FT                   ELQNLQKPEEVQKTLDDLLKQVNNEMSTYQPDSQISRFNAMQEVNKAVQISPDFAKVVR
FT                   EAIRLNRVTEGALDVTVGKLVNLWGFGPDKRLNKAPSAEQIAALAPSVGIEKLSVSDNS
FT                   LMKSVPNLYLDLSSIAKGFGVDKLAEHLESLGLANYLVEIGGELRGKGKNLQGVDWRIA
FT                   IEQPTLAQGQAAQITVPLHNLGMATSGNYRNYFEDEQGNRLSHIINPKELRPVSHKLAS
FT                   ITVFAPTTMTADGLSTGLFVLGPEKALEVAEREKLAVFLIIKNGEAFETKMSREFEKLI
FT                   NQK"
FT   gene            175160..175405
FT                   /locus_tag="APL_0157"
FT   CDS_pept        175160..175405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73265"
FT                   /db_xref="GOA:A3MYM9"
FT                   /db_xref="InterPro:IPR007495"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYM9"
FT                   /inference="similar to AA sequence:RefSeq:NP_872967.1"
FT                   /protein_id="ABN73265.1"
FT                   /translation="METLLITFGFFIAVIFAMSIGFIVKGKTIKGSCGGITALGMKKMC
FT                   DCEEPCDNLKAKMADGTADPEEVARFSKEPQFYEVK"
FT   gene            175634..176803
FT                   /gene="trmU"
FT                   /locus_tag="APL_0158"
FT   CDS_pept        175634..176803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="APL_0158"
FT                   /product="putative tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73266"
FT                   /db_xref="GOA:A3MYN0"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYN0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9CLA3"
FT                   /protein_id="ABN73266.1"
FT                   /translation="MTNQTQLSSKTYDTHFAKLTAEQLAENAKKKVIIGMSGGVDSSVS
FT                   AFILQQQGYQVEGLFMKNWEEDDDTDYCTAAADLADAQAVADKLGMKLHKINFAAEYWD
FT                   NVFEHFLNEYKAGRTPNPDILCNKEIKFKAFLEYAAEDLGADYIATGHYVRRSGDDNNA
FT                   QLLRGLDANKDQSYFLYTLSHKQVGQSLFPVGDIEKPIVRQIAEDLGLATAKKKDSTGI
FT                   CFIGERKFKDFLARYLPAQPGEIRTVGGKVVGRHDGLMYHTLGQRKGLGIGGVKGLSED
FT                   PFYVVEKDLINNVLVVAQGHDNSALLSSGLIATQLHWVDRQPIRENLRCTVKTRYRQTD
FT                   IACEIQPIDDDTIRVIFDDPQIAVTPGQSAVFYQGEVCLGGGVIEEQLK"
FT   gene            complement(176876..178030)
FT                   /gene="hcaT"
FT                   /locus_tag="APL_0159"
FT   CDS_pept        complement(176876..178030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcaT"
FT                   /locus_tag="APL_0159"
FT                   /product="putative 3-phenylpropionic acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73267"
FT                   /db_xref="GOA:A3MYN1"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYN1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44629"
FT                   /protein_id="ABN73267.1"
FT                   /translation="MIKLTPFQWSAFNFFGFFCAYGVFLPFLPVWLKQYGYSTEMIGLL
FT                   ASFGYLFRFAGGMLASQQVKSPNQLIPTARILTLLNLIVIVVIAWSAESIWLLFPALML
FT                   FHIFNAGAMPIGDSIASLWQQQVGIDYGKARLFGSIAFVVGSLSTGYLTGWLGENSIIW
FT                   IMFGFFILLGCGQLLTPKVNFETQQDKKSSSNLSYWQILKEPTTLRMMLAVSLILGSHA
FT                   AYYTYSTIHWSAAGISTQTSSLLWGFAVCAEILFFLFSNRLFKSWRIAHLMMIASVIAI
FT                   IRWSILASTTEITLLVISQTFHAITFGMAHYAMIRYISAQNPEKITKLQGLYFALSNCG
FT                   FTAIFTFVSGMLYQDMPNFAFWLMAIIAVPAIFIVPKKFNTTLR"
FT   gene            complement(178027..178857)
FT                   /gene="proC"
FT                   /locus_tag="APL_0160"
FT   CDS_pept        complement(178027..178857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="APL_0160"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73268"
FT                   /db_xref="GOA:A3MYN2"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYN2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P52053"
FT                   /protein_id="ABN73268.1"
FT                   /translation="MRVKMNHQKLAFIGTGNMAYAIIQGLLKSHYPASQIIACNKSNLV
FT                   RRAELQAVGIATNFTNRAAVEQAEVVVLAVKPQMMAEVCSEFSAVDFSNKTVISVAAGI
FT                   SVARLEQLLPTAKNIIRTMPNTPSLIGEGMTGLFAKKSVNSTACQFAESLMSAVGKCYW
FT                   VEQEQQINHIIAVTGSSPAYFFRFMEAMQQSAMQMGFSEADARLLVQQAALGAAKLVEA
FT                   NPNTPLSTLRENVTSKGGTTAKALEVFEQHALAETVDQAMWAAIHRAEEMEQQL"
FT   gene            179020..179928
FT                   /gene="rdgC"
FT                   /locus_tag="APL_0161"
FT   CDS_pept        179020..179928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="APL_0161"
FT                   /product="recombination-associated protein RdgC"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73269"
FT                   /db_xref="GOA:A3MYN3"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYN3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P57810"
FT                   /protein_id="ABN73269.1"
FT                   /translation="MFWFKNVMIYRLTSPLSLESHSLEDQLQQTKFTPCSQSDMSKFGW
FT                   SSPLSGSELLHFSQSKQFLLVSHKEDKLLPANVIKKETEERIAVLEEKEARKLKKTEKQ
FT                   AIKDDVVAMLLPRAFSKHQFTAIWLDLDAQLVYVDAGSSKRAEDTLALLRKTLGSLPVV
FT                   PISFALLPSEVMTNWIAKGHTPNWLNLLEEAELKSFDTDSVVRCKRQDLESEEIAQHLQ
FT                   ASKFVTKLAIDWENHFSCVLNEDATLSRVKFADEVREKNDDILKEDIAQRFDADLLLMT
FT                   EELKLFTQKMIEEFGGIKERI"
FT   gene            179938..180543
FT                   /locus_tag="APL_0162"
FT   CDS_pept        179938..180543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0162"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73270"
FT                   /db_xref="GOA:A3MYN4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYN4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P77475"
FT                   /protein_id="ABN73270.1"
FT                   /translation="MLVSTEILDQYQALIFDMDGTIIDTMPSHAKAWEITGEHFGYQVD
FT                   SSVMYELGGATTYTIGREIMQRANMPMELLEEVVQMKRKIAMDLTYEHSSLLPAFEIIQ
FT                   HYSGKKPLAVGTGAHRIQAYKLLDKFNLRPYFNTIVDADDVKEHKPSPETFLLCAERLG
FT                   VEPKHCLVFEDADLGIQAALAGGMDGFDVRTNQITRAR"
FT   gene            complement(180719..182578)
FT                   /locus_tag="APL_0163"
FT   CDS_pept        complement(180719..182578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0163"
FT                   /product="anaerobic ribonucleoside triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73271"
FT                   /db_xref="GOA:A3MYN5"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYN5"
FT                   /inference="similar to AA sequence:RefSeq:NP_872972.1"
FT                   /protein_id="ABN73271.1"
FT                   /translation="MIRLQPNQLEGKLSFIEHYLHAKNAADGSKMDANANVTQKNIATM
FT                   ENEMMKDFFVQINRAKVSNKIAELFDEELAGEYLRQIESHEIYVHDETSLKPYCVSVTM
FT                   YPFLHDGLTKLGGESKAPKHLASFCGSFVNFVFAVSSQFAGAVATVEFLTYFDYFARKD
FT                   FGDNYLTTHRSEIENHLQQVVYSINQPAAARGYQSVFWNISLYDKHYFEAMFGNFVFPD
FT                   FERPNWETTAALQIFFMKWFNQERSKAILTFPVVTAAMLTENGKCKDNEFADQMAEELS
FT                   QGNSFFIYQSDNPDSLASCCRLRNEISDHTFSYSLGAGGVATGSINVITINMNRLVQDG
FT                   RDLEEEVGKIHKYQYAYRKLMEEYLAAGMLPVYDAGFISLDKQFLTIGINGMAEAAESQ
FT                   GLTVGYNSDYMQFVQSRLKVIFEANQTASKKYGVKFNTEFVPAENLGVKNAKWDKADGY
FT                   FVPRDCYNSYFYVVEDENTNALDKFLLHGKELIEWLDGGSALHLNLDEALTQSGYRSLL
FT                   DIAAKTGCNYFCINVKITICNECSHIDKRTLCSCSKCGSQNIDYGTRVIGYLKRVSAFS
FT                   PPDKKNIACVFIIEKRLNPLCKNCLTQFLLSLSHKGRECFLLK"
FT   gene            complement(182583..183050)
FT                   /locus_tag="APL_0164"
FT   CDS_pept        complement(182583..183050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73272"
FT                   /db_xref="GOA:A3MYN6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014191"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYN6"
FT                   /inference="similar to AA sequence:RefSeq:NP_872973.1"
FT                   /protein_id="ABN73272.1"
FT                   /translation="MKNLRFCSEQIVWQEVPHETSLAFLITGCPLGCKGCHSTESWKVG
FT                   SGQILTKNYLAEQLNKYQGLISCVLFMGGEWLPEQLIPLLSYCKQRGLRTCLYTGLERD
FT                   ELSAELLSQLTYLKTGRWIAERGGLNSLTTNQRFIDLRTGENLNHLFIKGV"
FT   gene            183432..184013
FT                   /gene="rnfA"
FT                   /locus_tag="APL_0165"
FT   CDS_pept        183432..184013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfA"
FT                   /locus_tag="APL_0165"
FT                   /product="electron transport complex protein RnfA"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73273"
FT                   /db_xref="GOA:A3MYN7"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYN7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNT6"
FT                   /protein_id="ABN73273.1"
FT                   /translation="MVDYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMAT
FT                   TFVLTVASLSAYLVETYVLIPLEAQFLRTLVFILVIAVIVQLTEMIVHKTSPTLYRLLG
FT                   IYLPLITTNCAVLGVALLNVNLSNNLVESVLYGFGAALGFSLVLVLFAALRERLAAADV
FT                   PRPFQGASIALITAGLMSLAFMGFTGLVKI"
FT   gene            184034..184624
FT                   /gene="rnfB"
FT                   /locus_tag="APL_0166"
FT   CDS_pept        184034..184624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfB"
FT                   /locus_tag="APL_0166"
FT                   /product="electron transport complex protein RnfB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73274"
FT                   /db_xref="GOA:A3MYN8"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR016463"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYN8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNT5"
FT                   /protein_id="ABN73274.1"
FT                   /translation="MYILIAIAVIALIFGAILGYSSIKLKVEADPIVEQIDALLPQSQC
FT                   GQCGYPGCKPYAEAIANGDQITKCVPGGQPLVVKIADLLGVEVPAMDGVAEPEVKVALI
FT                   HEDMCIGCTKCIQACPVDAIIGTNKAMHTVIPDLCTGCELCVAPCPTNCIEMVKQQTTT
FT                   KTWNWQFDENLVIPVVNTTELQKKLVIGGGKNE"
FT   gene            184617..186929
FT                   /gene="rnfC"
FT                   /locus_tag="APL_0167"
FT   CDS_pept        184617..186929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfC"
FT                   /locus_tag="APL_0167"
FT                   /product="electron transport complex protein RnfC"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73275"
FT                   /db_xref="GOA:A3MYN9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYN9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNT4"
FT                   /protein_id="ABN73275.1"
FT                   /translation="MSNAIAVLDRIRQGNRSGELWQFPGGIHPMQNKKQSNQKPIRSLH
FT                   LPKFFYVPVVQHSGWAGELLVKVGDNVLKGQPLTKGDNYRQLPVHAPTSGTVIGIEPYV
FT                   SAHPSGLPEITVIIETDGKDEWIERRPIDDFLTLTSGQIIEKVYQYGIAGLGGAVFPTA
FT                   SKLSLADKRCKVLIINGAECEPYITCDDRLMQDYTHEFLEGIRILRYVLRPEEVVLAIE
FT                   DNKPQAIQAVEKALKGSNDITLRVIPTIYPSGASDQLVQVLTGLEIPQGKRSIEMGIVM
FT                   HNVGTVFAVKRAVMDDEPLIERVVTLTGDKIRNKGNVWARLGTPIQHLLEQVDYQADSR
FT                   FPVFLGGPMTGFILQSLQAPITKTANCIIAPDHFEYAPPEPERSCIRCSSCSDACPVGL
FT                   LPQQLYWYARSEDHDKSKEYHLDACIECGVCAYVCPSYIPLIQYFRQEKAKITEIEEKA
FT                   KKAEEAKARFEAREARLQKEKDARTARIAQAADKRREEIANSAGEDPVAAALARIKAKK
FT                   AEAQTAEPVQAKANGEPDNSELMAQRRARRLAKQAEVKNEVNDNLSINTVQQVEETDPK
FT                   KAAVAAALARARAKKAAQAPEQAVENAEKFATATEAEDPRKAAVAAALARAKAKKAAQQ
FT                   ADQQEQVQAGENTEKVAAANEAEDPRKAAVAAALARAKAKKAAQQADQQEQAQAVENTG
FT                   KVATATETEDPRKAAVAAALARAKAKKATQQEQLQAVENAEKVVTATEAEDPRKATVAA
FT                   AIARAKAKKMSQGLSND"
FT   gene            186922..187566
FT                   /locus_tag="APL_0168"
FT   CDS_pept        186922..187566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73276"
FT                   /db_xref="GOA:A3MYP0"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYP0"
FT                   /inference="similar to AA sequence:RefSeq:ZP_01121905.1"
FT                   /protein_id="ABN73276.1"
FT                   /translation="MTNLFDSLLPPFPWSFLFIQDLIGTIVFAVSGAIAARQHKMDIFG
FT                   MFILAFVTGVGGGTLRDVMIGSTPVFWMKQPIYVLMITLAVIITAVFKNNFSKKEWQTG
FT                   LLIFDAIGLGVFTVIGVQKGLDFGLHPLIAIALGGMTGCFGGVIRDILRNEVPIVLQKE
FT                   VYVTASLIGGVIFVLFYSAGVESRWVDIATVATVIVIRLLAIRFNLNLPRI"
FT   gene            187586..188632
FT                   /gene="rnfD"
FT                   /locus_tag="APL_0169"
FT   CDS_pept        187586..188632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfD"
FT                   /locus_tag="APL_0169"
FT                   /product="electron transport complex protein RnfD"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73277"
FT                   /db_xref="GOA:A3MYP1"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYP1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNT3"
FT                   /protein_id="ABN73277.1"
FT                   /translation="MFKMVSSPHTHSSNLTAKFMLWVMVAMLPALGMQAYFFGYGVFIQ
FT                   VFIALLLAVAIEIAIAKLRRKPTAFYVADLSGVLTALILAISIPPYAPYWIIVIGIIVA
FT                   LLLAKHSYGGLGQNLFNPAMVAYALLLVSFPVQMTGWLVPIDLLNEPPTFGDAISLVFS
FT                   GVTSDGFSVHQLLGSVDGIAQATPLDSAKTSMQKLGVEGVLQSPIFSGLFANGWWQINL
FT                   AFLAGGLLLIYKRIIHWQIPAAMLGMFALLSGLTDLLLPHTHLNVVSQLFSGAMMFGAF
FT                   FIATDPVTASITPRGKLIFGGLIGLFVYLIRYYGNYPDAVAFSVLLANICVPLIDHYTQ
FT                   PRLYGSGR"
FT   gene            188632..189264
FT                   /gene="rnfG"
FT                   /locus_tag="APL_0170"
FT   CDS_pept        188632..189264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfG"
FT                   /locus_tag="APL_0170"
FT                   /product="electron transport complex protein RnfG"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73278"
FT                   /db_xref="GOA:A3MYP2"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYP2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44291"
FT                   /protein_id="ABN73278.1"
FT                   /translation="MNTSKITVKYALLLGAIALICTAVSTGVYLLTKGRIDEVTAAQQR
FT                   QFLQEVVPASHFDNDLLGSCKIVNLPNAPYLNRIYIAKKSENLTAYAIQATAPDGYSGN
FT                   IALLMGVQPDGKVLGVRTLEHKETPGLGDKIETRVSNWILSFSGKLFSLENESLWAVKK
FT                   DGGQFDQFTGATVTPRAVVNNVRQSAKWVVTELAKSPEQLETFASCK"
FT   gene            189276..189962
FT                   /gene="rnfE"
FT                   /locus_tag="APL_0171"
FT   CDS_pept        189276..189962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfE"
FT                   /locus_tag="APL_0171"
FT                   /product="electron transport complex protein RnfE"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73279"
FT                   /db_xref="GOA:A3MYP3"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYP3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNT1"
FT                   /protein_id="ABN73279.1"
FT                   /translation="MNTENQIPVTEIDTTTPAEPSIWRNLLAEGVWKNNGALVQLLGLC
FT                   PLLAVSNNVTNALGLGLATLLVLVCTNTMVSLFRKFTPTDIRIPIYVMVIATVVTAVQL
FT                   LMNAFAYPVYQSLGIFIPLIVTNCIVIGRAEAFASKNSVAHSAFDGFAMGLGMTLSLVA
FT                   LGAMRELIGNGTLFDGLDLLLGDWAKSLRIDVLHLDSGLLLAILPPGAFIGLGVILAVK
FT                   NLIDKK"
FT   gene            189971..190927
FT                   /gene="msbB"
FT                   /locus_tag="APL_0172"
FT   CDS_pept        189971..190927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbB"
FT                   /locus_tag="APL_0172"
FT                   /product="lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA
FT                   acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73280"
FT                   /db_xref="GOA:A3MYP4"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011921"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYP4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44567"
FT                   /protein_id="ABN73280.1"
FT                   /translation="MTERITAREGYEHKFLKEFLYPKYWGVWLGVLALVVLAYVPARLR
FT                   DKLAVFVGRVVKNYLKKKGKKQYHRADTNLRYCFPNWSEQQREQVIERMFITVTQTMLG
FT                   IGEIAIRSVKHLQRRSEFLGLAHLQQAKQDGKNIILLVPHTWAIDASGIILHTHGMPMV
FT                   SMYNPHRNALVDWLWNATRERFGGKMHTRQNGIKPFLNDVRKGNMGYFLPDEDFGEELS
FT                   VYADFFATEKATLPGLNKMARVANAEVIPMFPIYNAEKSLYQMEILPALEFSGDPVQSA
FT                   REMNKVIEYFVTKNPEQYVWILRLLKTRRNGEDIYKR"
FT   gene            complement(190987..191973)
FT                   /locus_tag="APL_0173"
FT   CDS_pept        complement(190987..191973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73281"
FT                   /db_xref="GOA:A3MYP5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYP5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44058"
FT                   /protein_id="ABN73281.1"
FT                   /translation="MSQLIRTLKSHIRDEIIKKGGWVNSHAHADRAFTMTPEKIAIYQN
FT                   ANLQQKWDLVDEVKRNSTVDDYYRRFSQAIELMISQGVTAFGTFVDIDGVCEDRAIIAA
FT                   HKAREVYKSDIALKFANQTLKGVIEPTAKKWFDIGSEMVDMIGGLPYRDELDYGKGLEA
FT                   MDILMDKAKSLGKMLHVHVDQFNTPKEKETEQLCDKAIEHSMQGRVVAIHGISIGAHPK
FT                   EYRKMLYQKMRDSQMMVIACPMAWIDSGRKEDLQPFHNALTPADELIPEGITVAIGTDN
FT                   ICDYMVPLCEGDMWQELSLLSAGCRFTNLEEMANIASINGRKVLGLL"
FT   gene            192415..193380
FT                   /gene="tbpA"
FT                   /locus_tag="APL_0174"
FT   CDS_pept        192415..193380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="APL_0174"
FT                   /product="thiamine-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73282"
FT                   /db_xref="GOA:A3MYP6"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYP6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44984"
FT                   /protein_id="ABN73282.1"
FT                   /translation="MKLAKIAALSAFVTGVAYAQQPTLVVYTYDSFSSDWGPAPKLEPL
FT                   FEAQCQCDVKFMPFEDGITMLNRIRLEGKKTKADVMLGIDNFTMAEAEKTGLFAMHDLN
FT                   LAPLNWENKTFYPYDYSEYAFVYDKEKLANPPKSLKELVERQDLKVIYQDPRTSTVGRG
FT                   LLFWLNTVYGEQAEQAWQTLAKHTVTVGKGWSETYSAFLKGESDLVLSYSTSPLYHQWH
FT                   DKTDKYVAAQFDEGHLVQTEVAAILNSSKQKALAKQFLAFLHQPEAQKVISYHNVMKPV
FT                   VGSVPDSAFDKLPAYKPLAFKMPDATQVKSWLATWTKSWQ"
FT   gene            193587..194036
FT                   /gene="dksA"
FT                   /locus_tag="APL_0175"
FT   CDS_pept        193587..194036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="APL_0175"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73283"
FT                   /db_xref="GOA:A3MYP7"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYP7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P0ABS3"
FT                   /protein_id="ABN73283.1"
FT                   /translation="MSQVANTTSLGLLALAGVTPYQPKKDEEYMNDAQKEHFRKILRAW
FT                   HVQIMDEAERTKNQMQEEVANFADPADRATQEEEFSLELRNRDRERKLLKKIEQTLNSI
FT                   AEDEYGYCETCGVEIGLRRLEARPTADMCIDCKTLAEIREKQMGL"
FT   gene            194179..195711
FT                   /gene="pcnB"
FT                   /locus_tag="APL_0176"
FT   CDS_pept        194179..195711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="APL_0176"
FT                   /product="putative poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73284"
FT                   /db_xref="GOA:A3MYP8"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYP8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44439"
FT                   /protein_id="ABN73284.1"
FT                   /translation="MFSRQKKSKKQPLTEQETLSAKQERKVKAVELQPKSKRPAPAFNE
FT                   QSERSTKKPKKHSDLPSHLLHKKFTVNAGHYDITPKDFPKNALAIVEKLQRAGFEAYVV
FT                   GGCIRDLLLGHKPKDFDVATNAKPEEIQKIFGRQCRLIGRRFRLAHIVFGRDIYEVATF
FT                   RADHASHNSDKISKVSEEGMLLRDNVYGTLREDAQRRDFSVNSLYYDPKHNLIFDFFDG
FT                   IADLKAGKLRLIGDPVVRYQEDPVRMLRAVRFMAKLDMFLDKPSDTPIRELAHLLKNIP
FT                   AARLFDESLKLFQSGQGFKTYQLMRQYGLFEQLFPVLTPFFTERNDSNAERMLSKALNS
FT                   TDDRIRDNLRVNPAFLFAALLWYPLREKMEVLKNEGGLNSHDAMMLAANDVLAESCKAI
FT                   ALHRRHTSVIRDIWALQFQMTKRSGKRPQQTLEHVKFRAGFDLLVMRAEIEGGDLVELS
FT                   AWWHEYQFSNDAQRAEMLKAVRNVPNFAGEEKKKRRRKTFRKKKPAKKASAE"
FT   gene            195781..196251
FT                   /gene="folK"
FT                   /locus_tag="APL_0177"
FT   CDS_pept        195781..196251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="APL_0177"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73285"
FT                   /db_xref="GOA:A3MYP9"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYP9"
FT                   /inference="similar to AA sequence:RefSeq:NP_873146.1"
FT                   /protein_id="ABN73285.1"
FT                   /translation="MKTVYIALGSNLDNPLAQVKQAVESLKTFAINFEISPFYGSKPVG
FT                   PQDQPDYVNAVAKFDTDLTALELLDKLQSIENAQGRVRIRRWGERTLDLDIILYGDERI
FT                   HSERLTVPHIEMQNREFVIVPMYDLNPDLVLPSGQKLAEIYQRFKHHQMATF"
FT   gene            complement(196289..196510)
FT                   /locus_tag="APL_0178"
FT   CDS_pept        complement(196289..196510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73286"
FT                   /db_xref="InterPro:IPR025985"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYQ0"
FT                   /inference="similar to AA sequence:RefSeq:NP_873147.1"
FT                   /protein_id="ABN73286.1"
FT                   /translation="MRKSLLFAIFCLNLTACTPKVQLETPAEGITINMNVVVDHRIDVK
FT                   FDEKSRAVLQTSDNKAAKSEAVVEAPIE"
FT   gene            complement(196507..199203)
FT                   /locus_tag="APL_0179"
FT   CDS_pept        complement(196507..199203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73287"
FT                   /db_xref="InterPro:IPR021730"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYQ1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P52645"
FT                   /protein_id="ABN73287.1"
FT                   /translation="MVALLIVGGATLFSGKQLATVSNWFLPDGWQIQTPAGGIQANLEN
FT                   AHLAKFSLTYQNCPLITVDNLAVYWHSQHQVSIDKATLDYQCLTQLPPSDESPSKFSLA
FT                   PILALLPEGEAEIKALHWLNLPNDLHPRFSQLLETPSYGKFTFFQQKLTASVRQQAVEL
FT                   TAEFANQRLSGNLSYQPSEQEKHNLLFSTHLNPKDLLAIPSQFEGDYHWILPKEMIANE
FT                   VIREGSSLLSWQTDEQNHLIGDWAFASETAPQNRLNFPFRFDGQTLEIKQGKFYWDWLE
FT                   DFPLQGFINAKLTPNSFANGDYYPLKTYLRFNLLSQSKTAGKGNIVLESRDGELQADGL
FT                   NMPFQITGNVKYDDFILYSTVPVAFSGKFNDLNVKFQPKSLLRLVGKQRLLAIHDLRFP
FT                   LAGIQINKYGVNGRLHAVFKGESPDFKNINLHLDGFAKHFKIGQLDFFEDAPDNNAVKD
FT                   LWQWKVWGDTNIHTIAGKLKISGRGDWHRNLVRLNELNGELGKIHQQGVYIPKTELSLL
FT                   EPVKFAYQKWQLDGGVQIKSPEMRFDYGGIIPSPSAKLQVNGEIENLNLKGELQADKIE
FT                   PIKLFARRKLAKTASELIGRLYWREQSAKVFQPLIPFRRHWLITDGTVRGETAFSAGIE
FT                   KGIIAGGHFAIRNASLSMPNGEAKAIEFNLPYRLQDNEFDFGLKQPIDLKIGQLNLGLP
FT                   IEKIRVKVFGHYPYSRKKPLMLQQLSMNLLDGELNVERFALPQTQIAYLKLANINFEQI
FT                   LELVQYQQIELKGKANATLPFWLEGKPCYVCDGLLSQAVESNLKIQPELMKAISQTSGY
FT                   SERLLLYLLNDTKITDLRGLINVGSTGEMVLDAKLKMQLNQQEKAKINFNYNHKENIFN
FT                   LWHMINSGSYVEQNLENSIYQQLDKRK"
FT   gene            complement(199236..200000)
FT                   /locus_tag="APL_0180"
FT   CDS_pept        complement(199236..200000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73288"
FT                   /db_xref="GOA:A3MYQ2"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYQ2"
FT                   /inference="similar to AA sequence:RefSeq:NP_873150.1"
FT                   /protein_id="ABN73288.1"
FT                   /translation="MVLMLFVQMSLNHYFAPQNSIFISPYLLAFFVTNLIIFFVLWKGE
FT                   ICPGQTDRLLFVLKFFMVFSLGNFIYSVGFTPKHNPMALAGVASLMLGLFYWLFTAREK
FT                   PLNVLIYCAFGILAVGMIQYLAIYWIELPSLFNGIRANNFAQLLLGILLAGWYLMLAKS
FT                   RLDVFFKLLVQLALIVLVFNYLWSAFVLYQQLQIMPDMALLPYALYFIVQFVIFALLAW
FT                   LLLGKGEKQIKNPLGWTLATLLAMLYPFTNMI"
FT   gene            200154..200561
FT                   /gene="gloA"
FT                   /locus_tag="APL_0181"
FT   CDS_pept        200154..200561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="APL_0181"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73289"
FT                   /db_xref="GOA:A3MYQ3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYQ3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44638"
FT                   /protein_id="ABN73289.1"
FT                   /translation="MRILHTMLRVGDLDRSIKFYTEVLGMRLLRTSENPQYKYSLAFVG
FT                   YADESESAVIELTYNWGVESYELGTAFGHVALGVDDIYATIESVRAAGGKITREPGPVL
FT                   GGTTVIAFAEDPDGYKIEFIENKNAQAALGN"
FT   gene            200701..201357
FT                   /gene="dnaQ"
FT                   /locus_tag="APL_0182"
FT   CDS_pept        200701..201357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="APL_0182"
FT                   /product="DNA polymerase III, epsilon subunit and related
FT                   3'-5' exonucleases"
FT                   /EC_number="3.1.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73290"
FT                   /db_xref="GOA:A3MYQ4"
FT                   /db_xref="InterPro:IPR005987"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYQ4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VND8"
FT                   /protein_id="ABN73290.1"
FT                   /translation="MTEQVTDYNFLKNRFRGYLPVIIDVETAGLNAQTDALLELAAITV
FT                   KMDENGYLVPDQKCHFHIQPFEGANINPDSLKFNGIDIDNPLRGAVPENIAIPEMFKMV
FT                   RRAMKEQGCQRAVIVAHNATFDQAFVQAAVKRINAKRDPFHPFAMFDTATLAGFMYGQT
FT                   VLVKACQMAKIPFDGKQAHSALYDTEKTTELFCAMVNRLKDLGGFPLVSDSESNV"
FT   gene            complement(201448..202725)
FT                   /locus_tag="APL_0183"
FT   CDS_pept        complement(201448..202725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0183"
FT                   /product="predicted Mn2+ and Fe2+ transporters of the NRAMP
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73291"
FT                   /db_xref="GOA:A3MYQ5"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYQ5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P57864"
FT                   /protein_id="ABN73291.1"
FT                   /translation="MTQTQQIEPASNWQSKLKAMGPGILMASAAVGGSHIVASTQAGAI
FT                   YGWQLALIIILANLFKYPFFRFGVQYTLSSNKTLLEGYQEKGKIYLWIFFILNVIAAMI
FT                   NTAAVGIVTAAILKFIFSALGIQFDLSIPVASTVIIAVTWGILLLGKYRFLDTLSKGIM
FT                   IALTVSTVTAVIVAALKGGIQVAPDFIEPSPWNLASLGFIVALMGWMPAPIEISAINSM
FT                   WVVAKRRLNKVSYEDGIFDFNVGFIGTAILALVFLALGALVQYGSGEAVEQAGVKYIAQ
FT                   LIKMYSFAIGDWSKLLIAFIAFMCMFGTTITVIDGYSRANNEALRLLLNRKESSMASLS
FT                   IWMTVTAAIGILIITVFMSDVAKMLSFAMICSFVSTPIFAALNLSLVLKGEHKVKGGLF
FT                   WLSIVGLIYLTAFTLLFIAYELGMLS"
FT   gene            complement(203301..204422)
FT                   /gene="tyrA"
FT                   /locus_tag="APL_0184"
FT   CDS_pept        complement(203301..204422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="APL_0184"
FT                   /product="T-protein"
FT                   /EC_number="5.4.99.5"
FT                   /EC_number="1.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73292"
FT                   /db_xref="GOA:A3MYQ6"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008244"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011277"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYQ6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43902"
FT                   /protein_id="ABN73292.1"
FT                   /translation="MNPLNPLREQIDQVDQQLIRLFAERLKLVAEVGKVKSEHGIPVYA
FT                   PERETAMIAARRQEAEKQGVPADLIEDVLRRVMRESYVNENKHGFKTTNPHIHKIVIVG
FT                   GKGKLGGLFARFLTLSGYRVETLGSQDWEQAEHILSDCDLVIVCVPIVKTLETIERLQP
FT                   FLTENMILADLTSVKAQPLEKMLEVHSGPVVGLHPMFGPDIASMAKQVVACCHGRFSEK
FT                   YEWLIEQIKIWGAKIEVIDAHEHDHAMTYIQALRHFSTFTFGLHLSRQSVKLSQLLALS
FT                   SPIYRLELAMIGRLFAQDGGLYADIISDKPENLAVIESLKETFTSSLDFFKNNDKAGFI
FT                   QAFEDVHHWFGDYSEQFLKESRVLLQQANDNRK"
FT   gene            complement(204535..205596)
FT                   /gene="aroF"
FT                   /locus_tag="APL_0185"
FT   CDS_pept        complement(204535..205596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroF"
FT                   /locus_tag="APL_0185"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase,
FT                   Tyr-sensitive"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73293"
FT                   /db_xref="GOA:A3MYQ7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYQ7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P00888"
FT                   /protein_id="ABN73293.1"
FT                   /translation="MNTVVNQDSLHNVNIVDEKVLLTPAELKAELPLPEYLRKQIETSR
FT                   REISDIIHKRDQRKLIVIGPCSIHDPIAAIEYGKKLKALADTVSDKLYIVMRVYFEKPR
FT                   TTVGWKGLINDPKIDGTFDVETGLRVGRKLCLDLAELGLPLATEALDPMTPQYLADLFS
FT                   WSAIGARTTESQTHRELASGLSMAVGFKNGTDGSLSVAINAMQSAAQSHSFIGINQKGQ
FT                   VNLLHTKGNPDSHVILRGGKTPNFEKQYVEECEAALRKAGLAEAIMIDCSHGNSNKDYR
FT                   RQPLVAEDALSQLLAGNTSIIGLMIESHLNAGNQSSDQAFNQMQYGVSITDACIDWQTT
FT                   ENLLTDFAEKLRA"
FT   gene            complement(205638..206684)
FT                   /locus_tag="APL_0186"
FT   CDS_pept        complement(205638..206684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0186"
FT                   /product="ADP-heptose:LPS heptosyltransferase I"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73294"
FT                   /db_xref="GOA:A3MYQ8"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYQ8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45042"
FT                   /protein_id="ABN73294.1"
FT                   /translation="MKKQPLNICILRLSAIGDVCHTLAVVQAIQRQYPDAKISWIIGKT
FT                   EAMLMQGLENIELIPYDKKTGWKGIFTLWKTLANKRFDFLLNMQTAFRASIISLGIKAT
FT                   KKIGFNRDRAREMQWLFTNEKVEMTASPHVLDGQMMFAKAIGVTDLTPRWSLPVSQSDL
FT                   DYSAAFIDKSKKNVLIAPCSSKQEKDWGAEHNAEIAKWLAAQNINVLIAGSPSAYETET
FT                   AAKIQQLTPNCINIAGKTSLKQLAALIKQVDLVISPDTGAAHIATTQGTPVIGLYAIHN
FT                   PRRTAPYNDRHNVVSVYDQAVLDYYGKPWYELPWATKAKSKSGEKLMERISVDDVKKKI
FT                   VETLAVKL"
FT   gene            complement(206772..208211)
FT                   /gene="pykA"
FT                   /locus_tag="APL_0187"
FT   CDS_pept        complement(206772..208211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA"
FT                   /locus_tag="APL_0187"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73295"
FT                   /db_xref="GOA:A3MYQ9"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYQ9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43924"
FT                   /protein_id="ABN73295.1"
FT                   /translation="MSRKLRRTKIVCTMGPATDRGNNLEKVIAAGANMVRMNFSHGVPE
FT                   DHIERANKVREIAARLGKTVAILGDLQGPKIRVSTFKDGKIFLNIGDKFTLDADLPRGE
FT                   GHQDAVGLDYKNLPNDVVPGDILLLDDGNVQLKVLSVEGVKVHTEVTVGGPLSNNKGIN
FT                   KLGGGLSAPALTEKDKEDIKLAAKIGVDYLAVSFPQSSADLDYARQLAREAGLEAKIVA
FT                   KVERAETVATEEAMDDIILGSDVVMVARGDLGVEIGDAALVGVQKRLIRRARKLNRVVI
FT                   TATQMMESMIKKPMPTRAEVMDVANAVLDGTDAVMLSGETANGDYPVETVKSMAEVCLG
FT                   AETMPSINISRHRMEGTFATIDEAVAMSAMYTANHLEGVSALIALTHSGETAKLMSRIS
FT                   SGLPIYALSRNQQALNRTALYRGVTPVFYDEESRTFEGAKKAIALLKEKGYLMSGDLVL
FT                   LTQGDELKEGGTNTSRLLKVE"
FT   gene            208343..208834
FT                   /gene="sixA"
FT                   /locus_tag="APL_0188"
FT   CDS_pept        208343..208834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sixA"
FT                   /locus_tag="APL_0188"
FT                   /product="possible phosphohistidine phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73296"
FT                   /db_xref="GOA:A3MYR0"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYR0"
FT                   /inference="similar to AA sequence:RefSeq:NP_873020.1"
FT                   /protein_id="ABN73296.1"
FT                   /translation="MNIWIMRHGEAGFNAATDSERPLTENGRKTAYKQGQWLAKRFLEQ
FT                   SIVPDKVIVSPYLRAQQTFEALNEGMQAVDFKRNLVNSSIEIWEGVTPGGDPENVKNYL
FT                   DFLREEGAKNILIISHLPLVYDLVVSLTQHQDSVHFYPAVIAEIDWKTDFGKVSAIEYP
FT                   "
FT   gene            209057..210019
FT                   /gene="dus"
FT                   /locus_tag="APL_0189"
FT   CDS_pept        209057..210019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dus"
FT                   /locus_tag="APL_0189"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73297"
FT                   /db_xref="GOA:A3MYR1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYR1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNP2"
FT                   /protein_id="ABN73297.1"
FT                   /translation="MRIGQYELKNRIFLAPMAGITDQPFRRLCTKLGASLTFSEMMSTN
FT                   PEVWHTEKSRLRLAHHEEIGINAVQIAGSDPAEMAMAAKVNVEYGAQIIDINMGCPAKK
FT                   VNKKMAGSALLREPELVAQILDAVVNAVDVPVTLKIRTGWDQENRNCLEIAKIAEKAGI
FT                   SALTIHGRTRHCLFEGNAEYDSIKAVKQAVSIPIIANGDITSAEKAKYVLDYTQADAVM
FT                   IGRGSFGRPWLFKEVEQFLENGRLLDLPLDEKCRLMFKHIEDLHRFYGEQKGYRIARKH
FT                   VGWYADQLSPDLTFKRTFNALDSTKEQSLALEDFMKSIR"
FT   gene            210047..210343
FT                   /gene="fis"
FT                   /locus_tag="APL_0190"
FT   CDS_pept        210047..210343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="APL_0190"
FT                   /product="DNA-binding protein Fis"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73298"
FT                   /db_xref="GOA:A3MYR2"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYR2"
FT                   /inference="similar to AA sequence:RefSeq:NP_873022.1"
FT                   /protein_id="ABN73298.1"
FT                   /translation="MLEQQPVQNPLTVSMLNAQAQQVNKPLRDNVKAALKNYLSQLNGE
FT                   DPTELYELVLSEIEHPMLDMVMQYTRGNQTRAATMLGINRGTLRKKLKKYGMG"
FT   gene            complement(210408..211766)
FT                   /locus_tag="APL_0191"
FT   CDS_pept        complement(210408..211766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0191"
FT                   /product="predicted Na+-dependent transporters of the SNF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73299"
FT                   /db_xref="GOA:A3MYR3"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYR3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45320"
FT                   /protein_id="ABN73299.1"
FT                   /translation="MANKSVERQSWSNRLAYVMTVAGATVGFGATWRFPYLVGENGGGA
FT                   YVFLFCIAMIVIGIPMILVENVIGRRIKVNAIDAFGGMANGKKIASGWKILGYMGLLGA
FT                   FGILAYYMVLGGWVLNYISSLISGTLDLSTPVTVETTASYYKESIQNSPMAIIGYTALF
FT                   VLVNYFILSKGIVDGIERSVKYLMPLLFVFLLVMVIRNVTLPGAAEGIAFYLMPDFSKI
FT                   TPKLFVFVLGQVFFALSLGFGVLITLSSYLDKNENLVKTATITGIMNTLIAVLAGFMIF
FT                   PSLFSFGVAPNSGPTLVFQSLPIVFSNMWGGTLFAIIFFSLLVVAALTTSLTIYEVIIT
FT                   ALQEKTKMSRKKAIAVTLSTIFVIGNIPSVLGDNLWQHIRIMDKSIFDAFDYISGNILF
FT                   ILTALGSAIFVGFVLKDEAKKELGAGKVFTNIWFNYVKFVIPVIILVIFFNSL"
FT   gene            complement(211831..212664)
FT                   /gene="dam"
FT                   /locus_tag="APL_0192"
FT   CDS_pept        complement(211831..212664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="APL_0192"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73300"
FT                   /db_xref="GOA:A3MYR4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYR4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44431"
FT                   /protein_id="ABN73300.1"
FT                   /translation="MSNKRAFLKWAGGKYRLTTEIRKHLPPKSAQGACFVEPFVGAGSV
FT                   FLNTDYERYLLADINPDLINLFNIIKHDVEHYIKETKTLFLASEANTASFYYARRQEFN
FT                   RSSDKFRRSVLFLYLNRFGFNGLCRYNQKHEYNVPFGAYKTHYFPENELRFFAEKAQKA
FT                   EFICADFEQVFARLYQAPDNYIVYCDPPYAPLQQDTNFTHYAGGGFSLVQQEKLAQLAR
FT                   QAQTNNIPVLISNHDTAFTRQIYHGAKIKKIKVQRSIGQRADSRIKVDELFALFL"
FT   gene            complement(212657..213757)
FT                   /gene="aroB"
FT                   /locus_tag="APL_0193"
FT   CDS_pept        complement(212657..213757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="APL_0193"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73301"
FT                   /db_xref="GOA:A3MYR5"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYR5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNR5"
FT                   /protein_id="ABN73301.1"
FT                   /translation="MLQVNVELKERRYPITIGAGLLGDPNSYSSLKAGDKVMIVSNPTV
FT                   AAHYLATVTNTLNGLGCSVDSVLIPDGEKYKTLDSLNMIFTALLEKNHNRDTTLIALGG
FT                   GVIGDVAGYAAASYQRGIRFIQIPTTLLAQVDSSVGGKTAVNHPLGKNMIGAFYQPISV
FT                   IIDTNTLQTLPKREVSAGLAEVIKYGAIFDIHFFEWLESNIHHLVALKQNELEYCIQRC
FT                   CQLKADVVARDETEKGDRALLNLGHTFGHAIEAHLGYGNWLHGEAVSVGMLEAAELSRI
FT                   LGDLSAQDVSRLERLLAQAVLPTISPDGMEPSEYLPYMWRDKKVLGGQLRLVLLKSLGK
FT                   AYVTAQASEQQVLSAIERFTQREFHE"
FT   gene            complement(213831..214352)
FT                   /gene="aroK"
FT                   /locus_tag="APL_0194"
FT   CDS_pept        complement(213831..214352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="APL_0194"
FT                   /product="shikimate kinase (SK)"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73302"
FT                   /db_xref="GOA:A3MYR6"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYR6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNR4"
FT                   /protein_id="ABN73302.1"
FT                   /translation="MAEKRNIFLIGPMGAGKSTIGRQLAQMLGMEFIDSDAVIEERAGA
FT                   DIDWIFDLEGETGFRKREERIINELTQNQGVVLSTGGGSVLSKENRNVLSARGIVIYLE
FT                   TTVDKQFERTQRDKKRPLLQTENPRETLEALAKVRNPLYEEIADITLQTDEQSAKLVAT
FT                   HIIELIDNLQ"
FT   gene            complement(214614..217181)
FT                   /gene="mrcA"
FT                   /locus_tag="APL_0195"
FT   CDS_pept        complement(214614..217181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="APL_0195"
FT                   /product="membrane carboxypeptidase/penicillin-binding
FT                   protein"
FT                   /EC_number="2.4.2.-"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73303"
FT                   /db_xref="GOA:A3MYR7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYR7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P31776"
FT                   /protein_id="ABN73303.1"
FT                   /translation="MKIAKIILSALLSLIILGGIAAGLAYIHIRDSLPNVSSLKTVELQ
FT                   QPMQIFTADGKLIGEVGEQRRIPVKLAEIPQTLIDAVIATEDVRFYDHKGIDPKGIVRA
FT                   IWRSSQGDTQGASTITQQLARNFFLTPERNLERKLKEAILALEIEKVLTKDEILELYLN
FT                   KIYLGYRSHGVAAAAKTYFGKNLDQLTLGEMAIIAGLPKAPSTMNPLYSVKRAEARRNV
FT                   VLGRMLEVGKITQQQYDQAKAETVKATFYGTALEFRADYVTEMVRQEMVKRYGEDVAYN
FT                   KGFKVYATVLSTDQKAAQDALSENLINYDRRHGWRGAEKLWSGKEAWDDEKIIDHLSKL
FT                   PNSDPFIGAAVMAVGKNGYTIMLPNGDKEELQKSNAVFGKQIKLNVGEQIWVRKYKNGK
FT                   DWQLGQIPEVNSALVSLNSDNGAIEAIVGGFSFEQSRFNRATQSLVQVGSSIKPFIYAA
FT                   AMNKGLSLSTTLSDSPITITKKGQKPWTPKNADNRYEGPLRLRVALGKSKNMIAIRALQ
FT                   MAGVDYVAEYLERFGFNRDQFVATEALALGAASFTPLEMARGYAVFDNGGYLIEPYIIE
FT                   RILDNQGNELFKANPAIACMDCNIGVKYPEPTYFDGVKIHDETQLQGNSEISENDESND
FT                   TSAENDDELEIKPAVKSDAPSLMTEAAQNGTETRYAPRVISGELAFLMRSALNSAIYGE
FT                   PGQAWNGTSKALANEFKRKDIGGKTGTTNNSKVTWYAGFGANIVTTVYVGFDDNKRDLG
FT                   KGEAGARTAMPAWIKYMKVALADKKERTPVMPPNIIETKIDSVSGFLGNNLTEYFIKGT
FT                   EPTKKYIVEKAYKLPQEAKPHLEQRLGLPPKELLNSPGSFELF"
FT   gene            217320..218000
FT                   /locus_tag="APL_0196"
FT   CDS_pept        217320..218000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73304"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYR8"
FT                   /inference="similar to AA sequence:INSD:AAP95392.1"
FT                   /protein_id="ABN73304.1"
FT                   /translation="MKKFAESFKKESKNYSIGISENQAYRCFSFEYQEQRETYWQLKTD
FT                   DNRFTLPQAIECLKNPVFIRSVPFQYVWRKYLFLPINYDQAMIYRQILQVLRQELPLAI
FT                   EEVYFDYQCFPLPNDNLVRVIIYALRKNYADSLFIQPNTILDCELYCFVRGFNYLSSSE
FT                   SAQQDRIYALENKTFKLTPKGVEFNTDLTQANCHLKQLELPDSITDPVLYLTALGASLW
FT                   NGEE"
FT   gene            218072..218503
FT                   /locus_tag="APL_0197"
FT   CDS_pept        218072..218503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73305"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYR9"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ABN73305.1"
FT                   /translation="MSVAIGLAVHLQLAALQINQQNRPLAKQNQQLKTERDNLHRKLEQ
FT                   YRSSPIRDTVQTFTKSQVGAFLNLLQSLPLPQGGVEEAIFEYDDMPIMKIVGVLINSDQ
FT                   FERLEKYLSEQKTFKYSLVSFQLNEQQEIEFVFNIMLRE"
FT   gene            218506..219033
FT                   /locus_tag="APL_0198"
FT   CDS_pept        218506..219033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73306"
FT                   /db_xref="GOA:A3MYS0"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYS0"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ABN73306.1"
FT                   /translation="MLSLNRLYLLPNNYLFRVLSFIQTYFKTVCLIMFILIISYPLYRY
FT                   LYESYSHQELLLNRQRLTEEVEQEYKLYQSVSQYHQQLAEKEQYVSLLNQQLQIIFTDN
FT                   QVKPEQLQWELEQEKSIYFSVTHQVSNIFKLIRILSENSLLKFKTIHLIKLKQDKQLQL
FT                   KANVIVTEDKNE"
FT   gene            219026..219430
FT                   /locus_tag="APL_0199"
FT   CDS_pept        219026..219430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73307"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYS1"
FT                   /inference="similar to AA sequence:RefSeq:NP_873009.1"
FT                   /protein_id="ABN73307.1"
FT                   /translation="MSKYIWILFIFSSISVADPFYGEKLARENPTFSADTEIAMNTENL
FT                   TACNISLPQISRYLPAKLTQLKFIGVLKKEDKYKAILMDAQKQLFDLQVNDWLADELIQ
FT                   IIDIDLKSIRYINWQTEKNCESPTPVILKL"
FT   gene            219442..220740
FT                   /gene="hofQ"
FT                   /locus_tag="APL_0200"
FT   CDS_pept        219442..220740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofQ"
FT                   /locus_tag="APL_0200"
FT                   /product="type II secretory pathway, component HofQ"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73308"
FT                   /db_xref="GOA:A3MYS2"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYS2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P31772"
FT                   /protein_id="ABN73308.1"
FT                   /translation="MRKMIWLLLFILTPVMANTFSLSLKNAPTAEILSYLAEEYGKNIV
FT                   LSDNIETNTTLRIENSDFDSVLKSITRANKLTSAYEKQIYFIGHKKDEKAATAIGVNSD
FT                   LLKPKLITKTIKLDYAKAAEVIESLTKGSGHFLSENGYLHFDDRSNSLIIKDSPESMKN
FT                   IVQLIRNLDKPTEQIAIEARIVTISSENLQELGVRWGIFAPTNGHHKIAGSLEANGLPN
FT                   TNRLNVNFPVNNAASIALQVAKINGRVLDLELTALEQENNVEIIASPRLLTTNKKPASI
FT                   KQGTEVPYVLYNRKDEVKNIEFKEAVLGLQVTPHISNDKQILLDLVVTQNSPNSTGSTL
FT                   QGLVTIDKQELNTQVFAQHGETIVLGGIFQHLTAKGEDRVPILGSIPVLKKLFSHSSDK
FT                   ISKRELVIFVTPYIVKNGQPQISSHSSQKLAPK"
FT   gene            220866..221279
FT                   /gene="nusB"
FT                   /locus_tag="APL_0201"
FT   CDS_pept        220866..221279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="APL_0201"
FT                   /product="transcription antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73309"
FT                   /db_xref="GOA:A3MYS3"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYS3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNQ2"
FT                   /protein_id="ABN73309.1"
FT                   /translation="MKVSPRRRARECAVQALYSWYVSQNSVEEVELSFVTDQDMNGVDL
FT                   PYFRKLLRGTVLYVEAIDNDLRPFLDRAEDEVDPIERTILRLSAYELKYELDVPYKVVI
FT                   NEGIEVAKVFGSDDSHKYINGILDKLAPALGRK"
FT   gene            221347..222309
FT                   /gene="thiL"
FT                   /locus_tag="APL_0202"
FT   CDS_pept        221347..222309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="APL_0202"
FT                   /product="Thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73310"
FT                   /db_xref="GOA:A3MYS4"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYS4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q57190"
FT                   /protein_id="ABN73310.1"
FT                   /translation="MEFEVIAQYFKRKNLRSDVDLSVGDDCAVTTLKPNERLAVTTDTL
FT                   VSGTHFLPSISAADLAYKTLAVNLSDLAAMGAAPAWVSLALTLPKVDHQWLAEFSQSLF
FT                   AVLDRYHVDLIGGDTTGGPLSLTLTAQGILPQDQGLFRHQAQVGDWIFVSGSLGDSAAG
FT                   LSILLDNCKISDESDRYLVQRHLRPTPRVELGLALRAFSCCAIDISDGLLADLGHILER
FT                   SQVGAEIELDNIPLSTHLTTKYSEKEALHFALTGGEDYELCFTVSDDKRSEMERILRSQ
FT                   GIKVSCIGRITPAASGLILRQNGKQVPLPTQSGFDHFKS"
FT   gene            222322..222795
FT                   /gene="pgpA"
FT                   /locus_tag="APL_0203"
FT   CDS_pept        222322..222795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="APL_0203"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /EC_number="3.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73311"
FT                   /db_xref="GOA:A3MYS5"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYS5"
FT                   /inference="similar to AA sequence:RefSeq:NP_873013.1"
FT                   /protein_id="ABN73311.1"
FT                   /translation="MKNFNLKNPIHLFACGFGSGLLKPAPGTWGSLAGVLIAVLLWNLT
FT                   ESSLFFIGLTLVSFIAGCHICEKTSRDLNVHDDGRIVWDEIVAIFLMFAFLPEYNGLAY
FT                   TLTFICFRFFDVLKPYPIRYFDEKLETGLGIMFDDILAAIYALIALHFIYWLI"
FT   gene            222804..223430
FT                   /locus_tag="APL_0204"
FT   CDS_pept        222804..223430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0204"
FT                   /product="putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73312"
FT                   /db_xref="GOA:A3MYS6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYS6"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00733454.1"
FT                   /protein_id="ABN73312.1"
FT                   /translation="MLTILLVHLAGLASPGPDFFYVVRQSASHSTKAGILAAIGISLGI
FT                   IFWASFAIFGLAWLSNTIGTVFQFLIMVIGGIYLSYIGSLMVRVTKNATFTNEPTNLRV
FT                   LDNVTEIKKGLLINIFNAKAGVYFTSVVSAFLAQFTQTSDLFLLLFLFVFSTLIYFILV
FT                   ALLFSRRPIQEFYTKYSRYIDNVAGVIFILFGMILIFDGIKGLIS"
FT   gene            complement(223489..224526)
FT                   /locus_tag="APL_0205"
FT   CDS_pept        complement(223489..224526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0205"
FT                   /product="predicted rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73313"
FT                   /db_xref="GOA:A3MYS7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYS7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44703"
FT                   /protein_id="ABN73313.1"
FT                   /translation="MKPKFNENKPRFQTVEERRDNKFQTKSNRFEDKPRFDKPKFGGDK
FT                   ACFDRKDHQEAREAIYPTIGKKAAGEGNVQISVKGGNNTMKEKKTGPLSPRAPEKIKKN
FT                   RAEEMKVYGENACIALFKQRPDAIVRLWATVEGAKKLGDMLSYLAEHKKAYHVVDRAEM
FT                   ERVTGTEHHGDVCLLVKKAVPFSLEGYLQVPRKRDCLVLLDAVNNAQNVGGIIRTCAFY
FT                   GVNGVIVESADTLNSSAAARVAEGGLEFVRPLETKNKQIALTQLRNAGYQVVHLTRNKQ
FT                   AAPLAKTKLAAKTVFVLSEIPAQDIEYPEDTTVQLSFENPLNSGLNVAVSTGILLNQWY
FT                   QANII"
FT   gene            224692..225504
FT                   /gene="suhB"
FT                   /locus_tag="APL_0206"
FT   CDS_pept        224692..225504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="APL_0206"
FT                   /product="Inositol-1-monophosphatase (IMPase)"
FT                   /EC_number="3.1.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73314"
FT                   /db_xref="GOA:A3MYS8"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYS8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9CNV8"
FT                   /protein_id="ABN73314.1"
FT                   /translation="MNPMLNIAIRAARKAGNIIAKGYEQAASEIEVAQKGTNDYVTAID
FT                   KAAEAAIIEVIRKSYPDHAIVGEESGILAGENENVQWVIDPLDGTTNFVKRLPHFAVSI
FT                   AVRENGRTTVGVVYDPIRNELFTAVRGEGAKLNEFRLRVETERRDLNGTVLATGFPFKA
FT                   AKHRPAHLNMLEGLMNNGVADFRRTGSAALDLAYVAANRVDGYFEIGLKPWDCAAGDLI
FT                   VREAGAIVTNFVGGTDYLKSGNVVAGQARVVKEILNAIQPTLTEDLKN"
FT   gene            225625..227478
FT                   /gene="dxs"
FT                   /locus_tag="APL_0207"
FT   CDS_pept        225625..227478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="APL_0207"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase (DXPS)"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73315"
FT                   /db_xref="GOA:A3MYS9"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYS9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNP7"
FT                   /protein_id="ABN73315.1"
FT                   /translation="MQNKYPLLSQINSPEDLRLLAKEQLQSVADELRAYLLESVSQTSG
FT                   HLASGLGVVELTVALHYVYQTPFDQLIWDVGHQAYPHKILTGRRDQMHTIRQKNGIHPF
FT                   PWREESLYDVLSVGHSSTSISAGVGIAVAAEKENAGRKTVCVIGDGAITAGMAFEAMNH
FT                   AGALHTDMLVILNDNEMSISENVGALNNHLARIFSGSIYTTVRDGSKKVLDKVPTIKNF
FT                   MKKSEEHMKGVISPESTLFEELGFNYIGPIDGHNIDELVKTLSNMRELKGPQFLHIRTK
FT                   KGKGYEPAENDPIGYHGVPKFDPTCGQLPKSKTIPTYSDIFGNWLCEMAEQDSKLIGIT
FT                   PAMREGSGMVEFSKRFPEQYFDVAIAEQHAVTFGAGLAIAGYKPVVAIYSSFLQRAYDQ
FT                   LIHDVAIQNLPVIFAIDRAGIVGADGQTHQGAFDVSFMRCIPNMTIMCPSDENEMRQML
FT                   YTAYRMNTPTAVRYPRGNAQGVALAPMQALEVGKGKLIQQGQKVAILNFGPLLNEARIV
FT                   AEKHNYTLADMRFVKPLDEQLVAELADSHELLVTLEENAIQGGAGSAVNEYLQKIGKIR
FT                   PLVMLGIPDFFVPQATQAESYADLGLDAAGIEQRIQAVVNQ"
FT   gene            complement(227524..227862)
FT                   /locus_tag="APL_0208"
FT   CDS_pept        complement(227524..227862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0208"
FT                   /product="putative transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73316"
FT                   /db_xref="GOA:A3MYT0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYT0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:O05086"
FT                   /protein_id="ABN73316.1"
FT                   /translation="MLKQAVTKLPKDAKPILHSDQGWQYQMADYQEMLRKHHIKQSMSR
FT                   KANCLDNGAMESFFGRLKTECYFGKRFETFEQLEKVIHEYIHYYNNERIQVKLKGLSLV
FT                   QYRTQSLN"
FT   gene            complement(227895..228212)
FT                   /locus_tag="APL_0209"
FT   CDS_pept        complement(227895..228212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0209"
FT                   /product="putative transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73317"
FT                   /db_xref="GOA:A3MYT1"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYT1"
FT                   /inference="similar to AA sequence:RefSeq:NP_439862.1"
FT                   /protein_id="ABN73317.1"
FT                   /translation="MDFPLEILLPLTGLKRSTFFYHLPPKIDKNAVIRQKVIEIYQDND
FT                   GNYGYRRITLKLRDFLGAINHKRIQRIMQQLDLKGKCKQRKYRSYQGEVGKIAENVLPM
FT                   I"
FT   gene            complement(228224..228733)
FT                   /locus_tag="APL_0210"
FT   CDS_pept        complement(228224..228733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0210"
FT                   /product="predicted transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73318"
FT                   /db_xref="GOA:A3MYT2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYT2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q57066"
FT                   /protein_id="ABN73318.1"
FT                   /translation="MTKYNSLFKQQVIEFYLQNDKNRLFTQRYFQLSKKTLTRWIAQFN
FT                   HNGINGLAVIGKKQKYSPEFKLTVIQAVKKGQFSAESASLHFGIANSGSISQWLHTFEE
FT                   QGINGLLPKPKGRPTMKPKYPKMPPPPKTEEERLRYRILELEAENAYLKKLREFNQQKM
FT                   RQKQPS"
FT   gene            complement(228822..230087)
FT                   /gene="glyA"
FT                   /locus_tag="APL_0211"
FT   CDS_pept        complement(228822..230087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="APL_0211"
FT                   /product="glycine/serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73319"
FT                   /db_xref="GOA:A3MYT3"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYT3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43844"
FT                   /protein_id="ABN73319.1"
FT                   /translation="MFTANMNIQDYDPILWQAIENENRRQEEHIELIASENYASPRVMQ
FT                   AQGSQFTNKYAEGYPGKRYYGGCEYADIVEQLAIDRAKQLFGADYVNVQPHSGSQANAA
FT                   VYGALIQPNDTILGMDLAHGGHLTHGAKVSFSGKIYNSVLYGITAEGLIDYEDVRQKAL
FT                   ECKPKMIVAGFSAYSQIVDWAKMREIADEVGAYLFVDMAHVAGLIAAGVYPSPLPYAHV
FT                   VTTTTHKTLGGPRGGLILSACGDEEIYKKLQSSVFPANQGGPLVHIIAAKAVCFKEALE
FT                   PEYKIYQQNVVKNAKAMVEVFKQRSYEVISNGTENHLFLVSFVKQGLTGKAADAALGQA
FT                   NITVNKNSVPNDPQKPFITSGIRIGTPAVTRRGFKEADVQALAGWMCDVLDSIGKDNHE
FT                   QVIAETKAKVLDICARLPVYAK"
FT   gene            complement(230318..231205)
FT                   /gene="pnnK"
FT                   /locus_tag="APL_0212"
FT   CDS_pept        complement(230318..231205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnnK"
FT                   /locus_tag="APL_0212"
FT                   /product="probable inorganic polyphosphate/ATP-NAD kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73320"
FT                   /db_xref="GOA:A3MYT4"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYT4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKR8"
FT                   /protein_id="ABN73320.1"
FT                   /translation="MKPEERFFECIAIVGKPRHEIALETHLAVYNWLKDRHYRVLVEKS
FT                   IAQQLNLPEARSLEEIGQQANLVIVIGGDGNMLGMARRLAEYQVPLIGINRGNLGFLTD
FT                   IAPHSTFEQLHNCIERGEFVIEERFLLEARIERNGKIIATNNALNEVVIHPTQVARIIE
FT                   FEVYIDGKFAFSQRSDGLIISTPTGSTAYSLSAGGPILTPNMNAIALVPMHPHTLSSRP
FT                   LVIDGDSQISLRFAQYNQPSLEVSCDGQYDLPFTPEDRIIVEKSPNKLRLLHLKDYNYF
FT                   TVLGSKLGWSSKLF"
FT   gene            complement(231296..234643)
FT                   /locus_tag="APL_0213"
FT   CDS_pept        complement(231296..234643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73321"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR013395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYT5"
FT                   /inference="similar to AA sequence:RefSeq:NP_245249.1"
FT                   /protein_id="ABN73321.1"
FT                   /translation="MNILLISQCNKNALTETRRILDQFAERCGDRCWQTAITQAGLETL
FT                   HNMLRQTARKNTAVACYWTHGKNLTELLWIVGDKSQFNAEGRVPTNRTQRNILRADDEN
FT                   GWLSAYSIQILTAIAALLHDIGKANIAFQQKLKPKAKFFPDCYRHEWISTRLFEAMISG
FT                   CDTDEQWLARLANWQNYIEENPDWLPNLTLIADKSDHPHNFSHFPPLAKVVLWLILSHH
FT                   KLPFTQKTLDCHSDQERILSEHFMLKTAVEPFYRFLAPVEHWVMNQSEHPQPENFWQFK
FT                   TLVMESKAWQKAMQRWANKALNHAPLRELSQLNKTINDPFLLILSRLCLIVGDHNYSSA
FT                   PADRLLGDLNFFEKLIANTDKKTKQPKQALDEHLLGVCKTSAKFARLLPKLAKELPHIQ
FT                   QHRPFTKRTNLDRFKWQNRAFELARSLQSESEQAGFFGVNMASTGCGKTLANAKIMYGL
FT                   SNQDGARFTIALGLRVLTLQTGLALRQKLMLSSEQLAVLVGGSATKQLFELQNESVQSG
FT                   SESAQEWFEDNEVYGMNFLESGIAEEEFGTLLADNKAKKLLYAPIVSCTLDHMIQATET
FT                   IRGGKHIVPLLRLLTSDLVLDEPDDFSQSDLPALSRLVHLAGMFGSKVLLSSATLTPDL
FT                   ISGLFNAYQAGRKIYNRHQGINPELPICCAWIDEYKQQQQKCAAVKEFERYHALFTASR
FT                   AEKLMQSPIRHKAEIIQLPPFSAVENQDINYTMLADSLIEQAITLHQRYAQQDPISKKF
FT                   VSVGLIRFANIKPMIPLVETLFKTPLNTQFSDYKIHLCCYHSRQLLLLRSKLEEKLDRI
FT                   LNRHEPEALFSQPEIMSALTQDKAVHHIFIVLGSPVTEVGRDHDYDWAIVDPSSMRSII
FT                   QLAGRVWRHRPEKIATQANILLLPTNWRGLQTKNNGSEPIFCRPGFEDQSNKLTSHKTV
FT                   GLIKQEHLASITAIPRIIKPLGLQAETNLADLEHKVIGDLLNNKGINRVNAYWQDNLTN
FT                   RLNANLPLITPFRKNEGKWQTEVVCLPSEESHWEFMFKSSEKAWEDPYFENDYLAEISY
FT                   QKLNCESPWITPWLTTPLNQALSELCEQLDEADQTQAALRFATVSLQHYGKTLPIWKFN
FT                   ETLGFWQP"
FT   gene            complement(234640..235596)
FT                   /locus_tag="APL_0214"
FT   CDS_pept        complement(234640..235596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73322"
FT                   /db_xref="GOA:A3MYT6"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019857"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYT6"
FT                   /inference="similar to AA sequence:RefSeq:NP_245248.1"
FT                   /protein_id="ABN73322.1"
FT                   /translation="MKKTPYIPSSDLKTILHSKRANIYYLEHCRILLNGGRVEYVTDKG
FT                   NESLYWNIPIANTICLLLGSGTSITQAAMRELSKAGVMVGFCSGGGTPLFNGTEAEIGC
FT                   DFFSPQSEYRPVEYLQQWCRFWFDDNKRLNSAKTLQLARLQLLLRTWNKFDWEYAQDKL
FT                   TALVQHYQEEFTNVKDSQSLLAAEGRLTAKLYALANQATLNDESFKRESGKEGANQFLD
FT                   HGNYLAYGLGATACWVLGLPHGLAILHGKTRRGGLVFDAADIIKDAIILPQAFISAQNG
FT                   DNEKQFRQACINNLIRFEALDIIINTLKQLASEGANI"
FT   gene            complement(237305..237874)
FT                   /locus_tag="APL_0215"
FT   CDS_pept        complement(237305..237874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73323"
FT                   /db_xref="GOA:A3MYT7"
FT                   /db_xref="InterPro:IPR013396"
FT                   /db_xref="InterPro:IPR042564"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYT7"
FT                   /inference="similar to AA sequence:RefSeq:NP_245245.1"
FT                   /protein_id="ABN73323.1"
FT                   /translation="MSELTHYIELKAIPQVDILQTDVIAHGLQILHKFLPLYQGQIGLS
FT                   FPAYGLGRTLGGIIRVFGNEQHCTQIKTQLIGEGLQDYVLITSVTPVPEEIVEYHRYQR
FT                   VHRKGQSAIRRTEKFLTQQGKWTEDVRKEMLIHQQNQKTFPHVKLKSSSTKQHFVLAIR
FT                   QFRLAEPASGLFNAYGLSQVATVPHF"
FT   gene            complement(237877..238872)
FT                   /locus_tag="APL_0216"
FT   CDS_pept        complement(237877..238872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73324"
FT                   /db_xref="InterPro:IPR013399"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYT8"
FT                   /inference="similar to AA sequence:RefSeq:NP_245244.1"
FT                   /protein_id="ABN73324.1"
FT                   /translation="MTKLTTASVLAFERKLDISDATFTQKNSTSSEPEIAVTIREKSVR
FT                   GTISNRLKNALANDPAKLDAEIEKANLQRVDVATLNDDYDTLVARFTCKVLPFEGKPNV
FT                   CNDPEYQAKLLSTIQNYLTAHGMSELAKRYATNLANARWLWRNRISAETIQVSIKVADD
FT                   VIVFENAKQLPLNSFEQADEKLQKIASYIEKGLKGEEFIILEVEAQAKMGRGQEVYPSQ
FT                   ELVLDTGTRKSKILYEINHKAGMHSQKIGNAIRTIDTWYAENAPFPIAAEPYGAVTNLG
FT                   TAFRQPKEKIDFYTLFDNWVLKDVAPELEQQHYVISVLIRGGVFGASGKE"
FT   gene            complement(238874..239833)
FT                   /locus_tag="APL_0217"
FT   CDS_pept        complement(238874..239833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73325"
FT                   /db_xref="InterPro:IPR013398"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYT9"
FT                   /inference="similar to AA sequence:RefSeq:NP_245243.1"
FT                   /protein_id="ABN73325.1"
FT                   /translation="MNYPNFYLLFDHVEIQAANTISSPITYGFPSLTGFTGAIHALSRK
FT                   LFPQQVELGGVMIACHDYQILGYKNSDFSDLTFNQTRNPLKKNGDSPSIIEEGKIHLDI
FT                   SLVVEMEVKDPELYYALNSQDSEQKTQFLEHCKKLLMQQRIAGGSVFQIENVELFNLSD
FT                   TKEIKLALMPAFVLMDAKQTLADITQSLQSGISNNEITIYPATPNANALDALLEVATLH
FT                   HIPLSEHATSQEWETFNVNQGKGWLVPIPVGYQAISPLFTAGEMQNCRVTEYPSQYVET
FT                   VYSLGKWVFPFSLPDDLSQCFWHYNTPQDNLYLITQGA"
FT   gene            complement(239830..241179)
FT                   /locus_tag="APL_0218"
FT   CDS_pept        complement(239830..241179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73326"
FT                   /db_xref="InterPro:IPR013397"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYU0"
FT                   /inference="similar to AA sequence:RefSeq:NP_245242.1"
FT                   /protein_id="ABN73326.1"
FT                   /translation="MITPLQIRAKIIDFLQAQHLKKSENDYKKLEKATEPEEIAKIKAE
FT                   ISKSEEKYRLDTWLHIAATEMAQQLKFGTHIAKGIHPDAKGNNINFRANLNLPATLVGS
FT                   QLIDKLVLDANGNAAALPLAAFFDIMVDEVNKRTLKDLLLTDEPCLDGCFSDDLSLSAQ
FT                   YKIAFQMALKGNLNSPETHERNKQVLWVNSSSAIEDNHYTCLIPLYPSSFTHAIYNKLN
FT                   QARFSEENKQARENRYKNKAQNPYISIPHLAVTKLGGTKPQNVSLLTSKQGGRNYLLPS
FT                   LPPIFSKGELRLTNAQNTIFNDRLAYVCRAGLYQLYQAVADSRKNYIVRVPRAEAVNLI
FT                   VQMVLQQAYKLQKRTAGWSRDYQLAWCEKYWLDPQRAKLNGEEQFHSALTQQDWISEVE
FT                   QRFAAWLNALLKKRFPKHQDDFTATEYNEWRKYFRKKLHRQLRCLYKEVL"
FT   gene            241585..243516
FT                   /gene="thrS"
FT                   /locus_tag="APL_0219"
FT   CDS_pept        241585..243516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="APL_0219"
FT                   /product="threonyl-tRNA synthetase ThrS"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73327"
FT                   /db_xref="GOA:A3MYU1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYU1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q65TQ0"
FT                   /protein_id="ABN73327.1"
FT                   /translation="MPIITLPDGSQRQFDNPVSVMEVAQSIGAGLAKATIAGRVNGERR
FT                   DACDIISEDSSLEIITAKDEDGLEIIRHSCAHLLGHAIKQLFPNVKMAIGPTIDNGFYY
FT                   DVDLDRSLTQEDLDAIEKRMLELAKTNYDVVKKRVSWQEARDTFEKRGEPYKMAILDEN
FT                   IERTATPALYHHEEYIDMCRGPHVPNMRFCHHFKLQKVAGAYWRGDSKNKMLQRIYGTA
FT                   WADKKQLAEYLTRLEEAAKRDHRRIGKALDLYHMQEEAPGLVFWHNDGWTIFRELETFV
FT                   RTKLKEYDYQEVKGPFMMDRVLWERTGHWQNYADLMFTTQSENREYAIKPMNCPGHVQI
FT                   FNQGLKSYRDLPIRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFCTEDQIESEVTS
FT                   CIRMVYDIYSTFGFSNIQVKLSTRPENRIGDDAMWDRAEDGLAKALTANGLSYEIQEGE
FT                   GAFYGPKIEFALRDCLDREWQCGTIQLDFALPGRLDASYVAEDNGRRTPVMIHRAILGS
FT                   IERFIGIITEEYAGFFPTWLAPTQAVVMNITDSQADYVQKVTKALSDAGIRVKSDLRNE
FT                   KVGFKVREHTLRRVPYMLVCGDKEIEAGKVSVRTRKGADLGTFTIDEFVEILKNQVKAR
FT                   GLKLLGEE"
FT   gene            243658..244332
FT                   /locus_tag="APL_0220"
FT   CDS_pept        243658..244332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0220"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73328"
FT                   /db_xref="GOA:A3MYU2"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYU2"
FT                   /inference="similar to AA sequence:RefSeq:YP_052544.1"
FT                   /protein_id="ABN73328.1"
FT                   /translation="MKKLLMTTLCVTALGLAGCATEGSRAIAPTVTQAASTATNYHGVK
FT                   SAISVGKFDNKSSFQNGVFSDGQDQLGNQSKTILVSHLQQTGRFSVLDRTNMSEAAAEA
FT                   KIKGQKQNLKGATYVITGDVTEFGRKTVGDHQLFGILGRGKEQVAYAKVTLNVVNVNTS
FT                   EVVYSVQGAGEYNLSNREVLGFGGTAGYDSTLNGKVLDLAIREAVNNLVNGIEAGHWTP
FT                   AK"
FT   gene            244342..244689
FT                   /locus_tag="APL_0221"
FT   CDS_pept        244342..244689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73329"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="InterPro:IPR014508"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYU3"
FT                   /inference="similar to AA sequence:RefSeq:ZP_01374532.1"
FT                   /protein_id="ABN73329.1"
FT                   /translation="MKKINIIMFALITVVLSACSSRSVDTNTYYWGNYSDLIYSYYNEP
FT                   GDFTKQENGFNEIIKMAKDAQKPVAPGVYGHLGLVLLKQGKTAEAQNAFLQEQQLFPES
FT                   KTFMQYLQRKK"
FT   gene            244701..245360
FT                   /locus_tag="APL_0222"
FT   CDS_pept        244701..245360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0222"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73330"
FT                   /db_xref="InterPro:IPR008517"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYU4"
FT                   /inference="similar to AA sequence:RefSeq:YP_052542.1"
FT                   /protein_id="ABN73330.1"
FT                   /translation="MKKLLILLSGILFLSGCAQQQKPSYDYSALKESKPKSILVLLPVN
FT                   NSVDVKADTSVLARVTYPLAELGYYVYPVALVDEVFKQNGLTDGNAIRSANIKKIYDIF
FT                   GADSILYLNVDKYGTSYKVFDSVTEVELEGKLIDLKTGKTLWDGTGRFAEGSTHSNDGA
FT                   LVALVKAAVSQVVDTTKDKGYEVSASAMSSLVHVGKNGGLLVGPRHSLYGKEDVKK"
FT   gene            245638..246117
FT                   /gene="infC"
FT                   /locus_tag="APL_0223"
FT   CDS_pept        245638..246117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="APL_0223"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73331"
FT                   /db_xref="GOA:A3MYU5"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYU5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKS0"
FT                   /protein_id="ABN73331.1"
FT                   /translation="MKEVRLTDENGEQVGIVSIQDALARAEDAELDLVEISPNAEPPVC
FT                   RIMNYGKFIYEKEKAAKEQKKKQKVVQMKEIKFRPGTDEGDYQIKLRSILRFLEDGDKV
FT                   KITVRFRGREMAHQDIGLDVLDRVKTDTAEVAVVESAPGKLEGRQAVMVIAPKKK"
FT   gene            246366..246563
FT                   /gene="rpmI"
FT                   /locus_tag="APL_0224"
FT   CDS_pept        246366..246563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="APL_0224"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73332"
FT                   /db_xref="GOA:A3MYU6"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYU6"
FT                   /inference="similar to AA sequence:RefSeq:YP_249100.1"
FT                   /protein_id="ABN73332.1"
FT                   /translation="MPKIKTVRGAAKRFKKTASGGFKRKQSHLRHILTKKTTKRKRHLR
FT                   HKSMVAKADQVLVVACLPYA"
FT   gene            246631..246984
FT                   /gene="rplT"
FT                   /locus_tag="APL_0225"
FT   CDS_pept        246631..246984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="APL_0225"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73333"
FT                   /db_xref="GOA:A3MYU7"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYU7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44358"
FT                   /protein_id="ABN73333.1"
FT                   /translation="MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQY
FT                   AYRDRRQRKRQFRQLWIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKV
FT                   AFAALVEKAKSAL"
FT   gene            247033..247569
FT                   /locus_tag="APL_0226"
FT   CDS_pept        247033..247569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73334"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYU8"
FT                   /inference="similar to AA sequence:RefSeq:NP_245468.1"
FT                   /protein_id="ABN73334.1"
FT                   /translation="MRKLIVIRGHSGSGKSTFAKQKIAEFEQHFPSGKVFHIEHDQFLY
FT                   ENGEYIWTKERFQSAKILAKQKLASAWEFAKNHPQVPILIVISNVNIALQAVEKYQNIA
FT                   NSLRMKIEKYRLMNFFKNQHDVDVYTVLNMYLMLEQQPLADEIIIQPIKQMPYFMRIIL
FT                   EKMRKRRDKKDIQAV"
FT   gene            247602..247895
FT                   /locus_tag="APL_0227"
FT   CDS_pept        247602..247895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73335"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYU9"
FT                   /inference="similar to AA sequence:RefSeq:YP_087805.1"
FT                   /protein_id="ABN73335.1"
FT                   /translation="MKKLMLLALSLVTVACSTPEQQSTVPMDMQAVAEYQQRVTSGNTV
FT                   SEKQKQRVAQQIEPDEPLNQSDKRPKIVRQVVREPVIYPSIGVGYGYHRHHW"
FT   gene            complement(247952..249247)
FT                   /locus_tag="APL_0228"
FT   CDS_pept        complement(247952..249247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73336"
FT                   /db_xref="GOA:A3MYV0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYV0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44717"
FT                   /protein_id="ABN73336.1"
FT                   /translation="MSLFEASLIILLLIVTSAVISSAEISLAGARKLKLQSMINEGDLR
FT                   AEKVLKLQEQPGRFITVVQIGLNMVAILGGVVGESAINPYFSELLSKYTQAEWVDSAAS
FT                   WIAFIIVTSAFVLFADLMPKRLAMTYPEKIAVRTIGVMMFCIALFKPLVLFFDWIANTL
FT                   FKFFHVSTVRQDNMTSEDIVAVVDAGAKAGILKAQEHYLIENVFEMQERRVTSTMTTRE
FT                   HIVFLNRTDNREKVLETLGEDPYSKVLICDDGLDKILGYIETHDLLTQYLKNDNVSLTD
FT                   AKLLKKSLFIPDTLSLYEVLELFKSAGEDFAVIVNEYALVVGILTLNDVMSIVMGELVS
FT                   TEEEQIVRRDEDSWLIDGATPLEDVMKALEIESFPNAENYETIGGFMMYMLRKIPKKTD
FT                   FVLYDQYKFEIIDTENFKIDQLMVSFRKDISN"
FT   gene            complement(249291..249941)
FT                   /gene="rluA"
FT                   /locus_tag="APL_0229"
FT   CDS_pept        complement(249291..249941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="APL_0229"
FT                   /product="predicted RNA pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73337"
FT                   /db_xref="GOA:A3MYV1"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006508"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYV1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43930"
FT                   /protein_id="ABN73337.1"
FT                   /translation="MTEKLTICFQHHDFVVIDKPVGVSVHKDEEAIGLTENLAEQLQAE
FT                   QVWLVHRLDKVTSGLLIFALNKQAAVHFYHLFEQHKIEKTYWALSDQKPKKKQGKISGD
FT                   MQKSRNGAWKLFHSKQNPAVTQFVSHSLEPNLRHFILQPKTGKTHQLRVAMKSLGSPIL
FT                   GDQRYAGTAADRVYLHAYQLKFDYQGESFCIQSQPTSGRFWAKLGNAEHLKNI"
FT   gene            249991..250623
FT                   /gene="gpmB"
FT                   /locus_tag="APL_0230"
FT   CDS_pept        249991..250623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="APL_0230"
FT                   /product="phosphoglycerate mutase/fructose-2,
FT                   6-bisphosphatase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73338"
FT                   /db_xref="GOA:A3MYV2"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYV2"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00732066.1"
FT                   /protein_id="ABN73338.1"
FT                   /translation="MALNIYLVRHGKTVWNLEGRLQGSGDSPLVEEGIEGAKKVGRALK
FT                   AVKFAAAYSSMQKRAQDTANYILAENNDKNIPHFHHFGLNEFDFGLWEGTKSVDLYSND
FT                   EYWTMKKTPAEYRAETNGGETYEDLYSRVIKVFNQIAQLHQDNENILIVAHGMTLTVLT
FT                   AVLRGLHWSECRDETKHSFVINTAINRAVVEKGKAELVEFNRTEHLA"
FT   gene            complement(250690..251103)
FT                   /locus_tag="APL_0231"
FT   CDS_pept        complement(250690..251103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0231"
FT                   /product="putative Holliday junction resolvase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73339"
FT                   /db_xref="GOA:A3MYV3"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYV3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKS6"
FT                   /protein_id="ABN73339.1"
FT                   /translation="MARTILAFDFGTYSIGCAVGQDITGTAQGLPSFKAQDGIPNWDQI
FT                   EKVIKEWQPERLVVGLPLNMDGSEQPLTQRAKKFANRLNGRFNLPVELQDERLTTVSAK
FT                   AEIFERGGYKALKKDKVDSISACLILESWFEAQ"
FT   gene            complement(251156..251716)
FT                   /locus_tag="APL_0232"
FT   CDS_pept        complement(251156..251716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73340"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYV4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKS7"
FT                   /protein_id="ABN73340.1"
FT                   /translation="MLENLQGKFLIATPEIDDDYFDRTVIYICEHNSNGAMGLVINTPT
FT                   DLSVLELITRMDFQMANQRNYHKDQMVLSGGPVSQDRGFIIHTKTEQEFLHSYRVTDNI
FT                   LLTTSGDVLDSLGKPEAPEKFIVCLGCATWKPEQLEQEIARNYWLISEANDKTLFETGY
FT                   LERWVEANEMLGISGVLARAGRA"
FT   gene            complement(251716..252447)
FT                   /locus_tag="APL_0233"
FT   CDS_pept        complement(251716..252447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73341"
FT                   /db_xref="GOA:A3MYV5"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYV5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44627"
FT                   /protein_id="ABN73341.1"
FT                   /translation="MRIPRIYHPELLANRTDCILSEDATNHVGRVLRMTEGEQIILFDG
FT                   SNHIFHATLQAVGKKQIIAKIDGSELDNRESNLPIHLGQVISRGDRMEFTIQKSVELGV
FT                   KTITPLWSERCGVKLNDERQDKKLQQWQKIAIAACEQCGRNEIPEIRPIMKLTDWCKEQ
FT                   DDMLKLNLHPRAKYTIRQLPNVPEAGVRLLIGSEGGLSAEEIAMTETQGFTEVLLGKRV
FT                   LRTETASLAAITALQVCFGDI"
FT   gene            complement(252622..253212)
FT                   /locus_tag="APL_0234"
FT   CDS_pept        complement(252622..253212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0234"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73342"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYV6"
FT                   /inference="similar to AA sequence:RefSeq:NP_874154.1"
FT                   /protein_id="ABN73342.1"
FT                   /translation="MKLSKKVLLIATTLATAVLTGCQSQSNVLNFTTPSPTATFNTNNQ
FT                   TAAVSVLTQDLRTSREVASYTKNGQITYLTSSPEVGLMFQQAVQQDLNAKGFQLVQGAA
FT                   NANVIVSVRKFFATVEQGNLLYKVNAAVGVEVAVKGSKGNFSKNFNATRGYEGAAVTTD
FT                   NDDIKKVLGQAYDDVVKAIYNDNEISNAIHQFK"
FT   gene            253341..253652
FT                   /gene="bolA"
FT                   /locus_tag="APL_0235"
FT   CDS_pept        253341..253652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /locus_tag="APL_0235"
FT                   /product="stress-induced morphogen (activity unknown)"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73343"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYV7"
FT                   /inference="similar to AA sequence:RefSeq:NP_874153.1"
FT                   /protein_id="ABN73343.1"
FT                   /translation="MLIEQAIRDKLTAQFSPVFLNIENESYMHSSGRGAESHFKVTLVS
FT                   ETFEGIRTVACHRAIYTCLADELENGVHALALHTYTPTEWAENNGMVPKSPNCAGVGL"
FT   gene            253764..253853
FT                   /locus_tag="APL_2049"
FT   tRNA            253764..253853
FT                   /locus_tag="APL_2049"
FT                   /product="tRNA-Ser"
FT   gene            complement(254045..254419)
FT                   /locus_tag="APL_0236"
FT   CDS_pept        complement(254045..254419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0236"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73344"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYV8"
FT                   /inference="similar to AA sequence:PFAM:PF04170"
FT                   /protein_id="ABN73344.1"
FT                   /translation="MKKIAFIALSMTLGACSLLPQKSVVGTFQGNLPCADCERIKAELI
FT                   LGNNNSYQYNTVYVKNGKEYPFTDKGTYTWEQNKRGVIRLERDSGSLAFKINDTQAEIC
FT                   DANGNPAKIANSPYVLHKVK"
FT   gene            complement(254439..254747)
FT                   /locus_tag="APL_0237"
FT   CDS_pept        complement(254439..254747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73345"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYV9"
FT                   /inference="similar to AA sequence:RefSeq:NP_874152.1"
FT                   /protein_id="ABN73345.1"
FT                   /translation="MKNSTIRNITEVLQNSSLSRIVQRANELNLLNQKIQKLLPRQYHG
FT                   LYRIVNLVDNCLIFEVQNATIRQGLLLQRTLLLELIQTDFPNVTELQFRVSPSFKHF"
FT   gene            254850..255176
FT                   /locus_tag="APL_0238"
FT   CDS_pept        254850..255176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73346"
FT                   /db_xref="InterPro:IPR020508"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYW0"
FT                   /inference="similar to AA sequence:RefSeq:NP_874151.1"
FT                   /protein_id="ABN73346.1"
FT                   /translation="MFLMTLFRHFHKTPFWSQLVFGLVAIFALPEIQATLNRENEQNTV
FT                   INQLVTQYTQVTEDGEQQTLFIAERHLAQMNTTSQAVVFCKILTKSYRFYGDDNHPIRA
FT                   GPIA"
FT   gene            255285..258002
FT                   /gene="secA"
FT                   /locus_tag="APL_0239"
FT   CDS_pept        255285..258002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="APL_0239"
FT                   /product="preprotein translocase secA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73347"
FT                   /db_xref="GOA:A3MYW1"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYW1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43803"
FT                   /protein_id="ABN73347.1"
FT                   /translation="MISKIITSIFGSSNDRTLKRLRKRVAQINKLEPAFEKLTDEELQA
FT                   KTAEFKQRLADGASLDSLLHEAFATVREASRRVMGMRHFDVQLIGGMVLTNRNIAEMRT
FT                   GEGKTLTATLPCYLNALTGKGVHVVTVNDYLARRDAETNRPLFEFLGLSVAVNVPGLPN
FT                   EVKREAYKADITYSTNSELGFDYLRDNLAHAKEDRFQRELHYALVDEVDSILIDEARTP
FT                   LIISGPAEDATQIYQAIDTIIPHLVQQDKEDTEEYTGEGDFTLDLKNKQAHLTERGMVK
FT                   VEGILTEMGLMQEGETLYHPARIALLHHVYAALRAHKLFELNVDYIVKDGEVVIIDEHT
FT                   GRTMAGRRWSDGLHQAIEAKEKVNIQGENQTVASITYQNYFRLYEKLAGMTGTADTEAF
FT                   EFQQIYGLDTIVIPTNKPVIRDDRTDLMFKSEPEKFAAIIKDIQECMARQQPVLVGTAS
FT                   VEKSELLSAELTKAGIAHNVLNAKFHAQEAEIVAEAGAPGAVTIATNMAGRGTDIVLGG
FT                   NWKAEIAKLENPTEEQIEAIKAAWKERYDIVMKAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSLDDALMRIYLNEGKLNMMRKAFSEEGEAMESKLLTKVIASAQAKVE
FT                   AHNFDGRKNLLQYDDVANEQRKAIYEQRNYLLETEDISAMIETIRGDVFNRVIDQFIPP
FT                   QSIEEMWDVAGLEEALKRQFGMELPIQHWLEQENDLHEETLRERIIDIATQEYHAKEEK
FT                   VGSEVMRNFEKGVMLQNLDELWKEHLSAMDYLRKGIHLRGYAQKDPKQEYKKESFEMFT
FT                   NMLDLLKSNVISVLSRIQVRSQEEIEEAQRQQEAMAQAESENYRTADHQAEAQQSESLT
FT                   EEQLANLDIGRNDPCPCGSGKKYKHCHGSKARYA"
FT   gene            258132..259319
FT                   /locus_tag="APL_0240"
FT   CDS_pept        258132..259319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0240"
FT                   /product="tetratricopeptide repeat (TPR) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73348"
FT                   /db_xref="GOA:A3MYW2"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYW2"
FT                   /inference="similar to AA sequence:RefSeq:YP_378620.1"
FT                   /protein_id="ABN73348.1"
FT                   /translation="MSEITFEQYLALLVEEQDSAATPFEWLTILRKYDEIIRLLPDKAV
FT                   LYHNRCTVLQNLGLYQLALKDINKAVELAPNYAIAWCNKAMLHNLLGDYSQGWQAYEWR
FT                   WQTGLPAFEPLEINIPQWQGENIGNAKILFHVEQGFGDNIQFVRYALEMKRQGLNVVVL
FT                   NHSGIENLLNDNLAQHGIETMRNGGRVSGLAYHLPMLSAPLVFGCTLENIPYSNGYLQA
FT                   QPEFLAKWQEKITACSKRQRLKIGVVWAGSAKHNRNASRSLPFELFSQLFALDADFHCL
FT                   QKELNETDYKRSDLFENLHIWQQDIGDFSDTAALIAQMDLVISVDTSVAHLAAAMSKPT
FT                   WVMLSYHPDFRWLLTRQDSPWYDSVKLFRQDASLNWQSVIKNIQQQLQHILKENT"
FT   gene            259316..259714
FT                   /gene="mutT"
FT                   /locus_tag="APL_0241"
FT   CDS_pept        259316..259714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="APL_0241"
FT                   /product="mutator mutT protein"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73349"
FT                   /db_xref="GOA:A3MYW3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYW3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44932"
FT                   /protein_id="ABN73349.1"
FT                   /translation="MNKPVIQVAAGIIRNEFGQIYLTQRLEGQDFAQALEFPGGKVDAG
FT                   ETPEEALKRELEEEIGIHILSAFPYESFRFDYPTKVIEFFFYLVEEWVGEPFGREGQEG
FT                   FWVAQADLDESEFPPANSRLIQRLKSEV"
FT   gene            259949..260893
FT                   /gene="argC"
FT                   /locus_tag="APL_0242"
FT   CDS_pept        259949..260893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="APL_0242"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase
FT                   (AGPR)"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73350"
FT                   /db_xref="GOA:A3MYW4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYW4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q8Y339"
FT                   /protein_id="ABN73350.1"
FT                   /translation="MSKYKIFVDGAVGTTGLRIFDRLASAEDIELLSLPEELRKDLNAR
FT                   VAKVAEADLTFLCLPDEASKELVAHAPADARICDTSTAHRVNPNWTYGFAEFSGQFEKI
FT                   QNANRVAVPGCHATGYIALVRPLIEKGALSADYPLSCHSLTGYSGGGKAMIAEYQNPDR
FT                   EQKFSAPRVYGLALKHKHLPEMQALTGSNHPPIFTPVVADYYSGMLVTVPLPVSALSQA
FT                   VNSAEKIANLFSEYYQNSKLITVHPACSLPEDGMLAANTFSGKDSLEIFVYGNETQLLL
FT                   CARFDNLGKGASGAAVQCMNIMLGREETAGLDV"
FT   gene            260923..261777
FT                   /gene="argB"
FT                   /locus_tag="APL_0243"
FT   CDS_pept        260923..261777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="APL_0243"
FT                   /product="acetylglutamate kinase (AGK)"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73351"
FT                   /db_xref="GOA:A3MYW5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYW5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMS6"
FT                   /protein_id="ABN73351.1"
FT                   /translation="MLQNEVENFANLLEQATVYLAPYQEKIIVVKYGGNAMINEDRKKL
FT                   VMQDILLLNQLGVKVVLVHGGGPEISQGVKLLGKEPQFINGLRVTDQDTINVVLQMLAG
FT                   KVNKSLVALLKGKGVGLCGIDANMLQCEKLQAEVDYGFVGEIVKVNTQLLELALSANLI
FT                   PVISTVGVDDQGVAYNINADTVASEIAMALGAAKLVSMTDIAGLLRDRFDESTLIPEVE
FT                   VSEVQGLIDQGIIAGGMIPKIACCTDFINAGGIEANIIDGRVPHAILVSLFGGKNGTLF
FT                   YKK"
FT   gene            261791..262972
FT                   /gene="argD"
FT                   /locus_tag="APL_0244"
FT   CDS_pept        261791..262972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="APL_0244"
FT                   /product="acetylornithine aminotransferase (ACOAT)"
FT                   /EC_number="2.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73352"
FT                   /db_xref="GOA:A3MYW6"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYW6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMS5"
FT                   /protein_id="ABN73352.1"
FT                   /translation="MNSNDIKQLDADYIAQTYGRFNLALSHGKGCDVWDFEGNQYLDFT
FT                   SGIGTNSLGWADDGWLAAVTTQAGKLQHTSNIFFTEPSAVLAKSLVEASGLKRVFFCNS
FT                   GAEANEGAIKTARKYSHDKYGKGRATLLSLVNSFHGRTISTLAATGQDVFHQHFFPFTQ
FT                   GFEHTPANDLDALHARIEQDDVCAIILEIVQGEGGVCALDTEYLQGVQAICQAKDIILI
FT                   IDEVQTGIGRTGKLFAYQHFGLQPDIITLAKGLGGGLPIGAFVLGGKCQNTLGKSDHGS
FT                   TFGANPVCCAAANAVLAKIDEKFLADVAAKGEKLRAALLTLPKVKSVSGLGLMLGIEFE
FT                   DGVKAADVVAKAIEKGVLTLTAKTKLRLLPPLVISEQQIDHGVAVLREVLESL"
FT   gene            263186..264895
FT                   /locus_tag="APL_0245"
FT   CDS_pept        263186..264895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0245"
FT                   /product="transferrin binding protein-like solute binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73353"
FT                   /db_xref="InterPro:IPR001677"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR035313"
FT                   /db_xref="InterPro:IPR035316"
FT                   /db_xref="InterPro:IPR038197"
FT                   /db_xref="InterPro:IPR038669"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYW7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q06988"
FT                   /protein_id="ABN73353.1"
FT                   /translation="MNVKKSQIAIVIAATLLTACSGGKGGFGLDNTQEQIPRYDPKKTK
FT                   SIEFGDDVTEAKPYEQLPEFLQPTLGSEIAIPRRIIGPKAEERVELSPDNIKRLGGSLD
FT                   EIPHAKEIEDHPAVKKSGEKFSLVYSHDNKSPQRTRNMDYVRSGFVFALGGFSTKKNEK
FT                   QENVYRSGKIGYVFYKGINPSKALPVDKIVKYEGTWDFTTDAVNKRRAQGFEESYIGDR
FT                   YGAISYDEPINNDKYGAVGHSSEFVVNFGKKELTGQLYRNHPIRKENTQEKTKRYDINA
FT                   KLFGNRFRGSAKATDPKDRYFGKDANNSLEGGFYGPNAEELAGKFLSNDKSLFGVFAAK
FT                   QKGQKAETETKFDARQIDLKDFKQSEMDSFGQANLLVIDGHIIPLLKQNFDHQLANKSV
FT                   KVTACCENLADVKFGTFDVAGEGPKLYLTGERTAVDAIPKSGVFAYKGSWQGQISSQDG
FT                   TKWQTPENSAAYLQVDFDNKRVNGGFGSGPTSGTVLSLQEGVIDKNGFSGVVKTLKDGF
FT                   SANGKTFHVDGKVSGGFYGKTASEIGGSLLSTEQSQDKAAGVFGAKRQVEKK"
FT   gene            264910..267177
FT                   /locus_tag="APL_0246"
FT   CDS_pept        264910..267177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0246"
FT                   /product="truncated transferrin-binding protein 1
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73354"
FT                   /db_xref="GOA:A3MYW8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010948"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYW8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44970"
FT                   /protein_id="ABN73354.1"
FT                   /translation="MKQFKLSLSYIAIQSAFLILSAQTYAKQNETELDTVTVKAKTEIH
FT                   RRQNEVTGLGKVTKISKDLDKEQVQNIRDLTRYDPGISVVEQGRGASSGYSIRGVDRNR
FT                   VALLVDGLPQIQSYKSLSLFAQSGAINEIEYENIRSIEFSKGASSQEYGSGALGGAVGF
FT                   RTKNPDDVIKEGQNWGLDSKTAYSSKNKQFSESLSFAGRSGGFEALVQYTHRKGKETEI
FT                   HKDATKVRQSFYRLVPRELNWDKNQRDNWFVFEDECPTGQGSNPGCVPRPIVRGAKVIK
FT                   DSTNAKDYTGDGRIAPNPMKYQSGSWLFKLAYHFSPQHSVNAVFEQTKQRYDIQDMAQA
FT                   KYSNLLPNNKGEPDRKKTEVEYSLFGRNFYPDDPSQAIGYGNTLNPSLVRSAYWSRARF
FT                   FDERHTKRRLGFGYQYKSENDKGIFDRLNLNLDQQDIRLLTKLHSLSCSRYPYFDKNCK
FT                   ITPDKRDANATYERNIYKERHKQVQLSFEKDLAIGRTQHLFNLSMSYDRMRSNHKRDQF
FT                   ERVYLVYSKEDESEHPYYDVGNRDKDVGYYNSGTYKYPRIIGKRQAIVAHNNYCKFDMH
FT                   YGKRKDFSDCSAHITKGQHYAIGLSDRIFFGDKLDLGLGVRYDYHRFKSDDDWVNTGTH
FT                   KNFSWNTGLTIRPREYIALSYRASSGFRVPSFVEMFGRRVPGAADNKYWRRDLLKKKLT
FT                   SEKALNQEVGVAFNGNLGVLEVSYFDNRYRDLIVSAKEKGIDGIAGFYNLQSINLNGVP
FT                   IG"
FT   gene            complement(267745..269007)
FT                   /gene="rho"
FT                   /locus_tag="APL_0247"
FT   CDS_pept        complement(267745..269007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="APL_0247"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73355"
FT                   /db_xref="GOA:A3MYW9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYW9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44619"
FT                   /protein_id="ABN73355.1"
FT                   /translation="MHLTQLKNTPVSDLVALGEGQMGLENLARLRKQDIIFAILKQHAK
FT                   SGEDIFGQGILEILPDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLQTGDKIEGKIRP
FT                   PKEGERYFALLKVDLVNDDKPEVSRSKILFENLTPLHANSRLRMERGNGSTEDLTARIL
FT                   DLAAPIGKGQRGLIVAPPKAGKTVLLQNIAQSITHNHPECELIVLLIDERPEEVTEMQR
FT                   TVRGEVIASTFDEPATRHVQVAEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTVTPV
FT                   SGKILSGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTG
FT                   NMELHLSRKIAERRVFPAIEFNRSGTRKDDLLMSPEEHRNAWMLRKVLNPMDEVAAMEW
FT                   LIDKLGVAKTNEEFFELMKRS"
FT   gene            complement(269205..270155)
FT                   /gene="cysK"
FT                   /locus_tag="APL_0248"
FT   CDS_pept        complement(269205..270155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="APL_0248"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73356"
FT                   /db_xref="GOA:A3MYX0"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYX0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45040"
FT                   /protein_id="ABN73356.1"
FT                   /translation="MTIYADNSYTIGNTPIVRLKNFGQNGNLLVKIESRNPSFSVKCRI
FT                   GANMVWQAEKDGILTKGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSTERKRLL
FT                   RGLGVNLVLTEGSKGMKGAISKAEEIVASDPNRYVILKQFENPANPAIHQQTTGPEIWN
FT                   ATEGKVDVIVAGVGTGGTITGISRYIKQDQGKQIISVAVEPKESPVITQTLNGEEVKPG
FT                   PHKIQGIGAGFIPKNLDLSLIDRVEQVSSEEAIATARRIMAEEGILVGISSGAAVAAAD
FT                   RLAKLPEFADKQIVAILPSASERYLSTLLFEGVEV"
FT   gene            complement(270367..271317)
FT                   /gene="thrB"
FT                   /locus_tag="APL_0249"
FT   CDS_pept        complement(270367..271317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="APL_0249"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73357"
FT                   /db_xref="GOA:A3MYX1"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYX1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q65RV1"
FT                   /protein_id="ABN73357.1"
FT                   /translation="MTTLRIYAPASSANLSVGFDSLGAAISPIDGSLLGDVVQIEDCET
FT                   AFELESAGYFVRKLPKEPQKNIVYQAYVLFSERLKLRGGSVKNLRLTLEKNMPIGSGLG
FT                   SSACSIVAALVALNKFHDEPFSKMELLEMMGELEGRISGSIHYDNVAPCYLGGLQLMTQ
FT                   SLGNICQTIPFFDEWYWVLAYPGVEVSTAEARAILPKNYTRQDMIQQARYLGSFVHACH
FT                   THQDILAATMMKDLIAEPYRENLLPNFAEVRQGCKDLGALSVGISGSGPTMFAIAPDLE
FT                   HAQKLAAYLEKEYLQNNEGFIHICKVDNQGARELK"
FT   gene            complement(271317..273773)
FT                   /gene="thrA"
FT                   /locus_tag="APL_0250"
FT   CDS_pept        complement(271317..273773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="APL_0250"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73358"
FT                   /db_xref="GOA:A3MYX2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYX2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44505"
FT                   /protein_id="ABN73358.1"
FT                   /translation="MRVLKFGGTSLANPERFIQAADIIEKAHLKDQAAGVLSAPAKITN
FT                   HLVAIVDKAIAGESFESNLKEATEIFHNIINGLYAINNKVDREGLLALVEAELAQIQSV
FT                   ASEAAKSKSLPDSVAATIHCRGEKLSIAMMQAWFEAKGYEVTRIDPVEKLLAHGSYLES
FT                   SVDIAESTKRVDANSIPKKNVVLMAGFTAGNENGELVLLGRNGSDYSAACLAACLKADC
FT                   CEIWTDVDGVYTCDPRLVPEAICLESMSYQEAMELSYFGAKVIHPRTIGPLVPLNIPCL
FT                   IKNTANPDAKGTLIDGNVATDGLKVKGITNLDNVAMFNVSGAGMQGMVGMAARVFSTMS
FT                   KAGISVILITQSSSEYSISFCVPAKFEEKATACLNAEFAQELSKGDLDPIDMIRELSII
FT                   SVVGDGMRTAKGIAARFFSSLAQANISIVAIAQGSSERSISAVVPMNKAIEAVKATHQG
FT                   LFSNKKSIEVFLVGVGGVGSELIDQIKQQKEFLAKKDIEIRVCALANADKMLLNENGLN
FT                   LDNWKSDLETATQPSDFDVLLSFIKLHHVVNPVFVDCTAAQSVANLYTRALKEGFHVVT
FT                   PNKKANTGSYRYYQELREAARQGQHKFLYETNVGAGLPVIENLQNLLAAGDEVEKFEGI
FT                   LSGSLSFIFGKLDEGLSLSEATLIAKEKGFTEPDPRDDLSGADVARKLLILARETGLAL
FT                   EFDDIEVEGVLPKGFSDGMSKEEFLKVLPEIDAQFNERVQAAKAEGKVLRYVGSITGDK
FT                   CRVAIEAVDENHPLYKVKDGENALAFLTRYYSPIPLLLRGYGAGTDVTAAGIFADILRT
FT                   LHGGSN"
FT   gene            274183..274824
FT                   /gene="sodA"
FT                   /locus_tag="APL_0251"
FT   CDS_pept        274183..274824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="APL_0251"
FT                   /product="manganese superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73359"
FT                   /db_xref="GOA:A3MYX3"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYX3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:O30826"
FT                   /protein_id="ABN73359.1"
FT                   /translation="MAYQLPELGYAYDALEPHFDKATMEIHHTKHHQTYVNNANAALEA
FT                   HPELLEKCPGALIKDLSQVPAEKRTAVRNNVGGHVNHTLFWKGLKTGTTLQGALKDAIV
FT                   RDFGSVEAFQAEFEKAAATRFGSGWAWLVVEGGKLAVVSTANQDNPIMGKEVAGVSGFP
FT                   ILALDVWEHAYYLHYQNRRPDYIKAFWNVVNWDEAARRFEEHASHCGCAK"
FT   gene            complement(274912..276036)
FT                   /gene="alr"
FT                   /locus_tag="APL_0252"
FT   CDS_pept        complement(274912..276036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="APL_0252"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73360"
FT                   /db_xref="GOA:A3MYX4"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYX4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNC9"
FT                   /protein_id="ABN73360.1"
FT                   /translation="MKPATATISREALRHNIELIKTFAPQQKLLAMIKANAYGQGLLPA
FT                   ADTLADLVEGFGVARLREALEIQETGYTGKILLIEGFFDREELLKTLSRRFDTVIHCQE
FT                   QLELLEQVAEEWQQEQQKGFWKRKAKIYFPINVWLKIDTGMHRLGVHPEQVDMFYQRLK
FT                   ACPLVESISFVSHFSRADEPDCGYTEKQIAIFEAATSPYPTHERSISASSGILYWKQAH
FT                   YDWVRPGIIMHGISPHYTPITDLGFKPVMTLSSSLIAVRTHKAGEPVGYGGTWISDKDT
FT                   KLGVVAMGYGDGYPRNAPEGTPVLVNGRIVPIVGRVSMDMLTVDLGADSQDKVGDEVIF
FT                   WGKDLLIEEVAQHIGVISYELITKLTPRVIFEYE"
FT   gene            276157..278094
FT                   /gene="recD"
FT                   /locus_tag="APL_0253"
FT   CDS_pept        276157..278094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="APL_0253"
FT                   /product="exodeoxyribonuclease V alpha chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73361"
FT                   /db_xref="GOA:A3MYX5"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041851"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYX5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45158"
FT                   /protein_id="ABN73361.1"
FT                   /translation="MLTLLYELKETNVISELDYQFAKMIDRKQQSYPYTEQQKNLAVLL
FT                   AALVSFHVMQGHAAIRLDSQASRFFFGLSNRNEEKALNDEILQKIGGITPLEWQGVLQN
FT                   HIAFSSDPKQVAPMLFQHGLLYFYRYWQAENNIANYLVKAVEFPEQIANTALDKQILEK
FT                   LFEKSDEVNWQKIAVATAIKQKFSIISGGPGTGKTTTVAKLLAALQEKQLRSGKAMLNV
FT                   ALVAPTGKAAARLKESITLSLSVLNLNFEIPTTASTIHRLLGIRPQSDEPRYHSKNPLH
FT                   IDLLVVDEASMIDLFLMEKLMAALKPNTRLIILGDKDQLASVEAGAIMGELGAFLQQGY
FT                   SRKHCDYLNQVTEYQLVPKGKSLPICDSLCHLKKSYRFDANSGIGQLAKLVNEKQAVES
FT                   WQLFAKGSADLSLIEYAHTSDFPEKQQWIQNCVKQITDKAVELYKEYLTLVKQRYNNPT
FT                   KVSVNEIFEVFQKVRFLSALRISELGVEQLNKRIETALAAAKLISLEQSKNYYIGKPLL
FT                   ITQNSPQNHIYSGDIGIILPDENGISRVYFDTKIDDGYLSLSLNRLPEFEPAYVMTVHK
FT                   SQGSEFEHTLLITPLHFAPVMSKELIYTAITRAKKHFTLFGEKQVWLQAVNNNLQRQSG
FT                   LKAQLMHLFS"
FT   gene            278439..280264
FT                   /locus_tag="APL_2110"
FT   rRNA            278439..280264
FT                   /locus_tag="APL_2110"
FT                   /product="16S ribosomal RNA"
FT   gene            280422..280497
FT                   /locus_tag="APL_2050"
FT   tRNA            280422..280497
FT                   /locus_tag="APL_2050"
FT                   /product="tRNA-Glu"
FT   gene            280714..283608
FT                   /locus_tag="APL_2116"
FT   rRNA            280714..283608
FT                   /locus_tag="APL_2116"
FT                   /product="23S ribosomal RNA"
FT   gene            283774..283885
FT                   /locus_tag="APL_2122"
FT   rRNA            283774..283885
FT                   /locus_tag="APL_2122"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(284242..285696)
FT                   /gene="pepD"
FT                   /locus_tag="APL_0254"
FT   CDS_pept        complement(284242..285696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="APL_0254"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73362"
FT                   /db_xref="GOA:A3MYX6"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYX6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44817"
FT                   /protein_id="ABN73362.1"
FT                   /translation="MSEITKLSPTLLWQWFDKICAIPHPSYHENQLAEFIVDWAKSKNL
FT                   FAERDEAGNVLIRKPATQGMENRCTIALQAHLDMVPQANAAAQHDFLKDPIQPYIDGEW
FT                   VKAKGTTLGADNGIGLASCLAVLEADDIAHPALEILLTMSEEVGMEGVLGLRPNWLKSD
FT                   IMINTDTEENGEIYIGCAGGENINLSLPLQYETNAHDSALQITLKGLQGGHSGCDIHTT
FT                   RANAIKLMARILAEIQTHYPIQISALKGGSVRNAIPREAQVTLTVAANHQQNVIAYLTE
FT                   LAKKIQNELRLAEANLKLEIEPSQLPNQSLTIESTQKVIHLLNVLPNGIIRNSDVVKDV
FT                   VETSLSIGLVKIEEQQLTATILARSLIESGKEDVRGKINSLAALTGAKVAFSGNYPGWE
FT                   PDTQSRITPLTKAIYDEVLGYEAQVKVIHAGLECGLIKKVYPNMDLVSIGPTIQNAHSP
FT                   DEKVHIPAVEIYWKLLTKLLAQAPVK"
FT   gene            285869..286342
FT                   /gene="gpt"
FT                   /locus_tag="APL_0255"
FT   CDS_pept        285869..286342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="APL_0255"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73363"
FT                   /db_xref="GOA:A3MYX7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYX7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKP2"
FT                   /protein_id="ABN73363.1"
FT                   /translation="MSEKYTNEKYVVTWDMFHMHARKLAERLLPASQWKGIIAVSRGGL
FT                   FPAAVLARELSIRHVETVCISSYDHDEQGELKVLHAAQTDGEGFIVVDDLVDTGNTAKE
FT                   IRKMYPKAKFVTVFAKPAGTPLVDDYVIDIPQETWIEQPWDLGITFVPPLARK"
FT   gene            286426..287046
FT                   /gene="gmk"
FT                   /locus_tag="APL_0256"
FT   CDS_pept        286426..287046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="APL_0256"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73364"
FT                   /db_xref="GOA:A3MYX8"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYX8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKP3"
FT                   /protein_id="ABN73364.1"
FT                   /translation="MLGNLYILSAPSGAGKSSLINALLADLPRSEVQLSVSHTTRNPRP
FT                   GEEHAVHYYFTHHAEFESLIEQGHFLEWAEVFGNYYGTSLPMIEKSLENGIDVFLDIDW
FT                   QGARQIRNKVPNVKTIFILPPSREELEKRLIGRGQDSAETIGKRMAEAVSEMSHYNEFD
FT                   YVIVNDDFQTALSELKSILTSERLKQASQAVRYEKLIRQLLSK"
FT   gene            287148..288542
FT                   /locus_tag="APL_0257"
FT   CDS_pept        287148..288542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0257"
FT                   /product="probable outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73365"
FT                   /db_xref="GOA:A3MYX9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYX9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45217"
FT                   /protein_id="ABN73365.1"
FT                   /translation="MKLSKLALTLSVVLALSACSTTKLSADGSLEQAQATYQQYEEITK
FT                   QFQINEQWWQGYNDSQLNSLVEQAIANNLDLAKSAIAVNRALYNANLVGANLVPTFSGS
FT                   GSSSAAKGVGSTSNQISTGISTISHTASFKLSYTLDLWQRLADAASAAEWEHKATVEDL
FT                   KATRLSLLNSVVSTYYQIAYYKDAIAVIERTINNYQQISTILNNKYAAGAIDRLAVEQA
FT                   QQATLNARNSLISERTNLKTAEQTLRNLLNLKPNQALPTRYPSILGVKLQGIDLNVPVS
FT                   AIANRPDVVARLNRLQSAFKSLTATEKSWFPTVTLGGSISASASKVANISDNPVGNGVI
FT                   SFDLPFLDWNRVKNNVKISESDYMTAKLNYEQTVTSALNEIDQHYYAYQQSLSSYATLQ
FT                   QAYEHDKRISNYYKNRYEQGVSEFREWISALNTELNSQLSILNQKYMILSNENTVYQSM
FT                   AGKYRR"
FT   gene            complement(288590..288886)
FT                   /locus_tag="APL_0258"
FT   CDS_pept        complement(288590..288886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73366"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYY0"
FT                   /inference="similar to AA sequence:RefSeq:NP_874188.1"
FT                   /protein_id="ABN73366.1"
FT                   /translation="MSDIEKIEVEVLFAYPNKHFLKKITLDAPTSVQNVILQSGILEKY
FT                   TEIDLRTNKVGIFSRPVKLTDMVENGDRIEIYRPLIADPKEIRRKRAAEQNKK"
FT   gene            complement(288879..289313)
FT                   /locus_tag="APL_0259"
FT   CDS_pept        complement(288879..289313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0259"
FT                   /product="predicted oligoketide cyclase/lipid transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73367"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYY1"
FT                   /inference="similar to AA sequence:RefSeq:NP_874187.1"
FT                   /protein_id="ABN73367.1"
FT                   /translation="MPIVNQSSLVPYSAEQMYQLVNDYEKYPQFLSGCIGAKTISRGNN
FT                   ELEAELQIQKLGISQSFSTHNKMLPNERIEMKLVNGPFRQLQGAWNFQPFDEQSCKISL
FT                   YLEFEFSNPVVGMVFGKIFNELTLKMVNAFKQRAKEVYGV"
FT   gene            complement(289361..290416)
FT                   /gene="modC"
FT                   /locus_tag="APL_0260"
FT   CDS_pept        complement(289361..290416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="APL_0260"
FT                   /product="molybdenum import ATP-binding protein ModC"
FT                   /EC_number="3.6.3.29"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73368"
FT                   /db_xref="GOA:A3MYY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR015852"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYY2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKP7"
FT                   /protein_id="ABN73368.1"
FT                   /translation="MLQLNLHQTLGQLKLAVKLDIPNKGVTAIFGRSGAGKSSLINLIA
FT                   GLSTPQKGYIRLNQQTLFDSEQRINLAPEKRKIGYVFQEHRLFPHYTVEKNLKYGYKRS
FT                   DSAHFLQIVQLLGIEHLLTRFPASLSGGEKQRVAIGRALLSEPQLLLMDEPLSALDLPR
FT                   KQELMNYLSKLAAQIEIPILYVSHSLDEIIRLADNLILLEQGKVTLFDSVANVWYHPAF
FT                   TAWQPDSQKVSLLELPISSHQSNYKMISLALGSQKIWINETLHYHIGDKLRLTIASKDV
FT                   SISLKEPNPSSIRNILTGKITEIIPHSDRMDIAVLVDSHIIWASISLWSFDELALKNGQ
FT                   NVYLQIKSVSL"
FT   gene            complement(290420..291109)
FT                   /gene="modB"
FT                   /locus_tag="APL_0261"
FT   CDS_pept        complement(290420..291109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="APL_0261"
FT                   /product="molybdenum transport system permease protein
FT                   ModB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73369"
FT                   /db_xref="GOA:A3MYY3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYY3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45322"
FT                   /protein_id="ABN73369.1"
FT                   /translation="MFNFTPQELDAIFLSLKVALLAVALSLPLAIFTAWLLSRKQFWGK
FT                   NLLNGIVHLPLVLPPVVIGYLLLVSMAKKGVIGQYLWQWFEFSFSFSWKGAVLASMVMA
FT                   FPLMVRSIRLTLDAVDPKLEQAARTLGAPPLKVFFTLTLPLSYSGIIAGAVLGFARSLG
FT                   EFGATITFVSNIPNQTQTIPSALFTFIETPDGELAAARLCAVSIMISLIALFASEWFAE
FT                   KQKRLLN"
FT   gene            complement(291169..291927)
FT                   /gene="modA"
FT                   /locus_tag="APL_0262"
FT   CDS_pept        complement(291169..291927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="APL_0262"
FT                   /product="molybdate-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73370"
FT                   /db_xref="GOA:A3MYY4"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYY4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45323"
FT                   /protein_id="ABN73370.1"
FT                   /translation="MKRLSKTLLIGISALSSAFAFAQNITVFAASSMSNVLQEINQDFA
FT                   KQYPNDKVIFSFASSSVLAKQIEQDAPADVFISADLKWMEYLKEKQPAKTQNIRHLVKN
FT                   DLVLIAPKDSSLTTSDIQAVDFTKILANSYLSVGDPAHVPAGKYAKKALEHYGLWQQVE
FT                   PKLARAKNVRDALSFVERGESPLGIVYSTDAKISDKVKVIAIFPTESYGEIVYPAATLS
FT                   DKAQAKAFLDFLYSQEAKAKFKAAGFYPIN"
FT   gene            complement(292023..292784)
FT                   /locus_tag="APL_0263"
FT   CDS_pept        complement(292023..292784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0263"
FT                   /product="putative ABC transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73371"
FT                   /db_xref="GOA:A3MYY5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYY5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P0AFN8"
FT                   /protein_id="ABN73371.1"
FT                   /translation="MNLTGFFTLSAKESRRIIRIWRQTLVPPIITTTLYFLIFGKLIGG
FT                   RIGEMNGVGYMQFIAPGLVMMNAITASYVNTASSFFLSKFTRNFEELLVSPLSTHNIIW
FT                   GYVMGSIVRGGLAGILVMLVALCFVSFDIHSWTIILLTLLMTTVAFALGGLINAVYAKS
FT                   FDDVGLIPTFVLTPLTYLGGVFYSISLLPEFWQTVSKFNPIVYMINGFRYGFLGISDVS
FT                   VSYTFVVLISFITVLYYIAFSLIEKGVGLRS"
FT   gene            complement(292788..293696)
FT                   /locus_tag="APL_0264"
FT   CDS_pept        complement(292788..293696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0264"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73372"
FT                   /db_xref="GOA:A3MYY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYY6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P36879"
FT                   /protein_id="ABN73372.1"
FT                   /translation="MNALEITNLIKTYPTGVQAVKGIDLIVEQGDFYALLGHNGAGKST
FT                   TIGIISSLVNKTSGSVKVFGYDLDTQKIQLKQQIGLVPQEFNFNQFEKVIDVLTQQAGY
FT                   YGISQKEATVSAETWLKKLDLWEKRHHLTRELSGGMKRRVMIARALMHNPKLLILDEPT
FT                   AGVDIELRRSLWDFLRELNQQGTTIILTTHYLEEAENLCRHIGIIQNGLLVENTSMKAL
FT                   LSKLETETFVLDLQKKSENQPLEIKGYPTQWLDENTLEVEVKREQGLTNLFHQIAQQDV
FT                   EVLSMRNKSNRLEELFMKMAN"
FT   gene            complement(293696..295762)
FT                   /gene="dnaX"
FT                   /locus_tag="APL_0265"
FT   CDS_pept        complement(293696..295762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="APL_0265"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73373"
FT                   /db_xref="GOA:A3MYY7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYY7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43746"
FT                   /protein_id="ABN73373.1"
FT                   /translation="MSYQVLARKWRPQRFSEVVGQQHVLSALENGLREGRLHHAYLFSG
FT                   TRGVGKTSIARLFAKGLNCETGITATPCGECANCKAIEEGRFIDLIEIDAASRTKVEDT
FT                   RELLDNVQYKPTVGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEYVKFLLATTDPQKLP
FT                   ITILSRCMQFHLRALDQAQIANHLEFILQQENIPYESVAIEKLAKAAQGSIRDSLSLTD
FT                   QAIAVSNANISLPIVQQMLGLIDDHQPIELVTALAQADGEKAMAVIQSVAEKGIDWSQL
FT                   LSDIAQTLHQIAMLQLLKNNGQEQTQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQ
FT                   RAGVEMTILRALAFHPKRTEELNRHPVMEAAKATSAQPHTPQQNIEQLKARLNQNHTQQ
FT                   AVNSVQNVATQPVAKMPENPTAYQQPAVNTTESGSTPVSPALAAMQARKQLQRTQAQLA
FT                   QNEKKKPELVKPATLPASRANPQKTPSLQERFMNLATEQQAQSRPQPTQQAAKPLSDED
FT                   YRWTWLNPELETQNESTKPSDIKQAILQERTPELVAKTIALSCEQDEWCKIVNELKLGG
FT                   LSRQVALNSYLAEKQGERLKLILKPAMAHLDNAESRQSLATALQEKGFSYELSIGKSAE
FT                   HKTPLEIRRAIFENLTLEAKKALTHDEKLMLLRQTFDAEIDESTIRAVAENKE"
FT   gene            complement(295811..296350)
FT                   /gene="apt"
FT                   /locus_tag="APL_0266"
FT   CDS_pept        complement(295811..296350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="APL_0266"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73374"
FT                   /db_xref="GOA:A3MYY8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYY8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKQ4"
FT                   /protein_id="ABN73374.1"
FT                   /translation="MNQLDLIKSSIKSIPDYPKAGIIFRDITSLLEVPEAFKATVDAIV
FT                   AEFKDKGITKVVGTESRGFIFGAPVALALGVPFVLVRKPKKLPRAVISQSYALEYGEDT
FT                   LEIHLDSVKENDNVLMVDDLLATGGTIDATAKLIRRLGGKVEHAAFVIWLPDLGGKERL
FT                   EKEGINSFTLVEFAGH"
FT   gene            296551..297183
FT                   /locus_tag="APL_0267"
FT   CDS_pept        296551..297183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73375"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYY9"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00732307.1"
FT                   /protein_id="ABN73375.1"
FT                   /translation="MNQILIPYVSMADMLVETFGKSCEVVLHDLNRPEHSVVYVAGDVT
FT                   HRKPGQNFDHLVKEVMLSDKLNNNYVANYYFEVKGKLIRSSTQLIFDQNQQLVGALCIN
FT                   IDTTPITEQIAYLNTLLPNLNQIKQTEKTLETEELPLSAMVENLMDKILNGQSVQTMSR
FT                   DEKIEKIRFMEQKGLFLMKGSIEKAAEKLGVNKVTIYSYLDEVRGKR"
FT   gene            297183..297545
FT                   /locus_tag="APL_0268"
FT   CDS_pept        297183..297545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0268"
FT                   /product="putative translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73376"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYZ0"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00732306.1"
FT                   /protein_id="ABN73376.1"
FT                   /translation="MEIILPNQSKGHYSPAIKSNGMLYISGQLPFNADGKIVGDIAAQT
FT                   KQALANLAQVLAAAELSRNDVVQCRVYIPDVAYWDTVNQVYADFFGSHKPARTVVPCGN
FT                   LHYNALIEIDAVAEFA"
FT   gene            297556..298650
FT                   /gene="thrCA"
FT                   /locus_tag="APL_0269"
FT   CDS_pept        297556..298650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrCA"
FT                   /locus_tag="APL_0269"
FT                   /product="putative threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73377"
FT                   /db_xref="GOA:A3MYZ1"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYZ1"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00732305.1"
FT                   /protein_id="ABN73377.1"
FT                   /translation="MKFICNQCQQIAPVSTRQAKCQCGGLWTLDYQPPKFDLNEIDQYE
FT                   WNLFRYRKFIALQDESWRDISLGEGMTPIVRFDENVLLKMDYFMPTLSFKDRGAAVLIS
FT                   HCKSIGVDSVVQDSGGNAGNSVAAYCAKAGIQCEIFVPEGTSPKKINMIEAHGAKANVI
FT                   KGSRDHCADVCRAKVENEGVYYANHVYNPFFYEGTKTYIYETFEQLGRIPKHIVVPVGN
FT                   GTLFIGVIKGLEHLLESGVIDEMPTIIALQSEYCDPLLQAVKKGQKFAEQVEIKPTIAE
FT                   GIAIGQPMRASEILAYAEKYAIRFVHAPEDKILAARNALAKKGIYCEHTTAANYAAYLH
FT                   YCELYGAVEECLITICGAGLKSDH"
FT   gene            298665..299156
FT                   /locus_tag="APL_0270"
FT   CDS_pept        298665..299156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73378"
FT                   /db_xref="GOA:A3MYZ2"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYZ2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P64484"
FT                   /protein_id="ABN73378.1"
FT                   /translation="MSEKTFENLTALLDQYQARYRVVHHTSAGKSEEVAKIRGTEIGQG
FT                   AKALVCKIKGNGIKQAVLAILPADEQADLNQIAQYLGGTKASLASPKEVDELTDCVFGA
FT                   IPPFSFHPDLKLIADPSLLERYDEIAFNAGTLERSIILNTQDYARIVQPTLVCFVKREI
FT                   "
FT   gene            complement(299267..300022)
FT                   /locus_tag="APL_0271"
FT   CDS_pept        complement(299267..300022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0271"
FT                   /product="putative chelated iron transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73379"
FT                   /db_xref="GOA:A3MYZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYZ3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44662"
FT                   /protein_id="ABN73379.1"
FT                   /translation="MVSIPTSISVEKLSVRYNNGHLALYDVSFQLQNGTICALIGVNGG
FT                   GKSTLFKSLMGLVKPQTGTILLNRMPIQQALKQNLVSYVPQSEEVDWQFPVSVYDVVMM
FT                   GRYGYMGLLRRPSSLDKQKVMQAMERVDICHLQHRQIGELSGGQKKRVFLARALAQESQ
FT                   IILLDEPFTGVDVKTENAIVELLQQLRSEGHLILVSTHNLNSVPSFCDQVLMINRTLLA
FT                   AGKTETTFTTENLEKVFGGVLHYLAKDIG"
FT   gene            complement(300024..300920)
FT                   /gene="yfeA"
FT                   /locus_tag="APL_0272"
FT   CDS_pept        complement(300024..300920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeA"
FT                   /locus_tag="APL_0272"
FT                   /product="iron (chelated) ABC transporter,
FT                   periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73380"
FT                   /db_xref="GOA:A3MYZ4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYZ4"
FT                   /inference="similar to AA sequence:RefSeq:NP_874177.1"
FT                   /protein_id="ABN73380.1"
FT                   /translation="MKLSFLKQVFVVALGLSATLAMAAPFKVVTTFTVIQDIAQNVAGD
FT                   KAVVESITKPGAEIHDYQPTPKDIAKAQKADLILWNGMNLERWFERFFENVKGKPAVVV
FT                   TEGITPIAITEGEYKNLPNPHAWMSSANALQYIENIRAALVKYDPKNAESYNQNAKIYA
FT                   EKVKAIAEPLRQRLSVIPEAQRWLVTSEGAFSYLAQDYQLKELYLWAINAEEQGSPQQV
FT                   KKVIDGVKANNIPVVFSESTVSDKPAKQVAKETGALYGGVLYVDSLSTKDGAVPTYLDL
FT                   LKVTISTIVDGFEKSKK"
FT   gene            complement(300987..301322)
FT                   /locus_tag="APL_0273"
FT   CDS_pept        complement(300987..301322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0273"
FT                   /product="putative dissimilatory sulfite reductase"
FT                   /EC_number="1.8.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73381"
FT                   /db_xref="GOA:A3MYZ5"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYZ5"
FT                   /inference="similar to AA sequence:RefSeq:NP_874176.1"
FT                   /protein_id="ABN73381.1"
FT                   /translation="MYYIELNEKKYPTDASGYLIHLADWSEDLAIEIAKKEYIELTDEH
FT                   WEIIFLVRDFYQEYKTSPAIRMLVKAMAQKFGEEKGNSRYLQRLFPDGPAKQATKIAGL
FT                   PKPIKCL"
FT   gene            complement(301375..302040)
FT                   /locus_tag="APL_0274"
FT   CDS_pept        complement(301375..302040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73382"
FT                   /db_xref="GOA:A3MYZ6"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYZ6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44477"
FT                   /protein_id="ABN73382.1"
FT                   /translation="MENRVISGAAGNESLLSTHKVLRNTYLLLSMTLAFSAVIAFAAMS
FT                   MNAPALPWWGLLIGFYGLLFLTNATANSSAGILSVFALTGFLGYTLGPILNRYIGAGLG
FT                   DVVALALGSTALVFFACSAYVLTTKKDMSFLSGMMMALFVVLLVGIIANIFLAIPALSL
FT                   AMSALFVVFSSGAILLGTSNIIHGGETNYIRATVDLYVSIYNLFLSLLQIFGVLGSDD"
FT   gene            302222..302773
FT                   /gene="pgsA"
FT                   /locus_tag="APL_0275"
FT   CDS_pept        302222..302773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="APL_0275"
FT                   /product="phosphatidylglycerophosphate synthase"
FT                   /EC_number="2.7.8.5"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73383"
FT                   /db_xref="GOA:A3MYZ7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYZ7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44528"
FT                   /protein_id="ABN73383.1"
FT                   /translation="MKLNFPTYLTLFRVVLIPLFVIAFYLPAGWYAAEISTLIFFIASI
FT                   TDAFDGYLARKWNQTTQLGAFLDPVADKVLVAVALVCVVEYYHTWWISIPAAIMIAREI
FT                   IISALREWMAELGERASVAVSMWGKFKTTAQMLALGGMLWRFNFAMEVLAWILLYIAAG
FT                   LTLWSMMQYLNAAKGSLLKS"
FT   gene            302893..304863
FT                   /gene="frpB"
FT                   /locus_tag="APL_0276"
FT   CDS_pept        302893..304863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frpB"
FT                   /locus_tag="APL_0276"
FT                   /product="iron-regulated outer membrane protein B"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73384"
FT                   /db_xref="GOA:A3MYZ8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A3MYZ8"
FT                   /inference="similar to AA sequence:INSD:BAB86907.1"
FT                   /protein_id="ABN73384.1"
FT                   /translation="MHKKTIFKLSLISLAVAGYAEANQATLDTVKVQAQPTVNHTRNIS
FT                   NLRELLANRTDINVGGGSVSAQYISIRGSGQDRIGMIVDNTSTNTQQWYHQGRFQLDPS
FT                   MVKSIKIDKGAGSASAGIGITDGVIRAETVSAKDLLKDGRSFGARIGSEYNSNRGINDS
FT                   LSLYGQANNLDVLLLGSWGDDKNYKAGKGYSDAVNKNSRVVNNTARRQGNYLAKFGYDI
FT                   TDKQRIGLSFRQESFYGAGQDRFEMIFNSRPVNANTTKRTYNLEYDAKDIGFARDVKAN
FT                   VFHILGTDKREDYQQNKLTGYQRSSKTKTTGANLGFTSEFGGEHLFKYGVNLRKEQTGS
FT                   QNSFGNIKGEQKFEYGLYAEGIWSLGKVLTLTTGLRYDYYDLDTAGKVDKNGKPLAGNK
FT                   SVSDKRLNPSFGLIWDITPNFALNAKLNYASRSPILASANTITDNRGSLDKARGLRFID
FT                   PKLKTEDVRLAEVGFEWKYADFNLKGSVFEQRVKNFYQTTNSIISNAGTLKTKGYEAEL
FT                   DYQWNALKLTAGVAYADPKADFALSNDPLNVIPQGRQWSTGVSYKFVEPNLEIGWLGRY
FT                   AQSKEYKTGAAPKVETRRRIGYGVHDIFVNWQPLNQDNFNVNFTVKNIGNKFYRSHSQR
FT                   NLEVTPPSPGREFKIGMNYSF"
FT   gene            305016..306848
FT                   /gene="uvrC"
FT                   /locus_tag="APL_0277"
FT   CDS_pept        305016..306848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="APL_0277"
FT                   /product="UvrABC system protein C"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73385"
FT                   /db_xref="GOA:A3MYZ9"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MYZ9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKR0"
FT                   /protein_id="ABN73385.1"
FT                   /translation="MFDAKAFLADVPHLPGVYRMYDAKNTIIYVGKAKDLKKRLSSYFR
FT                   SQLASKKTEALVANIHHIETTITHSETEALLLEHNYIKENQPKYNVLLRDDKSYPYILL
FT                   TKHQHPRITSFRGSKKVAGEYFGPYPNAGAVRETLNLLQKLFPIRQCEDSYYKNRSRPC
FT                   LQYQIGRCLAPCVEGYYSQAEYDNQVNLVRLFLQGKDGQVVEHLVQKMENAAQELDFEA
FT                   AARFRDQIQSVRAVQEKQFVSNERLDDLDIISIAYQHGIACVHILFVRHGKVLGNRSYF
FT                   PKVPNNTDLSELADTFVGQFYLQMNQHRTIPNQIIIDQSLSEVTALANVLSEQAGHKVS
FT                   IADKNIRGDKSRYLALAKTNAEAALTLQLKQDTHIRQRYDSLKALLNLAEIKRMECFDI
FT                   SHTMGNQTVASCVVFDKNGPLKSDYRRFNIEGITGGDDYAAMEQALLKLYDRNLEEEKI
FT                   PDIIFIDGGKGQLNRALETFTSLNVSWDKRKPLLVGVAKGVERKAGLETLLISKWDKEI
FT                   HLPPDSPALHLIQHIRDESHNHAITGHRKKRQKAFTESGLESIAGVGAKRRQALLKYLG
FT                   GMQGVKAATLEEIQSVPGISKQLAEVIFDTLQHS"
FT   gene            306917..307669
FT                   /locus_tag="APL_0278"
FT   CDS_pept        306917..307669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0278"
FT                   /product="putative Mg-dependent deoxyribonuclease"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73386"
FT                   /db_xref="GOA:A3MZ00"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ00"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45305"
FT                   /protein_id="ABN73386.1"
FT                   /translation="MFDSHIHLDQLDSNQIDRIVRDPLLQSVLAVSTDLASAERLLALK
FT                   RVFPKIQMAAGFHPEQTLIDDKQQQMLFDWIVKNRANLTAIGEVGLPNYLKRQNPKLDY
FT                   QPYLALLEQFVVLSKRLNLPLNLHIVHDDVAITLDLLEKYQIQQAHFHWFKTDDDSLER
FT                   FLRTPYFASVTPDILWNPKTQKIVRNLPLDRLLIETDSPWRHESLENASISQQLQAILT
FT                   QLAKLRVESESMIRSQIRRNYQQLYGII"
FT   gene            complement(307806..309824)
FT                   /gene="rep"
FT                   /locus_tag="APL_0279"
FT   CDS_pept        complement(307806..309824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="APL_0279"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73387"
FT                   /db_xref="GOA:A3MZ01"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ01"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44804"
FT                   /protein_id="ABN73387.1"
FT                   /translation="MKLNDQQQQAVEYVTGACLVLAGAGSGKTRVIINKIAHLIAHCGY
FT                   SPKQIAAVTFTNKAAREMRERVAHSIGKENSKGLTISTFHTLGFEILKREYKLLGFKSG
FT                   MTLFDEHDQLALLKHLLPENAAEDKDLLKALISTISNWKNDLLSPEMVLTRVRDERERV
FT                   FSHFYQLYQNQLKAYNALDFDDLIMLPVLLFRQFPEAKTRWQQKVRYLLVDEYQDTNTS
FT                   QYELIKLLVGNEANFTVVGDDDQSIYSWRGAKPENMQRLREDFDLKVIKLEQNYRSSRR
FT                   ILHCANILIDNNDHIFQKRLFSNLGEGEKLNVIEAKNEEHEAERIVGELIAHRFSNKTK
FT                   YKDYAILYRGNHQSRLLEKLLMQNRIPYKISGGTSFFARAEIKDMMAYLRLVVNQDDDA
FT                   AFLRIVNTPKREIGAVTLEKLGLLANEKQVSLFEAIFDFELIQRLTPKPYQALQDFARW
FT                   IVEIADQAERSDPIEAVKDLLAKIQYEAYLYETATSPKAAEMQSRNVQTLFEWVQGMLE
FT                   GDEIEEPMTLVQVVNRLTLRDMLERGEDDDEADQVQLMTLHASKGLEFPHVFLVGMEEG
FT                   ILPHQTSLDEDNVEEERRLAYVGITRAQQTLTFSLCKERRQYGEIIKPEPSRFLLELPQ
FT                   DDLVWESEKPKMTEEQKVEKTSANIANLMAMLKANKK"
FT   gene            310158..311273
FT                   /gene="potA"
FT                   /locus_tag="APL_0280"
FT   CDS_pept        310158..311273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="APL_0280"
FT                   /product="spermidine/putrescine import ATP-binding protein
FT                   PotA"
FT                   /EC_number="3.6.3.31"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73388"
FT                   /db_xref="GOA:A3MZ02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ02"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45171"
FT                   /protein_id="ABN73388.1"
FT                   /translation="MEQLEQKPIIELRNVTKSYGSKTILKNLNLTINDGEFLTILGPSG
FT                   CGKTTALRLIAGFEDLTEGSIILDGQDVSNVPAEQRPVNTVFQSYALFPHMTIFENVAF
FT                   GLRMQKVPNDQIKPRVMEALRMVRLEDRAEQKPAQLSGGQQQRIAIARAVVNKPKVLLL
FT                   DESLSALDYKLRKEMQHELKALQRQLGITFIFVTHDQEEALTMSDRIIVMNGGKIAQDG
FT                   TPREIYEEPKNLFVARFIGEINVFDATVIERVDARNVKANVEGRICNIKVEDMDVQPNQ
FT                   KLKVLLRPEDILIEELDENESSKAIVGHILDRNYKGMTLESSVKLDHNGMTVLVSEFFN
FT                   EDDPNIDHEVGQKVALTWYEGWEVVLNDEDC"
FT   gene            311260..312126
FT                   /gene="potB"
FT                   /locus_tag="APL_0281"
FT   CDS_pept        311260..312126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="APL_0281"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein potB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73389"
FT                   /db_xref="GOA:A3MZ03"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ03"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45170"
FT                   /protein_id="ABN73389.1"
FT                   /translation="MKIANNKFQAGTVSVIFGWLLLFVLVPNVLVLLISFLTENRQSAY
FT                   FVDFIFSLDAYTQLFNDTYATVLWNSFKMSAIATFFCLIIGYPFAFIIAKMPAKIRPIL
FT                   LFLVVLPFWTNSLIRIYGIKIFLGVKGVLNEALLAIGLIDEPLRLLNSELAIIIGLVYI
FT                   LLPFMILPLYSSIEKIDGRLLEAAKDLGANAFQRFVRVTIPLTMPGIVAGCLLVLLPAM
FT                   GMFYVADLLGGGKTPLIGNIIKSLFLNTNQFALGSAVSIALTVLMALMLYVYYRANKLL
FT                   NKKVELE"
FT   gene            312153..312893
FT                   /gene="potC"
FT                   /locus_tag="APL_0282"
FT   CDS_pept        312153..312893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="APL_0282"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein PotC"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73390"
FT                   /db_xref="GOA:A3MZ04"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ04"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45169"
FT                   /protein_id="ABN73390.1"
FT                   /translation="MFVVFAYLYIPIIILVVNSFNEDRYGLQWKGFSWNWYERLFANDT
FT                   LVQATMNSLTIAFFAATFSTVLGALTSIALYRYKFRGMQMVGGLLFIVMMSPDIVMAVS
FT                   LLVLFMILGVRLGFISLLIAHITFCLPYVVITISSRLSDFDGKMLEAAKDLGASEVTIL
FT                   RKIILPLALPSIISGWLLSFTISLDDVVVSSFVTSPSYEVLPLKIFSLVKTGVTPEVNA
FT                   LATIMIIFSLTLVVLSQLVVRKKA"
FT   gene            313035..313640
FT                   /gene="ruvA"
FT                   /locus_tag="APL_0283"
FT   CDS_pept        313035..313640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="APL_0283"
FT                   /product="holliday junction ATP-dependent DNA helicase
FT                   RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73391"
FT                   /db_xref="GOA:A3MZ05"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ05"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKV4"
FT                   /protein_id="ABN73391.1"
FT                   /translation="MIGRLHGKIIEKQPPEMVIDVQGVGYEVLLPMTSFYSLPQVGEEA
FT                   TIFTHLVVREDAHLLFGFAQKQDRTLFRELIKTNGVGPKLALAILSAMSVSQFANAVEN
FT                   EELAKLTKIPGIGRKTAERLLVELKGKFKGVAQSDFFEEHSVETIVATHSHDPADEARD
FT                   ALVALGYKLADAEKMIKKVNKAGATSEQLIREALKASL"
FT   gene            313779..314663
FT                   /gene="ruvB"
FT                   /locus_tag="APL_0284"
FT   CDS_pept        313779..314663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="APL_0284"
FT                   /product="holliday junction ATP-dependent DNA helicase
FT                   RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73392"
FT                   /db_xref="GOA:A3MZ06"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ06"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKV5"
FT                   /protein_id="ABN73392.1"
FT                   /translation="MEIFIKAAKLRDEALDHLLIFGPPGLGKTTLANIVANEMGVNIRT
FT                   TSGPVLEKAGDLAAMLTNLEPYDVLFIDEIHRLSPAIEEVLYPAMEDYQLDIMIGEGPA
FT                   ARSIKLDLPPFTLVGATTRAGSLTSPLRDRFGIVQRLEFYSVDDLTSIVKRSADCLNLN
FT                   LSPDGAYEVARRSRGTPRIANRLLRRVRDYADVRNNGVITSDIAKQALAMLDVDSEGFD
FT                   FMDIKLLQAIVERFDGGPVGLDNLAAAIGEERDTIEDVLEPYLIQQGFLQRTPRGRIAT
FT                   SRTYAHLGIAKLD"
FT   gene            complement(314720..315424)
FT                   /gene="ubiG"
FT                   /locus_tag="APL_0285"
FT   CDS_pept        complement(314720..315424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="APL_0285"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73393"
FT                   /db_xref="GOA:A3MZ07"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ07"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKW2"
FT                   /protein_id="ABN73393.1"
FT                   /translation="MNNIDQTELDKFEKMAATWWDPNGSFKPIHLLNPLRLDYIQQKAN
FT                   GLFGKKVLDVGCGGGILSEAMARAGATVTGIDMTTEPLEVARKHAEENGLSIDYRQTTI
FT                   EDFVQNQTACHAEKFDVITCMEMLEHVPDPLSIIQSCKALLKPDGVLFFSTINRTLKAY
FT                   MLVIIGAEYVLKMLPKGTHEFEKFIKPAELLNWCDMADLRCQEMKGYHFNPVTEKFWLN
FT                   NDVSCNYIAMLK"
FT   gene            315604..318294
FT                   /gene="gyrA"
FT                   /locus_tag="APL_0286"
FT   CDS_pept        315604..318294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="APL_0286"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73394"
FT                   /db_xref="GOA:A3MZ08"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ08"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43700"
FT                   /protein_id="ABN73394.1"
FT                   /translation="MSELAKDITPVSIEDELKTSYLDYAMSVIVGRALPDVRDGLKPVH
FT                   RRVLFSMDQNSNTFNRPHVKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVD
FT                   GQGNFGSIDGDAPAAMRYTEVRMQKITQELLTDLDKETVDYSPNYDGKEMIPDVLPTKI
FT                   PALLVNGSSGIAVGMATNIPPHNLNEVLDGCLAYIENEQIGIEELMRFIPGPDFPTGAI
FT                   INGRKGIEEAYRTGRGKVYVRAKASVETTEKGREQIVVTELPYQVNKAKLIEKIAELVK
FT                   DKKIEGISGIQDHSDKKGISIVIEVKRDAVGEVVLNHLYSLTQMQVTFGINMVALDHGQ
FT                   PKVLNLKQIIEAFVKHRREVVTRRTIFELRKARERAHILEGLAIALANIDPVIELIRNS
FT                   KTADEAREGLLARAWALGNVAPMLEAAGVDASRPEDLPENLGVRDGQYYLSEAQARAIL
FT                   ELRLHRLTGLEHEKIVDEYKALLTEIGELLRILSSAERLMEVIREELEKVKAEFGDERR
FT                   TEITAASGDINMEDLIAQEDVVVTLSHAGYVKYQPLSDYEAQRRGGKGKSATKMKEDDF
FT                   IEKLLVANTHDTILCFSSRGRLYQLKVYQLPQASRGARGTPIVNILPLVKEENERITAI
FT                   LPIPNGEFSADKFIFMATASGVVKKVSLDAFSNVRSSGLIALKLREGDELIGVDITDGE
FT                   SEIMLFSAQGRVVRFAEKAVRAMGRTATGVRGIKLATTDISSEEIEEAEIVEIENEEAD
FT                   ESSVSLDTDRVVSLVIPRTEGDILTVTQNGFGKRTVIGEYPVKSRATKGVVSIKVNERN
FT                   GKVVAAVQVEEADQIMLITDAGTLVRTRVAEVSLVGRNTQGVRIIRTADDESVVSVERV
FT                   CEPDDEDENSEALDNVESTETSTEA"
FT   gene            318391..319938
FT                   /pseudo
FT                   /gene="hsdM"
FT                   /locus_tag="APL_0287"
FT                   /note="internal stop codon"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q47163"
FT   gene            319940..320260
FT                   /locus_tag="APL_0289"
FT   CDS_pept        319940..320260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73395"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ09"
FT                   /inference="similar to AA sequence:RefSeq:YP_719732.1"
FT                   /protein_id="ABN73395.1"
FT                   /translation="MNELKLFENRQIRSTWDDEKEEWFFSIVDIVGALTESSNPRRYWS
FT                   DLKRKITDEESGIELYEKIVQLKMQSSNGKFYSTDAADMAGIFRIIQSIPSPKAEPFKL
FT                   WL"
FT   gene            320427..321521
FT                   /locus_tag="APL_0290"
FT   CDS_pept        320427..321521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0290"
FT                   /product="putative Type I restriction enzyme EcoR124II
FT                   specificity protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73396"
FT                   /db_xref="GOA:A3MZ10"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ10"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P10485"
FT                   /protein_id="ABN73396.1"
FT                   /translation="MNILELIKDCEVEWKSLGEVAKYEQPTKYLVKSTNYNDDFNTPVL
FT                   TAGKTFILGYTDEIDGIYPAKSNPIIIFDDFTTANKWVDFDFKVKSSAMKMITSSDENK
FT                   FSLKYIYYWLNTLPMEDNTDHKRQWISNFANKKIPIPPLEIQEKIVKTLDIFTKLEAEL
FT                   SLRVKQYDYYRNELLTFDDDVEFITLDKISENLNSMRKPIKSGLREKGRIPYYGASGIV
FT                   DYVEDYIFDDEILLISEDGANLIARNTPIAFSVLGKCWVNNHAHVLKFKTDVERKFVEF
FT                   YLNNLDLSPFISGAAQPKLNKQNLNKIPIPNITFATQQKIVDILDKFDRLPNSISDGLP
FT                   KEIELRRKQYEYYRERLLNFPKSE"
FT   gene            321527..322642
FT                   /pseudo
FT                   /gene="prrC"
FT                   /locus_tag="APL_0291"
FT                   /note="internal stop codon"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P10486"
FT   gene            322648..325785
FT                   /locus_tag="APL_0293"
FT   CDS_pept        322648..325785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0293"
FT                   /product="putative type I site-specific
FT                   restriction-modification system, R (restriction) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73397"
FT                   /db_xref="GOA:A3MZ11"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ11"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P10486"
FT                   /protein_id="ABN73397.1"
FT                   /translation="MLEEIYTPITETNKFIVLDKYEKLEQGSSYQTESDLECEFIADLQ
FT                   NQGYEYRTDLNSQEALLQNVRRQLETLNNVQFLDSEWQRFLTEYLDKPSENIIDKTRKI
FT                   HHDHIYDFVFDNGRIQNIYLVDKKQVARNKVQVINQFEQTGTHANRYDVTILVNGLPLV
FT                   QIELKKRGVAIREAFNQIHRYSKESFNKDHSLFKFLQIFVISNGTDTRYFANTTKRDKN
FT                   SFDFTMNWARSDNTLIKDLKDFTATFFQKNTLLNVLLTYSVFDVSETLLIMRPYQIAAT
FT                   ERILWKIRSSHLANNWCSTESGGYVWHTTGSGKTLTSFKAARLATELDFIDKVFFVVDR
FT                   KDLDYQTMKEYQRFSPDSVNGSDSTAGLKANIEKDDNKIIVTTIQKLNNLMKSEDKLAI
FT                   YQQPVVFIFDECHRSQFGEAQKNLHKKFKKFCQFGFTGTPIFPENALGTETTASVFGRE
FT                   LHSYVITDAIRDEKVLKFKVDYNDVRPKFRDIETEQNLDKLTALETKEALLHPERIKEI
FT                   TQYILSHFKQKTHRLNATGKGFNAMFAVSSVEAAKHYYEQFKLQQQAVDKTQSVLNVGF
FT                   ANGSEGVRNLSQQISNKKPLKVATIFSFATNEEQNAIGEIEDEGFEPTAMNSSAKEFLA
FT                   LAIDDYNQMFRTNFGMDSKAFQNYYRDLAKRVKNQEVDLLIVVGMFLTGFDAPTLNTLF
FT                   VDKNLRYHGLMQAFSRTNRIFDATKTFGNIVTFRDLEQATIDAITLFGDTNTRNVVLER
FT                   TYQDYMHGYEDSSGKKHRGYLAVVKELQEKFPEPNNLETEEDKKAFTKLFGEYLRLENV
FT                   LQNYDEFHELVKSGQDNLVCETPATYGSNAVETLTERQVQDYRSAYNDIRDWQRRERSN
FT                   AESKSSVDWSDVIFEVDLLKSQEINLDYILELIFEHNKKIKNKDALVEEIRRMIRSSIG
FT                   NRAKESLVVDFIHQTDLNSIPDKASVIEAFFQFAQKEQKREAEELIQSEKLNEEAAKRY
FT                   ISSSLKREYASENGTDLVSMLPKMSPLDPKRHKKKETVFQKIVSFIEKFKGVGGSI"
FT   gene            325804..327747
FT                   /gene="uupA"
FT                   /locus_tag="APL_0294"
FT   CDS_pept        325804..327747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uupA"
FT                   /locus_tag="APL_0294"
FT                   /product="ABC transporter ATP-binding protein Uup-1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73398"
FT                   /db_xref="GOA:A3MZ12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ12"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q57242"
FT                   /protein_id="ABN73398.1"
FT                   /translation="MALLNLSNAYLGFGDHPLLDHTELHIEPGERVCLVGRNGAGKSTL
FT                   MKVLAGEVQLDDGKLIFEKDIVVTRLEQDPPRHIQDTVFDYVAEGIAHLSDLLKQYHHI
FT                   SQQMQTDYSDELLAKLSNVQAQLEHNNGWQFENRIQDTLKLLELDPDKRLCELSGGWVR
FT                   RAALARALVADPDILLLDEPTNHLDVEAITWLEDLLLNFKGSIIFISHDRSFIRKMATR
FT                   IVDLDRGKLVSYPSNYDVYLETKAEDLRVEALQNELFDKKLAQEEVWIRQGIKARRTRN
FT                   EGRVRALKALREERRNRREVQGTAKIQIDQTARSGKIVFEVENASYEIEGKTLLKNFTT
FT                   TIQRGDKIALVGTNGCGKTTFIKLLLGELQPTSGSIRCGTKLEVAYFDQYRADLDLEKT
FT                   VMDNVADGKQDVEVNGVKRHVLGYLQDFLFPPKRAMTPVKALSGGERNRLLLAKLLLKP
FT                   NNLLILDEPTNDLDVETLELLEEVLADYQGTLLIVSHDRQFIDNTVTECYFFEGNGVLN
FT                   KYVGGYFDAKQQQENYHATIAQNQPNKRSNSAENLQKTEEKQPLVEKSEPAKKVKLSYK
FT                   EQRELDELPAKMEALEAEMESLQAEVNSADFFSKDPSYTQAQLQKLADAEMALEAAFER
FT                   WEVLENIKNGNS"
FT   gene            327747..328511
FT                   /locus_tag="APL_0295"
FT   CDS_pept        327747..328511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73399"
FT                   /db_xref="GOA:A3MZ13"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ13"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q57097"
FT                   /protein_id="ABN73399.1"
FT                   /translation="MARVDNYEQRFGGIGRLYTPEGLAKLRQSHICVIGIGGVGSWAVE
FT                   ALARSGIGKITMIDMDDICVTNINRQIHAMTGTIAQLKTEAMKERIERINPECVIEIID
FT                   DFITPENIPEYLNRGYDYVIDAIDSVKTKAALIAYCKRNKIKMVTTGGAGGQTDPTQIQ
FT                   ITDLSKTIQDPLASKVRSLLRKEYNFSQNPKRKFGIDCVFSTQPLIFPKMGEGCEVSAT
FT                   MNCANGFGAVTMVTATFSFFAVSRVIDKLLKS"
FT   gene            complement(328590..328922)
FT                   /locus_tag="APL_0296"
FT   CDS_pept        complement(328590..328922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73400"
FT                   /db_xref="InterPro:IPR020493"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ14"
FT                   /inference="similar to AA sequence:RefSeq:NP_874146.1"
FT                   /protein_id="ABN73400.1"
FT                   /translation="MLKKFITSGIVSMMFISTIQNAVAEMKTSSLSMAKPSVSKHLPSQ
FT                   CQQMFSVAHKLVSDAEKQPGTHTQVQKMKNKLSSTKEEILKMETEMQEKSCNKGLTALN
FT                   TLKQKH"
FT   gene            329378..330928
FT                   /gene="cydA"
FT                   /locus_tag="APL_0297"
FT   CDS_pept        329378..330928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="APL_0297"
FT                   /product="cytochrome oxidase subunit 1"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73401"
FT                   /db_xref="GOA:A3MZ15"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ15"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45021"
FT                   /protein_id="ABN73401.1"
FT                   /translation="MLDVVELSRLQFALTALYHFLFVPLTLGLSFVLVVMETLYVTTGK
FT                   EVYKDMTKFWGKLFGINFALGVTTGITMEFQFGMNWSYYSHYVGDIFGAPLAIEGLMAF
FT                   FLESTFIGLFFFGWDRLSKGKHLLATYAVAFGSNLSALWILVANGWMQNPVGSEFNFET
FT                   MRMELVSFSELVLNPVTQSKFLHTVTAGYTCGAVFVLGISAYYILKGQDLGFAKRSFSV
FT                   GASFGLVAIIAVAIMGDESGYEIGKAQPTKLAAMEGEFETQPAPAAWNVVVLPNTAEMK
FT                   NEFSIHIPYMAGIIATRSFDTEIKGLNDIRAINEQRVRTGIQAYALLEKLRTGNYTAED
FT                   KAAFQAGQKDLGFGLLLKQYTPNVGDATEEQIQKAAASTIPNVGPTFWAFRIMMASGGL
FT                   MLLLIGFAFFQNMRGTVGKSRLFLKAMLWGIPLPWIAIESGWFLAEYGRQPWAIYEMLP
FT                   TGVSNSALTTTDLWIAIGLLCGLYTLFLVVEMYLMFKYGRLGPSALKTGRYHFEQSAK"
FT   gene            330942..332078
FT                   /gene="cydB"
FT                   /locus_tag="APL_0298"
FT   CDS_pept        330942..332078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="APL_0298"
FT                   /product="cytochrome oxidase subunit 2"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73402"
FT                   /db_xref="GOA:A3MZ16"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ16"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45020"
FT                   /protein_id="ABN73402.1"
FT                   /translation="MIDYEILRFIWWILIVVLLIGFAVTDGFDMGVLTLLPVIGKSNVE
FT                   RRVMINTIAPHWDGNQVWLLTAGGAIFAAWPTVYATSFSGFFLAMILVLAALFFRPVGF
FT                   EYRAKIDSPKWRNAWDWGLFIGGFVPSLIFGVAFGNLLQGVPFEFNNINQVVYTGSFFG
FT                   LLNPFALLCGVVSLMMLTTQGATWLQMKTTGDLRNRARATAQLTAAIVLVAFVLAGVWL
FT                   SFKDGFVITSDLDHNAQSFLTNKTVAVESAAWFRNFAEMPVLWVVPALAVVGALLTIVA
FT                   SKANRSGFAFFSSSIMLVGVITTAAVSMFPFIMPSISHPEMSLTVWDSTASQYTLMAML
FT                   VVACIFVPLVLAYTTWSYFKMYGRLDAKYLEDNKASAY"
FT   gene            332646..333035
FT                   /locus_tag="APL_0299"
FT   CDS_pept        332646..333035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73403"
FT                   /db_xref="GOA:A3MZ17"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ17"
FT                   /inference="similar to AA sequence:RefSeq:NP_874141.1"
FT                   /protein_id="ABN73403.1"
FT                   /translation="MNFPIRVYYEDTDAGGVVYHANYVCFFERARTEFLRQAGFSQQEL
FT                   LSKSFAFVVKKLEVDYKVPARLDDLLNVETTVLELKKATIVFRQQLWKGDICLSSAIVT
FT                   VASVDLTKMKPVAIPAEIRQVLQAV"
FT   gene            333070..333750
FT                   /gene="tolQ"
FT                   /locus_tag="APL_0300"
FT   CDS_pept        333070..333750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="APL_0300"
FT                   /product="colicin transport protein TolQ"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73404"
FT                   /db_xref="GOA:A3MZ18"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ18"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43768"
FT                   /protein_id="ABN73404.1"
FT                   /translation="METEFNLVSLFMQASIVVKIVILILISFSILSWAVIIQRSRVLTE
FT                   AKKNALAFENKFWSGEDLHRLHEGLENRRDGLNGSEQIFYAGFKEYMRLQQVNPDAPEA
FT                   TMKGSSRAMNLALNREVENLESYIPFLGTVGSISPYIGLFGTVWGIMHSFMGLSAVKQA
FT                   TLQSVAPGIAEALIATAIGLFAAIPAVMAYNRLSLRVNKLEQDYANFIDEFTTILHRQA
FT                   FSKK"
FT   gene            333829..334269
FT                   /gene="tolR"
FT                   /locus_tag="APL_0301"
FT   CDS_pept        333829..334269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="APL_0301"
FT                   /product="biopolymer transport protein TolR"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73405"
FT                   /db_xref="GOA:A3MZ19"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ19"
FT                   /inference="similar to AA sequence:RefSeq:NP_874139.1"
FT                   /protein_id="ABN73405.1"
FT                   /translation="MSYRRKRNDIKSEINIVPFLDVLLVLLLIFMATAPVISQSVEVNL
FT                   PEDKHSQSVSNEDKTPVILQVADVGLYKLKIDGNFVQGSSGQEDLGEQEVIAYAGEAFQ
FT                   KDPNTLFLVAAEKNIPYEEVIKGIVLLKDAGIKNAGLMTQGK"
FT   gene            334285..335580
FT                   /gene="tolA"
FT                   /locus_tag="APL_0302"
FT   CDS_pept        334285..335580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="APL_0302"
FT                   /product="cell envelope integrity inner membrane protein
FT                   TolA"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73406"
FT                   /db_xref="GOA:A3MZ20"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ20"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44678"
FT                   /protein_id="ABN73406.1"
FT                   /translation="MKSKNDRLELAVIVSILLHALLIGLLILGSFFTKTTLEEAAGGSG
FT                   GTGEEFEAVMVDTGQVAAEYGRLKSDKKGNAKPKVEEKEEPKPEEVVEDEPTPQEIAEE
FT                   QAKEQQRIAMIEEQKKQEEQRKEEQRKKAEEKRQQEIEKQEQLKKEQAEEATRKKAAEA
FT                   ARLKAEAEAKNLEAAAKAAEEEKKAKEAQKKLEQQKKLEEQKQAEKEAKLKAEKEAKEK
FT                   AEKEAKAKAEKEAKEKAEKEAKLKAEKEAKEKAEKEAKLKAEKDAKAKAEKEAKAKAAA
FT                   EAKAKADAAAKAAQAKNNKALDDFLSGGDIGGGSSKGGNKNTAGSQGNGNAKGIGDGRG
FT                   TADTGYAQLIKKKLARTYRVDPSFSGRECQVKIFIDPAGNITNHQVLSGPDDICRAAVT
FT                   AITSARNVPRAPNEETYNKYKSPIIKFGLKVL"
FT   gene            335598..336878
FT                   /gene="tolB"
FT                   /locus_tag="APL_0303"
FT   CDS_pept        335598..336878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="APL_0303"
FT                   /product="translocation protein TolB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73407"
FT                   /db_xref="GOA:A3MZ21"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ21"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKU3"
FT                   /protein_id="ABN73407.1"
FT                   /translation="MKLKSRFTSIIGVITLFFSQTVTAESDVVISVDEGVSMAQPIAVV
FT                   PFKANGGVPADVGQIIADDLRNSGKFTPVERSKLPAQPGSAAEVNSQQWTDIGVDSVVV
FT                   GQVTPTGGGYNVAYQLVDTLSNPATVLAQGAFNVPAAQIRQGAHTVSDQVFEKITQIRG
FT                   AFRTKIAYVVQRGVSSYELRVSDYDGYNAFTVVKSKEPLMSPEWSPDGSRLAYVTFENK
FT                   KAQVVVHDLRSGSRRVVAALRGHNGAPAFSPDGSRIAFASNQDGELDIYVVGANGGKPS
FT                   KLTANAGNNTEPSWSPDGSTIYFTSDRAGSPQVYRMGSSGGGASPMGGSGSYNAKVSSD
FT                   GKNLIMIAGDKVVKRDLASGGTEVLSSTFLDESPSISPNGIMVIYSSTKGTSKVLQLVS
FT                   ADGRFKANLPGAGGQFKFPAWSPYLTK"
FT   gene            336904..337374
FT                   /gene="palA"
FT                   /locus_tag="APL_0304"
FT   CDS_pept        336904..337374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="palA"
FT                   /locus_tag="APL_0304"
FT                   /product="outer membrane protein precursor PalA"
FT                   /note="pubmed:8763621"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73408"
FT                   /db_xref="GOA:A3MZ22"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ22"
FT                   /inference="similar to AA sequence:INSD:CAA61413.1"
FT                   /protein_id="ABN73408.1"
FT                   /translation="MKKLAKVLMIAAPAFVLAACSSSSDNANANANANANANAGQFGGM
FT                   TAEDLQTRYNTVYFGFDSYAVEGEYQQLLDAHAAYLTSANGKVTVAGHADERGTPEYNI
FT                   ALGQRRADAVKNYLATKGANQVSTVSYGEEKPAVLGHTEADYAKNRRAVLEY"
FT   gene            337552..338358
FT                   /locus_tag="APL_0305"
FT   CDS_pept        337552..338358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73409"
FT                   /db_xref="GOA:A3MZ23"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ23"
FT                   /inference="similar to AA sequence:RefSeq:ZP_01231791.1"
FT                   /protein_id="ABN73409.1"
FT                   /translation="MALFMRLAGELPLAEKAIFRNAITALISGYIIWRNKQSFLGQAEN
FT                   RTLLLLRSITGLLGILCGVYIIDHLVLSDVDMIGKLTSFILIVFSAVFLKEKASYVQWG
FT                   LCLSAFVGALFIIKPAFEIKFFPYVIGIIGAVFAALAYLCLRLLGKRAKPETSNTIVFF
FT                   FSAFSTIVLLPFVFLDFVPITAIQFNYLLLSGITATVGQFCVTLAYKYAAAKDISIYSY
FT                   ASVLFSAFLGATIFEQFPDGWSVLGYLIIFSSGFLMFMFTRTKRKI"
FT   gene            338438..339298
FT                   /gene="djlA"
FT                   /locus_tag="APL_0306"
FT   CDS_pept        338438..339298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="APL_0306"
FT                   /product="DnaJ-like protein DjlA"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73410"
FT                   /db_xref="GOA:A3MZ24"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ24"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKU4"
FT                   /protein_id="ABN73410.1"
FT                   /translation="MQFIGKIIGFFIGYKLFGGIFGGLLGVFIGHLADKKLYELGSVRS
FT                   SIFGKNLTRQSLFTQTTFAVLGHIAKAKGRVTEDDIHLARLLMARLKLDANAQQLAQQA
FT                   FTLGKEADFPLRQVIQEFREACGQRADLLRFFVEVQMQAALQDGQLDSNEQQILFTIAE
FT                   TMGMSRFQFEQMIAMVMAAQQFRSGGFYQQSQQQSGSYHQSQGNYGGYRPSGPNVKDAY
FT                   TVLGVTENDDQNTVKRAYRKLMNEHHPDKLAAKGLPDEMMELAKEKAQQIQAAYDLICK
FT                   TKGWK"
FT   gene            339383..340345
FT                   /gene="dusC"
FT                   /locus_tag="APL_0307"
FT   CDS_pept        339383..340345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusC"
FT                   /locus_tag="APL_0307"
FT                   /product="tRNA-dihydrouridine synthase C"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73411"
FT                   /db_xref="GOA:A3MZ25"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR032886"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="InterPro:IPR042270"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ25"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKU5"
FT                   /protein_id="ABN73411.1"
FT                   /translation="MINNIPKVILAPMQGVLDPFVRKLLTAVNDYDLCISEFVRVVDQK
FT                   LPKKAFYRRAPELLQGGLTDSGTPVRVQLLGQHPQWLAENARLAIELGSQGVDLNCGCP
FT                   SKTVNGSNGGASLLKDPDLIYRATKAMREAVPQDQIVSVKVRLGWDSADQSFEIADAVA
FT                   QGGANEITVHGRTKQDGYRAERINWQAIGEIQKRLSIPVIANGEIWDFESAKNCQNTTA
FT                   CSSLMIGRGALNTPNLSRVVKFNQPKMAWNEVLQLLFQYVNMENEHDSGFYHVARIKQW
FT                   LHYLDKEYPQAKDLFQILKTEHGYDGLKTHIERAVNQEF"
FT   gene            340397..341443
FT                   /locus_tag="APL_0308"
FT   CDS_pept        340397..341443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0308"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73412"
FT                   /db_xref="GOA:A3MZ26"
FT                   /db_xref="InterPro:IPR006507"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ26"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P59917"
FT                   /protein_id="ABN73412.1"
FT                   /translation="MKKQIFSEQEITTEQQFVAKQEFEASDDIQIEEEYQEVEAELIVE
FT                   ESLKPSRFWVRVLLFALGLFSVAVIAQSVQWLIDTFQARQWIYFAFAIVFALISLTGVV
FT                   AIIGEWRKLVFLRHHQQQQQVSEQLLLEELSTTSGEKAVNFCNEVVANLKNVPSVQHSQ
FT                   QRWQSQLNEAYNAKEVLYLFSETVLTPLDKQVKKMISKSATENAVIVAVSPLAVVDVLM
FT                   VAWRNIALVNKISKTYGMQLGYFSRLKLFKMVLTNMVFAGATEVVSDVGMEFFSQNLTA
FT                   KLSLRAAQGIGVGLLTARLGIKAMEFCRPVAFQAGEKPKLSAIRQQLLTSVKNTIFAKA
FT                   EEKVSEKV"
FT   gene            complement(341631..343547)
FT                   /gene="yheS"
FT                   /locus_tag="APL_0309"
FT   CDS_pept        complement(341631..343547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yheS"
FT                   /locus_tag="APL_0309"
FT                   /product="putative ABC transporter ATP-binding protein
FT                   YheS"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73413"
FT                   /db_xref="GOA:A3MZ27"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ27"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44808"
FT                   /protein_id="ABN73413.1"
FT                   /translation="MIFFTDLILKRGQSVLLENTSATIHTGQKVGLVGKNGCGKSSLFA
FT                   LVKGELQPEGGDVSLPKNWAISWVNQETPALEISALDYVIQGDREYTGLMNQLEKANQE
FT                   NNGNQIAMIHTQLDTIDAWTIQARAATLLNGLGFSNEQLSLPMKSFSGGWRMRLNLAQA
FT                   LICRSDLLLLDEPTNHLDLDAVIWLEKWLTNYRGTLLLISHDRDFLDPIIDRVIHIENQ
FT                   QLNDYTGNYTSFEIQRATKISQQNAAYAQQQRKVAHLQSFIDRFKAKATKAKQAQSRIK
FT                   ALEKMELIAPAYADSPFEFEFRPPLALPSPLLMMEKAGAGYGNKTILESVKLNLVPGSR
FT                   IGLLGRNGAGKSTLIKLLAGELAPQTGHIQLAKGVQLGYFAQHQVDTLRFDESPLWHLQ
FT                   KIAPELTEQEVRNYLGGFDFKGDKVKQNVGSFSGGEKARLVLALIVWQRPNLLLLDEPT
FT                   NHLDLEMRQALTDALTYYEGSLVVVSHDRHLLRSTVNEFYLVHDKKVEEFKGDLDDYQK
FT                   WLNEQNALEAAKNSGNSTACTEEKADNSAANRKEQKRLEAELRQQTAPLRKKITQLEKD
FT                   LEKASEKLNQLEALLASSEIYEAENKAQLTETLAKQIEEKKAVEEIEMEWLDCQEQLEA
FT                   LLS"
FT   gene            344138..345379
FT                   /gene="moeA"
FT                   /locus_tag="APL_0310"
FT   CDS_pept        344138..345379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="APL_0310"
FT                   /product="molybdopterin biosynthesis protein MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73414"
FT                   /db_xref="GOA:A3MZ28"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ28"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45210"
FT                   /protein_id="ABN73414.1"
FT                   /translation="MALLPLSEALANMLARLPSPTKIENLPLNQCANRILAEDIFSPIN
FT                   VPSFDNSAMDGYAFRLADLVQFERLIVAGKSFAGNPFIGEVKAGECIRIMTGAMVPADC
FT                   DVVVMQEEAEAETLASGQISVKFCKTPKLGQNIRRIGEDVKQGALVLAKGSLLNVTTLP
FT                   LLASLGVAQVPVFSRLKVAILSTGDELTSVGQALEQGKIYDTNRFAVRLMLEKLNCDIL
FT                   DFGILPDDPAVFEQTFTQAQQQADVLITSGGVSVGEADFTKEVLDKLGEIGFWKIAMKP
FT                   GKPFAFGKLQHAWFFGLPGNPVSALVTFYQLVQPALAKLAGVNAERIANLTQNLTAIAD
FT                   TNLKKAVGRQDFQRGFYYVNEQGEVAVRPVGLQGSHLFSAFYESNCFIVLEAERGNVDA
FT                   GEKVTIQPFNSLLR"
FT   gene            345389..346135
FT                   /gene="moeB"
FT                   /locus_tag="APL_0311"
FT   CDS_pept        345389..346135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeB"
FT                   /locus_tag="APL_0311"
FT                   /product="molybdopterin biosynthesis protein MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73415"
FT                   /db_xref="GOA:A3MZ29"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012730"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ29"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P12282"
FT                   /protein_id="ABN73415.1"
FT                   /translation="MELSDQEMLRYNRQIILKSVDFDGQEKLKASRVLIVGLGGLGCSA
FT                   AQYLASAGVGHLILVDFDEVSLSNLQRQILHTDANIGQLKVESAKVRLSQINPHIQLEA
FT                   INKQCSDAEFAELIERVDLVVDCTDNVTVRNQLNLQCFAQKRPLVSGSAIRFEGQISVF
FT                   TYAENEPCYNCLSRLFGDGTLSCVEAGVIAPIVGVVGSLQALEAIKLLLNIGKSLSGKL
FT                   LMIDGLYFSVREMNLPKLQDCEICCQ"
FT   gene            346228..346303
FT                   /locus_tag="APL_2051"
FT   tRNA            346228..346303
FT                   /locus_tag="APL_2051"
FT                   /product="tRNA-Asn"
FT   gene            complement(346529..347857)
FT                   /gene="rumA"
FT                   /locus_tag="APL_0312"
FT   CDS_pept        complement(346529..347857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="APL_0312"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73416"
FT                   /db_xref="GOA:A3MZ30"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ30"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKU9"
FT                   /protein_id="ABN73416.1"
FT                   /translation="MALFYSEKAAKQQAKKSAKTTACPPVTIQSLDYQGLGVAKINGKT
FT                   WFIENALPNEQVEIQVLEEKRQYGRAKAVKILKQSAARQQPSCALYGKCGGSQMQHIPL
FT                   DLQREAKQQALFQRLQKLQSQPIDFQPMIIGNDKGYRRRAKLSIASQNNQLAIGFRMQN
FT                   SNQIIPLEQCEVLVEPLSQLIKPLQSLFSTWQNKKSLGHIELVQADDTITMLIRNVGQF
FT                   HPQDSRNLQQFAERHSLSLYVMTAENDITHLSGEAPYYQIHGVKLGFSIRDFIQVNGDL
FT                   NEKMVDKALEWLDLSAQDRVLDLFCGMGNFTLPIAKQAGFVVGVEGVEPMVAQAKQNRD
FT                   TSGLKNVAFYQTNLDEPFADKPWASEPFNKVLLDPARNGAFFCLDHLAALNPGTIVYVS
FT                   CNPATLVRDAEKLIQAGYKLQKAAMIDMFPHTGHLESISLFTK"
FT   gene            347915..349240
FT                   /locus_tag="APL_0313"
FT   CDS_pept        347915..349240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0313"
FT                   /product="deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein"
FT                   /EC_number="3.1.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73417"
FT                   /db_xref="GOA:A3MZ31"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ31"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9CMF1"
FT                   /protein_id="ABN73417.1"
FT                   /translation="MISNVWTERFLADKKREQDHRSPFQRDRARILHSEAFRCLQAKTQ
FT                   IHAVGEDDFYRTRLTHSLEVAQIGSSIRAKLLREKQAFQAVVSEQKFANLAENLTALLP
FT                   SRSLIESLCFAHDIGHPPFGHGGEMALNYKMRAYGGFEGNAQSFRIVTQLEPYTPQHGM
FT                   NLTRRTLLGIIKYPALLEETEPQTRPQFAESSYINLHQFKTCKGIFSDDQTFLDWVLAP
FT                   LSEQDRNLLRSISFSKDPFEPHKTQYKSLDCSIMELADDIAYGVHDLEDAIAGGMVTPQ
FT                   SWQQAQQQLAQCSSSWIQTILPTLSQKLFSQHRYERKDVIGALVNYFVTNVQWREQASF
FT                   DEPLLRFNAYLPDDVKCVLEILKRFVYQYVICDVKTQRVEYKGQRILMALFDMLSTDPE
FT                   RLLPQNIALRWQQAEQVKRPRIICDYLAGMSDGQAFKLYQSL"
FT   gene            349416..352325
FT                   /gene="hepA"
FT                   /locus_tag="APL_0314"
FT   CDS_pept        349416..352325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="APL_0314"
FT                   /product="ATP-dependent helicase HepA"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73418"
FT                   /db_xref="GOA:A3MZ32"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ32"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKV0"
FT                   /protein_id="ABN73418.1"
FT                   /translation="MFVVGQRWISESENNLGLGIVTASDNRTVTIQFPAAEEERIYALS
FT                   VAPLTRVQFQKGDRINSVEGWQLDVEEVVENQGFIIYLGKRADSGEEAVLPEMQLDHKV
FT                   SFSKPQDRLFSAQIDRSDRFALRYRALQHQQAQFQSPLRGMRGIRASLIPHQLHIAKEV
FT                   GQRVAPRVLLADEVGLGKTIEAGMILQQQLFSGRVERVLVLVPESLQHQWLVEMLRRFN
FT                   LKFSLFDEERCSDFDKADEDGNDVSENPFDSEALVIASIDWLESSPNRAKQVLASHWDM
FT                   LIVDEAHHLAWSENEPSVGYQFVERLSKQTPAVLLLTATPEQLGQESHFARLALLDADR
FT                   FYDYHSFIAEQKDYKPVADAVATLLNDKPLSHDEQNSIAELLSEKDTEPMFKVINSEKS
FT                   KENDRLQVRQELIRELIDRHGTSRVLFRNTRQGVKGFPHRVYHQITLEMPSQYTNALKV
FT                   MGMMGGVTKDDQLYPERLFQRMNPAAKWADFDPRIEWLITFLKNHRDEKILVICKQADT
FT                   AIALEQILREREAIRSAVFHEKMSIVERDRASAYFAQMEEGAQVLISSSIGSEGRNFQF
FT                   ASNLVLFNLPDNPDLLEQSIGRLDRIGQKNDIQIHVPCFENSMQMVLATWYHQGLNAFE
FT                   ETCPMGAALFREFGEELEGFLKNPQAVGFDEFLVRTFKRQQQLKAELEQGRDRLLELNS
FT                   NGGEVAQALAEAIAKEDNNPHLVNFALSLFDVIGLEQEDLGEQSIVISPTGHMLVPDFP
FT                   GIAEDSTTVTFDRQLALMREDVEFLTWDHPMIRNGIDLITSGDIGKSAISLLINKHLPA
FT                   GTLLLEAIYMVETQAPKGLNLTRFLPPTPVRILLGNKGNDMAAQVSFTGLEKQLKPVNK
FT                   QMANKIAKMAQADIKKLIDISEQKIAAKLPELIEKASQDADSTLSAELYRLTSLQAVNK
FT                   NIRADEIEALEQQRIESLKQIALANWRLDSLRVIVSNKE"
FT   gene            352395..353108
FT                   /gene="rluA"
FT                   /locus_tag="APL_0315"
FT   CDS_pept        352395..353108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="APL_0315"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73419"
FT                   /db_xref="GOA:A3MZ33"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ33"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P59831"
FT                   /protein_id="ABN73419.1"
FT                   /translation="MFDVFVNSVFFMVRKMALIEYHPPLEPFLTEVYRDNHILVINKPS
FT                   GLLSVPGNRPEYYDSAMTRVQQKYGFTEPAHRLDMATSGILLFALSKAAEKELKRQFRD
FT                   REPKKHYIALLWGKLGEKVGDTGEMNFPLICDWENRPRQKICYERGKKAITHYEVLAHL
FT                   PNNTTRVKLTPITGRSHQLRVHSLALGHPILGDKFYASPLAKSLSPRLCLHAESLSITH
FT                   PITGEAMTFTAQTEF"
FT   gene            complement(353304..353852)
FT                   /gene="ampD"
FT                   /locus_tag="APL_0316"
FT   CDS_pept        complement(353304..353852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="APL_0316"
FT                   /product="signalling protein AmpD"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73420"
FT                   /db_xref="GOA:A3MZ34"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ34"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44624"
FT                   /protein_id="ABN73420.1"
FT                   /translation="MDLTIQNGILIHQKQVPSPHFNARPIANDISLLVIHYISLPPEQF
FT                   GGNFIDQFFQGNLDPTVHPYFEEIKDLRVSAHCLINRKGEITQYVNFNDMAWHAGLSEF
FT                   NGRDKCNEYSIGIELEGSNHQPFTEAQYQSLAHLTQALMTEYPEITLQRIAGHCDIAPE
FT                   RKIDPGQYFDWGYYKTLIA"
FT   gene            353973..354815
FT                   /gene="yhiR"
FT                   /locus_tag="APL_0317"
FT   CDS_pept        353973..354815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhiR"
FT                   /locus_tag="APL_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73421"
FT                   /db_xref="GOA:A3MZ35"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ35"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P31777"
FT                   /protein_id="ABN73421.1"
FT                   /translation="MLSYRHSFHAGNHADVVKHIVQLLILQSLKQKDKGFLYLDTHSGV
FT                   GRYSLLSAESEKTGEYLEGVARLWERTDLPEEVALYINELKKINKGEKLRYYAGSPLLA
FT                   VNQLRPQDRAILTELHPNDFPLLRQEFAKKDNVVTKRENGFQQLKSALPPKERRGFVLI
FT                   DPPYELKEDYELVVKAIEEGYKRFATGIYAIWYPVVLRQHTKRIVRGLADSGIRKILQI
FT                   ELAVRPDSDQRGMTASGMIVINPPWQLESQMKKVLPYLAEVLVPEGTASWTVSWITPE"
FT   gene            354902..355543
FT                   /gene="pryE"
FT                   /locus_tag="APL_0318"
FT   CDS_pept        354902..355543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pryE"
FT                   /locus_tag="APL_0318"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73422"
FT                   /db_xref="GOA:A3MZ36"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ36"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKV3"
FT                   /protein_id="ABN73422.1"
FT                   /translation="MEQYKHDFIEFALSRNVLKFGEFTLKSGRKSPYFFNAGLFNTGRD
FT                   LAKLGEFYAQAIQASGLNFDVLFGPAYKGIPIATTVAVALVNQFDVDKPCCFNRKEAKD
FT                   HGEGGNLIGSPLKGRILLVDDVITAGTAIRESMEIINANQAELAGVLIALNRKEKGKGE
FT                   LSAIQEVERDYGCQVFSIIDFDDLIQFIEKSEQYAPYLASMRAYREQYGV"
FT   gene            355682..356770
FT                   /locus_tag="APL_0319"
FT   CDS_pept        355682..356770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73423"
FT                   /db_xref="GOA:A3MZ37"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ37"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P42318"
FT                   /protein_id="ABN73423.1"
FT                   /translation="MAAKNLPFHADTVGSYLRTDAWKKAHADYKAGTISLEARDAIVEE
FT                   EVKKLVQAQLDAGIQVVTDGEFHRSWWHIDFLENLNGIEGYVPEKAYAFKGVAVRPYNT
FT                   RCCGKVSWNPNHPFLEHFKKFNAIVAGRAVAKFTIPSPNQLMYPVQWDHGIYATREEFA
FT                   KDVQQAYKDAIKAFYDAGCRYLQIDDVYWGSLCNNYQQPTFEADKAQAVANIQAILADK
FT                   PADLTITTHVCRGNYKSSYLLEGAYDPIADGLFGQTNYDGYFLEYDDERSGGFEPLKHF
FT                   ANNKGRVVLGLISSKFPELEDKEAIKARIAEAAKYVPLEQLCLSPQCGFASTEEGNVMT
FT                   EEQQWAKVRHVEEIAKEVWGED"
FT   gene            complement(356847..358037)
FT                   /gene="metC"
FT                   /locus_tag="APL_0320"
FT   CDS_pept        complement(356847..358037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="APL_0320"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73424"
FT                   /db_xref="GOA:A3MZ38"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ38"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44527"
FT                   /protein_id="ABN73424.1"
FT                   /translation="MSNLSQLETKLVHAGRKSRYTQGSVNPVVQRASSLVFESVSQKKH
FT                   ATRNRYKGELFYGRRGTLTHFALQDAMCELESGAGCYLYPCGAAAVTNSILAFVSQGDH
FT                   VLMTGAAYEPTQDFCNVILKNIGVSTTYYDPLIGEGIRALIRPNTKVLFLESPSSLTME
FT                   VPDIPTLVRIAREVNPNMVIMIDNTWAGGVLFPALEFGIDISIQAGTKYLVGHSDVMIG
FT                   TAVSNARCWDQLREHSYLMGQMVDADSAYTTARGLRTLGIRLKEHQERSIQVAQWLAQR
FT                   PEVKAVFHPALPSCPGHEFFKRDFKGASGLFSFELNQKLNDEQLANFLDHFELFTMAYS
FT                   WGGFESLILANQPEEIARIRPAIERKLSGTLIRIHVGLEAVEDLIADLEKSFSRLK"
FT   gene            complement(358114..358653)
FT                   /gene="dsbB"
FT                   /locus_tag="APL_0321"
FT   CDS_pept        complement(358114..358653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="APL_0321"
FT                   /product="disulfide bond formation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73425"
FT                   /db_xref="GOA:A3MZ39"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ39"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VKY2"
FT                   /protein_id="ABN73425.1"
FT                   /translation="MLSYFKELSLNRTAWLLLAFVAFALEASAIYFQYGMGLVPCVMCV
FT                   YERLAIFGLLIAGLVGAISPRFFLTRWLALLLWGFSAFKGLALAIKHHDYQANPSPWNQ
FT                   CEFKPEFPQTMPFDQWFPSIFAPGPVNCSEKQWEMFGLGMPEWLILAFSIFALMFVIVL
FT                   LSQFKRAKPQYRSVFR"
FT   gene            complement(358750..360291)
FT                   /gene="nhaB"
FT                   /locus_tag="APL_0322"
FT   CDS_pept        complement(358750..360291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaB"
FT                   /locus_tag="APL_0322"
FT                   /product="Na(+)/H(+) antiporter 2"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73426"
FT                   /db_xref="GOA:A3MZ40"
FT                   /db_xref="InterPro:IPR004671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ40"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44706"
FT                   /protein_id="ABN73426.1"
FT                   /translation="MDSSNAIFKSFLGKAPEWYKICIIAFLVINPLIYFFISPFVAGWA
FT                   LVAEFIFTLSMALKCYPLQPGGLLAIEAVFIGMTSAHHVKEEIMANFEVILLLMFMVAG
FT                   IYFMKQLLLYVFTKLLIVIHSKKILSLAFCLSATFLSAFLDALTVIAVIISVGTGFYGV
FT                   YHKVASGNSFEDSTDISNDEKIITNKEILEQFRAFLRSPLMHAAVGSALGGVMTMVGEP
FT                   QNLIIAGQAEWGFVEFLLRVLPVSLPVLICGVITCLLLEHFKIFGYGARLPRRVWGVLA
FT                   RYNLLKEQRMTQQDRVKMGIQALAGIWLVVGLALHLADVGIIGLTIIIICTAFCGITDE
FT                   HAIGRSFQEPMPFTALIVVFFTVVAVIVDLKLFEPIISYVLSADPHSQLALFYVFNGLL
FT                   SMISDNVFVGTVYINEAKTALESAIISREQFDLIAVAINTGTNLPSVATPNGQAAFLFL
FT                   LTSPFAPLIRLSYGKMLYMALPYTIVLSIIGFLSLEFLLPPLTELMSNWGWIITR"
FT   gene            360456..361184
FT                   /gene="fadR"
FT                   /locus_tag="APL_0323"
FT   CDS_pept        360456..361184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadR"
FT                   /locus_tag="APL_0323"
FT                   /product="fatty acid metabolism regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73427"
FT                   /db_xref="GOA:A3MZ41"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR014178"
FT                   /db_xref="InterPro:IPR028374"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ41"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44705"
FT                   /protein_id="ABN73427.1"
FT                   /translation="MDNSYILKAQSPAALAEEYIVRSIWNNKFPAGTDLPAERELADKI
FT                   GVTRTTLREVLQRLARDGWLHIQHGKPTRVNDVWETAGPNIISTIIKLDRSYLPVIIAN
FT                   VVSLRTRMAESYIPEAVRLNAEACVAFFNQLDELEDTADAFATFDYKLFRQFTFTANKP
FT                   VYALILNSFKGMYHQVASIFFADPVCRQLTLKFYRDLLNACVEKDHEKASLIMAQNRQS
FT                   SSEIWGKLLQSIPENFGELK"
FT   gene            361193..362263
FT                   /gene="phoH"
FT                   /locus_tag="APL_0324"
FT   CDS_pept        361193..362263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="APL_0324"
FT                   /product="PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73428"
FT                   /db_xref="GOA:A3MZ42"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ42"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P0A9K5"
FT                   /protein_id="ABN73428.1"
FT                   /translation="MNEILFTLEPQDNARLQSLCGAFDEHLTLIEKSFNLVIARNGFSF
FT                   SIQSAEDSHYSATLIQNAAKLLKRLYTDTAPIKGKIKELDLEDIHLAIQESRMLLQNQW
FT                   VSGSQGEISIKTKRGVIKPRGEHQQAYLRNILSHDISFGIGPAGTGKTFLAVAAAVESL
FT                   ERQEIRRILLTRPAVEAGEKLGFLPGDLGQKIEPYLRPLYDALFEMLGFEKAQKLMERN
FT                   VIEIAPLAYMRGRTLNDAFIILDESQNTTTEQMKMFLTRIGFNSKAVITGDITQVDLPR
FT                   SQKSGLKHAMEVLKDVPDLSFNYFDSHDIVRHPVVAKIVQAYDVWEAEDEQRREQRRLE
FT                   KLALEQQKILEQAEQL"
FT   gene            complement(362302..363279)
FT                   /locus_tag="APL_0325"
FT   CDS_pept        complement(362302..363279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73429"
FT                   /db_xref="GOA:A3MZ43"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ43"
FT                   /inference="similar to AA sequence:RefSeq:NP_245649.1"
FT                   /protein_id="ABN73429.1"
FT                   /translation="MFFESLQFSIGVMLPTILLMLLGIFLRRRKFVDDDFCNTASKVMF
FT                   NFALPTMLFLNVVKSPLDYSKDLNLIFAGLSGTLIIYLIAEWWAAKYIRERGYRCIFTQ
FT                   GVFRTNAAILGLALTINAYGEAGLATVSIYTASLVILFNVLSVITILNSLSDQKPSAAR
FT                   LAAAVAKNPLIQAIVLGIVVNYLQIRIPKSLMQTAQSLANITLPMALICIGATLDFKAL
FT                   SQFRQQTAESELTRVVLYASFSRLILAPLFLFILGKWVFALNPMQLGILFLTATAPVAA
FT                   ATYAMVRAYGGNGKGAANLIGITTIGSIFTASLGLFVLRHLGWI"
FT   gene            complement(363351..364256)
FT                   /gene="prfB"
FT                   /locus_tag="APL_0326"
FT   CDS_pept        complement(363351..364256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="APL_0326"
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73430"
FT                   /db_xref="GOA:A3MZ44"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ44"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNG1"
FT                   /protein_id="ABN73430.1"
FT                   /translation="MVVNTIRTLDQGVEDVEGLIELAVEAEDEDTFNEAQAEANELEEK
FT                   LAKLEFQRMFSGQHDAADCYVDLQAGSGGTEAQDWTEMLLRMYLRWAESKGFKTELIEV
FT                   SDGDVAGLKSATVKITGEYAFGWLRTETGIHRLVRKSPFDSNNRRHTSFAAAFVYPEID
FT                   DDIDIEINPADLRIDVYRASGAGGQHVNKTESAVRITHIPSGIVVQCQNGRSQHQNKDQ
FT                   CMKQLKAKLYEMEMMKKNAEKQAMEESKSDIGWGSQIRSYVLDDSRIKDLRTGVENRNT
FT                   QAVLDGDLDKFIEASLKAGL"
FT   gene            364716..365633
FT                   /gene="selD"
FT                   /locus_tag="APL_0327"
FT   CDS_pept        364716..365633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selD"
FT                   /locus_tag="APL_0327"
FT                   /product="selenide, water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73431"
FT                   /db_xref="GOA:A3MZ45"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ45"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VNG0"
FT                   /protein_id="ABN73431.1"
FT                   /translation="MVGNETADDAAVYDIGNGIGIISTTDFFMPIVDDPFDFGRIAAAN
FT                   ALSDVFAMGGKPIMAIAILGFPVNKLPAEVAQKIVEGGRFACQQAGIALAGGHSIDSPE
FT                   PIFGLAVTGTVSTEQVKKNASAQAGCELFLTKPLGIGVLTTAEKKGLLKVEHQNLARDV
FT                   MCQINLIGAQFSQLADVTAMTDVTGFGLLGHLSEICQGSNVRAEVNSAEIHTLDGVKDY
FT                   IAQGAVPGGTNRNFDSYGHLISAMSDEQKAILCDPQTSGGLLIAVRPQAVEKVQQIAKQ
FT                   ANIPLFRVGRLLEADTMKPLIEVI"
FT   gene            365638..366093
FT                   /gene="mutT"
FT                   /locus_tag="APL_0328"
FT   CDS_pept        365638..366093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="APL_0328"
FT                   /product="putative NTP pyrophosphohydrolase (MutT/Nudix
FT                   family)"
FT                   /EC_number="3.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73432"
FT                   /db_xref="GOA:A3MZ46"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR033713"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ46"
FT                   /inference="similar to AA sequence:RefSeq:YP_719844.1"
FT                   /protein_id="ABN73432.1"
FT                   /translation="MHKPNITLACVVHCKGKFLFVEEIEYGKRTLNQPAGHLEANETLL
FT                   EGASRELFEETGIRAQMQHLIKIYQWHAPRSQTDYLRFVFAVELDDFVPIAPQDSDITQ
FT                   GFWLSLEEFKHFIRQDGQCERNPLVTQSLEDYLSGESYTLDVLRVFE"
FT   gene            366103..367302
FT                   /locus_tag="APL_0329"
FT   CDS_pept        366103..367302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0329"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73433"
FT                   /db_xref="GOA:A3MZ47"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ47"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P25534"
FT                   /protein_id="ABN73433.1"
FT                   /translation="MAEQFDVVIVGGAVTGSVLALALSSLSQHKMRIAIVEKQLPDYAQ
FT                   QGGFDARSIALAQGSLQKFAQIRPLAGSSLAEQIQQIATPIQQIQVSDLGHFGKTTLKA
FT                   SELNLAQLGVVVELAKLGKNLTACIEQQPNIHWFCPNQIVHFERLQTEVLLRLQNGERL
FT                   RTQLMVAADGIQSQIALQCGVETELLKDYQQSALIANVEISEPYQGQAFERFTTQGPLA
FT                   LLPLSDNRMSLVWCVKQAEDLLSLTDEDFLSQLQLQFGWTLGKFERVSKRFVYLLTSQK
FT                   AQSHIHHRLAIVGNAAQLLHPVAGQGFNLGMRDLFTLAQLLAKAFAQGKDLGAFALLNQ
FT                   FEQARKQDQAQIISLTSGLISLFSCDFLPLQAVRNLGLFAISHSKLLRENIANKALGWQ
FT                   "
FT   gene            complement(367332..367808)
FT                   /locus_tag="APL_0330"
FT   CDS_pept        complement(367332..367808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73434"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ48"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ABN73434.1"
FT                   /translation="MFKIIKITLSFPIVLGLIGCSNIRENHSPQADFQRFYHWDEVYGN
FT                   DYIQATLLTMHSLEVAKNTPSRIDAIQNYLEEVDTIQASLDYLDIQNDEILPIKNIGLR
FT                   ALQLSQETFRDMIKLESQPNEALAQSVQDKGKIITQLGNEISHEKLKLMKKYQL"
FT   gene            complement(367865..368542)
FT                   /gene="hlp"
FT                   /locus_tag="APL_0331"
FT   CDS_pept        complement(367865..368542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlp"
FT                   /locus_tag="APL_0331"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73435"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ49"
FT                   /inference="similar to AA sequence:RefSeq:NP_873123.1"
FT                   /protein_id="ABN73435.1"
FT                   /translation="MTKFTKISATALFALFLTACDKPANKPAAEQAAATPAPAAQAQTE
FT                   ATKPAEPVVDTGAEDYKKFQEWQQVQEKSIGNAINTEIEKLGEKSKDPAVVQDTMNKAI
FT                   LAQIENIQKSAATLDIKDAQVNALKDKALEAMALGAKMITENDKLAKNPTPDAHKAFGE
FT                   LQAQLDKIAAEGQKIEAELATKYGPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAP
FT                   AQK"
FT   gene            complement(368623..369102)
FT                   /gene="hlpB"
FT                   /locus_tag="APL_0332"
FT   CDS_pept        complement(368623..369102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlpB"
FT                   /locus_tag="APL_0332"
FT                   /product="lipoprotein HlpB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73436"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ50"
FT                   /inference="similar to AA sequence:RefSeq:NP_873124.1"
FT                   /protein_id="ABN73436.1"
FT                   /translation="MKKLATIGAVALLAFSVTACNKADPAADYKKFQEWYQVQEQTQAT
FT                   AQAELQKQLTEVMSQAQKDPKALEAVLNTFAGKVQETLKSLDAVDVKSAEIKALKDKTK
FT                   AVLGLSNEVISEQVKVMAAPTAEAQQAIQAKATQLNQAAQELQKLQADLKAKFEK"
FT   gene            complement(369238..370383)
FT                   /gene="visC"
FT                   /locus_tag="APL_0333"
FT   CDS_pept        complement(369238..370383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="visC"
FT                   /locus_tag="APL_0333"
FT                   /product="putative monooxygenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73437"
FT                   /db_xref="GOA:A3MZ51"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ51"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P25535"
FT                   /protein_id="ABN73437.1"
FT                   /translation="MVGLALAALLKNTDSQIKIIEKQIPQTSETFSNRVSAINATSEKM
FT                   LEQVGALQLIQTERLSPYQKMSVWEQDSFAHIEFDNSDPSIRQLGLSQLGFIIENNQIQ
FT                   SALWQQVSRQDNVEIILSEPKTVGINENGAFLTLANNEMISAKLVVGADGANSWLRRQM
FT                   HIPLVSKDYEQTALVCNVKTVEPHHNIARQIFSPKSILAFLPLADENLCSIVWSLPPEK
FT                   AQQLQHCEVQQFNRELTIAFDNRLGLIELQSERAIYPLTARYARDFAQPRFALIGDAAH
FT                   TIHPLAGLGVNLGFADAITLAQEIKQHLTLGHDIGEYRHLRRFERIRKTEAIKLLAAME
FT                   GLKQLFQGSHPVKKLIRGVGLSATNQLPVLKKLLIAQAVGI"
FT   gene            complement(370507..371367)
FT                   /locus_tag="APL_0334"
FT   CDS_pept        complement(370507..371367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73438"
FT                   /db_xref="GOA:A3MZ52"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ52"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9L7V3"
FT                   /protein_id="ABN73438.1"
FT                   /translation="MELIIISGRSGSGKSVALRALEDVGYYCVDNLPLPLIPELAGFLS
FT                   NSGRSAVVSLDIRNIPENPESIEALLEQLSKLTIQTKIIFLDCERNTLIRRYSDTRRLH
FT                   PLSNKDLSLESAIDLENTLLEPLYQQANYIIDTTNISSHELAENLRGILRGSTDKALKI
FT                   VFESFGFKYGLPADADYVFDVRFLPNPHWNPELRPMTGLEQPVIDFLERQTEVHNFIYQ
FT                   TRNYLEMWLPMLEKNNRSYLTIAIGCTGGKHRSVFIAEQLAKYFQSRDKDVQIRHRSLE
FT                   KHHKK"
FT   gene            complement(371386..371898)
FT                   /gene="ptsN"
FT                   /locus_tag="APL_0335"
FT   CDS_pept        complement(371386..371898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="APL_0335"
FT                   /product="PTS system, nitrogen regulatory IIA-like protein"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73439"
FT                   /db_xref="GOA:A3MZ53"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ53"
FT                   /inference="similar to AA sequence:RefSeq:NP_873127.1"
FT                   /protein_id="ABN73439.1"
FT                   /translation="MKLTEFLTPENIRQGVLVSSKKRVLELAGKIIAEAANKSTACADD
FT                   EGLCPIECFGNLFKREKLGSTGINGIALPHAKFPDSIALAVDKPIAAFIQLEKPIDYEA
FT                   HDNKEVDLVYAIMIPSSCCEQYKNGLQEIAQRLNDKTLTKQLRSANNAEEIWQLLVYAD
FT                   NQILEQE"
FT   gene            complement(371948..372673)
FT                   /gene="yhgB"
FT                   /locus_tag="APL_0336"
FT   CDS_pept        complement(371948..372673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhgB"
FT                   /locus_tag="APL_0336"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73440"
FT                   /db_xref="GOA:A3MZ54"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ54"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45073"
FT                   /protein_id="ABN73440.1"
FT                   /translation="MPTLYAEHLAKSYKNRQVVKDVSLNVKAGEIVGLLGPNGAGKTTT
FT                   FYMVVGLVRHDQGQIRIDDQDISLLPMHDRAKQGIGYLPQEASIFRRLTVYDNLMAVLQ
FT                   VRKDLTTQQRKARADELINEFHIEHIRNSLGQSLSGGERRRVEIARALAANPQFILLDE
FT                   PFAGVDPISVIDIKKIIVNLKERGLGVLITDHNVRETLDVCERAYIVGSGQMIASGTPE
FT                   EVLNNADVKRVYLGDQFKL"
FT   gene            complement(372683..373186)
FT                   /locus_tag="APL_0337"
FT   CDS_pept        complement(372683..373186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73441"
FT                   /db_xref="GOA:A3MZ55"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ55"
FT                   /inference="similar to AA sequence:RefSeq:NP_873129.1"
FT                   /protein_id="ABN73441.1"
FT                   /translation="MKFAIKSMVFTALLSTSLSSYALKGDTDQPINIDSGSQSLDMNSN
FT                   VVTFSDNVVITQGSIKVTADKVTIIRQEGKKETLEASGSPVTFQQTLDNGKPVNGKGNS
FT                   VHYDLNSEFLTLVGNAELKQQGSFIKASKITYDVKKQQLKANSGNKSRVKTILIPNELN
FT                   DKKK"
FT   gene            complement(373211..373807)
FT                   /locus_tag="APL_0338"
FT   CDS_pept        complement(373211..373807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73442"
FT                   /db_xref="GOA:A3MZ56"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ56"
FT                   /inference="similar to AA sequence:RefSeq:NP_873130.1"
FT                   /protein_id="ABN73442.1"
FT                   /translation="MNIRLNIILLIIVAALAGWYVSQQKPENDGLDQLIKKEGNPDYTG
FT                   NRITTSVYDLKGKPQYFAEAKEIKRYQNTELTEFIQPLVELFDAETALKQWKVSADYAE
FT                   ITKEKILNLDGNVKLQALDKNARLQKIETDKLRIDLNTQDISTESVVKSVGLGISTTGT
FT                   GLKGNLKRQVATITKDVKTYLEPTIIKQSNDEQKN"
FT   gene            complement(373967..376606)
FT                   /gene="pepC"
FT                   /locus_tag="APL_0339"
FT   CDS_pept        complement(373967..376606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="APL_0339"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73443"
FT                   /db_xref="GOA:A3MZ57"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ57"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9CN89"
FT                   /protein_id="ABN73443.1"
FT                   /translation="MNQPYSAMRNNIHMLGDFLGETIREAQGNEILELIESIRVLSRDS
FT                   RAGDEKAREQLLDKLANISTENVLPVARAFSQFLNLTNIAEQYQTISRHHQDESLGNRS
FT                   LSALFARLKAQGTPVETVIKTVEKLSIELVLTAHPTEVTRRSLVHKHVEINKCLGQLEH
FT                   DDLTEAEQTKLKRRLMQLIALAWHTNEIRAARPTPVDEAKWGMAIIENSLWKAVPDFCR
FT                   ELNFQLEKHFDVQYEVALSPVRFSSWMGGDRDGNPFVTAEITQKVLRMNRWKAAELFLN
FT                   DVSDLVEELSIVQCTPEFREKYGDHIEPYRVVVKGLRSKLQKTLTYFGELIEAKPTTVD
FT                   PSEIITCDNDLWEPLYDCYQSLHACGMRIIANGSLLDCLRRIRCFGLGLSRLDIRQESS
FT                   RHETAIAEITRYIGLGDYAQWTEDDKQAFLVRELSSRRPLVPTNWTPSPETQEILDTCK
FT                   VVAQQPEGTISAYVISMAREASDVLAVHLLLKEAGCNYTLPVAPLFETLDDLDHSEKVM
FT                   TDLFNIGWYRGVINNYQMVMIGYSDSAKDAGMLAASWAQYRAQEALVNLAEKYHIELVL
FT                   FHGRGGTVGRGGAPAHAALLSQPPRSLKSGLRVTEQGEMIRFKLGLPAVAVETLNLYAS
FT                   AILEANLLPPPEPKQKWRDIMDKGAAISCEIYRGVVRGEPDFVPYFRSATPEQELGKLP
FT                   LGSRPSKRNPNGGVESLRAIPWIFAWMQNRLMLPAWLGAGAALRQMIEQGEESTLKEMC
FT                   NEWPFFSTRIGMLEMVFSKADLWLAEHYDQRLVAKELHRLGKTLRAQLSADIQTVLTLA
FT                   HDGQLMADLPWIAESIALRNVYTDPLNLLQVELLQRLRSQGEVRDPQLEQALMITITGI
FT                   AAGMRNTG"
FT   gene            complement(376821..377660)
FT                   /locus_tag="APL_0340"
FT   CDS_pept        complement(376821..377660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73444"
FT                   /db_xref="GOA:A3MZ58"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ58"
FT                   /inference="similar to AA sequence:RefSeq:NP_873131.1"
FT                   /protein_id="ABN73444.1"
FT                   /translation="MIKAFFKPIWFILLAFFTLKAAAADNYPAAPNPFYYVTDYTKTLT
FT                   QQEWRTLEDALIANRAKTSSQIIVVIVPSTNGEDVASYSHNLFNKWGIGRTKNNENNGI
FT                   LLLIAKNDRKLFIATGRGLEGALPDAIASTIIRHNITPYFKQNLYAEGIASGLSAIMAA
FT                   INGEYAAYDSYGENSGEESLDQIDGLLFFLVAGIVIFLIFRPGRNDQYISPSAADQLGR
FT                   IIINSSRRRGGFGGGFGGGFGGGSSGGFGGGFGGGSRGSGDSFGGGSSGGGGAGGSW"
FT   gene            complement(377657..378106)
FT                   /locus_tag="APL_0341"
FT   CDS_pept        complement(377657..378106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73445"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ59"
FT                   /inference="similar to AA sequence:RefSeq:NP_873132.1"
FT                   /protein_id="ABN73445.1"
FT                   /translation="MKLFSFLSNKLPVDTQRIEQAISHLEQQTSAELRVVVERKAKGKA
FT                   DAITRANQLFDELKMRETEERNGVLIYLSFKPHNLAIVGDKAIHEKVGQVFWQSVYDAM
FT                   KQQCRQADYTQAICEGIKQVEVQLATYFPRRDNDTNELSNEVVIK"
FT   gene            complement(378173..378733)
FT                   /locus_tag="APL_0342"
FT   CDS_pept        complement(378173..378733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73446"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ60"
FT                   /inference="similar to AA sequence:RefSeq:NP_873133.1"
FT                   /protein_id="ABN73446.1"
FT                   /translation="MIAVVAIGGFSLTKYNDLMRAEEDINSVWGNVESAYQRRADLIPN
FT                   LVNTVKGQANFEKETLTSVIEARAKATAVTIDLNNATEEQMAKFQEAQQGVNSALSRLL
FT                   VSVEKYPELKAHEGFLNLQAQLEGTENRINVERNNFNAAVKEYNKQVREFPTKIAAMIM
FT                   GFKAKPQFKAEAGSEKAPTVNFN"
FT   gene            complement(378909..380570)
FT                   /gene="fruA"
FT                   /locus_tag="APL_0343"
FT   CDS_pept        complement(378909..380570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruA"
FT                   /locus_tag="APL_0343"
FT                   /product="PTS system fructose-specific EIIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Includes: Fructose-specific phosphotransferase
FT                   enzyme IIB component; Fructose permease IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73447"
FT                   /db_xref="GOA:A3MZ61"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ61"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44714"
FT                   /protein_id="ABN73447.1"
FT                   /translation="MNISFVFPQSLGKARAFLVNEVLSAAAKQQGHQVVNAEQADFVVL
FT                   FNDEIPTIAAGKQGAVVNLDQAFSQPEATLKQAVENAKTFANATVSSASNSGMKNIVAV
FT                   TACPTGVAHTFMSAEAIENYAKAQGWNVKVETRGQVGAGNPISAEEIAAADLVFVAADI
FT                   DVDLDKFKGKPMYRTSTGLALKKTAQEFEKAFAQATVYQGGATAAQQAEGSASGEKKGL
FT                   YKHLMTGVSHMLPLVVAGGLLIAISFMFGIEAFKDETIAGGLPKALMDIGGGAAFHLMI
FT                   AVFAGYVAFSIADRPGLAVGLIGGMLATTAGAGILGGIVAGFLAGYTVKFLNGVIQLPA
FT                   SLTSLKPILILPLLGSAIVGLAMIYLINPPVKGIMDALVEWLNSMGQTNAIILGAILGA
FT                   MMCVDMGGPVNKAAYTFGVGLIASQQYTPMAAVMAAGMVPPIGMAIATLIARNKFTTNQ
FT                   RDAGKASFVLGLCFISEGALPFVAADPVRVIATSIIGGAAAGAISMAFGITLQAPHGGL
FT                   FVIPFVSQPLMYLAAIAIGSVVTGVIYATIKQKASE"
FT   gene            complement(380652..381599)
FT                   /gene="fruK"
FT                   /locus_tag="APL_0344"
FT   CDS_pept        complement(380652..381599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="APL_0344"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73448"
FT                   /db_xref="GOA:A3MZ62"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ62"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44330"
FT                   /protein_id="ABN73448.1"
FT                   /translation="MTQQLRIATVTLNPAFDLVGRLQRIEVGEVNTVETLGLYPAGKGI
FT                   NVAKVLADLGVKLAVSGFLGAENQGDFVQSFKQNGVDDQFYRIDGKTRINVKITETEAD
FT                   VTDLNFLGFEISAEDWTNFTAQSQQWAKAFDLVAVCGSLPRGVTAQQFAQWLESLHQQG
FT                   LKVVLDSSNAALTEGLKAHPWLVKPNRRELEVWANRPLNSLEEVIAAAQELRAGGIENV
FT                   IISMGADGSVWLNSEGVVQAQPPRCQNVVSTVGAGDSMVAGLIYGLAQGWDKAKTLAFA
FT                   SGTSALAVSQSNVGISDRNALDEIVAQVKLTRLS"
FT   gene            complement(381614..383122)
FT                   /gene="fruB"
FT                   /locus_tag="APL_0345"
FT   CDS_pept        complement(381614..383122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruB"
FT                   /locus_tag="APL_0345"
FT                   /product="multiphosphoryl transfer protein"
FT                   /EC_number="2.7.1.69"
FT                   /note="Includes: Phosphocarrier protein HPr; PTS system
FT                   fructose-specific EIIA component"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73449"
FT                   /db_xref="GOA:A3MZ63"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR016258"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ63"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44715"
FT                   /protein_id="ABN73449.1"
FT                   /translation="MLNLSAKNICLNSSVNNKDEAIKLVAAGLTANGNVAEGYEAGMLA
FT                   RETQTSTFLGNGIAIPHGTLDTRHLVQNTGVQIYQFPQGVEWGEGNKAYVVIGIAAKSD
FT                   EHLTLLRQLTGVLSDEAAAELLATTQDTDEFISVLSGKKSLPSLTDTLISLNIDSPSLI
FT                   TLSAINAAKLQENGYVNQAFISEAISNQPLNLGNNIYLTDAAQGNQSNGIAVARNMSGQ
FT                   TVITVAATDEHLQSHLAYLLNGDIRSQFSTASAEQIIALFNGESIVNSAQNTTACVNLA
FT                   TGQVIGTFTVRNDNGLHARPSAVLVQTLKPFAAKVTVENLDRGTAPANAKSTMKVVALG
FT                   ASQAHRLRFVAEGEDAQQAIEALAKAFVEGLGESVSFVPAVEDTIEGAAQPQAVESAKN
FT                   FANPTASEPTVEGQVEGTFVIQNEHGLHARPSAVLVNEVKKYNATIVVQNLDRNTQLVS
FT                   AKSLMKIVALGVVKGHRLHFVATGDDAQKAIDGIGEAIAAGLGE"
FT   gene            383383..385716
FT                   /gene="glgB"
FT                   /locus_tag="APL_0346"
FT   CDS_pept        383383..385716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="APL_0346"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73450"
FT                   /db_xref="GOA:A3MZ64"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ64"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q65TI0"
FT                   /protein_id="ABN73450.1"
FT                   /translation="MKTYTYSKQDLSFIEQLSQAYCKDPFSYLGLHQAGDVSVIRVFLP
FT                   EATTVKILSAVGQILSEALKIDDSGLFVAQLAQQYSSLNYRLRVGYSLAEIDLEDPYRF
FT                   TSSLLPMDNWLLAEGTHLRPYEILGAHLKTQEGVSGVHFSVWAPNARRVSVVGDFNYWD
FT                   GRVNPMRFHAESGIWDIFLPNVEKGALYKFEILDSNGNIRLKSDPYAFASQFRPDTASV
FT                   VTGLPEKIEVDAKLRHANDPDQPISIYEVHLGSWRRHLENNYWLNYEEIANELIPYVKD
FT                   MGFTHIELLPITEYPFDGSWGYQPTGLYSPTSRFGSPEDLRTLIRKAHEAGINVILDWV
FT                   VGHFPTDSHGLTEFDGSHLYEHQDPREGYHQDWNTLIFNYGRHEVFNYLSSNALYWTER
FT                   FGIDGLRVDAVSSMIYRDYSRKDGEWIPNQYGGRENLEALDFLRRTNRMLKKEGHGAVV
FT                   IAEESTSFAGITHSPEENGVGFDYKWNMGWMNDTLRYMSLDPIYRQYHHDWMTFGMMYQ
FT                   YSEKFVLPLSHDEVVHGKCSILGKMSGDCWQKFANLRAYYGYMWGYPGKKLLFMGNEFA
FT                   QGREWNYNESLDWFLLGEQGGGWHKGVLNWVRDLNRTYQKYPALYQLDYDPAGFEWLVV
FT                   DDWQQSVFAFERKAKNGESVIVVSNFTPVVRHNYRIGVRQDGTYTEILNSDAAYYEGSN
FT                   VGNYGEIECEAIESHGKPFSIELSIPPLSTIFIACQPKPKEAVEAEQDIVKMAEVAMQK
FT                   ALKPTKKTVSVKAKAHKKAHKNKK"
FT   gene            385723..387708
FT                   /gene="glgX"
FT                   /locus_tag="APL_0347"
FT   CDS_pept        385723..387708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="APL_0347"
FT                   /product="glycogen operon protein GlgX"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73451"
FT                   /db_xref="GOA:A3MZ65"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR040784"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ65"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45178"
FT                   /protein_id="ABN73451.1"
FT                   /translation="MKVTAGSPFPLGAQAVENGTNFAIFSENATAIELCLFKQSQEQRF
FT                   AMRRTGDVWHLFVENIGEGIEYGFRVAGITDKQKGALFNPQKLLLDPYAKRIVGTVSAH
FT                   TADEIKYFQWDDKRDNAHLAPKSVVVAPDNFDWEDDERPHYPWRETIIYELHVKGFSRL
FT                   NQQIPEPLRGTYAGLAHPASIAYLKRLGVTTIELQPVSHHIDEVHLQKMGKTNYWGYNV
FT                   IGHSAVEPVLAWDQEDPITEFKYLVKTLHKHGFEVILDLVYNHTAEGGTDSLTLCQRGI
FT                   DNQNYYWLNQQGEYENWAGCGNALNLSHPRVCQWAIDSLVYWVSECHVDGFRFDLATTL
FT                   GRTPEFDQLSPFFEKIKQTPELEHIKLIAEPWDIGPNGYQVGRFPIQFAEWNDKYRTTM
FT                   REFFLGESGNLGEFARRLAGSDDLYWQYSPAKSINYFASHDGFTLQDLVSYNKKHNEAN
FT                   GENNRDGENTNHSNNHGVEGETDNEFVNILRDQTACSLLATLFLSNGVPMLRAGDELGH
FT                   SQKGNNNAYCQDNEIAWIDWQNANESRIEYVAKWIALRKRIALLSHQNHWWTENDVQWF
FT                   SSQGKVMEIEDWHNTESKALQILLQDHWLILINAKKTTQQFFLPTGKWHICLGKNIATL
FT                   IANTQSVALQFEQMGVCVLQRKLSSY"
FT   gene            387724..389040
FT                   /gene="glgC"
FT                   /locus_tag="APL_0348"
FT   CDS_pept        387724..389040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgC"
FT                   /locus_tag="APL_0348"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73452"
FT                   /db_xref="GOA:A3MZ66"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ66"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9CN92"
FT                   /protein_id="ABN73452.1"
FT                   /translation="MLTQEKNDLNKSGLDITNDTLVLILAGGRGSRLYELTDRRAKPAV
FT                   YFGGCRRIIDFALSNCINSNLLKIGVITQYAAHSLLRHLQRGWSFLPYERNQYIDMLPA
FT                   RQQLDENTWYRGTADAVYQNMSMMKSHYRPKYVVILAGDHIYKMDYTQMLRDHVESGAK
FT                   CTVGCIEVPREQAVEFGVMAVNDKLKVKEFVEKPADPPAMPGRPDSSLASMGIYVFDAD
FT                   YLYKMLEQEAAVPGTSHDFGKDIIPKAVEEGVLYAHPFERSCKGRNATGAIYWRDVGTI
FT                   DSYWAAHMDLVSEEPQLDLYDESWPIHGRPQQTAPARFYYNKQRQRTLDNSLIAGGCVI
FT                   TDAEISNSVLFNRVHVAEETIIEHTVILPQVSIGKNCVIKRAVIDRHCVIPDGLQIGVN
FT                   PEEDAKHFRVSKGGIVLVTQGMLDKLQGITSNIKLHHTI"
FT   gene            389143..390579
FT                   /gene="glgA"
FT                   /locus_tag="APL_0349"
FT   CDS_pept        389143..390579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="APL_0349"
FT                   /product="glycogen synthase"
FT                   /EC_number="2.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73453"
FT                   /db_xref="GOA:A3MZ67"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ67"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45179"
FT                   /protein_id="ABN73453.1"
FT                   /translation="MKILHICSEMYPLIKTGGLADVMGALPYAQQQSGNDVRVLIPLYP
FT                   QVAEKIGETNEVATIGTFAGLVTIRFTYFNGLGVYVIDAPHLFQRSGNPYHDSGYADYP
FT                   DNYKRFALLGYLGAQLSEGLDQWWGKADILHAHDWQGGLACAYLKSWNSPVKSVFTIHN
FT                   IAYPGRFHSYHLHELGLPWHFFQAEGLEFYGEISYLKAGLYFADKITTVSPTYALEITE
FT                   EIAGGGMHGLLQTRKAQGRLHGVLNGVDDTVWNPETDTNIVATYKPSYMQGKSKNKAEL
FT                   QQMFHLPEDKDAMLMVMVTRLTEQKGADFILDRIDELMEERVQLVVLGSGSPHLEYLLN
FT                   EARSRHPEQIGIYIGYNEALSHQIIAGGDVILVPSRFEPCGLTQLYGLKYGTLPLVRRT
FT                   GGLADTVVDSNKESIEQRTATGFVFNYPSSDDFLEAFRRAVNLWKKNKLWSSVRQNALA
FT                   QDFGWARAAASYQAIYQEIV"
FT   gene            390609..393113
FT                   /gene="glgP"
FT                   /locus_tag="APL_0350"
FT   CDS_pept        390609..393113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="APL_0350"
FT                   /product="glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73454"
FT                   /db_xref="GOA:A3MZ68"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ68"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45180"
FT                   /protein_id="ABN73454.1"
FT                   /translation="MGNKALSPENIQQVKDAILYKMVFALGVEPREASKRNWLNAALRV
FT                   VRDLSTESWLQTRRSQVANGSRRVYYLSMEFLMGRTFSNAMIAEGVYELIDAALKELGQ
FT                   NLEDIINEEGDPGLGNGGLGRLAACYMDSLAAMKIPAIGYGIRYEYGMFRQEIRNGEQV
FT                   EQPDQWLENEFAWPYLRSSKRFPIRFGGRVWNEGSKVVWQPDEEIVAQAHDQLIPGFET
FT                   TATNSLRLWSAHASGKGFGLADFNRGDYFSAMSHQNLSENVSRVLYPDDSTYNGRELRL
FT                   RQEYFLCSASVQDIIRRHETECGSCVNLVDKVAIHLNDTHPTLAVPELMRILIDEKGYS
FT                   WEQAWSMTRKIFYYTNHTLMSEALETWPVEMLGRILPRHLGIIFEINEWFLNEVREKFP
FT                   GDEDLVQRVSLIDEHGDRRVRMAWVAVVASTKVNGVAKIHSDLMVESIFADFARIYPDR
FT                   FTNVTNGVTPRRWLRIANPGLANILDKRIGTNWLTNLSELEKFNVFIDDADVQAEVAAV
FT                   KYENKRKLAEYVEKNLGITLNPEAIFDVQVKRIHKYKRQQLNVLHIITLYNRILKNPNA
FT                   DWTPRVFIFAGKAASAYYAAKKVIRLINDVANVINNDERIRDLIKVVFIPNYGVSLAQM
FT                   IIPAADVSEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEILDCVGKDNIFIFGNT
FT                   VEQVEELRRNGYSPYHYYETDGELNEAVSQILNGKFSPDDPYRYQDLILNSGDYYQACA
FT                   DFRSYVEAQEKVAAAYRNKKAWTRSAIINIANMGYFSSDRSVLDYARDIWHIEPMDELQ
FT                   LKDNADLKSILESSNKLLGSRK"
FT   gene            complement(393225..393641)
FT                   /gene="ndk"
FT                   /locus_tag="APL_0351"
FT   CDS_pept        complement(393225..393641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="APL_0351"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73455"
FT                   /db_xref="GOA:A3MZ69"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ69"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMD0"
FT                   /protein_id="ABN73455.1"
FT                   /translation="MIQQTLCLIKPDATQRNLIGKILSHLEEAGLTIKALKKVQLNQEQ
FT                   AEGFYAEHQGKEFFAPLVEFMISAPIVAVVLEGENAIAHYRELMGATNPEQRKAGTIRA
FT                   LYAISGRENSVHGSDSEQSAKREIAYFFTPNEIL"
FT   gene            complement(393700..395727)
FT                   /gene="metG"
FT                   /locus_tag="APL_0352"
FT   CDS_pept        complement(393700..395727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="APL_0352"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73456"
FT                   /db_xref="GOA:A3MZ70"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ70"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMC9"
FT                   /protein_id="ABN73456.1"
FT                   /translation="MLVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGNEIYFVCAD
FT                   DAHGTPIMLNAAKQGITPEQLIEKAKADHVADFKGFNISFDNYHSTHSEENREITTEMY
FT                   KKLRANGFIKSRVISQLFDPEKQMFLPDRFVKGTCPKCKAEDQYGDNCEVCASTYSPMD
FT                   LINPRSAISGATPIVKESEHFFFDLPNFEGMLKEWTRSGSLQSEIANKMQEWFESGLQQ
FT                   WDISRDAPYFGFPIPDAENKFFYVWLDAPIGYMASFKNLCDRTGLNFDEFWKKDSETEL
FT                   YHFIGKDIVYFHSLFWPAMLDGCELRKPTNVFAHGYVTVDGVKMSKSRGTFIQASTYLK
FT                   HIDPECLRYYYAAKLNERIEDLDLSLEDFVQRVNSDIVNKLVNLASRNASFIAKRFEGK
FT                   LADKLEDEALFAEFIAQSEQIAAHYENREFNKAIRLIMDLCDKANKYVDDKAPWVIAKQ
FT                   EGCDAQLQAVCSMGIELFRVLMSYLKPVLPQLAERAEAFLQTELTWDNIQQPLLGQNVA
FT                   PFKSLFSRLEKKQIDAVIEETKALFAAQNKEKGKQKVENTENTAVEPIAAEITIDDFAK
FT                   LDLRVAKVISCEAVPESNKLLKFQLDLGDHQRQVLSGIKAAYNNPEELVGRFVIMVANL
FT                   APRKMKFGVSEGMILSAGTGGADLFLLSADEGIRPGMQVK"
FT   gene            395906..396868
FT                   /gene="menC"
FT                   /locus_tag="APL_0353"
FT   CDS_pept        395906..396868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="APL_0353"
FT                   /product="O-succinylbenzoate synthase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73457"
FT                   /db_xref="GOA:A3MZ71"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ71"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P58487"
FT                   /protein_id="ABN73457.1"
FT                   /translation="MRKAELYRYAIPCQTGVVLRKQPLIQREGLILKLEENGKIGLGEI
FT                   APLPGFSQETLADAEMQAKMWLANQTDDLEELFPSVAFGISCALAELRNELITQGKFAS
FT                   AILCDGNFTQFAQKIARIPQPLGKIKIGFEPEKEGELANRLLEQFPHLTLRLDANRSFS
FT                   LAQAVGFGKKIAKSNRLRIQFIEEPCFTPSFSRQFAQATGIAIAWDESVREAGFNVKAE
FT                   DYLKAIVIKPTLTGSLAKCVNLIKQAHTQGLKAVISSSLESSLGLSQLARIAAQYTPET
FT                   VAGLDTLGLMQVQLVRAWQGADLPLAGLQSRFLQKIAEI"
FT   gene            397182..397874
FT                   /gene="rsuA"
FT                   /locus_tag="APL_0354"
FT   CDS_pept        397182..397874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="APL_0354"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73458"
FT                   /db_xref="GOA:A3MZ72"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ72"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45124"
FT                   /protein_id="ABN73458.1"
FT                   /translation="MRLDKFIAENTGLTRSQAARALKSGLVTINGKLEKSGSVKIGDTD
FT                   EICYEGERLEWVDEGQYFMLYKPQGYVCSHDDGEYPTVFQFFDYPLMTKLHTAGRLDVD
FT                   TTGLVLLTDDGKWSHRITSPKHHCEKTYLVTLADPVEDFYAKKLAEGILLRGEREPCLP
FT                   AKMEVIDDYNVNLTISEGRYHQVKRMFAALGNKVEALHRWRIGDVVLDENLEEGEYRPL
FT                   SEQEVESF"
FT   gene            397874..399070
FT                   /gene="proP"
FT                   /locus_tag="APL_0355"
FT   CDS_pept        397874..399070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="APL_0355"
FT                   /product="bicyclomycin resistance-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73459"
FT                   /db_xref="GOA:A3MZ73"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ73"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45123"
FT                   /protein_id="ABN73459.1"
FT                   /translation="MVTQRPHPCFFIILGMMAMLPPLAIDMYLPSFLDIARDLQVSQEK
FT                   VQTTLAVFTFGFAVGQLFWGPMADSFGRKPIILFGLTGSALAAYFLTQVMTIENFYLLR
FT                   LIQGLCAAAPAVVLGALVRDLFDRNMFAQMMSVIMIISMLAPLLAPILGGYIAKYFHWH
FT                   SIFYTLVLMGISCVLLISWKIPETLAIEKRQPLRFGIVFKNFWTLLSDKATLGYVLVGG
FT                   LTFAGMFCFLTSGSLVYIGIYGVSQEYFGYFFGLNMIVMVSMTALNGRIVVKVGSEKML
FT                   KIGLLVQLLAGIWLACVAIFKLGFWAMAIGIPFYVGMLSTIGSNATAAILDRYPQMAGT
FT                   ANGLAGTARFGIASLVGAMLSHIAVTSERPMLYAMAMCTIAASIAYYLLCKNKSKQAI"
FT   gene            complement(399116..399502)
FT                   /locus_tag="APL_0356"
FT   CDS_pept        complement(399116..399502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73460"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ74"
FT                   /inference="similar to AA sequence:RefSeq:NP_873542.1"
FT                   /protein_id="ABN73460.1"
FT                   /translation="MKKATWTIAITISFLLSACAVTPQQQAQRQARQIKAQQDLSVALA
FT                   KQCDVETAEMMAQLYNPPIAQTEKEKAEFTQRYQKKVNDPLFQACHKLAWENYKHQEEL
FT                   KQIQRYYDFGRTRFHPWHYCYACW"
FT   gene            complement(399573..400142)
FT                   /locus_tag="APL_0357"
FT   CDS_pept        complement(399573..400142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73461"
FT                   /db_xref="InterPro:IPR026269"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ75"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44248"
FT                   /protein_id="ABN73461.1"
FT                   /translation="MSETTINDFSLLCRLFGNLFYRSPTDPILAGTFAWLAQGGLRRQW
FT                   ALSTDAQSESALTVLEKNANPTQLQASYQALFGEDGAIATTISAYNISVEDFINFRRTR
FT                   AMPELEKPDHVALLLLTASWIEDNLDSDAAQQAFFEQFLLPCSAKFLGQIEAHDNGFYK
FT                   ALAQLCRDALGAMADELEELSEAEVE"
FT   gene            400200..401042
FT                   /gene="nfo"
FT                   /locus_tag="APL_0358"
FT   CDS_pept        400200..401042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfo"
FT                   /locus_tag="APL_0358"
FT                   /product="putative endonuclease 4"
FT                   /EC_number="3.1.21.2"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73462"
FT                   /db_xref="GOA:A3MZ76"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ76"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMC4"
FT                   /protein_id="ABN73462.1"
FT                   /translation="MKYIGAHVSASGGVENAVLRAVEIGANAFALFTKNQRQWKALALK
FT                   ADTIEKFKRFCKAHQFSPEHILPHDSYLINLGNPEAENLAKSREAFIDEMERANQLGLK
FT                   LLNFHPSAHLNKISESECLARIAESINIAVDKVPNVIAVIENTAGQGSNLGYRFEHLAE
FT                   IIDQVEDKNRVGVCLDTCHLFSAGYDISSLESCEQTFSEFERTVGFQYLRGMHLNGSKT
FT                   PLGSRVDRHHTLREGTIGTDFCKFIMQDDRFDNIPLILETIQPEIWTEEIKFLRTLAK"
FT   gene            401163..401759
FT                   /gene="nlpC"
FT                   /locus_tag="APL_0359"
FT   CDS_pept        401163..401759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpC"
FT                   /locus_tag="APL_0359"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73463"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ77"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45296"
FT                   /protein_id="ABN73463.1"
FT                   /translation="MKKHPTLTRLKPLFITSLFAIFGSYSSIASASLSSHPATSSQIKI
FT                   VAKAASAEQIEAQISYKQGMKARVSHREELSTDGGNAAKKVHSIYRKWAGTRYRLGGEG
FT                   RGGIDCSAFVQKTMSGAFNLDLPRSTAEQRHLGRSISKSDLRPGDLVFFRRNNHVGVYI
FT                   GAGKFVHASTSQGVTTSSLSERYWARNYTQSRRVL"
FT   gene            complement(401808..402263)
FT                   /gene="impA"
FT                   /locus_tag="APL_0360"
FT   CDS_pept        complement(401808..402263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impA"
FT                   /locus_tag="APL_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73464"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ78"
FT                   /inference="similar to AA sequence:RefSeq:NP_873545.1"
FT                   /protein_id="ABN73464.1"
FT                   /translation="MASIRPLTRELPYQPLPMYRDMNSERSIKLDLNSLCIKRPTETFF
FT                   IQVKNPNLIAWGIELDDLLIVEQSEQYLVNDLIVIEKNGEYKFYQFFNEIENSVGTREI
FT                   ILFSLDVREPNLRITDWQEIEIAGVITNVVHQMRHKSAQTAARKYAA"
FT   gene            complement(402489..402875)
FT                   /gene="grcA"
FT                   /locus_tag="APL_0361"
FT   CDS_pept        complement(402489..402875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grcA"
FT                   /locus_tag="APL_0361"
FT                   /product="autonomous glycyl radical cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73465"
FT                   /db_xref="GOA:A3MZ79"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR011140"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ79"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMC2"
FT                   /protein_id="ABN73465.1"
FT                   /translation="MIKGVQITESSNSNLVNSFWLLDEEKNEARCIAAKGDVYKEDQVI
FT                   AISELGQIAYREVPVNVAPTIKVEGGQHLNVNVLRRETLEDAVKNPEKYPQLTIRVSGY
FT                   AVRFNSLTPEQQRDVITRTFTESL"
FT   gene            403081..403758
FT                   /gene="ung"
FT                   /locus_tag="APL_0362"
FT   CDS_pept        403081..403758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="APL_0362"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73466"
FT                   /db_xref="GOA:A3MZ80"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ80"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMC0"
FT                   /protein_id="ABN73466.1"
FT                   /translation="MNNWTEALGEEKQQPYFQHILQQVHQERMNGVTVFPPQKEVFSAF
FT                   ALTEFKDVKVVILGQDPYHGPNQAHGLAFSVKPPVAPPPSLVNMYKELAQDVEGFQIPN
FT                   HGYLVDWAKQGVLLLNTVLTVRQGQAHSHANFGWEIFTDKVIAQLNQHRENLVFLLWGS
FT                   HAQKKGQFIDRSRHCVLTAPHPSPLSAYRGFFGCKHFSKTNRYLLSKGIAPINWQLRLE
FT                   IDY"
FT   gene            complement(403856..404728)
FT                   /locus_tag="APL_0363"
FT   CDS_pept        complement(403856..404728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73467"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ81"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q57144"
FT                   /protein_id="ABN73467.1"
FT                   /translation="MKKFFHFPKFSEAFPNEKRPSKLLREYFRYSFRKVWCSTQCIQLT
FT                   NYLNNSPLWAELFNQNLYRVNTLLDTYCDKTFNKKQRLKAIKENFTRFENLFRIHFCNQ
FT                   LVTQQEVCIAKLSDELNLYLSINQIDPLEGFFSLNIKNNQKEHIYDASFTLLEENKILI
FT                   SSIQGPNSKSAQDLIKSATKQLYGIRPMFMLIYIFKLIAEKFNLELLGIPHKRQAKYRW
FT                   NDHSRLLFNYDIFWKDNNAILTKNDYWSLSNNIERKPLNIIPSKKRSMYKKRYQLLDDI
FT                   KEKINLMFY"
FT   gene            complement(404823..407621)
FT                   /gene="ssa1"
FT                   /locus_tag="APL_0364"
FT   CDS_pept        complement(404823..407621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssa1"
FT                   /locus_tag="APL_0364"
FT                   /product="serotype-specific antigen 1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73468"
FT                   /db_xref="GOA:A3MZ82"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034061"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ82"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P31631"
FT                   /protein_id="ABN73468.1"
FT                   /translation="MLEKYYFNKSCIAIAISTFLSTSVAYADSLESPHSGIKLSDEISS
FT                   KYSGKGVKLGVLDGGFVVQHPLNSSKLHPSSFKLTSPDGKVLTYDPSYLQFEVKPVEQN
FT                   GKKDLTALFETHGLGVSGVISAKASKKDGFKGGVAKDAEIHIATNTPNRSLAELIAEAQ
FT                   QSESEDEGQGDSKNQKPNFDELAKDDLLLTKEKRLSFERLEWATALNKLVERNLFAINN
FT                   SWNLDPISDNIADFDKLYHSLSTDKQNSLLQAVLNAKRKNTLLVFAAGNESKKQVGVMA
FT                   MLPRYLPELEKHYLSVVAVDNKNNLAEYSNHCGVSKNWCVAAPGNLAILNAIPDNKLKP
FT                   QYSLDKEEGTSLATPVVTGALAILKERFNYLVPTQIRDTLLTTATDLGEKGVDDKYGWG
FT                   VINIAKAINGPSQFLNDETVNVTRDDRWKNDFSSKFKFTKQGEKSLDLAGKNNIARIDV
FT                   EQGRLNLSGMTQSKQVKNNAHLGVNQTEIRQGYMATENSQLTLLDSNGLIGKDKAIIQL
FT                   NGSLKIADKLTENSKQGSISATVVKLHDKASYQGGFTKLIDNKNLANKGLMQDLYFKQS
FT                   EIIAKVNSNKAFTDPNASDNAKSGLSLLNQLRTSSFAYRQGVYNDWLQSALEQKKLGQL
FT                   HYAVSNHIYADALALLRHQNAKQLSHVQHNLFTAAYSPQKTSVWLEHSGQKHSKVAIKQ
FT                   NSSTLGLSHKFNDNALLSATLMRKNHHMDKDFAHADLKQTSLNIGLRYPLADHWFSELA
FT                   LQFGQQKYNQRRWYKKSQLGQAQNKGHHMGGEIRVGYQFMPQTWIIEPSLGVQFIQTRM
FT                   KALNEKGELAINTTALHYNDINLTPSVKLKYTVKFEQGSISPYVGLNYLHRVKGKESKI
FT                   TSQLNGYPLQSYATQKRNHALNLEAGMQFQYKNWFVSANVDYDRIKSTNAFGWKTNIGL
FT                   TF"
FT   gene            complement(407842..411741)
FT                   /gene="hrpA"
FT                   /locus_tag="APL_0365"
FT   CDS_pept        complement(407842..411741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpA"
FT                   /locus_tag="APL_0365"
FT                   /product="ATP-dependent RNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73469"
FT                   /db_xref="GOA:A3MZ83"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ83"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45018"
FT                   /protein_id="ABN73469.1"
FT                   /translation="MKPSQKNFKNRPLDDSQKALIANLKELTNTDYRRLRSRIHGISAI
FT                   KKQEAKNNVIAEIEREILSAQAAFQARKAQHSNLEITYPDLPVSARREEILKLIAENQV
FT                   VVIAGETGSGKTTQLPKMCLELGRGVKGLIGHTQPRRLAARSVANRIAEELKSEMGATV
FT                   GYKVRFNDQVGENTLVKLMTDGILLAEIQNDRYLNQYDTLIIDEAHERSLNNDFILGYL
FT                   KQILHKRPDLKVIITSATIDVERFSRHFNNAPIIEVSGRTFPVEVRYRLIVEEDDQDQL
FT                   QGILNAVDELQAEGRGDILIFMNGEREIRDTAEALQKQELRFTEILPLYARLSAAEQQR
FT                   IFQPSGLNRVILATNVAETSLTIPNIKYVIDTGTARISRYSYRTKVQRLPIEPISQASA
FT                   NQRKGRCGRTSEGICIRLYSEEDFNARPEFTDPEILRTNLASVILQMTSLGLSDIEAFP
FT                   FVDRPDTRQVQDGIRLLEELGAINGNKLTAIGHQLAQLPIDPRLGRMVIAAAQNGSLHE
FT                   VMMIVSALSIQDPRERPQERQQAADEKHRRFADKDSDFLAFVNLWHYIQTQQKELTKNQ
FT                   FRKQCQKDFLNYLRVREWQDIYHQLRLAVREMGLPINSEEANYQQIHSALLTGLLSHIG
FT                   LKDSEKMHYLGARNAHFYVFPTSALFKKQPKWLAASELVETTKLWARTVAKIEPEWIEP
FT                   LAGHLIKRSYSEPHWSKSKGAVMAYEKVSLYGIPVVANRLVNYGSIDPTVSREIFIRSA
FT                   MVEGDWHNNYKFFKENNRLIKEVEDLEHKSRRRDILVDEQTLFDFYDQRIGTEVVSSRH
FT                   FDTWWKKASQKNPELLNFEKSFLMNENANTVSDLDFPNFWYQGQLKLKLSYQFEIGKDH
FT                   DGVTVHIPLPLLNQVEPEGFDWQIPGLRHELVVALIKSLPKAARRNFVPAPNYADAFLA
FT                   RAEPYQKPLIESLAYELRRMTGVTIDPALWDLSQLAPHLRMTFRVVDEKGKKLQESENL
FT                   DELKFALKDQVQESLSTIADDGIEQSGVHLWNFANLPQFYEQKKANFSVKAYPAIVDEQ
FT                   TAVGVKLFETEFEQTRAMQAGLRRLLLLNVPSPIKYLHEKLPNKAKLGLYFAPFGKVLE
FT                   LIDDCIACAVDKLVDEFGGFVWTEEKFNELHEFVRGNLNDTTAEIALQVEKILTLAFEL
FT                   NKRMKGKMDFTMAFALSDIKAQLSGLVYPDFVTKTGYQRLADLHRYLTAIDKRLDKLGT
FT                   DTNTDRAKMLRVEQAENAYKQLLTKLPKSKAIPDEVLEIRYMVEELRVSLFAQQLGTKY
FT                   PISDKRILNVISAIN"
FT   gene            complement(411911..412363)
FT                   /locus_tag="APL_0366"
FT   CDS_pept        complement(411911..412363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73470"
FT                   /db_xref="GOA:A3MZ84"
FT                   /db_xref="InterPro:IPR007382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ84"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44110"
FT                   /protein_id="ABN73470.1"
FT                   /translation="MSLQFNPISLFLVVLIFLGVVGNNNSITIAATVLLLVQQTFLSKY
FT                   LPFLDKHGLSIGIIILTIGVLSPIVSGKISLPSFSEFLNWKMLLAVVAGIAVAWLGGRG
FT                   VSLMGGQPLLVTGLLVGTIIGVALLGGVPVGPLIAAGILSLLIGKG"
FT   gene            complement(412560..413156)
FT                   /gene="grpE"
FT                   /locus_tag="APL_0367"
FT   CDS_pept        complement(412560..413156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="APL_0367"
FT                   /product="heat shock protein (HSP-70 cofactor)"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73471"
FT                   /db_xref="GOA:A3MZ85"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ85"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMB7"
FT                   /protein_id="ABN73471.1"
FT                   /translation="MTAQNENAQAQAEQVEVANEAQLEQTAEIQQEQPVEAELAAAYAR
FT                   INELETYVAEADNREKDIQLRAQAEIQNIRRRAEQDVEKAHKFALEKFSKELLTVVDNL
FT                   ERGLNALDTAVTDEKTQALVDGVEMTHKEFISTLAKFGVEAVGVVGEAFNPEVHEAISM
FT                   QPAEGIEANHISVVLQKGYTLQGRVLRPAMVMVAG"
FT   gene            413401..414483
FT                   /gene="potD2"
FT                   /locus_tag="APL_0368"
FT   CDS_pept        413401..414483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD2"
FT                   /locus_tag="APL_0368"
FT                   /product="spermidine/putrescine-binding periplasmic protein
FT                   1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73472"
FT                   /db_xref="GOA:A3MZ86"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ86"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45168"
FT                   /protein_id="ABN73472.1"
FT                   /translation="MKKLAGLFAAGLATVALTACNEEKPKAAEAAAQPAAAGTVHLYTW
FT                   TEYVPEGLLDEFTKQTGIKVEVSSLESNETMYAKLKLQGKDGGYDVIAPSNYFVSKMAK
FT                   EGMLAELDHAKLPVIKELNQDWLNKPYDQGNKYSLPQLLGAPGIAFNSNDYKGDAFTSW
FT                   GDLWKPEFANKVQLLDDAREVFNIALLKLGKNPNTTNPEEIKAAYEELRKLRPNVLSFT
FT                   SDNPANSFIAGEVSVGQLWNGSVRIAKKEQAPVNMVFPKEGPVLWVDTLAIPANAKNKE
FT                   NAHKLINYLLSAPVAEKLTLEIGYPTSNVEALKTLPKEITEDPAIYPTADVLKAAQWQD
FT                   DVGNAIELYEKYYQELKAAK"
FT   gene            414627..416018
FT                   /gene="norM"
FT                   /locus_tag="APL_0369"
FT   CDS_pept        414627..416018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norM"
FT                   /locus_tag="APL_0369"
FT                   /product="putative multidrug resistance protein NorM"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73473"
FT                   /db_xref="GOA:A3MZ87"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ87"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VMB5"
FT                   /protein_id="ABN73473.1"
FT                   /translation="MNLQWQRYPENTRKLFKLTLPIFISQLSVAGMGLADIVMAGLVSD
FT                   DDVSAIAVSNSIYFPLFLFVLGLLNVITPTVSYLNGSNQRHLIAHQIRQGFWLVLVCSV
FT                   PLIIVFLNSHWILDYMNTPQAFSTKSQQYLAIMAIGVVPALLGINLRCMNDGLSNPKPA
FT                   MRIMFFGLLLNIPLNYIFIFGKFGLPEMGAVGCGMATAIVNWIMFLLLFHYSYTNKSQK
FT                   DIGLFNRWFEMPSGQTLLKICKLGLPIGFATFTEVMLFSTSALLLSPLGSQVVASHQAA
FT                   LQTSSLLFMIPMSFSIATTIVVGKTLGQKQVEQAKIISYHALITGALFALAAAVVIVIL
FT                   DEIIPLAFTSDPVSIAIAAHLLLFAAVYQIPDSLQAVANGILRGYKHTKPILYVTMFCY
FT                   WVIGMPFGYILARTDWIVEPMAASGFWFIFCVSLSIAAGLLIYQMHKIQQIPAEQLLAK
FT                   LERIK"
FT   gene            416034..419642
FT                   /gene="recB"
FT                   /locus_tag="APL_0370"
FT   CDS_pept        416034..419642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /locus_tag="APL_0370"
FT                   /product="exodeoxyribonuclease V beta chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73474"
FT                   /db_xref="GOA:A3MZ88"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ88"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45157"
FT                   /protein_id="ABN73474.1"
FT                   /translation="MKTLSPIELPLNCTALIEASAGTGKTFTMANLYLRLLLGVGCASL
FT                   TVEQILVVTFTKAATEELRDRIRRNIKACRRFLQEYDAEKTYDINDFFFQLHQQIESVE
FT                   EAILRLRIAEREIDLASIFTIHSFCQKMLFQFAFDSGMRFDNDLQPDESDLLRRLSEEV
FT                   WREMFYPMGLTETAAVAEYLGTPNNAFAAIRAFVSAELPSLSDEQHWLNGELAVYLAAL
FT                   QHFLADAKRHWSAHGEEISRLIETELVKKYKTGEKKALNRRSYQTRYLEKWRASVDEWA
FT                   ASSLSYLPEEQFERFCQEFLNEKAEEGAEPLVHPHFAKNQQILTAYQQQFANKQKPLLL
FT                   YQFLLAVRTKLADYKATHSEKSFNDMLTLLNQALKGERGAELAAQIRAQFPFAMIDEFQ
FT                   DTDKEQYEIFHKIFMQETHTNHGFIMIGDPKQSIYKFRGADIFTYLTASQQAQQKRTLA
FT                   KNWRSLPPIVSVTNRLFEFPEAAENSPFLYQGIQFHSVEAKASEAELIGADYVNCYLQA
FT                   KFDEKLAAKQCAYQIQQQLKQMEAGEFGLKFTNTTEEINAFQAKDIAILVRSHSQATLI
FT                   KSALAELGIRSVFLSEKESVYQSETAKELLWVLYACLNPYHQRHLLSALGTTLWGLSAT
FT                   EIHQLKNSELQWDEQVGRFITYQQIWQQQGILPMLHKLFMQEGIIERLRANPRDSDRRL
FT                   TDLLHLTELLQNAMPSLENESALVRWYERQLAKIDSTEEHILRLESEEELIKIVTIHGS
FT                   KGLQYPIVWLPFIGKKNQGAKASNLAIYRDEQGLAHWYFGKPSEQVQALMDREELAEDL
FT                   RLLYVAVTRAESQLNLILPQRFEDGWNAVHYLLSNGEIGLDKSYKAEISTSEYLQQKGI
FT                   DCQAVELDEKIANDKWRPAPFVSETLSAYHFSGQIQQTGLVTSFSALHQQHEWAMQHHT
FT                   GYSMPKVFENAGQDYDQQQVLTPETDNLFALDNEETNAYSSYQFPHSTKVGNILHSFFE
FT                   HSDFQQAVDFEQILTICEQLGLDENWHEPLQKWFEKVLATPFSETEFALKDVPITKRLN
FT                   EWQFYLRLKNSDGLRKLNQLLKQYSAVSAKLPDLNLPQLEGYLRGFVDCIVQVNEKFYL
FT                   IDYKSNFLGYLAQDYSRQNLEKTIGQYRYDLQYLLYTLALHRYLRVRLGEQYEYERDFG
FT                   GVAYLFLRGMNGTQNSGVFFEKPCKQLIEGMDELFG"
FT   gene            complement(419720..421231)
FT                   /gene="lnt"
FT                   /locus_tag="APL_0371"
FT   CDS_pept        complement(419720..421231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="APL_0371"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73475"
FT                   /db_xref="GOA:A3MZ89"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ89"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VM56"
FT                   /protein_id="ABN73475.1"
FT                   /translation="MNFVKNPSILTACLLAFALGGFGTLAYSPFDLWGIVYLSAAGLIW
FT                   AATLPQRKTAFWATFAWSLGCFCIGVNWVHVSMTQFGGVPLVVSYIAVFLLACYLALYN
FT                   LLFSYIAHKFRIQNPFALAAIFTFTEYLRGVVFTGFPWLQFGYTQIDSPFAGVAPLLGV
FT                   EGLTFFVMVVSGYLVLLVKKSVKTTASLVTLAILCGLAFAAKFIPFVQIDEQKQPLSVS
FT                   LVQGNIEQKMKWDPAHFDYTLQTYQRLISPLLGESDVIVLPESAIPALETQIYPLLSQL
FT                   QQVAADKGSEVIIGTLYQNENEQLFNSAVVLGNQSQPYDLHHSTRYNKHHLVPFGEYVP
FT                   FGSILDWMRDVFILPINLSQGEFVQQPLFAKNRKFNMAICYEVIFGNQMQQNQQAQQSD
FT                   YLLTITNDAWFGASIGPWQHFQMARMRALELGKPLLRAANTGITAIIGAKGEVIEQIPQ
FT                   FEANVLTAQIQPTKGETLFAKTGNRLIYALSLFCFIFAFVRNRKK"
FT   gene            complement(421313..422206)
FT                   /gene="corC"
FT                   /locus_tag="APL_0372"
FT   CDS_pept        complement(421313..422206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corC"
FT                   /locus_tag="APL_0372"
FT                   /product="magnesium and cobalt efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73476"
FT                   /db_xref="GOA:A3MZ90"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ90"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q57368"
FT                   /protein_id="ABN73476.1"
FT                   /translation="MSDEQQSVNTQQDKKSFLQSIFGGLFQSEPKNREDLVEVIRDSLD
FT                   NELIDSDTKDMIEGVMEISELRVRDIMIPRPQIVYIDANLDLTACVDLIIESAHSRFPV
FT                   ILDDGKDTVLGILHAKDLLKFLRTDSEEFEMPTILRPAVIVPESKRVDRMLKEFRSERF
FT                   HMALVVDEFGAVSGLVTIEDILEQIVGDIEDEFDEEEIEPIRQLSRHTYAVSALTDIEK
FT                   FNETFATDFTDEEVDTVGGLVMQAFGHLPKRGEQIQLEGIDFKVTSADSRRLIQLRVTV
FT                   SDEQLEKMEQLVSNEE"
FT   gene            422376..422978
FT                   /locus_tag="APL_0373"
FT   CDS_pept        422376..422978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73477"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ91"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00733428.1"
FT                   /protein_id="ABN73477.1"
FT                   /translation="MKLTKMAVTVATLAVSAFSVAGTLTASDSVELLAFDGQKVARGTA
FT                   GLSIDGNVHQVVVSVSDIVDGSYFSIDPIILTFNGTDEDAKIVTPKFTSNFTVDKFKKE
FT                   LNFKIETASGKEISYKRDFLKGEGFAPNSRVEDNLSKYNASKAVASVPAFANAALEAKG
FT                   QMVIETNNVKEEQLQVLFKKADKETQKRFLEWAKKQQ"
FT   gene            423214..423996
FT                   /gene="glpF"
FT                   /locus_tag="APL_0374"
FT   CDS_pept        423214..423996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="APL_0374"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73478"
FT                   /db_xref="GOA:A3MZ92"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ92"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44826"
FT                   /protein_id="ABN73478.1"
FT                   /translation="MERSLKGACIAEFIGTGLIIFFGVGCVAAAQLAGATFGLWEISIM
FT                   WGVGVALAVYTTAGVSGAHLNPAVTVALWKFACFDGKKVLPYIISQFLGAFAAAALVYF
FT                   LYKDLFAATEAAKNIVRGEGVGLAGVFSTYPHQHISVLQAFCVEAVITMALVALILALT
FT                   DDGNGVPRGPMAPLLIGLLIAAIGGAFGPLTGFAMNPARDFGPKAFAFLAGWGQVAFTG
FT                   ARDIPYFLVPLIAPIVGGLVGAWGYRRFIGKNLPCNCK"
FT   gene            424031..425542
FT                   /gene="glpK"
FT                   /locus_tag="APL_0375"
FT   CDS_pept        424031..425542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="APL_0375"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73479"
FT                   /db_xref="GOA:A3MZ93"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ93"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44400"
FT                   /protein_id="ABN73479.1"
FT                   /translation="MTKEYIIALDQGTTSSRAVLLDKNANIVEVSQREFTQIYPQVGWV
FT                   EHNPMEIWATQSSTLNEVVAKAGITSDKIAAIGITNQRETTIVWEKETGKPVYNAIVWQ
FT                   CRRTADICAKLKEDGHEAYIRKTTGLVVDPYFSGTKVKWILDNVEGAREKAELGELLFG
FT                   TVDTWLVWKLTQGRVHVTDYTNASRTMMFNIHTKQWDDKMLELLNIPRSMLPEVRNSSE
FT                   VYGETNIGGKGGVRIPVAGMAGDQQAALYGHLCVEAGQAKNTYGTGCFMLMNTGNEAVE
FT                   SKNGLLTTIACNAKGEPCYALEGSIFMGGASIQWLRDELKIVHDSKDSEYFATKEDSTN
FT                   GVYVVPAFTGLGAPYWDPYARGAILGLSRGANRNHIVRATLESIAYQTRDVLDAMQSDS
FT                   GKHLATLRVDGGAVANNFLMQFQADILNANVERPVVREVTALGAAYLAGLAVGFWKDLQ
FT                   ELRGKASIERTFVPDGDEAKRTRRYKGWKKAVKRALEWAKEDAEE"
FT   gene            complement(425663..428071)
FT                   /gene="lon"
FT                   /locus_tag="APL_0376"
FT   CDS_pept        complement(425663..428071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="APL_0376"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73480"
FT                   /db_xref="GOA:A3MZ94"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ94"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43864"
FT                   /protein_id="ABN73480.1"
FT                   /translation="MAPRKKKAIELPLLPLRDVVVFPYMVMPLFVGREKSIQALRAAMD
FT                   SNKQLFLVTQQDPNKEEPTTEDVYSVGVIANIIQMLNLPDGTVKVLVEGQQRAKIEHIH
FT                   DDENGFWAGVQPLISEYEDENDELKTIARAALNEFEGYVKNNKKIPAEILPKLQKISLE
FT                   DRLADTMASNLIASVQKKQALLEETNLIARFEALLVAMATELDSLETETRIRNRVKQQM
FT                   EKNQRDYYLNEQIKAIQKELGNGEDAEQTELDKLKEQIKEAKLPLEVKEKLDSEFKKLK
FT                   AMPQSSSEATVVRGYIDWVLKMPWNKKSTVKKDLAKAQEILDKDHYGLERVKERIVEYL
FT                   AVQSRLNKLKGPILCLVGPPGVGKTSLGQSIANATGRKYVRMALGGVRDEAEIRGHRRT
FT                   YIGSMPGSLMMKMAKVGVKNPLFLLDEIDKMAQDMRGDPASALLEVLDPEQNKAFNDHY
FT                   LEVDYDLSDVMFVATSNSMNIPPALLDRMEVIRLSGYTEDEKMHIARDHLIAKQQENNG
FT                   LKAGELTIEDSAILSIIRYYTREAGVRSLEREIAKICRKAVKTLVLDKKVKSITVTEDN
FT                   IADYLGVKRFDYGKMDSQNRVGEVTGLAWTEVGGDLLTIETTSVGGKGKFSFTGSLGDV
FT                   MKESIQAAMMVVRARSAQLGIADDFYEKRDIHVHVPDGATPKDGPSAGIAMCTALISSL
FT                   TGNPVRKEVAMTGEISLRGKVLPIGGLKEKLLAAHRGGITTVIIPKDNEKDLEEIPENA
FT                   KAALAIHSVETIDEVLAIALENPPMGIEVISPKSQTIKVKKTRSKAAIQ"
FT   gene            complement(428217..429662)
FT                   /gene="glpT"
FT                   /locus_tag="APL_0377"
FT   CDS_pept        complement(428217..429662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="APL_0377"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73481"
FT                   /db_xref="GOA:A3MZ95"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ95"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P96335"
FT                   /protein_id="ABN73481.1"
FT                   /translation="MFGPFKPAPHIAELPADKIDARYKFLRWQVFAGIFFGYAAYYFVR
FT                   ANFDLAQKGLIEAGLYNKAELGIIGTGAGLAYGLSKFVMAGMSDRSNPKVFLPFGLLLS
FT                   GLCMTMMGLMPWATSGIAVMFIMIFLNGWFQGMGWPPCGRTMVHWWSKSERGTIVSIWN
FT                   CAHNVGGMVPGAMVLLASTIYFSNTGEHATAKDVWQQALYYPGIAAMIAAIPVYFVMKD
FT                   TPQSCGLPPVEKWRNDYPDDYNEETAEKDLSTKEIFVTYVLKNKLLWYIAIANVFVYLI
FT                   RYGVLKWSPVYLGEVKHFNIKGTAWAYTIYELAAIPGTLLCGWVSDKLFKGKRGLTGFI
FT                   FMILTTIAVFALWKNPATPEAELAQYAGKAWYENPYQLMDFILMTTIGFLIYGPVMLIG
FT                   LHALELAPKKAAGTSAGFTGLFGYLGGTVSASAVVGWAAEYYGWDGGFYVMIAGGVLAV
FT                   LLMFIVMIEEGKHKAKLGDHYGK"
FT   gene            complement(429865..430953)
FT                   /gene="glpQ"
FT                   /locus_tag="APL_0378"
FT   CDS_pept        complement(429865..430953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="APL_0378"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73482"
FT                   /db_xref="GOA:A3MZ96"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ96"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q06282"
FT                   /protein_id="ABN73482.1"
FT                   /translation="MKTIKALAVSLITTAVLAGCSNTQPVEPVKSDKLIIAHRGASGYL
FT                   PEHTLESKALAFAQQADYLEQDLAMTKDNRLIVIHDHFLDGLTDVAKKFPKRARKDGRF
FT                   YVADFTLKEIQTLEMTENFKTENGQQVQVYPNRFPMWKSHFRIHTFEDEIEFIQGLEKS
FT                   TGKQIGIYPEIKAPWLHHQEGKDIALETLKVLKKYGYDQKSDKVYLQTFDFNELKRIKT
FT                   ELLPKLGMDVKLVQLVAYTDWHETEEKDASGKWVNYNYDWMFKDGAMAEVAKYADGVGP
FT                   GWYMLVDDKNSKLGDIKYTPMVKDIAKTKMELHPYTVRKDALPEFFSDVNQMYDALLNK
FT                   AGATGVFTDFPDTGVQFIKGTK"
FT   gene            431205..432890
FT                   /gene="glpA"
FT                   /locus_tag="APL_0379"
FT   CDS_pept        431205..432890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpA"
FT                   /locus_tag="APL_0379"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit A"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73483"
FT                   /db_xref="GOA:A3MZ97"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ97"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43799"
FT                   /protein_id="ABN73483.1"
FT                   /translation="MNISPQMYQNVADFSPINTDVIIIGGGATGAGIARDCALRGLKCV
FT                   LLERRDIATGATGRNHGLLHSGARYAVNDRESAEECIKENLILKQIARHCVDDTKGLFI
FT                   TLPEDDLNYQKNFIQACTDSGIEAVEIEPDLAKYMEPSVNPSLVGAVVVPDGSIDPFRL
FT                   TASNMLDATENGAQIFTYCEVKGLIREGGRVIGVNVYDHRNRIDRQFFALIVVNAGGIW
FT                   GQGIAEYADLKIKMFPAKGSLLVMGHRINNMVINRCRKPANADILVPGDTICVIGTTSD
FT                   RIPYDQIDNMAVTPEEVDVLFREGEKLAPSLRHTRVLRAYAGVRPLVATDDDPSGRNVS
FT                   RGIVLLDHAERDGLDGFITITGGKLMTYRLMAEWATDLVCKKLNKSDRLCSTAERPLPG
FT                   SNESREETSKKIISLPNTIRHSAVYRHGSRALRLLETERLDKTLVCECEAVTAGEVRYA
FT                   VDELNVNNLVDLRRRTRVGMGTCQAELCACRAAGLMSRFKVATPKESTTQLASFMEERW
FT                   RGIQPIAWGDAMREAEFTSWIYYSLLGLNDVPMDKEQGVNSNEF"
FT   gene            432880..434166
FT                   /gene="glpB"
FT                   /locus_tag="APL_0380"
FT   CDS_pept        432880..434166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpB"
FT                   /locus_tag="APL_0380"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit B"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73484"
FT                   /db_xref="GOA:A3MZ98"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZ98"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VM49"
FT                   /protein_id="ABN73484.1"
FT                   /translation="MNFDVVIIGGGLAGLTCGIALQEQGKRCVIINNGQAAIDFSSGSM
FT                   DLLSRLPSGQKVENVYQSLDELKLQAPEHPYSILGKDQVLAKAQQFEQLAQSLNLHLEG
FT                   STVQNHERITPLGGLRATWLSPNSVPTVKHLTALADKQVAILGIEGYHDFQPQLLADNL
FT                   KQHSQFADYEFTIGYLNIPELDYLRQNSREFRSVNIAQLLEHKLSFQDLVQEIKQAAGN
FT                   AKAVFLPACFGLDNQDFFNSLQQATGLALFELPTLPPSLLGIRQHRQLRSRFEQLGGMM
FT                   MNGDRAVKAEFEGKNVARIFTTSHQEEPISADYFVLAAGSFFSNGLVAEFERVKEPVFD
FT                   LDICGCKNFDSSDRFTWTNNRFAAPQPYQSAGVVINSACQVQKNGEVVSNLYAVGNVIG
FT                   GFQGIEQGCGSGVAVVTALTVAEQIGGTK"
FT   gene            434163..435437
FT                   /gene="glpC"
FT                   /locus_tag="APL_0381"
FT   CDS_pept        434163..435437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpC"
FT                   /locus_tag="APL_0381"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit C"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73485"
FT                   /db_xref="GOA:A3MZ99"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZ99"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43801"
FT                   /protein_id="ABN73485.1"
FT                   /translation="MNIQQLIENARQGAQSPVVHQHFDPSFESCLKCTACTAVCPVSRN
FT                   NPFYPGPKQSGPDGERLRLKSPDFYDEALKYCTNCKRCEIACPSDVKIGDIIVRARNRH
FT                   VERQNKPLIHKLRDAVLSNTDIMGTMNTPFAPIVNTITGLKATRFLLEKTLKVSQHRTL
FT                   PKYSFGSFRNWYMKKEAKRQAQFKEQVAYYHGCYVNYNNPQLGKEVIDVMNALDIGVVL
FT                   LEKEKCCGLPLMVNGFPERAKKQAEFNLKYLEKTVNKQLEVIGTSSSCTANIKEEYSHV
FT                   LGMPNTNVKSHINIVTRYLYKLQKAGRKLPLKPMRLRVAYHTACHVEKAGWAPYTLELL
FT                   KQIPELEVVMLPSQCCGIAGTYGFKAENYETSQAIGRTLFEHINEGGFDYVISECETCK
FT                   WQIDMSSNVTCLHPITLLSMALDKR"
FT   gene            435609..436841
FT                   /gene="ribD"
FT                   /locus_tag="APL_0382"
FT   CDS_pept        435609..436841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="APL_0382"
FT                   /product="riboflavin biosynthesis protein"
FT                   /EC_number="1.1.1.193"
FT                   /EC_number="3.5.4.26"
FT                   /note="pubmed:8522537; Includes:
FT                   Diaminohydroxyphosphoribosylaminopyrimidine deaminase;
FT                   5-amino-6-(5-phosphoribosylamino)uracil reductase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73486"
FT                   /db_xref="GOA:A3MZA0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZA0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P50853"
FT                   /protein_id="ABN73486.1"
FT                   /translation="MKLPCKRWFFLSFLQALRSKDFKAFFIIRVNMPVMCFPLPSNSFK
FT                   TMTDLDYMRRAIALAKQGLGWTNPNPLVGCVIVKNGEIVAEGYHEKIGGWHAERNAVLH
FT                   CKEDLSGATAYVTLEPCCHHGRTPPCSDLLIERGIKKVFIGSSDPNPLVAGRGANQLRQ
FT                   AGVEVVEGLLKEECDALNPIFFHYIQTKRPYVLMKYAMTADGKIATGSGESKWITGESA
FT                   RARVQQTRHQYSAIMVGVDTVLADNPMLNSRMPNAKQPVRIVCDSQLRTPLDCQLVQTA
FT                   KEYRTVIATVSDDLQKIEQFRPLGVDVLVCKARNKRVDLQDLLQKLGEMQIDSLLLEGG
FT                   SSLNFSALESGIVNRVHCYIAPKLVGGKQAKTPIGGEGIQQIDQAVKLKLKSTELIGED
FT                   ILLDYVVISPL"
FT   gene            436964..437611
FT                   /gene="ribE"
FT                   /locus_tag="APL_0383"
FT   CDS_pept        436964..437611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="APL_0383"
FT                   /product="riboflavin synthase alpha chain"
FT                   /EC_number="2.5.1.9"
FT                   /note="pubmed:8522537"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73487"
FT                   /db_xref="GOA:A3MZA1"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZA1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P50854"
FT                   /protein_id="ABN73487.1"
FT                   /translation="MFTGIIEEVGKIAQIHKQGEFAVVTINATKVLQDVHLGDSIAVNG
FT                   VCLTVTSFSSNQFTADVMSETLKRTSLGELKSNSPVNLERAMAANGRFGGHIVSGHIDG
FT                   TGEIAEITPAHNSTWYRIKTSPKLMRYIIEKGSITIDGISLTVVDTDDESFRVSIIPHT
FT                   IKETNLGSKKIGSIVNLENDIVGKYIEQFLLKKPADEPKSNLSLDFLKQAGF"
FT   gene            437672..438877
FT                   /gene="ribA"
FT                   /locus_tag="APL_0384"
FT   CDS_pept        437672..438877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="APL_0384"
FT                   /product="riboflavin biosynthesis protein"
FT                   /EC_number="3.5.4.25"
FT                   /note="pubmed:8522537; Includes: GTP cyclohydrolase-2;
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73488"
FT                   /db_xref="GOA:A3MZA2"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZA2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P50855"
FT                   /protein_id="ABN73488.1"
FT                   /translation="MTDFQFSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATP
FT                   ENINFMATYGKGLICTPISTEIAKKLNFHPMVAVNQDNHETAFTVSVDHIDTGTGISAF
FT                   ERSITAMKIVDDNAKATDFRRPGHMFPLIAKEGGVLVRNGHTEATVDLARLAGLKHAGL
FT                   CCEIMADDGTMMTMPDLQKFAVEHNMPFITIQQLQEYRRKHDSLVKQISVVKMPTKYGE
FT                   FMAHSFVEVISGKEHVALVKGDLTDGEQVLARIHSECLTGDAFGSQRCDCGQQFAAAMT
FT                   QIEQEGRGVILYLRQEGRGIGLINKLRAYELQDKGMDTVEANVALGFKEDEREYYIGAQ
FT                   MFQQLGVKSIRLLTNNPAKIEGLKEQGLNIVAREPIIVEPNKNDIDYLKVKQIKMGHMF
FT                   NF"
FT   gene            438988..439449
FT                   /gene="ribH"
FT                   /locus_tag="APL_0385"
FT   CDS_pept        438988..439449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="APL_0385"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /note="pubmed:8522537"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73489"
FT                   /db_xref="GOA:A3MZA3"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZA3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P50856"
FT                   /protein_id="ABN73489.1"
FT                   /translation="MAKITGNLVATGLKFGIVTARFNDFINDKLLSGAIDTLVRHGAYE
FT                   NDIDTAWVPGAFEIPLVAKKMATSGKYDAVICLGTVISGSTTHYDYVCNEAAKGIGAVA
FT                   LETGVPVIFGVLTTENIEQAIERAGTKAGNKGSECALGAIEIVNVLKAI"
FT   gene            complement(439538..440026)
FT                   /gene="greB"
FT                   /locus_tag="APL_0386"
FT   CDS_pept        complement(439538..440026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="APL_0386"
FT                   /product="transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73490"
FT                   /db_xref="GOA:A3MZA4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZA4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P57802"
FT                   /protein_id="ABN73490.1"
FT                   /translation="MAKSNYITRSGWQALDQELKFLWKDERPKVTQAVSEAAALGDRSE
FT                   NAEYIYGKRRLREIDRRVRFLSKRLEVLQIVDYHPKQEGKVFFGAWVELENEQGETKQY
FT                   RIVGCDEFDPAKNWISLDSPVARALIGKEVDDEIKVDTPLGKSLLYINKIWYEKEGLY"
FT   gene            complement(440036..440971)
FT                   /gene="kpsF"
FT                   /locus_tag="APL_0387"
FT   CDS_pept        complement(440036..440971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsF"
FT                   /locus_tag="APL_0387"
FT                   /product="arabinose-5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73491"
FT                   /db_xref="GOA:A3MZA5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZA5"
FT                   /inference="similar to AA sequence:RefSeq:NP_873633.1"
FT                   /protein_id="ABN73491.1"
FT                   /translation="MNYLASANETLSLYAQAISQLNQRLDGAFNQAVEMVLNCEGRVVV
FT                   AGIGKSGLVGQKMVATFASTGTPSFYLHPTEAFHGDLGMLKPIDVVILISNSGETDDVI
FT                   KLLPSLKSFGNKIIAMTGNPNSTLAQHANLILNIGVEREACPNNLAPTTSTLVTMALGD
FT                   ALAIALINARDFKAEDFARFHPGGSLGRKLLNRVKDVMQTKLPIAQPNADFSTILSVMN
FT                   EGRMGVALIMQGEQLQGIITDGDIRRTLAQFGTDSLAKTAEQIMSKHPKTVSDNTYLAK
FT                   AEEMMKELHIHSLIALNDEGKVSGIMELSS"
FT   gene            complement(441099..442391)
FT                   /gene="pepB"
FT                   /locus_tag="APL_0388"
FT   CDS_pept        complement(441099..442391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepB"
FT                   /locus_tag="APL_0388"
FT                   /product="peptidase B"
FT                   /EC_number="3.4.11.23"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73492"
FT                   /db_xref="GOA:A3MZA6"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR008330"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZA6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q4QM33"
FT                   /protein_id="ABN73492.1"
FT                   /translation="MVTMNITLSQDPAPEQWGKNAILSANQQGMTIHLQKDPLTTIQRA
FT                   ARKIKNQGVLNVTLSGQGWTLEECWAFHQGFISVRNTGTVSYPDLAEQQAEFDARLHCS
FT                   DFTRALINESSETLTPERLAQKAAEFITKQSEQYLGKNVVSAEMISGEVLKQQGYHGIW
FT                   TVGKGSANKPTLLKLDFNPSGDINAPVLACLVGKGITFDTGGYSIKPSDSMSTMRTDMG
FT                   GAALLTGALGFAISRGLTQRVKLYLCCAENMVSSTAFKLGDIIEYRNGVSAEVLNTDAE
FT                   GRLVLADGLIEASEQNAKFLIDAATLTGAAKVAVGNDYHSVLSMDDELTACLFNAAKAE
FT                   NEPFWRLPFEEFHRSQISSSFADIANIGSVPVGAGASTATAFLSYFVKDYEKNWLHIDA
FT                   SATFRKTASDLWAAGATGLGMKTLANLLLSR"
FT   gene            complement(442506..443321)
FT                   /gene="ompP4"
FT                   /locus_tag="APL_0389"
FT   CDS_pept        complement(442506..443321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompP4"
FT                   /locus_tag="APL_0389"
FT                   /product="lipoprotein E precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73493"
FT                   /db_xref="GOA:A3MZA7"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR006423"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZA7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P26093"
FT                   /protein_id="ABN73493.1"
FT                   /translation="MKLFKLTGLAVASAFILTACAHHDTSNHDEMILQEQAALGLNWVQ
FT                   QSGEYQALAHQAFNTAKVAFDQAKVAKGKKKAVVVDLDETMVDNSAYAGWQVKNHKAFD
FT                   GESWTRWVNARQTQAIAGAVEFNNYVNSHKGTMFYVSNRKDNGEKAGTLDDMKKLGFTG
FT                   VSEQTLFLKKDKSNKTPRFEEIEKQGYEIVLYLGDNLNDFGDATYKKSNAERRDFVAAN
FT                   KDKFGKKFIVLPNPNYGDWEGGLDKNYYKGDAKSRLDIRHGAIKAWDGK"
FT   gene            443494..444432
FT                   /locus_tag="APL_0390"
FT   CDS_pept        443494..444432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73494"
FT                   /db_xref="GOA:A3MZA8"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZA8"
FT                   /inference="similar to AA sequence:RefSeq:YP_088071.1"
FT                   /protein_id="ABN73494.1"
FT                   /translation="MNFLLKLTLFVSKTFAIWVVVFAFISAQYPETFKQFVPWIPYLLG
FT                   IVMLGMGLTLTFKDFGEVTKNPKAAIIGVIAQFVVMPSIAFLLAKAFQLPPDLAIGVIL
FT                   VGSCPGGTSSNVMTYLARGNTALSVACTTVSTLLAPVLTPAIFYLFASEWLEIDAGAMF
FT                   VSVLKMVLLPIFVGVVIRSIFKQKIEQFSQTMPLISVVAIILIVTAVVSVSKDRIIESG
FT                   LLIFFVVVLHNGLGYLIGYTVGRVLKLPIADSKAISIEVGMQNSGLGAALAALHFKANP
FT                   VVAVPSAVFSFWHNISGPVLAMIFASIKNEK"
FT   gene            complement(444512..445693)
FT                   /gene="macA"
FT                   /locus_tag="APL_0391"
FT   CDS_pept        complement(444512..445693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="macA"
FT                   /locus_tag="APL_0391"
FT                   /product="probable macrolide-specific efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73495"
FT                   /db_xref="GOA:A3MZA9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZA9"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00732742.1"
FT                   /protein_id="ABN73495.1"
FT                   /translation="MKLKSLITGLTLAGIITAGYFYFFNQSDNQQVYYITEPVARGTID
FT                   KHVLATGSVRASKRTEVGAQVSGKIINLYVTLGQQVKKGDLLAEIDSSNQSNSLSTAEA
FT                   TLSSYQAQLKSAQVALEVAQSNFNRLNKLYKQQSASQSDFETAKNTLASARATVDNVKA
FT                   QIKSAQISVNDAKTNLNYTQIVSPMDGTIVSIPVSVGQTVNANQTSPTIVHVADLSKML
FT                   VKLEISEGDIAQVKAGQAIRFTTLAEPNHTHNSKIDSVDPALTTLSDDNASNKYAEKSG
FT                   NTEAIYYYANSLVENSEQRLRIGMTVQGQVDIVKRENVLIVPTSALKKKSNAVFINVLE
FT                   NNQSIEKKVEIGLADSQYTEVLSGLNEGEKVITAQRTDDEKISAEMRRRPGGF"
FT   gene            complement(445790..446605)
FT                   /locus_tag="APL_0392"
FT   CDS_pept        complement(445790..446605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73496"
FT                   /db_xref="GOA:A3MZB0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZB0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44771"
FT                   /protein_id="ABN73496.1"
FT                   /translation="MTHPFRAIVSDLDGTLLNADHKIGQYTIETLSKLSQQGIDIFFAT
FT                   GRNYPDVKHIISKVNVDEAMLITSNGARANFLSGQTVLNHYLPEDIAFQLMNIPFDSNR
FT                   VCLNSYQGDEWFINVDIEQLKKYHKDSGYSYQVVDFSKHHGRQTEKVFFIGKAPEDLVP
FT                   IEQYIKAKFGDRIYMTYSALLCLEVMNKSVSKGNALEELVKLRGYELKDCLAFGDGMND
FT                   IEMLSKVGKGCIMRNADKRLIQALPQHEIIGNNAHESVAAYIRATFSIL"
FT   gene            447202..448743
FT                   /gene="leuA"
FT                   /locus_tag="APL_0393"
FT   CDS_pept        447202..448743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="APL_0393"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73497"
FT                   /db_xref="GOA:A3MZB1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZB1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9CJN5"
FT                   /protein_id="ABN73497.1"
FT                   /translation="MSNIIIFDTTLRDGEQSLKASLTVKEKLQIALALERLGVDVMEVG
FT                   FPVSSAGDFESVKTIAQHIKNSRVCALSRAVDKDIDVAAEALKVAEAFRIHTFIASSAI
FT                   HVESKLKRSFDDVVEMAVHAVKRARNYTDDVEFSCEDAGRTGIDNICRIVEAAINAGAT
FT                   TVNIPDTVGYCLPYQYGEIIANVMNRVPNIDKAVVSVHCHNDLGMATANSLTAVLNGAR
FT                   QIECTINGIGERAGNTALEEVVMAIKTRQDMFNGRDTRINTQEIHRVSQMVSQLCNMPI
FT                   QPNKAIVGSNAFAHSSGIHQDGMVKNKNTYEIMSPETIGLKKEKLNLTARSGRAAVKNH
FT                   MSEMGYQENDYDLDKLYDAFLKLADKKGQVFDYDLEALAFIDMQAGDEGRLHLDVITSQ
FT                   MISHLPASAFVQVELDGEKLSQVSSGGNGPVDAVFNAILAITGMDIKMLHYNLTAKGEG
FT                   AEALGQVDIVVEHEGRRFHGVGLATDIVESSARALIHVINAIYRAHKVADLKAKK"
FT   gene            449086..449664
FT                   /gene="rpoE"
FT                   /locus_tag="APL_0394"
FT   CDS_pept        449086..449664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="APL_0394"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73498"
FT                   /db_xref="GOA:A3MZB2"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZB2"
FT                   /inference="similar to AA sequence:RefSeq:NP_873637.1"
FT                   /protein_id="ABN73498.1"
FT                   /translation="MSELVADQELVERAQKGDKKAFNLLVVRYQNRVAGLLTRYVSRDD
FT                   IPDIVQESFIKAYRSLESFRGESAFYTWLYRIAVNTAKNHLTALGRRPPKEDILAEDAE
FT                   SFDVGGQLRESDTPENVVLSEELKRVVFDTIENLPEELKTAITLSELEGLSYEEIAEVM
FT                   QCPVGTVRSRIFRAREAIDAKVNPLMQQI"
FT   gene            449684..450307
FT                   /gene="rseA"
FT                   /locus_tag="APL_0395"
FT   CDS_pept        449684..450307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseA"
FT                   /locus_tag="APL_0395"
FT                   /product="putative sigma-E factor negative regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73499"
FT                   /db_xref="GOA:A3MZB3"
FT                   /db_xref="InterPro:IPR005572"
FT                   /db_xref="InterPro:IPR005573"
FT                   /db_xref="InterPro:IPR026279"
FT                   /db_xref="InterPro:IPR036147"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZB3"
FT                   /inference="similar to AA sequence:RefSeq:NP_873638.1"
FT                   /protein_id="ABN73499.1"
FT                   /translation="MQQNETLSAFMDGKKVDDAFIDELCESPELKQKWARYHAVSSVLH
FT                   GDEIILGRDFSAKMEALLENEEIESQPSVQETTTAPQGKLIKLKRWSMPLMQAGIAASV
FT                   CLVAVLGVNMMNEKNELAQASQPVLQTQPFSDSVQPVSYNAPSKDVATLDKLESQQHKI
FT                   NALLQAQQLQSKLDVEAMNTSKEKEQKEKAQTSSTDKKSELEKN"
FT   gene            450532..450960
FT                   /gene="rseC"
FT                   /locus_tag="APL_0396"
FT   CDS_pept        450532..450960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseC"
FT                   /locus_tag="APL_0396"
FT                   /product="putative sigma-E factor regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73500"
FT                   /db_xref="GOA:A3MZB4"
FT                   /db_xref="InterPro:IPR007359"
FT                   /db_xref="InterPro:IPR026268"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZB4"
FT                   /inference="similar to AA sequence:RefSeq:NP_873639.1"
FT                   /protein_id="ABN73500.1"
FT                   /translation="MMIETATVVDYQSGIATVQCSAKSACGGCAARNSCGTKSLSALTG
FT                   EKFAPQFKLSVDMPLTVGDKVQIGLPEQTLLLSVFLIYCVPLFVLVLSAVIFSQLFANE
FT                   LFVALFMLISVSMTFWNIRRIMYKKRESEFTPVFLRRL"
FT   gene            450972..452663
FT                   /gene="lcfA"
FT                   /locus_tag="APL_0397"
FT   CDS_pept        450972..452663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lcfA"
FT                   /locus_tag="APL_0397"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73501"
FT                   /db_xref="GOA:A3MZB5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZB5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P46450"
FT                   /protein_id="ABN73501.1"
FT                   /translation="MEKIWLQNYPEGSPKTINVTPYDSLLEMFESAVRKHPDIPAYINM
FT                   GKVLTFRKLEERSRAFAAYLQNELRLEKGDRIALMMPNLLQYPIALFGALRAGLVVVNV
FT                   NPLYTPRELEHQLNDSGAKAIVVVSNFAATLEKIVFETNVKHVILTRMGDQLSFGKRTL
FT                   VNFVVKYVKKLVPKYKLPHAVSFREALSIGKQRQYVKPSLYREDLAFLQYTGGTTGVAK
FT                   GAMLSHGNLVANLMQAKWVAEPLLRNSRECIAVIPLPLYHVFALSVNCLLFIELGITGL
FT                   LITNPRDIPSFVKELKKYKVVALTGVNTLFNALLNNEQFKEIDFSHLKLSVGGGASIQS
FT                   AVAKRWHDATDCHIIEGYGMTECSPLIAATRSDSVEHTGSIGVPVPNTDIRIVDDEGND
FT                   VPIGERGELWVKGPQVMQGYWQRPQDTADVLKDGWMATGDIVVMGEDLNLRIVDRKKDM
FT                   IIVSGFNVYPNEIEEVVAHNPKVNEIVAIGIPSKSSGEAIKIFVTKKDESLTREELRTY
FT                   CRQYLTGYKIPREIEFRDELPKSNVGKILRRVLRDEELAKIKEQQN"
FT   gene            452730..453356
FT                   /gene="upp"
FT                   /locus_tag="APL_0398"
FT   CDS_pept        452730..453356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="APL_0398"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73502"
FT                   /db_xref="GOA:A3MZB6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZB6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VM34"
FT                   /protein_id="ABN73502.1"
FT                   /translation="MKIVEVKHPLVKHKLGLMRAADINTKDFRALATEVGSLLTYEATT
FT                   DLETEAIEIDGWCGKVEVERIKGKKVTVVPILRAGLGMMDGVLEHIPSARISVVGIYRN
FT                   EETLEPVPYFTKLANDVEERLAIIVDPMLATGGSMIATIDLLKKAGCKQIKVLVLVAAP
FT                   EGIKALEAAHPDVELYTASIDSHLNEHGYIVPGLGDAGDKIFGTK"
FT   gene            complement(453463..454332)
FT                   /gene="ksgA"
FT                   /locus_tag="APL_0399"
FT   CDS_pept        complement(453463..454332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="APL_0399"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73503"
FT                   /db_xref="GOA:A3MZB7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZB7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VM33"
FT                   /protein_id="ABN73503.1"
FT                   /translation="MSNQNSKKHLGHTARKRFGQNFLHDMNVIHNIVSAINPKNGQFLL
FT                   EIGPGLGALTEPVAEQVDKLTVVELDRDLAERLRHHPFLNHKLTIIEQDALRFNFREYF
FT                   ESLELREGEGVRVFGNLPYNISTPLMFHLFKFHDLIQDMHFMLQKEVVKRLCAAPNSKA
FT                   YGRLTIMAQYYCQVMPVLEVPPTAFKPAPKVDSAVVRLMPHKVLPHPVKDVYWLNRVTT
FT                   QAFNQRRKTLRNALSTLFSPEQLEALNIDLNARAENLSIADYARLANWLYDNPPAVDNQ
FT                   EEIIDEDI"
FT   gene            complement(454398..455348)
FT                   /gene="surA"
FT                   /locus_tag="APL_0400"
FT   CDS_pept        complement(454398..455348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="APL_0400"
FT                   /product="peptidyl-prolyl cis-trans isomerase SurA"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73504"
FT                   /db_xref="GOA:A3MZB8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZB8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44721"
FT                   /protein_id="ABN73504.1"
FT                   /translation="MKLISAKSLLVALVTAIGISQTAIAIEERVVALVDGVPVMESQVQ
FT                   RALGKKANSEANHKAALEQIIDDLLVQKAVKEAGVKVNYSKVDQVIEDIAARNGITYGQ
FT                   LLDALDYQGITLEQYRQQIAQQMAMEQVRHISIGKSIQVDPKDVHAYAKELLEKDKANG
FT                   KLKNVTGVQHRVSHILIKTTPVLNDIQAKAKLAQIVADIKAGKTTFEEAAKANSVDYLS
FT                   AADGGDLGYNFLDIYDPAFAKAASTAKQEQITAPFKSQFGWHILKVTGTQQGDRTEDAY
FT                   NQRAYEQLVDKQAQEAAKDWVKALRKTADVQYVGK"
FT   gene            complement(455429..455968)
FT                   /gene="pyrR"
FT                   /locus_tag="APL_0401"
FT   CDS_pept        complement(455429..455968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrR"
FT                   /locus_tag="APL_0401"
FT                   /product="PyrR bifunctional protein"
FT                   /EC_number="2.4.2.9"
FT                   /note="Includes: Pyrimidine operon regulatory protein;
FT                   Uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73505"
FT                   /db_xref="GOA:A3MZB9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZB9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VM31"
FT                   /protein_id="ABN73505.1"
FT                   /translation="MEKIIIDAEQFQRTISRISHQIIEKHSSLDNLVLVGIKRRGAEIA
FT                   EMLQSRIAELAQTELPLMALDITFYRDDLHLDHQDPVYTGVESQIDITGKNVILIDDVL
FT                   FTGRTIRAALDALLDFGRATRIELVILVDRGHRELPIRADYVGKNIPTARTEQVQVRTQ
FT                   FYDGMNQVVLIRAKDE"
FT   gene            complement(455984..457414)
FT                   /gene="hldE"
FT                   /locus_tag="APL_0402"
FT   CDS_pept        complement(455984..457414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldE"
FT                   /locus_tag="APL_0402"
FT                   /product="bifunctional protein HldE"
FT                   /EC_number="2.7.-.-"
FT                   /note="pubmed:12798993; Includes: D-beta-D-heptose
FT                   7-phosphate kinase; D-beta-D-heptose 1-phosphate
FT                   adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73506"
FT                   /db_xref="GOA:A3MZC0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZC0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q8GLU7"
FT                   /protein_id="ABN73506.1"
FT                   /translation="MMMQYSPKFNNAKVLVLGDVMLDRYWFGATNRISPEAPVPVVKVQ
FT                   DIEERAGGAANVAMNIASLSVPVALHGLIGQDDAGRALDKLLNSHNIQNHCVALDSHPT
FT                   ITKLRILSRHQQLLRLDFEEGFHHVASDSLLAKLEQEITAYGALILSDYGKGTLESVQQ
FT                   MIQVARKAGVPTLIDPKGTDFERYRGATLLTPNMSEFEAVVGHCKDDDEIVEKGLKLIA
FT                   DFELTALLVTRSEKGMTLLRPNQAPFHLPTQAKEVYDVTGAGDTVISVLATAIADGRPY
FT                   EEACYLANAAAGVVVGKLGTSTVTPTELENAIHHREETGFGILAEDELKRAVEQAKQRG
FT                   EKIVMTNGCFDILHPGHVSYLENARKLGDRLIVAVNTDESVKRLKGESRPINDLNARMA
FT                   VLAGLASVDWVVPFAEDTPQRLIGEILPNLLVKGGDYKPEEIAGSQEVWANGGEVKVLN
FT                   FENGCSTTNVIKKIQASK"
FT   gene            complement(457528..459048)
FT                   /gene="engA"
FT                   /locus_tag="APL_0403"
FT   CDS_pept        complement(457528..459048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="APL_0403"
FT                   /product="GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73507"
FT                   /db_xref="GOA:A3MZC1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZC1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VM29"
FT                   /protein_id="ABN73507.1"
FT                   /translation="MTPVVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGHA
FT                   NIAGYDFIVIDTGGIDGTEEGVEEKMAEQSLLAIEEADVVLFLVDARAGLVPADIGIAQ
FT                   YLRQREKTTVVVANKTDGIDADSHCAEFYQLGLGEVEQIAAAQGRGVTQLIDQVLAPLG
FT                   EQLNADQAVENEENSANEEADEWDTDFDFENEDDTALLDEALEEETEESIEDKNIKIAI
FT                   VGRPNVGKSTLTNRILGEERVVVYDMPGTTRDSIYIPMERDGQQYTIIDTAGVRKRGKV
FT                   NLAVEKFSVIKTLQAIQDANVVLLTIDAREGISDQDLSLLGFILNAGRSLVIVVNKWDG
FT                   LSQDIKDQVKSELDRRLDFIDFARVHFISALHGSGVGNLFDSVKEAYACATQKTSTSML
FT                   TRILRMAADEHQPPLVNGRRVKLKYAHPGGYNPPIIVIHGNQVEKLADSYKRYLSNYFR
FT                   KSLKIIGSPIRIQFQEGNNPFAGKKNKLTPNQLRKRKRLMKFIKKSKK"
FT   gene            complement(459206..460516)
FT                   /gene="hemA"
FT                   /locus_tag="APL_0404"
FT   CDS_pept        complement(459206..460516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="APL_0404"
FT                   /product="glutamyl-tRNA reductase (GluTR)"
FT                   /EC_number="1.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73508"
FT                   /db_xref="GOA:A3MZC2"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZC2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q65SX9"
FT                   /protein_id="ABN73508.1"
FT                   /translation="MTILALGINHKTASVNLRSKVAFDDQKRQLAFEQIQHRALAESVV
FT                   ILSTCNRTELYFHNAEITPREEHEDNIAWREQCFEWFAEIHQLEHNELRECIYFKQNME
FT                   SARHLMRVACGLDSLILGEPQILGQVKQAYQYSENFYQSQNSHISTKLSRLFQRTFSTA
FT                   KRVRSETEIGSSAVSVAYAACGLARQIFDNFGKLRFLLVGAGETIELVARYLIQHGAKN
FT                   IMIANRTPQRAETLAERLNTPMQILSLSALQIGLNQADIVISSTGSPDMLISKEMVEIA
FT                   QKQRQFDPMLLIDIAVPRDIDENAGELDAVYSYSVDDLQHIIQRNMAQREQAAEQAAQI
FT                   VDEECKAFFEWLKQQQSSDLIKRYRQDAEQTRQELLAKALVALTSGQDSEKVLNELSYK
FT                   LTNSLLHVPTQALQAMAKSGNSQGLQSFSKALKLEEQ"
FT   gene            460794..463001
FT                   /gene="relA"
FT                   /locus_tag="APL_0405"
FT   CDS_pept        460794..463001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="APL_0405"
FT                   /product="GTP pyrophosphokinase"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73509"
FT                   /db_xref="GOA:A3MZC3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZC3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44644"
FT                   /protein_id="ABN73509.1"
FT                   /translation="MVAIRRSHELDPSTFELASWSAALQMSPITFEELQIAWRYAHEKL
FT                   DTDTYHLMWDGIEMVEILHGLNMDDDSLVAALLFPLVKNHIIDLAQVKEDFGNQVKNLV
FT                   KGVIEMDNIRQLSANSVSDLQIDNIRRMLLAMVDDFRCVVIKLAERIVYLRGKYRHTEE
FT                   DLVLAAKECSHIYAPLANRLGIGQLKWELEDYCFRALHPQCYRVIALQLGERRLERESY
FT                   IAKFVADLTACLSEQIGDLEVYGRPKHIYSIWKKMQKKNLRFEQLFDIRAVRVIVPNLE
FT                   DCYTALGIIHTQYKHLPEHFDDYIANPKPNGYQSIHTVVLGEDERTIEVQIRTRAMHEN
FT                   AELGVAAHWKYKEGATAGRSGYEEKIVWLRKLLAWQNDIADSGEIMAAEMRSQVFDDRV
FT                   YVFTPKGEVIDLPKNATPLDFAYAIHSEVGHRCIGAKVAGRIVPFTYLLQMGDQVEIIT
FT                   QKNPNPSRDWLNPNAGFVNTSKARAKIIAWFKKLDREKNIPLGKEALEAEMARFGFTYK
FT                   QIEQYALPRYNLKQFDDLYAGIGGGDIRLNQLSHYLQSKLIKPTAEQEDEAVLKQVNKN
FT                   ANNQQHKGKNGQIIIDGVGNLMHTIARCCQPIPGDEIVGYITQGRGISIHRADCEQLFD
FT                   LRSANPERVVNAQWGTHYANGFSLAIRVTANDRNGLLRDVSAVMANEKVNVLSVSSRID
FT                   AKRSLAIMDMSIELNNIEMLGKLLARIAQLDDVIEAKRLSN"
FT   gene            463075..464265
FT                   /gene="dxr"
FT                   /locus_tag="APL_0406"
FT   CDS_pept        463075..464265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="APL_0406"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73510"
FT                   /db_xref="GOA:A3MZC4"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZC4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VM27"
FT                   /protein_id="ABN73510.1"
FT                   /translation="MKKLVILGSTGSIGKSTLSVVEQNKTEYEVFGLVGGKNVELMAAQ
FT                   CLLFQPKFAALDDENAAKALEEQLRQLNVKTEVLSGQKAICELSAHPEVDMVMAAIVGA
FT                   AGLLPTLSAVKAGKKVLLANKESLVTCGQIFIDEARKSGAQLLPVDSEHNAIFQSLPPD
FT                   AQQKVGFCPLAELGVSKIILTGSGGPFRVKPLDEFAAITPAQAVAHPNWSMGKKISVDS
FT                   ATMMNKGLEYIEARWLFNASAEEMEIIIHPQSIIHSMVRYIDGSVIAQMGNPDMCTPIA
FT                   HTMAYPKRINAGVAPLDFFKLKELTFIEPDFARYPNLKLAIDAFAEGQYATTAMNAANE
FT                   VAVEAFLNERIRFIDIVNVNRTVVENIAPVQVKEIADVLHIDKLARELAEQAVINL"
FT   gene            complement(464325..465119)
FT                   /gene="lpxA"
FT                   /locus_tag="APL_0407"
FT   CDS_pept        complement(464325..465119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="APL_0407"
FT                   /product="Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73511"
FT                   /db_xref="GOA:A3MZC5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZC5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VM26"
FT                   /protein_id="ABN73511.1"
FT                   /translation="MRLIDSTAKISPLAVVEEGAQIGAHVEIGPFSVIGKNVKIGAKTV
FT                   IHSHVVINGHTEIGEQNQIFQFASIGEINQDLKYQGEPTKVIIGDRNRIRENVTIHRGT
FT                   VQGGGVTRIGNDNLFMINTHIAHDCSIGNRCIIANNGTLAGHVTLDDFVIVGGMSAIHQ
FT                   FVVIGSHVMLGGGSMVSQDVPPYVMAQGNHAQPFGVNLEGLKRRGFDKPAMHAIRNAYK
FT                   LIYRSGKTIEEAIPEIEQFAVNEPAVQLFLDFFKRSTRGIIR"
FT   gene            complement(465147..465611)
FT                   /gene="fabZ"
FT                   /locus_tag="APL_0408"
FT   CDS_pept        complement(465147..465611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="APL_0408"
FT                   /product="(3R)-hydroxymyristoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73512"
FT                   /db_xref="GOA:A3MZC6"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZC6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VM25"
FT                   /protein_id="ABN73512.1"
FT                   /translation="MTIEVQENREPKIIEVTEIMKMLPHRYPFLLVDRVIDFEEGKWLK
FT                   AIKNVTVNEPCFTGHFPESPIFPGVLILEAMAQATGVLAVATHGKMAQDELYYFAAIDN
FT                   ARFKRPVVPGDQLTFEVEFLKEMRGITKFTGKAFVDGKLVCEADLMCARK"
FT   gene            complement(465680..466705)
FT                   /gene="lpxD"
FT                   /locus_tag="APL_0409"
FT   CDS_pept        complement(465680..466705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="APL_0409"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73513"
FT                   /db_xref="GOA:A3MZC7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZC7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VM24"
FT                   /protein_id="ABN73513.1"
FT                   /translation="MANFRLIELAEQIGGTLRGNADLAISSIAALDKANSSQITFISNA
FT                   KYRPQLAQSQAGAIIVSEADIEFCAESQNLIIVKNPYVAYALLAQYMDSTPKAANSISP
FT                   NAVISSEAILGNNVFVGANAVIESGVELGDDVIIGAGCFIGKNTKIGARTQLWANVSVY
FT                   HNVRIGSDCLIQSSAVIGSDGFGYANDKGQWIKIPQTGGVIIGNRVEIGACTCIDRGAL
FT                   DPTVIEDNVIIDNLCQIAHNVHIGFGTAVAGGVIMAGSLKVGRFCQIGGASVLNGHMEI
FT                   CDGAVITGMSMVMKPITEKGIYSSGIPAQTNKEWRKTAALTMNIDEMNKRLKAIEKRLA
FT                   E"
FT   gene            complement(466705..467511)
FT                   /locus_tag="APL_0410"
FT   CDS_pept        complement(466705..467511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0410"
FT                   /product="hypothetical outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73514"
FT                   /db_xref="GOA:A3MZC8"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZC8"
FT                   /inference="similar to AA sequence:RefSeq:NP_873651.1"
FT                   /protein_id="ABN73514.1"
FT                   /translation="MKKLFKAATVTAALATAGLAQASDTIGFVDPNYLLQNHPVAIDAA
FT                   QKFEKFMKEGQSKFADEDKKLAEENKALTAERNKLESDAKKLQEEQTKVEASLKKKSAA
FT                   LEKDAPRLRSKEIQARQNAIEAEYKAFQNKVSAIQKREADFGKKAEAFQKKADAFQEKL
FT                   NKAQQEAGGMDPQAVQKQVVEEINATVKEVAKSKGYTLVLPPSVALYAEDETKDITEKV
FT                   LEALKAKHPEIKIEQPVANPEVKAEEAKPATDAPQAETTKPEEAKK"
FT   gene            complement(467627..470008)
FT                   /gene="D15"
FT                   /locus_tag="APL_0411"
FT   CDS_pept        complement(467627..470008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="D15"
FT                   /locus_tag="APL_0411"
FT                   /product="protective surface antigen D15 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73515"
FT                   /db_xref="GOA:A3MZC9"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZC9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:O32629"
FT                   /protein_id="ABN73515.1"
FT                   /translation="MQKFLLSSLLIANGVVAAPFVVKDIRVDGVQAETGQAIISSLPVK
FT                   VGQTATDNDVANVVRQLFGQNRFDDVRATREGNTLVIKVAERPFINSVDVEGNSAIPKE
FT                   PLQENLKANLITKGELYDAAKLEGFKQGLLDHYHSIGRYEAKIDTTTTRNENGGINIKL
FT                   NITEGEVAYVKNIKFEGNQVFTDKELTKPLDIQPDVSWWNIFESSKFEQQAYNKDLETL
FT                   RDYYLNRGYAQFALQDTDVTFNDKKTEVDLTYKIHEGVQYNISDIRIIGNTAKLDNELN
FT                   TLLKDFEPGQLFRKSELVEIEEGIKQILGEHGFGSAKVDLYPKFNEQDKTVQINFIVDA
FT                   GRRIYVRKIRFEGNDVTADSTLRREMRQQEGAWLSTTNAALGKSRLERTGFYETVDMTM
FT                   PTVQNTDDQVDLVYKIKERNTGSINFGIGYGTESGISYQAGIKQDNFLGMGSTVSLSGR
FT                   RNDYGTSVNLGYTEPYFTKDGVSLGGNVFYEDYDNSDSNTSAAYKRQTYGINGTLGFPV
FT                   NENNSYYLGLGYTHDKLKNVKREFTREKYVKSMNFPIIDGSNRYERIKADDFDFSFGWN
FT                   YNSLNRGYFPTEGTTANIGGKVTIPGSDNKYYRLNADFRNYYPLNREHKWVISTKAGLA
FT                   YTKGFGGKEVPFYQLYSAGGIGTLRGFAYGAIGPKAIYYSTQSNKFTNASDDVVGGNAM
FT                   ANASLELITPTPFVSDKYQHNVRTSLFVDAASVWNTKWKKSVYPTLPDYKDYKRVRASA
FT                   GIAFQWQSPIGPLAFSYAKPIKKYAGDEIEQFQFSIGSSF"
FT   gene            complement(470070..471383)
FT                   /gene="ecfE"
FT                   /locus_tag="APL_0412"
FT   CDS_pept        complement(470070..471383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecfE"
FT                   /locus_tag="APL_0412"
FT                   /product="putative zinc metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73516"
FT                   /db_xref="GOA:A3MZD0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZD0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44936"
FT                   /protein_id="ABN73516.1"
FT                   /translation="MTSVIAFFILICVLVFVHEYGHFWAARKCGVKVIRFSIGFGKVLF
FT                   KKTDKHGTEFAFSLIPLGGYVQMYNGENEHQARADQTLASKSVLQRAFIIVAGPLANFI
FT                   FAILAYWLVFANGIPTLKPVTGQILPDTIASQAKLPTEFEIKRVASHNVQDWEETTLAL
FT                   IGYVGSDRVEVEGSLVGEDRLQRFYLDLSNWNVDGNKENPLTTLGIRTKSSIVKPEIKQ
FT                   VIENSPAAKAGLQAGDKIVSVNQTPFDWADLVKQVQTGQILELTVEKSDNTYRYSLQPD
FT                   KKDDRYFIGIVPSYEPLADKYRTELKYDILTALWKSVEKVGALVKTILQFIGNLITGEL
FT                   SLKNMGGPISMAKGAGATAEIGWVYYISFMALISVNLGVMNLFPILPLDGGQLILLGAE
FT                   AVRGKPLAEKFQLRFQQIGVFFVLSLMAFAFMNDLIHF"
FT   gene            complement(471390..472259)
FT                   /gene="cdsA"
FT                   /locus_tag="APL_0413"
FT   CDS_pept        complement(471390..472259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="APL_0413"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73517"
FT                   /db_xref="GOA:A3MZD1"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZD1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44937"
FT                   /protein_id="ABN73517.1"
FT                   /translation="MLKERVLSAIVMVIAVLAGIFLLSPLPLTIALAAIITAAMWEWAQ
FT                   FAGFKRSLPRAVVAFVTVCLFILLIFANTNYIRAARFLTDETVPLLFISCVWWLIAFIL
FT                   VVTYPRSANVWAKSVIAKFIFGFCTLIPFFIAALALRFNNYAVDEFQGTYLLLYVCLLV
FT                   WGADSGAYFFGRAFGKHKLAPKVSPGKSWEGAIGGLITSCVIAFLFLELAPSDVFGREL
FT                   STVPFILVSVATVAISVLGDLAESMFKRQANIKDSSNLIPGHGGILDRIDSLTAAIPFF
FT                   TTFFFFVL"
FT   gene            complement(472284..472997)
FT                   /gene="uppS"
FT                   /locus_tag="APL_0414"
FT   CDS_pept        complement(472284..472997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="APL_0414"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73518"
FT                   /db_xref="GOA:A3MZD2"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZD2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VM20"
FT                   /protein_id="ABN73518.1"
FT                   /translation="MNFDPQKMPQHVAIIMDGNGRWAKQQGKLRVFGHQNGVKAVRSAV
FT                   SFAAKHGIKVLTLYAFSSENWSRPEAEVSALMALFMRALDSEVKKLHKNNIRLNIIGNK
FT                   SAFSESLQKRIAESEKLTENNTGLILNIAANYGSHWDITQAAQQLAIKVKLGEITVSDI
FT                   TPERLQNALVTGTQPLVDLLIRTSGEQRISNFLLWQIAYAELVFSPVLWPDFNDDSFSE
FT                   AIIAYQQRDRRFGGC"
FT   gene            complement(473169..473876)
FT                   /gene="gloB"
FT                   /locus_tag="APL_0415"
FT   CDS_pept        complement(473169..473876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="APL_0415"
FT                   /product="putative hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73519"
FT                   /db_xref="GOA:A3MZD3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZD3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P71374"
FT                   /protein_id="ABN73519.1"
FT                   /translation="MLNITPIPALSDNYIWAIQKDNDVIIVDPSDAVPVLAFIAKNQLN
FT                   LTAILLTHNHHDHTDGMPELLSRYPQLSVYGPQEVAQFANRIVQPEDHLTLFDYDVRVI
FT                   ESAGHTAQHVSYLFGNEYLFCGDALFSGGCGRVFTGNYQAQFDALQRFKALPEFVEIFP
FT                   AHEYTLSNLKFAEAVLAPSCALFEIQERAEILRSRNQPTLPTTLERELQINPFLQAVDL
FT                   DQFIALRHQKDNF"
FT   gene            complement(473935..474852)
FT                   /locus_tag="APL_0416"
FT   CDS_pept        complement(473935..474852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73520"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZD4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44554"
FT                   /protein_id="ABN73520.1"
FT                   /translation="MAVYYGLDVGGTKIELAAFNAQLEKLYSERVPTPQTNYEDWLNTV
FT                   ETLVLNADQKFGEQGSVGLGLPGFVNRETGIAEITNIRVADGKAILKDLSERLGREVRA
FT                   ENDANCFALSEAWDPNNQQFSTVLGLIIGTGFGGGFVFDGKIHSGRIGMAGEVGHMQLN
FT                   YHALKLLGWDKAPIYDCGCGNRACLDTYISGRGFEMLFRDLVGETISAKEIIERFYQKE
FT                   SKTIEFVDKYIELMAISIGNLITILDPDMIVFGGGLSNFDHIYEALPKALPPHLMRSAK
FT                   VPVFKKAIHGDSGGTRGAAALFLK"
FT   gene            complement(474855..475559)
FT                   /gene="pgpB"
FT                   /locus_tag="APL_0417"
FT   CDS_pept        complement(474855..475559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpB"
FT                   /locus_tag="APL_0417"
FT                   /product="phosphatidylglycerophosphatase B"
FT                   /EC_number="3.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73521"
FT                   /db_xref="GOA:A3MZD5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZD5"
FT                   /inference="similar to AA sequence:RefSeq:NP_873657.1"
FT                   /protein_id="ABN73521.1"
FT                   /translation="MLLIPLFTWATGWKWTFGGMDYHLYDLDFWLFFLTETGSTPYALI
FT                   TCVLFMLWLMWLTRKHYSWFLVGFICAGSVVGTQIIKEGAKAVFKEPRPFVTEMFQAQT
FT                   EQFYALPEAEQAQAVLTLAEKTHPNDADFIVSHQAGELGYSFPSGHTIFAVSWLLVFGG
FT                   LLFGLSGKAVVFAQIFTILWASLMLISRLRLGMHYPIDLFVSTLIAWLFHIIVFVWVIP
FT                   FLETFKIFQKRG"
FT   gene            complement(475651..476052)
FT                   /locus_tag="APL_0418"
FT   CDS_pept        complement(475651..476052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73522"
FT                   /db_xref="GOA:A3MZD6"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZD6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P71376"
FT                   /protein_id="ABN73522.1"
FT                   /translation="MHFTLKFAPFVLFSTPNFIHKQTTGLKTMSITLTTKQKQFLKGLA
FT                   HHLSPVVMLGGNGLTEGVLAEIENALAHHELIKVKISGAERETKQLIIDAIVRETKAVP
FT                   VQTIGHILVLYRQSEEKKISLPKATKAVS"
FT   gene            476090..476848
FT                   /gene="lgtF"
FT                   /locus_tag="APL_0419"
FT   CDS_pept        476090..476848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgtF"
FT                   /locus_tag="APL_0419"
FT                   /product="UDP-glucose--lipooligosaccharide
FT                   glucosyltransferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73523"
FT                   /db_xref="GOA:A3MZD7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZD7"
FT                   /inference="similar to AA sequence:RefSeq:NP_873659.1"
FT                   /protein_id="ABN73523.1"
FT                   /translation="MPTLSVAMIVKNEAQDLAKCLETVQGWVNEIIVLDSGSSDETVQI
FT                   AESFGAKVYVNTDWQGFGKQRRLAQQYVTSDYVLWLDADERVTPELKRSILQAVEKNEE
FT                   NTVYQVSRLSEVFGKQIRHSGWYPDYVVRLYRTDFAKYGEELVHEKVHYPKNATVKKLT
FT                   GDLLHFTYKDIHHYLVKSASYAKAWAIQRANAGKKASLLDGVTHALGCFVKMYLLKAGF
FT                   LDGKQGFLLAVLSAHSTFVKYADLWNRTRN"
FT   gene            complement(476952..477731)
FT                   /gene="pbpG"
FT                   /locus_tag="APL_0420"
FT   CDS_pept        complement(476952..477731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpG"
FT                   /locus_tag="APL_0420"
FT                   /product="penicillin-binding protein 7 precursor"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73524"
FT                   /db_xref="GOA:A3MZD8"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZD8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44664"
FT                   /protein_id="ABN73524.1"
FT                   /translation="MLKKFLSLLLLSPSLAIAQSYVVYDFTHDRILESRAANNVQPIAS
FT                   VTKLMTANIFLENNKNKNCSASISDQDFDHIKGTGTKLPKHTPIACDELLKAMLVHSDN
FT                   YAAHALSRSAGMSRAQFIQKMNQKAQQLGMRSTRFSDSSGLSSANISSALDLVKLAKYS
FT                   LNNAKIQELSNTKAAYVRVGKRNVFMQNTSALVREELFDAAINKTGYIRESGYNLVFVN
FT                   KHQCNHATIGVISLNNRSSATRSTLPKTNWNSTVAFP"
FT   gene            complement(477815..478852)
FT                   /gene="waaQ"
FT                   /locus_tag="APL_0421"
FT   CDS_pept        complement(477815..478852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaQ"
FT                   /locus_tag="APL_0421"
FT                   /product="heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73525"
FT                   /db_xref="GOA:A3MZD9"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZD9"
FT                   /inference="similar to AA sequence:RefSeq:NP_873660.1"
FT                   /protein_id="ABN73525.1"
FT                   /translation="MKKILVIRNDKIGDFMVCFPAFAMLKQSMPNAEITALVPSYTASL
FT                   AELCPSIDNVIIDTPNKKDKTEFNRVLQAVKNAQFDAVICFVSDWYNAKLTWKSGIKHR
FT                   LAPATKVFQFLYNQRLTQRRSQSAKSESEYNLDLARAFLQKHRIAVVEPNPPYLQFSEA
FT                   QLAQQKAKLAKNLQISTACKWLFVHASTGGSATSLSIEQYAQMLNGIASETNCEIVLTA
FT                   GKGESEKAYQLAAQITATKAVVYDKNDGLQDFARSIACADLFIAGSTGPLHIAGALNVA
FT                   TIGFYPSRLSALPRRWRPINEEGKHLAFMPPEAKEKAQQMNLGLISIPEALKTIVPFVK
FT                   NIWHS"
FT   gene            479096..480427
FT                   /gene="argG"
FT                   /locus_tag="APL_0422"
FT   CDS_pept        479096..480427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="APL_0422"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73526"
FT                   /db_xref="GOA:A3MZE0"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZE0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44315"
FT                   /protein_id="ABN73526.1"
FT                   /translation="MSATILESLPLGQKVGIAFSGGLDTSAALLWMRKKGAVPYAYTAN
FT                   LGQPDEDDYNAIPKKAMEYGAENARLIDCRAQLAHEGIAAIQCGAFHISTGGIPYFNTT
FT                   PLGRAVTGTMLVAAMKEDDVNIWGDGSTFKGNDIERFYRYGLLTNPKLKIYKPWLDQLF
FT                   IDELGGRFEMSQFLIENGFDYKMSVEKAYSTDSNMLGATHEAKDLEELSTGMKIVKPIM
FT                   GVAFWDESVEIKPETVSVTFEEGVPVALNGKRIEDAVELILEANRIGGRHGLGMSDQIE
FT                   NRIIEAKSRGIYEAPGMALLHIAYERLVTGIHNEDTIEQYRINGLRLGRLLYQGRWFDP
FT                   QALMLRETAQRWVAKAITGTVTLELRRGNDFTILNTESPNLTYEAERLSMEKVEDAPFT
FT                   PADRIGQLTMRNLDIVDTRGKLGIYTETGLLSVQNNVLPQLGKK"
FT   gene            480549..481010
FT                   /gene="rnhA"
FT                   /locus_tag="APL_0423"
FT   CDS_pept        480549..481010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="APL_0423"
FT                   /product="ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73527"
FT                   /db_xref="GOA:A3MZE1"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZE1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VM15"
FT                   /protein_id="ABN73527.1"
FT                   /translation="MKLVEIFTDGSCLGNPGKGGIGIVLRYNGHEKQVSKGYLQTTNNR
FT                   MELRAVIEALAMLKEPCQVQLNSDSQYMKDGITKWIFSWKKNNWKTANGKPVKNKELWI
FT                   ALDQEIQRHKIEWTWVKGHSGHRENEICDELAKAGANNPTLEDIGYNAD"
FT   gene            481167..481670
FT                   /gene="cvpA"
FT                   /locus_tag="APL_0424"
FT   CDS_pept        481167..481670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /locus_tag="APL_0424"
FT                   /product="colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73528"
FT                   /db_xref="GOA:A3MZE2"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZE2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45108"
FT                   /protein_id="ABN73528.1"
FT                   /translation="MVDIIVIGLIAFSILVSLWRGFISEVLSLAGWVVAFFVASGFYPY
FT                   LSSYLTQVNSVYLQNSEYLRNGVAAAVLFILTLIVCGIITALLSKLIDTTGLSATDRVL
FT                   GGAFGALRGILIVAAILFFLDTFSSASQTELWKESQLIPHFDFIVKWFFEQLQANSSFL
FT                   NSTK"
FT   gene            481684..483201
FT                   /gene="purF"
FT                   /locus_tag="APL_0425"
FT   CDS_pept        481684..483201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="APL_0425"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73529"
FT                   /db_xref="GOA:A3MZE3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZE3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43854"
FT                   /protein_id="ABN73529.1"
FT                   /translation="MCGIVGIIGGSPVNQAIYDGLTLLQHRGQDAAGIVTIDDENRFRL
FT                   RKANGLVSDVFRQEHMLRLQGNAGIGHVRYPTAGSSSVSEAQPFYVNSPFGLTLVHNGN
FT                   LTNNAELKERLFKEARRHVNTNSDSESLLNIFAHYLDQYPTSHLTPENIFETVRKTNEA
FT                   IRGAYACIAMIIGHGMVAFRDPFGIRPLVLGKRVVEGKTEYMFASESVALDIVGFEFVR
FT                   DVNPGEAVYITFDGELHSAICADNPKLNPCIFEYVYFARPDSVIDGVSVYGARVHMGEL
FT                   LGEKIKREWGRMVDEIDVVIPIPETSNDIAVRIANVLYKPYRQGFVKNRYVARTFIMPG
FT                   QAQRKSSVRRKLNAIASEFKGKNVLLVDDSIVRGTTSEQIVEMARAAGAKKVYFASAAP
FT                   EIRYPNVYGIDMPTCEELVAYDRSVEEVAEMIGVDKLIFQDLEALYKAVQAENPTIQHF
FT                   DASVFTGEYITGDVDKAYLDAIAHARNDKAKAKAAKQATNLEIHNEN"
FT   gene            complement(483270..483728)
FT                   /locus_tag="APL_0426"
FT   CDS_pept        complement(483270..483728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73530"
FT                   /db_xref="InterPro:IPR035279"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZE4"
FT                   /inference="similar to AA sequence:RefSeq:NP_873667.1"
FT                   /protein_id="ABN73530.1"
FT                   /translation="MMRKILFTLVCATLAHTGFANSAENSTAYTEQVKYKISETDIKIL
FT                   IRQLNNIEQCIFPDLAKPDYQKIYDNWSVAENMTMFYFQQNLLTELIGEQNAQFIEKDK
FT                   LSRQYFEQMHEKYNHQKASVDKSRCEDFKPIYAQIKQRIEYSIPQVYK"
FT   gene            complement(483824..485164)
FT                   /gene="gdhA"
FT                   /locus_tag="APL_0427"
FT   CDS_pept        complement(483824..485164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="APL_0427"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73531"
FT                   /db_xref="GOA:A3MZE5"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZE5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P95544"
FT                   /protein_id="ABN73531.1"
FT                   /translation="MSDLNALFQKIKQRDPDQAPFHQAVEEVFGSLAPFLAKNPKYTQQ
FT                   GILERIVEPERVITFRVTWVDDKGQVQVNRGYRIQMNSAIGPYKGGIRFHPSVDLGVLK
FT                   FLAFEQVFKNALTTLPMGGGKGGSDFDPKGKSDAEVMRFCQAFMTELSRHIGADTDVPA
FT                   GDIGVGGREIGYMYGQYKKLRNEFTSVLTGKSLTWGGSLIRPEATGYGAVYFADAMLAT
FT                   HGQGFDGKRVVISGSGNVAQYAAEKAIQKGAKVLTVSDSNGYVLFPDSGMTEKQLADLL
FT                   VLKNERRERLSVYAKEQGVQYFEGQKPWGVKCDIALPCATQNELDGEAAKELVKNGCFC
FT                   VAEGANMPTTLEGVEVFIAAKILYAPGKAANAGGVATSGLEMSQNAMRLAWTREEVDQR
FT                   LFNIMTAIHQNCVENGTETDGYVNYVNGANIAGFKKVATAMLEQGIV"
FT   gene            complement(485468..485812)
FT                   /gene="smpA"
FT                   /locus_tag="APL_0428"
FT   CDS_pept        complement(485468..485812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpA"
FT                   /locus_tag="APL_0428"
FT                   /product="small protein A"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73532"
FT                   /db_xref="GOA:A3MZE6"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZE6"
FT                   /inference="similar to AA sequence:RefSeq:NP_873668.1"
FT                   /protein_id="ABN73532.1"
FT                   /translation="MKMKSLLAIALLAVGVTSCSTVKKVVYRIDVPQGNYLEQEKIDQV
FT                   KVGMDKTQVQYLLGTPMLKDTFNQDRWSYVYIKREGYNDPIQHTLFVNFDSKGLVSNIT
FT                   LDKPITNEAQ"
FT   gene            complement(485883..486884)
FT                   /locus_tag="APL_0429"
FT   CDS_pept        complement(485883..486884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0429"
FT                   /product="nucleoid-associated protein NdpA"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73533"
FT                   /db_xref="GOA:A3MZE7"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZE7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q65R92"
FT                   /protein_id="ABN73533.1"
FT                   /translation="MSINVTEIVLHQIHQTEGETSELNTVLRDNLLAISPEVEQMMLQL
FT                   HQAYQSKAKAYGIFKNESIFAQQLNRLLEQETDFLPFSHSCAKMLSSELAKYPFASGGT
FT                   FILCRYNFLATDYLFIALIDSRTSMLVDDQLEIKRTEYLDITQYDIACRINLTELKINA
FT                   QSNRYLTFIKGRVGRKIADFFMDFLSAEEGLNPQLQNQTLLQAVSDYCDQGELSAPQTR
FT                   EVKKQVFEYCKGQINSGEEIALSELSEALPTLNEVDFAQFTQEQEYGLEENIPPVRNAL
FT                   KTLTKYSGSGKGVTISFNADLLGERLIWDELNDTLTIKGLPANLRDQLARNK"
FT   gene            486977..487366
FT                   /locus_tag="APL_0430"
FT   CDS_pept        486977..487366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73534"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZE8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44839"
FT                   /protein_id="ABN73534.1"
FT                   /translation="MTKVIHTEKAPAAIGPYVQAVDLGNLVLTSGQIPVNPQTGEIPTD
FT                   ITQQARQSLENVKAIVEQAGLSVADIVKTTVFVKDLNDFATVNAEYEAFFRENNHPTFP
FT                   ARSCVEVARLPKDVGLEIEAIAVRK"
FT   gene            487394..488131
FT                   /locus_tag="APL_0431"
FT   CDS_pept        487394..488131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73535"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZE9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44552"
FT                   /protein_id="ABN73535.1"
FT                   /translation="MKNITPNWHALEHIRAFTTVRTGGVSQPPFDSFNLGDHVADNPKD
FT                   VKQNRRLLVEQFGLPHFPLFLTQTHSTRVIRLPYDGDNLEADAVYTDQPNQVCLVMTAD
FT                   CLPVLFYSKDGKEVAAAHAGWRGLCDGVLENTVAEFACSPTDICAWLGPAIGPTKFQVG
FT                   KEVIEQFCAFDPQAEQAFVVDPTASGKFLGNLYQIARQRLRKLGITEISGGEHCTVTER
FT                   EDFFSYRRDKRTGRMASLIWRTE"
FT   gene            488229..488305
FT                   /locus_tag="APL_2052"
FT   tRNA            488229..488305
FT                   /locus_tag="APL_2052"
FT                   /product="tRNA-Met"
FT   gene            488696..489778
FT                   /gene="leuB"
FT                   /locus_tag="APL_0432"
FT   CDS_pept        488696..489778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="APL_0432"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73536"
FT                   /db_xref="GOA:A3MZF0"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZF0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q4QLS3"
FT                   /protein_id="ABN73536.1"
FT                   /translation="MQTYNIAVLAGDGIGPEIMAQAIKVLEATQQKFGFKLNFNHFNIG
FT                   GAAIDAQGKALPENTLKGCEEADAILFGSVGGPKWVHLPPDEQPERGSLLPLRKHFKLF
FT                   CNLRPATLYKGLEKFCPLRADIAAKGFDMVVVRELTGGIYFGQPKGREGEGSQTKAFDT
FT                   EVYYKYEIERIARVAFESAMKRNKKVTSIDKANVLQSSILWRETVSEIAKEYPEVTLEH
FT                   MYIDNATMQLIKAPETFDILLCSNIFGDIISDEAAMITGSMGMLPSASLNEDGFGLYEP
FT                   AGGSAPDIAGKNIANPIAQILSAAMMLRYSFNLNEAADAIEAAIQKALADGYRTGDLAD
FT                   ENTPISTSEMGDIIASNILS"
FT   gene            complement(489902..490297)
FT                   /gene="msrB"
FT                   /locus_tag="APL_0433"
FT   CDS_pept        complement(489902..490297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="APL_0433"
FT                   /product="methionine sulfoxide reductase B"
FT                   /EC_number="1.8.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73537"
FT                   /db_xref="GOA:A3MZF1"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZF1"
FT                   /inference="similar to AA sequence:RefSeq:NP_873723.1"
FT                   /protein_id="ABN73537.1"
FT                   /translation="MIKDIDELTEEQVEILINHGTEMPYSGKFLNENRIGTYRCARCHN
FT                   ALFRSDTKFDAGCGWPSFYEAISDDALRYLDDYSLGRHRTEIRCGNCDSHMGHVFNDGP
FT                   PPTGLRFCLNSIALNFKWDETGEEIDG"
FT   gene            490520..491524
FT                   /gene="gapA"
FT                   /locus_tag="APL_0434"
FT   CDS_pept        490520..491524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapA"
FT                   /locus_tag="APL_0434"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73538"
FT                   /db_xref="GOA:A3MZF2"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZF2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44304"
FT                   /protein_id="ABN73538.1"
FT                   /translation="MAIKIGINGFGRIGRIVFRAAQLRDDIEVVGINDLIDVDYMAYML
FT                   KYDSTHGRFNGTVEVKDGQLVVNGKAIRVTSERDPANLKWNEIGVDIAVEATGLFLDDA
FT                   TARKHITAGAKKVVLTGPSKDATPMFVNGVNFDAYAGQDIVSNASCTTNCLAPLAKVIH
FT                   NKFGIKEGLMTTVHATTATQKTVDGPSAKDWRGGRGASQNIIPSSTGAAKAVGKVLPAL
FT                   NGKLTGMAFRVPTANVSVVDLTVNLEKPATYEEICAEVKRASQEEMKGVLGYTEDAVVS
FT                   TDFNGAVETSVFDAKAGIALTNTFVKLVSWYDNETGYSNKVLDLVAHVYNYKG"
FT   gene            491720..492772
FT                   /gene="mreB"
FT                   /locus_tag="APL_0435"
FT   CDS_pept        491720..492772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="APL_0435"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73539"
FT                   /db_xref="GOA:A3MZF3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZF3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9L6A3"
FT                   /protein_id="ABN73539.1"
FT                   /translation="MFKKFLGLFSNDLSIDLGTANTLVYVKGQGIVLDEPSVVAVRQDR
FT                   IGSLKSIAAVGSDAKLMLGRTPKSITAIRPMKDGVIADFFVTEKMLQHFIKQVHSNNFM
FT                   RPSPRVLVCVPAGATQVERRAIKESAIGAGAREVYLIEEPMAAAIGAGLPVHEATGSMV
FT                   IDIGGGTTEVAVLSLNGIVYSTSVRIGGDKLDEAIVAYVRRHFGSAIGEATAERIKKEI
FT                   AMAIIRDEDEVRKMEVHGHNLAEGAPRTFELNSTHVLEAIEQPLNGIVEAVKSVLEQCP
FT                   PELAADIFERGMVLTGGGALLKNIDVLLSEATGVTVIIADEPLTCVARGGGKALDMIDM
FT                   HGGDVFSSDE"
FT   gene            492889..493938
FT                   /gene="mreC"
FT                   /locus_tag="APL_0436"
FT   CDS_pept        492889..493938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="APL_0436"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73540"
FT                   /db_xref="GOA:A3MZF4"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZF4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44475"
FT                   /protein_id="ABN73540.1"
FT                   /translation="MKPIFAKAPSLGVRLFLAIVISIVLIAFDGRSSAIIQFRNMLETA
FT                   ISGLYYFANTPRSVLDGVSNNFIDNNKLQMENHVLKEQLREKNADLLLLDQLKVENQRL
FT                   RLLLSSPLRQDEYKKIGEVLTAEMDAYRQQVIINRGKSDGAFVGQPIIDEKGVVGQVIS
FT                   VGEKSSRVLLITDVTHAVPVQVLRNDVRGIANGTGHNDELFIDNLPRSVDVIKGDVLVT
FT                   SGLGGRFPEGYPVAIVEAVTNDTQSQFARIVARPLASFDRLRYLLLLWPTGEELRKAQS
FT                   LSPQQVRDVVEERRNSLNPLERLKEKKKEEVKEESKEELLDGSDESINPESQFELDNEE
FT                   NNHTEQGAE"
FT   gene            493938..494426
FT                   /gene="mreD"
FT                   /locus_tag="APL_0437"
FT   CDS_pept        493938..494426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="APL_0437"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73541"
FT                   /db_xref="GOA:A3MZF5"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZF5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44476"
FT                   /protein_id="ABN73541.1"
FT                   /translation="MRTNPLFQILVLLLIFIIAFVLEIMPWPVGLQGLRPSWLVLVLIY
FT                   WALALPNKISVGTAFVAGIVWDLILGSILGIHALVLSIAIYFVAKHHLILRNLSLWLQA
FT                   ILVMLYVILIRFMIFFVELVLHSAEFNTQEILGAIISGILWPWIFLLMRQIRRQLRLR"
FT   gene            494439..495779
FT                   /locus_tag="APL_0438"
FT   CDS_pept        494439..495779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73542"
FT                   /db_xref="GOA:A3MZF6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZF6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45262"
FT                   /protein_id="ABN73542.1"
FT                   /translation="MSSLSFDFSEDFRPLPARMRPRTLAEYIGQAHLIEEGKPLRRAIE
FT                   AGHSHSMIFWGPPGTGKTTLAEIIAHHFDAEVERLSAVTSGVKEIREAIERAKLNRQTG
FT                   RRTLLFVDEVHRFNKSQQDAFLPHIEDGTIIFIGATTENPSFELNNALLSRAKIYILKP
FT                   LQAVEIAQVLTNALYDKERGLGNESYYIEDNVIELLADYVNGDARFALNCLELMSDMAE
FT                   ISSQGKRLNKALLAEVLGERQARFDKGGDRYYDLISALHKSVRGSSPDGALYWYARILT
FT                   AGGDPLYVARRLLAIASEDIGNADPRAMQVAINAWDCYTRVGAYEGERAIAQAVIYLAV
FT                   APKSNAVYNAFNEAKRLAKEGKDYDVPEHLRNAPTKLMKSLGYGEEYRYAHHEPNAYAA
FT                   GENYFPPELKDTVFYHPTERGMEKQIKEKLQWLNAQDQASLQQRYKR"
FT   gene            495860..496645
FT                   /gene="znuB"
FT                   /locus_tag="APL_0439"
FT   CDS_pept        495860..496645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="APL_0439"
FT                   /product="high-affinity zinc uptake system membrane protein
FT                   ZnuB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73543"
FT                   /db_xref="GOA:A3MZF7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZF7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44691"
FT                   /protein_id="ABN73543.1"
FT                   /translation="MFEILFPAWLAGLLLAFITAPLGAFVVWRKMAYFGDTLSHSALLG
FT                   VALGIFLQIDPYIAVIVMTLILAMLLVWLEHKTAYSLDTVLGIIAHCSLSLGVITISLL
FT                   DNVRVDLMSYLFGDLLAIDFNDVVFIGAGTLFIAGVLGYFWKKLLSITISPELAQIEGL
FT                   NVVRLRLLLMLLTALTIALSMKFVGALIITSLLIIPSAIARRFAKTPEAMVGYAIIFSI
FT                   FSITGGLLFSAWKDTPAGPSVVVCAGAIFLLSLFRKEKV"
FT   gene            496824..497621
FT                   /locus_tag="APL_0440"
FT   CDS_pept        496824..497621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73544"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZF8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44098"
FT                   /protein_id="ABN73544.1"
FT                   /translation="MCQLLGMNCNTPTDITFSFEGFRRRAGVTDQHTDGFGIAFFEGKG
FT                   VRIFRDNRPGASSPMADLVGQYHIKSFNVIAHIRKATRGDINLENTHPFIRELWGENWV
FT                   FAHNGTVEGVGVCEECHYQPIGTTDSEAAFCCLVSQLRERFLKKPSEKEIFDAVVEITS
FT                   EIAKHGVFNFILSNGHWMIARCSTNLHYVTRKAPFSTALRDDDVEIDFSKYTTANDKVT
FT                   IITTQPLTKNEKWVKMNNGGYAFFKNGDLIEEIEGTLPEQTHV"
FT   gene            complement(497701..498777)
FT                   /gene="metX"
FT                   /locus_tag="APL_0441"
FT   CDS_pept        complement(497701..498777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="APL_0441"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73545"
FT                   /db_xref="GOA:A3MZF9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZF9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q65U29"
FT                   /protein_id="ABN73545.1"
FT                   /translation="MAHSITLFSEKPLSLILGGMLSPIDVAYQTYGTLNADKSNVVLLC
FT                   HALTGDAEPYKNAPEQGWWQDFIGSGLAFDTARYFFICSNVLGGCKGTTGPSSINTKTG
FT                   KPYGSQFPIITVQDIVEVQKALLDTLGISHLHAVVGGSFGGMQATQWGISYPDFVSNII
FT                   NLCSSLTLSAEAIGFNHVMRQAIINDPHFNHGDYYDGLPPDNGLKIARMLGMLTYRTDV
FT                   QLARAFGREMKQQTEIWGDYFQVESYLSYQGVKFLDRFDANSYLRLLRALDLYDPALGY
FT                   EHEIDALKRIKANYTLVAITSDQLFKQIDVLKSKQRLEAAGVQVDYHEFHSNFGHDAFL
FT                   VDYDFFEPMIRKGLQTET"
FT   gene            499069..499758
FT                   /gene="sanA"
FT                   /locus_tag="APL_0442"
FT   CDS_pept        499069..499758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sanA"
FT                   /locus_tag="APL_0442"
FT                   /product="SanA protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73546"
FT                   /db_xref="GOA:A3MZG0"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZG0"
FT                   /inference="similar to AA sequence:RefSeq:NP_873748.1"
FT                   /protein_id="ABN73546.1"
FT                   /translation="MELTQATESLPKTSLWKRCLSICPRIALVSFAIVFLLSITVFVID
FT                   YATGIYVKDNIYTDIEKLPKHRNAVVLGTSKFYAKGTPNLYYKYRLEAAVQLINKGKAK
FT                   KLLVSGDNKTPYYNEPKVMLNDLYNMGIPKNMIEQDFAGYRTLDSIVRASKVYKLEPFI
FT                   IVSQQFHCERALFIAKYHNINAVCFAAKYPEGHIKVRLREFLARIGMIWDFLVWTKPET
FT                   LDKVKSK"
FT   gene            500018..510061
FT                   /locus_tag="APL_0443"
FT   CDS_pept        500018..510061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0443"
FT                   /product="autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73547"
FT                   /db_xref="GOA:A3MZG1"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZG1"
FT                   /inference="similar to AA sequence:RefSeq:YP_087940.1"
FT                   /protein_id="ABN73547.1"
FT                   /translation="MNKIFKVIWSHATQTFVVVSELTRSKSKAKASVSDVKKNEVSSLI
FT                   TSGFKLSAISSLLISTIPAAYAAVAINNTQGSDINTNGVQVTGSGIAIGSSAGYQQTDG
FT                   YTSNNSAEAKRNVYKLQDIGGTASNNTVSLGTNAYAGGEDSVAIGTRAQAVHNVQTTDM
FT                   AYNSRGSYNAGAVAIGFQSIARGDQTVALGSRAAAYNRQATAIGNDSYAMGVGSVVIGG
FT                   DDSGYAYESINGSHNSPKRPWANNEGNLGYTNLATGFNPSNELNKADYRPSAASGNGAT
FT                   VVGVHSQALSKGSTALGVAATAGDGGKTSSTIKDGQIDGIDRTQNIEATAIGALAHARD
FT                   RNTTAVGHAAKAYSEYSTSIGDDAVAKGKNSSAVGKSSYAQGNYSVAIGNAEDTTNADR
FT                   VNATKVIANGTRAIAIGTTARTNADDTIAFGTRTESTAGGAISIGYEAKSKALDAIAIG
FT                   KGAKALNTNTISIGTGNTVNGANSGAIGDPTVVNGTNSYSLGNNNTIDSNNTFVLGNSV
FT                   KLNTNAKNSTVIGNQNTINLTDVATNNVNTGYVNIQGDHNTINAARGIGILGNENTVDG
FT                   VTHDVFILGNNVKKTANDSVFLGSGSGYVAEDTTTKGLSKIYTSDTVNGKPVNFAGGNV
FT                   TAGVVSVGGVNEKDEKSTRRIQNVAPGLISAQSTDAINGSQLYAVADALKTNIPESKWN
FT                   IKENSTQKDVVNSGDNVSFANGNGTTANVSVSQDETTSTVKYSVNQSNLNVAQDGEVTA
FT                   ANKGDNFATADQVAQAINNSEKTTVINNGTTITATPTTTGTVTTYDLDLSKTTKDDIKQ
FT                   GVDANTTVNTKGITFTADNAGAKTERKLGETLAINGDKALINTTVEAGKVSVAATKKLQ
FT                   DAVVSAESALQEIVTTVNGTTAQTVNKNSNKANFINGKNIELTPSTTGITVATKENVDF
FT                   TTVNATTVNATTVNGDTIKSGNVVINQDGINAGDKKITHVADGNVTNDSKEAVNGSQLY
FT                   ATNQNVTNNTNNIAKNTADIAKGTVYAGDYAKDDSVKNEFTQALGNQTNVVGGASKDDL
FT                   SDNNIGVVSDGVTTLTVKLAKTLEGLTSATFGNDANDHTVINKDGVTITNSTDPNKTVS
FT                   LTDGGLNNGGNKITNVAEGKAGTDAVNVDQLTKAITDSAYNWNISDGTNNTAVPDSGTV
FT                   AVKGSANADSATKSGIVTNLTGTDITVDLSEKAKQELENGQKHSSVEGDSNVLVNVNAT
FT                   LNAAGGTQYDVKLADTVVIGQGDNSVTIDGTSGTVSGLNNLTWDPTENYTGGKAATQEQ
FT                   LKLVSDEVQKGWNVQTNNDPAQKVAPGETVKFKDGKNIKVTNTGKEITIATADNVVTTD
FT                   TDKYVTGGTVVYNDKGEATATLTGNNGAGGAITGVKNNFVTSATTDANGKKATLTRNDG
FT                   GTVDIDLTNTVNQAVTEATDKGTKYAGDKADTGAAANEFGRKLGETTNVKGGAQGELSD
FT                   NNIGVVSNGVDTLTVKLAKALSGLTSATFGSDATDQTVINKDGVTINSTTPDKTVSLTE
FT                   TGLNNGGNKITNVAEGKAGTDAVNVDQLTKAITDSAYNWNISDGTNNTAVPDSGTVAVK
FT                   GSANADSVNTVGVVTELEGTNVKVDLSQKAKDDIANGQKHSSVAGDTNFVVTQTTTNPE
FT                   GGKQYDIKLADKVVIGKDKPVTIDGTNGTVSGLTNTTWDPNTTYTGGQAATQEQLKSVS
FT                   DVVQNGWNIQANTDTATKVAPGDTVKFIDGENIKITRAGNDITVATAKDVKFDSVKVGD
FT                   KVSINNDGINAGDTKVTNVTNGTLAADSKDAVNGSQLYATNQNVTNNAANITKNADNIA
FT                   KGTVYAGDRLDAAVTGKTNNFTRALGEQTNVVGGATGELSDNNLAVISNGTDTLTVKLA
FT                   KSLTDLTNATFGSTDTDKTVINKDGVTISSGKPEKEVSLTDKGLNNGNNQITNVTSGLV
FT                   KRDGSSVELSKAEGDVLTNAVNVGDLKTTVTNLTEEGKGGGFGLTAEDNKDVKADLGKT
FT                   VKVQGDGSVKTTIVEKDGQSALQVGLTENVTVGGQDKPGTITVKGENSKDGVAINSKDG
FT                   SIGLTGAPGKDGQDAQATIKVVDGTKGLDGNNGKDGESKTRIVYEKPNGGGTEEIATLN
FT                   DGLNFVGDKGQVIQKKLNETLAIKGNLDVNATVTDKNLRVDNDKDQNGELIIKMAKSLT
FT                   DLTNATFSSDDSNTVIGGNGLTITPKAGDEVSLTDKGLNNGNNTIINVAPGVNGTDAVN
FT                   KDQLDGVNATANAGWNLTTNGDNTNASNVAPNSTVDLANTDGNIVITKAGNNVTFDLNN
FT                   NLTVGGPGKDGKDGVDGQLGVQGKDGKTGVALNGKDGTIGINGKDGSNGSITVKQGKPG
FT                   VDGKDGETKTRIVYETKDETGKPTTEEVATLNDGLKFVGDTGEVIAKKLNETLAIKGNL
FT                   TATAAVTDKNLRVDNENGRLIVKMAKSLTDLTNATFGSDNSNTTIGGNGVTITPKGGDA
FT                   SNTVSLTDKGLNNGNNQVTNVSTGLKDRDGNNVTLANASGDVLNNAVNVGDLKDSVNNL
FT                   TNATTGGFGLTDEKGNDVKADLGKTVTVQGDGSVKTEVVEKDGKKALQIGLTNNVTVGN
FT                   DKEPGTITVKGENGKDGVSISGKDGISIKGENGQDAVSINGKDGNGAIAVNGKDGKTGV
FT                   GLDGANGTIGINGKDGSNGTITLAKGEPGVDGKDGKTRIVYETKTPDGKTVTEEVATLK
FT                   DGLKFVGDDGKIITKELNETLTIKGNLSTTAAVTDKNLRVDNVDGALIIKMARTLTDLT
FT                   NATFTNAGGDKSVVDGNGLTITPINGGKTVSLTTKGLDNGGNKVINVAAGDVNATSTDA
FT                   VNGSQLYAVSEVANKGWNIQTNGSNTTNVKPGDTVNFANGDNIAITNDGTKVTVGLAKD
FT                   VDLGEDGSIKAGDTLVNNEGVKVGDNVSLTKDGLKAGNVTISATTGINAGDKQITNVAS
FT                   GLGGKKLSEAEGDTLTNAANIGDLQTAVSSVTDASKGGGFGLADDKGANVTQNLGKTIA
FT                   VKGDGKNISTVVKGGALTVNLNKDVDLGKDGSLTIGNTTINSDQVKVGDVTVSSNGKVS
FT                   GVADGDISPNSTQAINGSQLYDANQNIANYLGGGSKLDDKGNVIAPTYTITKVDGNTTT
FT                   ANNVGDAITNLNNEVVKPLTFEGDTGVASKRKLGSTVTIKGGVQDSSKLSENNIGVVSD
FT                   GKGTLAVKLAKDIKVDSVEAKTVNANTVNANTVKAGDTTINSDGVTIKDGPSVTKSGIN
FT                   AAGNRITNVKAGQADTDAVNVSQLKGAVGHVNQRINKVNKELRAGIAGANAAAGLPQAY
FT                   IPGKSMMAVAAGTYKNESALAVGYSRSSDNGKVILKLQGNANTRGDLGGSVGVGYQW"
FT   gene            complement(510370..511068)
FT                   /locus_tag="APL_0444"
FT   CDS_pept        complement(510370..511068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73548"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZG2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P77433"
FT                   /protein_id="ABN73548.1"
FT                   /translation="MDLQNRENFLNKLAQRMGRERKLVPDQMEAPVNNHPTTRLTHLSQ
FT                   QELCNEFMNFAKVLLVDVVETKEADVAQAVLEVCEKYGGGNIVLNNDARLETLGITDAV
FT                   KAKFDSYIWDFTNREENISRSEQANIGIVYGEYGLAESGGIVLFASKDNGRSTSLLPTT
FT                   SIVIVRKSTVLPRVAQLAQILHEKAQAGERMPSCVNIISGPSATADIELIKVVGVHGPV
FT                   SKIYVVIDDL"
FT   gene            complement(511197..512606)
FT                   /gene="ykgF"
FT                   /locus_tag="APL_0445"
FT   CDS_pept        complement(511197..512606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="APL_0445"
FT                   /product="putative electron transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73549"
FT                   /db_xref="GOA:A3MZG3"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZG3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P77536"
FT                   /protein_id="ABN73549.1"
FT                   /translation="MSHLQTSTLPFKQRVEQQVHNDIMRKAVVKAQETIGANRQKMVDE
FT                   LGNWEEWRDLSKQFRNHVLANLDAYLYQLSEKVTQNGGHVFFAETAEEATAYIRKVALE
FT                   KNAKTIVKSKSMVTEEIGLNHVLEAEGMKVVETDLGEYLLQIVGDKPSHIVVPAIHKDR
FT                   HRIRKELHEVLGYEGTEQPEEMNAFVRKTLRKDFLAADIGISGCNFAVPETGSVCLVTN
FT                   EGNLRLATTLPKTHIAVMGMERIAPTFKEVDALITMLCRSAVGAKLTAYNTWLTGPRLE
FT                   GETDGPEDFHLVIVDNGRSKILESEFSEVLRCIRCGACLNTCPAYRQIGGHGYGSIYPG
FT                   PIGSVISPLLGGYEEFKELPYACSLCTACNSVCPVKIPLAQLILKHREKIAEAGLTPFS
FT                   ERLSIKGFTFANSNPSVWNMGVKVGAKIAGKFIKNGKAPIQVGALAEWTKARDLPTADG
FT                   ESFREWFKNRK"
FT   gene            complement(512616..513341)
FT                   /gene="ykgE"
FT                   /locus_tag="APL_0446"
FT   CDS_pept        complement(512616..513341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgE"
FT                   /locus_tag="APL_0446"
FT                   /product="putative dehydrogenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73550"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZG4"
FT                   /inference="similar to AA sequence:RefSeq:NP_873674.1"
FT                   /protein_id="ABN73550.1"
FT                   /translation="MNVNFYVTCIADIVKAGVAKNSVLLLEKLGCNVVFLEKQGCCGQP
FT                   AMNSGYAKQAIPGMKNLIETFEVNDYPIVAPAGSCVYAIKNYAKYLNRFGEPEWAKRAE
FT                   KIAARLYDLTDFIVNVLKRTDVGASLTGKAVYHPSCSLSRKLGIVDEPLTLLKNVKGLE
FT                   LLPIHNQQTCCGFGGTFSVKMAEISGEMVTEKVVNITEVEPEYLVGADVSCLINIAGRL
FT                   NREGKNVKVMHIAEVLMQE"
FT   gene            complement(513511..515106)
FT                   /gene="lctP"
FT                   /locus_tag="APL_0447"
FT   CDS_pept        complement(513511..515106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="APL_0447"
FT                   /product="putative L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73551"
FT                   /db_xref="GOA:A3MZG5"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZG5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q57251"
FT                   /protein_id="ABN73551.1"
FT                   /translation="MALFLSIFPIVLLIYLMVKRNALPSYVALPWVAVVVLIIHLLFFA
FT                   TDITIISANISSAIMSVFTPITVIFGAILFNRFSEASGVTNTLRKWLGTINPNPVAQLM
FT                   IIGWAFAFMIEGASGFGTPAAIAAPILVGLGFNPIKVAILALIMNSVPVSFGAVGTPTW
FT                   FGFGSLNLAEAQILEIGSMTALIHAFAALVIPVIALSFIVTWKEIRQNIVFVYLSVFAC
FT                   VIPYFFLAQVNYEFPSLVGGAIGMFISIFLANKGVGLAKVENTLDNSSVTAKEVAKALL
FT                   PTGLLIGFLIVTRIQQLPFKAMMNNTTAWISTQLGSLGQFEISQGLVFSLKNIFGTTVS
FT                   ANYKLLYVPALIPFVITVLICIPLFALSGSKVKDVFAGSFKQTKNPFIALVGALIMVNL
FT                   MLVGNDGSMVKIIGKSFAAATGEYWTIFASYLGAVGAFFSGSNTVSNLTFGSVQLSTAE
FT                   ITGLSTSLVLALQSVGGAMGNMVCINNIVAVNSVLNIQNQEGAILKKTVLPMFIYGVIA
FT                   AIVALTIIPIFFNV"
FT   gene            complement(515572..515979)
FT                   /gene="hns"
FT                   /locus_tag="APL_0448"
FT   CDS_pept        complement(515572..515979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hns"
FT                   /locus_tag="APL_0448"
FT                   /product="DNA-binding protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73552"
FT                   /db_xref="GOA:A3MZG6"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR027454"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZG6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43841"
FT                   /protein_id="ABN73552.1"
FT                   /translation="MSDILKTLSNIRNLRALAKDSTLEQMESLLEKVSIVVEEKRELVK
FT                   AQELEQAKVMEGLKKYKELLAQDGISAEELVALLNNATEHKKREPRAPRPAKYKYVDEN
FT                   GNEKTWTGQGRTPRPIQKALDEGKSLASFAI"
FT   gene            516537..518054
FT                   /locus_tag="APL_0449"
FT   CDS_pept        516537..518054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0449"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73553"
FT                   /db_xref="GOA:A3MZG7"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZG7"
FT                   /inference="similar to AA sequence:RefSeq:NP_873676.1"
FT                   /protein_id="ABN73553.1"
FT                   /translation="MNLIDYSSSLLSIIPASLALLLAMVTRRVLLSLSVGILVGAFMLS
FT                   ATFADGFVYLKNIAIGLVYADGEYSFGKVQILIFLLLLGVFTSLLTYSGSNQAFANWAK
FT                   KHIKGRRGAKLLTACLVFVTFIDDYFHSLAVGAIARPVTDKFKVSRAKLAYILDSTAAP
FT                   MCVLMPVSSWGASIIATIGGLLATYNITEYTAISAFASMSLMNYYALFALIMVFIVAYF
FT                   SFDIGSMSRFERKALASETHTNEDTDVESKGRVYALIVPILVLIVTTVTSMIYTGAQAL
FT                   EAFSLLGAFENTNVNLSLVIGGSAGVLAVMLCTLGLIKAEDYPKAIWVGCKSMFGAILI
FT                   LTLAWLISSVVKDMHTGDYLSTLVAGNINPAFLPAILFVLATVMAFATGTSWGTFGIML
FT                   PIAAAMAINVDASLLIPCMSAVMAGAVCGDHCSPISDTTILSSTGAQCNHIDHVTSQLP
FT                   YALLVAVASIIGYLVLGFTGSAVSGFITTAVVMMVLIFIFRSKKMTA"
FT   gene            518260..519231
FT                   /gene="mglB"
FT                   /locus_tag="APL_0450"
FT   CDS_pept        518260..519231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglB"
FT                   /locus_tag="APL_0450"
FT                   /product="D-galactose-binding periplasmic protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73554"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZG8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44883"
FT                   /protein_id="ABN73554.1"
FT                   /translation="MKKLAICSLAVGISLSSSVIAQDTLGVSLYQYDDNFIRLMHDELI
FT                   SYTSENPSLSLLMNDAQNSQFVQNNQVQTLVNHKVDVLAVNLVDPNAWATVIGKAKDAN
FT                   LPIILFNKDPGAKAINSYKKVYYVGSNPEEAGKAQAKMIANHWKSSEALDLNHDGKMQY
FT                   AVLKGEVGHPDAEKRTKAVIEELKTQGIKTEQLALESAVWNKEIAKAKVNAWLSTPQNN
FT                   IEVIISNNDSMAIGALEVVTEKDKALPIYGVDATPEALNLIRKGKLAGTVTNDWRSQSR
FT                   AIIDFSRLLAKGELPENSQWKLENRVLRIPAMSIDRSNISDF"
FT   gene            complement(519366..520238)
FT                   /gene="sucD"
FT                   /locus_tag="APL_0451"
FT   CDS_pept        complement(519366..520238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="APL_0451"
FT                   /product="succinyl-CoA ligase [ADP-forming] subunit alpha"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73555"
FT                   /db_xref="GOA:A3MZG9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZG9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45102"
FT                   /protein_id="ABN73555.1"
FT                   /translation="MAILIDKNTKVICQGFTGGQGTFHSEQALAYGTKLVGGVSPNKGG
FT                   TTHLGLPVFDTVREAVEKTGATASVIYVPAPGCKDAILEAIDAGIQLIVCITEGIPTLD
FT                   MICVKQKLKESGVRMIGPNCPGIITPDECKIGIMPAHIHKKGKIGIVSRSGTLTYEAVK
FT                   QTTDEGFGQSTCVGIGGDPIPGSSFIDILKLFQADPETEAIVMIGEIGGSAEEEAAEFI
FT                   KMHVTKPVVSYIAGVTAPKGKRMGHAGAIISGGKGTADEKFKTLENAGVKTVRSLAEIG
FT                   SALRELLHK"
FT   gene            complement(520241..521407)
FT                   /gene="sucC"
FT                   /locus_tag="APL_0452"
FT   CDS_pept        complement(520241..521407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="APL_0452"
FT                   /product="succinyl-CoA synthetase beta chain"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73556"
FT                   /db_xref="GOA:A3MZH0"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZH0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9CNZ0"
FT                   /protein_id="ABN73556.1"
FT                   /translation="MNLHEYQAKQIFAQYRLPVSKGIVCHSLDDAVSAIHTLAGDTWAA
FT                   KCQVHAGGRGKAGGVKLVRSEAEIREFCNQWLGQRLVTFQTDKNGQPVNTIYLEETCLI
FT                   ERELYLGAVIDRSSQKIVFMASNAGGMNIEDVAAQTPELIHKATIDPLTGAQAFQGREL
FT                   AFKLGLSGDQIKQFAHLFVQLAKLFIEKDLALLEVNPLVLTKQGQLLCLDAKMVIDSNA
FT                   LYRHPELKALQDPSQEDAREADAAKWDLNYVALDGNIGCMVNGAGLAMGTMDIVKLHGG
FT                   RPANFLDVGGGATKERVSEAFKLILSDQNVKAVLVNIFGGIVRCDLIAEGIIAAVNEVG
FT                   INIPVIVRLEGTNAELGREILANSGLRLIAANTLTQAAQLAVKAAEGK"
FT   gene            complement(521551..522417)
FT                   /locus_tag="APL_0453"
FT   CDS_pept        complement(521551..522417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73557"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZH1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q57273"
FT                   /protein_id="ABN73557.1"
FT                   /translation="MTYYYPTANNVYPDQPHKSYRLRRFRFWLRSVLHASQVKKFSRFA
FT                   NRHPELSELLKAYPNYSYPVIHRFLDKRFNAERRLEIVCDNLTFLPQQFAQYHLPPLWV
FT                   KPISFGEFIPDFEIRLNINEYQAMEGFWALELRQKSSRRLVYLLTFGKIEQSLLIGAIQ
FT                   GANTENAKDLVKFLTKQCHGLRPAYLLIEVMKLLAHTLGYQLLGIPHKYQNKSRFIQSK
FT                   RYTVNYDTLFSESGGLLQEYWQLPLALNKDLTDVPSKKRSMYRKRFEMLDKLADVIQQT
FT                   FPLPPSS"
FT   gene            complement(522560..523789)
FT                   /gene="sucB"
FT                   /locus_tag="APL_0454"
FT   CDS_pept        complement(522560..523789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="APL_0454"
FT                   /product="dihydrolipoyllysine-residue succinyltransferase
FT                   component of 2-oxoglutarate dehydrogenase complex (E2)"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73558"
FT                   /db_xref="GOA:A3MZH2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZH2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45302"
FT                   /protein_id="ABN73558.1"
FT                   /translation="MTIEILTPVLPESVADATVATWHKKVGDTVKRDEVLVEIETDKVV
FT                   LEVPAPNDGVLAEISQEQGATVTSKQLLGKISTVQAGDFTQETIKQTNEATPADRKSAA
FT                   IEYDHSDADSQGPAIRRLLAEHNIEAHLVKGTGVGGRITREDIEHYLAQRQVQETKQAM
FT                   ASEHNTVSTVAYSARSEKRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMSLRK
FT                   TYGEKFEKQHGVRLGFMSFYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPR
FT                   GLVTPVIRNCDKLSMADIEKTIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTP
FT                   IINPPQSAILGMHAIKDRPVAVNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLL
FT                   EDPTRLLLEI"
FT   gene            complement(523909..526719)
FT                   /gene="sucA"
FT                   /locus_tag="APL_0455"
FT   CDS_pept        complement(523909..526719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="APL_0455"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73559"
FT                   /db_xref="GOA:A3MZH3"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZH3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45303"
FT                   /protein_id="ABN73559.1"
FT                   /translation="MQHKNFEDWLASSPFGGSNQTYVEEIYEQYLENPANVDASWRVIF
FT                   DTLPKTQVVEQPHSQVRDYFRKLARENVPESVTVIDPEASAKQVRLLQWINAHRFRGYL
FT                   EAKLDPINYYRWKISVVPELDYRHHGFTEADLNETVTIGKYVYGKETMKFGELADALKQ
FT                   TYLGTIGLEFMHVQDMEQRNWLQAKIESTLNKPLFTHTEKVNLLTELTAADGLERYLGA
FT                   KFPGAKRFSLEGSDAFIPMMKEIIRHAGRQGMKDVVMGMAHRGRLNMLVNVLGKRPAEL
FT                   FDEFAGKHADDNRTGDVKYHQGFSSDFDVDGERVHLTLAFNPSHLEIVSPVVIGSVRAR
FT                   QERIRDTEHNKVLAVTVHGDSAVAGQGVVQETLNMSNARGYKVGGTIRIVINNQIGFTT
FT                   SNPNDTRSTEFCTDIAKMIQAPIIHVNGDDPEAVAFAARMAVEYRTLFKRDIFIDLISY
FT                   RRHGHNEADEPLATQPMMYSIIKKHPTPRKVYADRLVAEGVLNQDQATEIMNNYRDALD
FT                   NGDRVVPEWREMDMAAVDWLQYLNYDWTAPYESKFPQDRFYTLAKRVCEYPESLRPHSR
FT                   VEKIYSDRKEMYEGKKLLDWGMAETMAYATLLDEGTHVRLSGEDAGRGTFFHRHAVVHN
FT                   QNDGTGYVPLAHLHANQGRFEVWDSVLSEEAVLAFEYGYATTDPKTLTIWEAQFGDFAN
FT                   GAQIVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAQQNMQVCV
FT                   PSTPAQAYHMLRRQAIRKMRRPLVAITPKSLLRHPLAVSSLEELTEGEFQNVIGEIDSN
FT                   IAAKKVKRVVMCSGKVYYDLLEQRRQNEQTDIAIIRIEQLYPFPYEDMKKVLEPYAHVK
FT                   DFVWCQEEPQNQGAWYCSKHNFEASIPEKAKLTYAGRPASASPAVGYTSLHAQQQKQLV
FT                   DDALTL"
FT   gene            complement(526962..527762)
FT                   /gene="znuC"
FT                   /locus_tag="APL_0456"
FT   CDS_pept        complement(526962..527762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="APL_0456"
FT                   /product="high-affinity zinc uptake system ATP-binding
FT                   protein ZnuC"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73560"
FT                   /db_xref="GOA:A3MZH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZH4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44692"
FT                   /protein_id="ABN73560.1"
FT                   /translation="MQIKRLTPVPKEKSKGHPLVQLQQIEVSFNEQKVLHNINLAIYAN
FT                   SITTIVGPNGGGKSTLLKVLLKLLTPDSGKVIHQKGLKIGYVPQKLHLDHSMPITVWKF
FT                   LSLKPDATTQAIQEALSLFSITHLAQNSMQKLSGGELQRVLLARAVLNKPHLLVLDEPM
FT                   QGVDITGQTELYQLLNNTRSWLNCAILMVSHDLNIVMANTDEVLCVNKHICCAGTPEMV
FT                   TNDPHFIHFFGDQFAKNVAFYSHHHNHHHNLHGDVCSGQCECQH"
FT   gene            527966..529456
FT                   /locus_tag="APL_0457"
FT   CDS_pept        527966..529456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0457"
FT                   /product="hypothetical metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73561"
FT                   /db_xref="GOA:A3MZH5"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZH5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44693"
FT                   /protein_id="ABN73561.1"
FT                   /translation="MAILSIFIGIVLALKNQPSINTTANYEQYVVLDEQQADQKDDPEQ
FT                   PEETTQLTSAEDQKQAADKTSTNNVNTEANEEVSEDEKNSELTAEDNSATSYDDLLAED
FT                   DEVEGQEGEISKVENKENEEKLPQEAEKVLNDILDVADEALRIQDQFSYTVGRGDKLKD
FT                   VLEQSGLGASDARAMIKRFPELANLDGGQQFYWILDNHGELEYMNWLVSEKEERIYERK
FT                   DNGKWVFQKIEKKGEWRQDVVRGVISGSFSSSLKEVGLSERQVNQLAVGLQSQIATNKL
FT                   KKGDRFAILVKREYINGTVTEVGNVEGILIVSDKKRYYAIQADNGRYYSSHGETLSRGF
FT                   ARIPLLFNARVSSHYNPRRLHPVTRRVRPHNGVDFGIPTGTPIIAPSDGVVEHIAYQAK
FT                   GAGRYIKIRHGHITTVYMHLSKTLVRVGQSVKKGERIALSGNTGASTGPHLHYEFHLNG
FT                   RPVNPMTVKLPGSNSGMADKERKKFLTRAKYVEAKLKF"
FT   gene            529475..530170
FT                   /gene="dsbC"
FT                   /locus_tag="APL_0458"
FT   CDS_pept        529475..530170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="APL_0458"
FT                   /product="thiol:disulfide interchange protein DsbC
FT                   precursor"
FT                   /EC_number="5.3.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73562"
FT                   /db_xref="GOA:A3MZH6"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZH6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45111"
FT                   /protein_id="ABN73562.1"
FT                   /translation="MKKNVTALFSVSLMGLCVSPVMADDMSLVKTLEGMGATNVKISDS
FT                   ALPGFRTAVSSEGVVQISENGRFVIQGQIFELKNGKAVNITNKSLLADLNALEKEMIIY
FT                   PAKNEKHVVTVFMDITCHYCHLMFQRIKEYNDLGITIRFLAFPRGGMNTQTAKQMEAIW
FT                   TSADKVKALTDAENGTLPKEVKTPNIVKKHYELGIKFGVTGTPNMVDSTGQLIAGYVEP
FT                   KELLKMLSE"
FT   gene            530220..531977
FT                   /gene="recJ"
FT                   /locus_tag="APL_0459"
FT   CDS_pept        530220..531977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="APL_0459"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73563"
FT                   /db_xref="GOA:A3MZH7"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZH7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45112"
FT                   /protein_id="ABN73563.1"
FT                   /translation="MIPLVLFITKRRKIVQKLIKQRPPLTSVTLSENPLLNRLYQSRGI
FT                   NSVQELERSLQYLYRPQQLANIEQAVSLLIDAFKQQSRIVIVGDFDADGATSTALTILA
FT                   LRQLGFKNVDYLIPDRFSQGYGLSVAVAEMVLAKGADLVITVDNGISSFEGIALLKLHH
FT                   IKVLVTDHHLPAETLPNADAMVNPNLADCSFPSKSLAGVGVAFYVMLALRSQMREAQLF
FT                   SLKEPNLAELLDLVALGTVADVVPLDHNNRILVHQGLTRIRSGHCRAGIRALAEVSKRE
FT                   LSSLQAGDLGFAIAPRLNAAGRLENMSLGVELLIAENMEIARQLAFELDSLNQTRKEFE
FT                   QEMKTEALAICANLPSLMQKDQAHGIALYQADWHQGVIGILASRIKDQFHRPVIAFAQE
FT                   SENSEYLKGSARSIAGLHMRDLLERIDVKHPNLIVKFGGHAMAAGLTIHQNNFLKFQHI
FT                   FDEVIDEIIAPEQLQGVIYTDGELSSNELNIHIAELLQKAGPWGQSFPEPLFEGEFKIL
FT                   QQRILGGKHLKLMVEQPFGGLFDAIWFNADLRIFPDLSIKSARLIYKLDINEFKGNKNL
FT                   QLRIENIVI"
FT   gene            532111..532962
FT                   /gene="plpD"
FT                   /locus_tag="APL_0460"
FT   CDS_pept        532111..532962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plpD"
FT                   /locus_tag="APL_0460"
FT                   /product="lipoprotein Plp4"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73564"
FT                   /db_xref="GOA:A3MZH8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZH8"
FT                   /inference="similar to AA sequence:INSD:AAC32565.1"
FT                   /protein_id="ABN73564.1"
FT                   /translation="MKNTTVFRGLLLSGIALAVTACGNLSNVTDEGTTENPVFPKISES
FT                   EFNHDGSQFGSWPNWENVRQIERGMNKDQLYNLIGRPHFEEGLYGVREWDYAFNYRENG
FT                   VHKICQFKVLFDKDMNAQSFFWYPNGCNGNASFNLSGDFLFDFDKDTLTAKGKEVVDNV
FT                   AAQLKSSKAEQVKVAGYTDRLGSEKYNLDLSQRRANMVKARLVQQGVTANINAVGYGKA
FT                   QQVKACDGIPHGQELKDCLRPNRRVEVTANGGVLKQNEGGNVAGPNGPAPLYQTPAYNS
FT                   GK"
FT   gene            533044..533862
FT                   /locus_tag="APL_0461"
FT   CDS_pept        533044..533862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0461"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73565"
FT                   /db_xref="GOA:A3MZH9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZH9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P21829"
FT                   /protein_id="ABN73565.1"
FT                   /translation="MTYQAIAFDLDGTLLNPHATILESSKQAIKKAREKGIKVFFVTGR
FT                   HHTAVRPYYAEIGLDTPVVCCNGTYLYDFQHDKVLSGKPLTAEQASHLINDAKSQGIHT
FT                   AVYFRDAMTYEQLNPHFAKLQQWVASCPESVRPNVYQLESFQQEIDKGTTVWKVLISDP
FT                   NLEKMQNFVKKLPLDQFSPEWSWVDRVDITSVGNSKGAMLAELLKMEGLEPQNVIAFGD
FT                   NFNDISMLELVGLGIAMGDSEEEVKQRADKTIGSNSEDSIAKTLTELLNL"
FT   gene            533862..535577
FT                   /gene="narQ"
FT                   /locus_tag="APL_0462"
FT   CDS_pept        533862..535577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narQ"
FT                   /locus_tag="APL_0462"
FT                   /product="sensor protein NarQ-like protein"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73566"
FT                   /db_xref="GOA:A3MZI0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042295"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZI0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44604"
FT                   /protein_id="ABN73566.1"
FT                   /translation="MNKPVNYSKYSIARRIGFYFLVMIAFASLISGISLSIMWSNKSDA
FT                   GLINVSGSLRMQSYRFLYEMEHHPQSIPARLAEYRQSLNSPEIQNSLEHKCLLPKEVTE
FT                   AYAKLQKNWLEMESFIVKRDRNAYEANIEGYANQVNNFVWQLQEFVELKLKVAIGVIAV
FT                   SMLLIIALAYFGVWYTRKRIITPLNQLVTASRQVKNEDFDHIRLAVDDPNELGLLSSAF
FT                   TQMASELAKLYASLEEKVEDKTRRLMAVNRSLLVLFQCSQLLTAKPVNQSVLFKVLQTI
FT                   LDNEQLRGIEIQVYGADYWNVTIDNAPEQDWQFNEIAIENEKLALLRWKPSLLCPDERL
FT                   IQNVSEMIGRSLYVLQVQKQQQQLLLMEERSIIARELHDSLAQSLTFFKIQVSLLKRNG
FT                   EVKQDWDKQKAILNDFEKALNEAYSQLRELLSTFRLTIEEANLTHALERVLDSLRIRTS
FT                   AQIRLNCKLPSQIFSAQQQVHALQIVREAVINAIKHANATEIYVVAETNADGEHCLIIR
FT                   DNGKGIASDIEPEGHYGLTIMKERAAELKGEFSIKNRPEGGVEVVVVLPNMITA"
FT   gene            535600..536118
FT                   /locus_tag="APL_0463"
FT   CDS_pept        535600..536118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0463"
FT                   /product="predicted sortase and related acyltransferases"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73567"
FT                   /db_xref="GOA:A3MZI1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZI1"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00732095.1"
FT                   /protein_id="ABN73567.1"
FT                   /translation="MQIRKSTEADFETILNIYNQAIPTHQITADLELATPINRRAWFDF
FT                   HLTSEQYPIWTVEDENGIAGWFSFSPFYERPAFVHTSEISIYLDSSAKGKGYGSKIIEF
FT                   MQTEMLKHNIHTLMAYVFELNQVSQNLMRKHGFEQWGRFPHIANMGKDEQGQDKWRTLL
FT                   MMSYQKGIE"
FT   gene            536159..536755
FT                   /locus_tag="APL_0464"
FT   CDS_pept        536159..536755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0464"
FT                   /product="HAM1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73568"
FT                   /db_xref="GOA:A3MZI2"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZI2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VLS3"
FT                   /protein_id="ABN73568.1"
FT                   /translation="MERTKVVLATGNKGKVKEMADVLAQFGFDVVAQSEFGIESPEETG
FT                   LTFVENALLKARYASKMTGLPAIADDSGLAVDALGGAPGLYSARYAGEDSNDEANRQKL
FT                   LAELQNVADEKRGAKFVSCIVFLQHETDPTPKIALGECFGEILREERGQNGFGYDSLFF
FT                   YPPKNCSFAELETSEKKQISHRAIALDVLKQQLLK"
FT   gene            536783..537103
FT                   /locus_tag="APL_0465"
FT   CDS_pept        536783..537103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73569"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZI3"
FT                   /inference="similar to AA sequence:RefSeq:NP_873774.1"
FT                   /protein_id="ABN73569.1"
FT                   /translation="MIITTTPTIDGHQITEYKGLVFGEVVSGANFIRDFFASITDVIGG
FT                   RSGAYESKLNSARQEALAELEKEAKRVGANAVVGVSMEYQSMGGDKGMFIVVATGTAVV
FT                   IR"
FT   gene            complement(537209..538879)
FT                   /gene="fhs"
FT                   /locus_tag="APL_0466"
FT   CDS_pept        complement(537209..538879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="APL_0466"
FT                   /product="formyltetrahydrofolate synthetase"
FT                   /EC_number="6.3.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73570"
FT                   /db_xref="GOA:A3MZI4"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZI4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VLW6"
FT                   /protein_id="ABN73570.1"
FT                   /translation="MKSDVEIAQAATMQPIHKIAEKLGLNADQIEQYGKYKAKINPTDA
FT                   FKLPAKNGKLILVTAINPTPAGEGKTTVTIGLTDALNQLGKNAVVAAREPSLGPVFGVK
FT                   GGAAGGGYAQVLPMEDINLHFTGDFHAITSANNLLAALLDNHIYQGNALNIDTKRVLWR
FT                   RVIDMNDRQLRNVLGGLGNPTDGVIRPDGFDITVASEVMAIFCLAKDLADLKTRLGNIL
FT                   VAYTKDKQPVYAKDLNAHGAMAALLKDAIKPNLVQTIEGSPAFIHGGPFANIAHGCNSV
FT                   TATRLALHLGDYAVTEAGFGADLGAEKFCDIKCRLADLKPDVAVVVATVKALKYNGGVE
FT                   KANLAEENLTALQQGLPNLLKHISNLKNVFGLPVVVALNRFVSDTDAELALIQTACAKQ
FT                   GVEVSLTEVWGKGGAGGVDLAQKVLKAIDEQENRFNFVYDVNESVQNKIKAIAQKIYGA
FT                   DDVNFSAEALAEIKNLEKLGLDKLPICMAKTQYSLSDNAKLLGCPSGFTVTVRSISVSA
FT                   GAGFIVAICGSIMRMPGLPKVPAANRIDVDENGLITGLF"
FT   gene            538989..539435
FT                   /locus_tag="APL_0467"
FT   CDS_pept        538989..539435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73571"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZI5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44168"
FT                   /protein_id="ABN73571.1"
FT                   /translation="MTNQLTPNFWQTKSLLEMNDAEWEALCDGCGKCCYRKYIQGRGKR
FT                   ERLYYTSVACNLLDVDNGRCTNYPNRFKIERDCTKLTKKNLPDFGWLPKTCAYRLLYEG
FT                   KPLFDWHPLISNDPQSVKKANILIPNGIHEKDVIDWFEFVIDEV"
FT   gene            539525..540274
FT                   /locus_tag="APL_0468"
FT   CDS_pept        539525..540274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0468"
FT                   /product="probable NADP-dependent dehydrogenase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73572"
FT                   /db_xref="GOA:A3MZI6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZI6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45200"
FT                   /protein_id="ABN73572.1"
FT                   /translation="MKTALVTGATAGFGLAICKLLIQSGYKVIGTGRRKERLDELHSQL
FT                   GNNFLPLAFDVSDDAATTQALNNRPAGWQAVDLLVNNAGLALGLEPAYKTDLKDWYQMI
FT                   DTNIKGLVTVTRLILPEMVERNSGHIINLGSIAGNYPYPGGNVYGGTKAFVKQFSLNLR
FT                   ADLAGTKVRVTNVEPGLCGGTEFSNVRFKGDDDKAAKVYENVNYVAPEDIANIVLWLNQ
FT                   QPEHVNINRIEVMPTAQTFSPLAVARG"
FT   gene            540457..541647
FT                   /gene="trpB"
FT                   /locus_tag="APL_0469"
FT   CDS_pept        540457..541647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="APL_0469"
FT                   /product="tryptophan synthase beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73573"
FT                   /db_xref="GOA:A3MZI7"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZI7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43760"
FT                   /protein_id="ABN73573.1"
FT                   /translation="MSDTLLNPYFGEFGGMYVPEILVPVLKQLEEAFVAAQNDPLFQAE
FT                   FTDLLKNYAGRPTALTLCRNLTKGSKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGK
FT                   TRIIAETGAGQHGVATALACAMLDLPCVIYMGAKDVERQSPNVFRMRLMGAEVIPVQKG
FT                   SCSLKDACCEAMRDWAANYETTHYLIGTAAGPHPFPTMVREFQKMIGEETKRQILEKEN
FT                   RLPDAVIAAVGGGSNAIGMFADFIEEKSVQLIGVEPAGKGIETGEHGAPLKHGTTGIYF
FT                   GMKSPIMQTKDGQIEESYSISAGLDFPSVGPQHAYLNSIGRAEYVSITDQEALDAFQAL
FT                   AQHEGIIPALESSHALAYALKLIAQNPDKEQLLVVNLSGRGDKDIFTVDKILNGGN"
FT   gene            541649..542458
FT                   /gene="trpA"
FT                   /locus_tag="APL_0470"
FT   CDS_pept        541649..542458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="APL_0470"
FT                   /product="tryptophan synthase alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73574"
FT                   /db_xref="GOA:A3MZI8"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZI8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43759"
FT                   /protein_id="ABN73574.1"
FT                   /translation="MSRFDTLFANLKAKNEGAFVPFVTLCDPDFDCSFEIIETLIANGA
FT                   DALELGFPFSDPLLDGPVIQAANKRALDGGYSTDACFEMIAKIRSKYPEIPIGLLLCAN
FT                   LVFVPTQDVFFKRCAETGVDAVLIADVPVLAAEEFTQAAKKHGIQSVFICPPNADQATI
FT                   ERIARLTEGYTYLVSRAGVTSAENQAHAKNLDNLIESLKRSNSAPILQGFGIAKPEQVK
FT                   EALVLGCDGAISGSAIVKIIERNLDSQTQLLSELAKFVSVMKAATKS"
FT   gene            complement(542535..542828)
FT                   /locus_tag="APL_0471"
FT   CDS_pept        complement(542535..542828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73575"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZI9"
FT                   /inference="similar to AA sequence:RefSeq:YP_154608.1"
FT                   /protein_id="ABN73575.1"
FT                   /translation="MQNIEKWENRELGQDEKFVQRSTHTTPEMLDELLALQPISIRLSK
FT                   GLIQDLKDIAQLHGLGYQPLIKQILTRFVESEKRMLANEKIQEDLAKLHNAA"
FT   gene            complement(542837..543121)
FT                   /locus_tag="APL_0472"
FT   CDS_pept        complement(542837..543121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73576"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZJ0"
FT                   /inference="similar to AA sequence:INSD:ABC41157.1"
FT                   /protein_id="ABN73576.1"
FT                   /translation="MLIISHQIYLKLIQKHRLSDPETEILEAFSNVNGQFLIDTREEHL
FT                   SEPPTEWFIAETNRGIKLKVCFIRKNNDIYIRTAYRPNAEEIRIYEKYK"
FT   gene            543301..546174
FT                   /gene="polA"
FT                   /locus_tag="APL_0473"
FT   CDS_pept        543301..546174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="APL_0473"
FT                   /product="DNA polymerase I (POL I)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73577"
FT                   /db_xref="GOA:A3MZJ1"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZJ1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43741"
FT                   /protein_id="ABN73577.1"
FT                   /translation="MATIAQNPLVLVDGSSYLYRAFHAFPPLTNKNGEPTGAMYGVLNM
FT                   LKSLVAQVEPSHIAVVFDAKGKTFRGELFEQYKSHRPPMPDDLRAQVQPLHTIIKALGI
FT                   PLISIEGVEADDVIGTLAVQAANAGKNVLISTGDKDMAQLVNDHIMLINTMNNTLLDRE
FT                   GVIDKYGIPPELIIDYLALQGDASDNIPGVKGVGEKTALGLLQGIGSLKEIYANLDQVA
FT                   TLSFRGAKTLAPKLEAEKDAAALSYLLATIKTDVELEVTHEQLVVQPQKRDELVELFGR
FT                   YEFKRWLNEVMNDANPVTQNSEEKIPNNYQATASVPQAVETEQTFAKVEIDRSRYETVT
FT                   TMEQLQSWIEKINQVKLVAVDTETDNLDSMSANLVGVSFGLANGDACYIPLTHKEQVTL
FT                   EPQQSDLFAEQAEAETTTSFELAKKQLNLTACLTELKPLLENADVKKIGQNIKYDLTIF
FT                   ANHGVQVAGVAFDTMLESYTLNSTGRHNMDELADRYLGHKTIEFEEIAGKGKNQLTFDK
FT                   IAIDVASKYAAEDADVTMKLHQVLVPELDKTPTLVKLFNEIEMPLVEVLSRIERNGVLI
FT                   DPEKLLAQSAEIEQRLAELEQLVHSEAGEVFNLASTKQLQEILFTKLGLPVLKKTPKGA
FT                   PSTNEEVLDELAGQGHLVPKLLMEHRGLSKLKSTYTDKLPLMINQKTGRVHTSYHQAVT
FT                   ATGRLSSSDPNLQNIPIRNEEGRRIRQAFIARDGYKIVAADYSQIELRIMAHLANDEGM
FT                   ITAFAEGKDIHCATAAEIFGLALDQVTSEQRRSAKAINFGLIYGMSEFGLSNQLGISRA
FT                   DAKKYMERYFQRYPAVQQFMTDIRESASEKGYVETLFGRRLYLPEIKSSNAMRRKAAER
FT                   VAINAPMQGTAADIIKVAMIDIDKAIRGDDNIKMIMQVHDELVFEVKEELIEHYSQLIK
FT                   AEMEKAIQLKVPLIAEVGVGDNWDEAH"
FT   gene            546848..547489
FT                   /gene="lolA"
FT                   /locus_tag="APL_0474"
FT   CDS_pept        546848..547489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolA"
FT                   /locus_tag="APL_0474"
FT                   /product="outer-membrane lipoprotein carrier protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73578"
FT                   /db_xref="GOA:A3MZJ2"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR018323"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZJ2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VLZ6"
FT                   /protein_id="ABN73578.1"
FT                   /translation="MKKLLKQSLLGFALVSMTGAAFADAQSVAELQRRLEQVSQYSADF
FT                   DQTVRSSKGKQIQSGKGKFQVKRPNLFRMDTKSPQENLIVSDGANLWFYDPFVSQVTVN
FT                   TVQDAVNNTPFVLLTSSDKSHWDQYDVTQNADTFVLKPKSKKSNLKQFDVRIDQSGMLK
FT                   GFSTIERDGQSNLYVLRNITGGGVSSDLFKFSVPKGAELDDQRGGKKSKK"
FT   gene            547564..547872
FT                   /gene="trpR"
FT                   /locus_tag="APL_0475"
FT   CDS_pept        547564..547872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpR"
FT                   /locus_tag="APL_0475"
FT                   /product="Trp operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73579"
FT                   /db_xref="GOA:A3MZJ3"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013335"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZJ3"
FT                   /inference="similar to AA sequence:RefSeq:NP_438990.1"
FT                   /protein_id="ABN73579.1"
FT                   /translation="MKILYNQREPQEWQQFMRLLQQAVAEDKLEQFFTSFLTADERDSL
FT                   GLRVQIVRELLKGDVPQREIQQNLNTSAATITRGSNMLKTLEPQFIEWLNEKLNGKA"
FT   gene            547901..548662
FT                   /gene="mtgA"
FT                   /locus_tag="APL_0476"
FT   CDS_pept        547901..548662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="APL_0476"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73580"
FT                   /db_xref="GOA:A3MZJ4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZJ4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44890"
FT                   /protein_id="ABN73580.1"
FT                   /translation="MFSLVKRLCRRIINFFIPQAISSRSGWLWFGTSRLGAGLGGFFVT
FT                   FLMIFSVLPVPFSAYMAQKKVEHLIAGDDYKIQYDWISLDKIAWQMQMAVIASEDQKFE
FT                   SHFGIDLQAIEIALQRNAKSKKVRGASTISQQTVKNMFLWHGQSWIRKGIELPLTFVME
FT                   NTWGKRRILEVYLNIAEFGDGIFGVEAAAKHFFKKRAKDLTLQESALLAASLPNPLVFR
FT                   VNQPGPTMRKRQAWIMRQVSALGGRSYLEKL"
FT   gene            complement(548732..549067)
FT                   /locus_tag="APL_0477"
FT   CDS_pept        complement(548732..549067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73581"
FT                   /db_xref="GOA:A3MZJ5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZJ5"
FT                   /inference="similar to AA sequence:RefSeq:NP_274596.1"
FT                   /protein_id="ABN73581.1"
FT                   /translation="MFTNWKEQTQITKQAFGKMAQAHPKMLQAMGALNAASAEEGLDAK
FT                   TRELIALAVAITTRCESCISVHAEAAIKAGATDKEIAGALATAIETNAGAAYAYALRAF
FT                   EAVETQR"
FT   gene            complement(549094..550098)
FT                   /locus_tag="APL_0478"
FT   CDS_pept        complement(549094..550098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73582"
FT                   /db_xref="GOA:A3MZJ6"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZJ6"
FT                   /inference="similar to AA sequence:RefSeq:ZP_01166111.1"
FT                   /protein_id="ABN73582.1"
FT                   /translation="MLNEVNPAPSTENPTSGQKLANFPVPLFASVMGLSGLTIAWYKGH
FT                   EVLNLPSEISDGLRYLTTLIWLLLFVIYLFKGIRFPQQVKADSMHPVKMNFLTAISIGL
FT                   LLLSVAWKPASIAVSQSLWMVGAILHLGFTFFVVDRWIFKSQFKLAQITPAWFIPVVGN
FT                   IIVPVVGVNYAPSDVNWFFFSIGFLFWIVLLTLVLHRMFFADPLPTKLNPTLFVLIAPP
FT                   AVGFISYTKLVGELVPFGQILYFFAMFWTLFLALKVRVFLNTPFFLSAWGYSFPLAAFS
FT                   IASLEMSGLANIETALYYRIIGSVMLIISTLIITYLTVRTLREIINGSVFQPD"
FT   gene            complement(550113..550454)
FT                   /locus_tag="APL_0479"
FT   CDS_pept        complement(550113..550454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73583"
FT                   /db_xref="GOA:A3MZJ7"
FT                   /db_xref="InterPro:IPR035308"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZJ7"
FT                   /inference="similar to AA sequence:RefSeq:NP_246417.1"
FT                   /protein_id="ABN73583.1"
FT                   /translation="MNSLELTMVIAVVQEMLAWAFYPLLILAVILTVALVILLIKEKGF
FT                   HLKRLVQAEVVGLVGGFIGVLVLFWLTQSGLSDIGAPIDAFALLGTYAVNFFGFAVLYY
FT                   TVKGWLFKN"
FT   gene            complement(550465..551808)
FT                   /locus_tag="APL_0480"
FT   CDS_pept        complement(550465..551808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73584"
FT                   /db_xref="GOA:A3MZJ8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZJ8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9R112"
FT                   /protein_id="ABN73584.1"
FT                   /translation="MSDNIQNFDLTRRLFLQSSALGLTATASSLLLPKSALAEPKVSAA
FT                   ITIVIAGGGAAGLATASRLTERLDEKAEIIVIEPNKHHIYQPGFTLIAAGLKPADYSVS
FT                   DTGDYLPPQVKWIEAKVEEFNPDANQVRLSNGENLNYDYLFVTTGLKLDYDAIEGMDTK
FT                   LIGTNGLGSIYHSAVGAEKTWKLLDEFSRKGGNAVLLRPNTEMKCSGAPLKYTFIVRDY
FT                   LHRRGTLAKSHISYNSNNGSFFSVPIVSEKVRMMFEARDIHYHYHRILKAIDPAKRIAT
FT                   FESKDEGKVELPYDFINVIPPQVAPDAVRNSPLAWQTGPWKNEGWMEVSKSTLRHVRYP
FT                   NVFGVGDIAGVPKGKTAASVKWQVPVAVDHLICELQGKESQLIYNGYTSCPLITEVGRA
FT                   MLVEFDYNNNLQPSFPGIIHPLEDSWTSWLLETIGLKPTYLSMLRGKA"
FT   gene            complement(551853..552065)
FT                   /locus_tag="APL_0481"
FT   CDS_pept        complement(551853..552065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73585"
FT                   /db_xref="GOA:A3MZJ9"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZJ9"
FT                   /inference="similar to AA sequence:RefSeq:ZP_01380874.1"
FT                   /protein_id="ABN73585.1"
FT                   /translation="MKANVGGIDKVLRIVIGALLTVLAATGTIGIWGYLGVIILLTGLF
FT                   SRCGLYSLLGINTAQNCPVCPFKKK"
FT   gene            552220..552507
FT                   /locus_tag="APL_0482"
FT   CDS_pept        552220..552507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0482"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73586"
FT                   /db_xref="GOA:A3MZK0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZK0"
FT                   /inference="similar to AA sequence:RefSeq:NP_246420.1"
FT                   /protein_id="ABN73586.1"
FT                   /translation="MSEIFEKAGEASNFLKLLANPNRLAILCCLLEKDCNVSELCQAIG
FT                   MPQAATSNQLAILRAAGVIVAEVKHRERVYRVEDEKVRAILAVLHQFYCE"
FT   gene            552582..553301
FT                   /locus_tag="APL_0483"
FT   CDS_pept        552582..553301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0483"
FT                   /product="predicted nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73587"
FT                   /db_xref="GOA:A3MZK1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZK1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q56691"
FT                   /protein_id="ABN73587.1"
FT                   /translation="MMSKPTLETILSHRSIRKFTEQPISEDLFQTLIQAGQQASTSNHL
FT                   QCVSVIRVKDQTIRQALREVSGMAYVTECAEFLVFCIDFHKHKQLVPDSQLDWAEVSVI
FT                   GAVDTGIFAQNVLLAAESVGLGGVYIGALRNDVAKVAEVLGLPQYCVPLVGMCLGYPAQ
FT                   DPALKPRLPISLVCYEDQYQPLDQTELTKYNEILTAYYQARTGEGQQWQAAIDKTLNKA
FT                   VRPHMLPFFQQQGLLKR"
FT   gene            553298..554212
FT                   /gene="rimK"
FT                   /locus_tag="APL_0484"
FT   CDS_pept        553298..554212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="APL_0484"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73588"
FT                   /db_xref="GOA:A3MZK2"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZK2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VLZ5"
FT                   /protein_id="ABN73588.1"
FT                   /translation="MKFLMLCREPRLYSCQRLQQACEQRGISLDILDPNRMLIKLAVEQ
FT                   GQSVLRLYYQTGEIYDKNRPLPQLLPDYDAVLPRFGTTSTEMGCRVLRYFEAKRVKVLN
FT                   DSTAFALARDKWLSLQVLVAAQIAVPASSLAGELCSMDGHLAQHQFPLIMKTLSGSQGV
FT                   GVMLAESKQTAQSVLGVLQQAKLTYLLQDFVAKSKGQDIRAFVIGDRVVAAMQRSSNEG
FT                   EFRANIHLGGKAQLIALTEAEQQLAVKAANAIGLSVAGVDLIRSDSGLLVLEVNASPGL
FT                   EGIEQASGIDIAGLMIEHLIHSL"
FT   gene            complement(554247..555005)
FT                   /locus_tag="APL_0485"
FT   CDS_pept        complement(554247..555005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73589"
FT                   /db_xref="GOA:A3MZK3"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZK3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44292"
FT                   /protein_id="ABN73589.1"
FT                   /translation="MFKIMLLLTKLITAIILPPFNALILWIFSLFLHKLQFKKLSYFCT
FT                   ALGMTILYICSTPYFSHQLIQAVTFSEKLTIEDYKKAQAIVVLGGGVRNSHELFGRYAI
FT                   AAAPLERMRYAAYLHKQTGLPILVTGGSPEGREPEAKIMAQELHDFFNVSVKWVESASN
FT                   TTEQNAILSKAMLKQEGIDRIILVTNQWHMKRAKMLFEREGFNVLAAGTTAHQALDIGI
FT                   LPFIPQAQALQNSSIALKEWIGYWKEKLIG"
FT   gene            555322..556590
FT                   /gene="maeB"
FT                   /locus_tag="APL_0486"
FT   CDS_pept        555322..556590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="APL_0486"
FT                   /product="NADP-dependent malic enzyme (NADP-ME)"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73590"
FT                   /db_xref="GOA:A3MZK4"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZK4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43837"
FT                   /protein_id="ABN73590.1"
FT                   /translation="MSDLKQQALDFHEFPVPGKISVTPTKSLATQHDLALAYSPGVAEP
FT                   CLAIEKEPAAARRYTARGNLVAVISNGTAVLGLGNIGALASKPVMEGKGVLFKKFAGVD
FT                   VFDIEINEHDPDKLVDIIASLEPTFGGINLEDIKAPECFYIEKKLRERMGIPVFHDDQH
FT                   GTAIIVGAAAVNGLQIVGKDIGEVRLVVNGAGASAIACTNLLRSLGFKKENITMCDSKG
FT                   VIYQGRGDNMDETKQFYAIEDNGWRTLADAVAGADVFLGCSKAGALTQDMIKTMAKDPL
FT                   ILALANPVPETTPHEAKAVRADAIVCTGRSDYPNQVNNVLCFPYLFRGALDVGATTINE
FT                   EMKMAAAHAIADLAKEPVPFEVLSTYGELSFGPDYVIPTPFDPRLIVAVSSAVAKAAMD
FT                   SGVATRPITDWDAYAKQVKALIA"
FT   gene            556776..557063
FT                   /gene="rplY"
FT                   /locus_tag="APL_0487"
FT   CDS_pept        556776..557063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="APL_0487"
FT                   /product="50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73591"
FT                   /db_xref="GOA:A3MZK5"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZK5"
FT                   /inference="similar to AA sequence:RefSeq:NP_873695.1"
FT                   /protein_id="ABN73591.1"
FT                   /translation="MSFKFEAEVRSAQGKGASRRLRHNGQVPAIIYGGNAEPVSIILDH
FT                   DKVNNAQAHDAFYNEVLTIVVAGKEEQVKVQAIQRHPTKPKLVHLDFKRV"
FT   gene            complement(557223..558263)
FT                   /locus_tag="APL_0488"
FT   CDS_pept        complement(557223..558263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0488"
FT                   /product="predicted phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73592"
FT                   /db_xref="GOA:A3MZK6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR015094"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZK6"
FT                   /inference="similar to AA sequence:RefSeq:YP_747708.1"
FT                   /protein_id="ABN73592.1"
FT                   /translation="MARPRKRENNGLPQNLLCRRRKRASGQIVEYFYYVMADSKEKSLG
FT                   TNKYEAVLEAAKLNFEFQKKGEVVLFIDVAKRYEVEIVPTKKAKNTRQSNLQAIGWLCK
FT                   FFGDPPIPLERIEPQHIKQYLQWRKDTPAVANIEVGLFNTIWNSAREWGYTSLPSPSQG
FT                   VKKFPTKYREIYVEDYILEKIYEFADERMADIIETAYLLGQRPIDICNIHRSHIYNGIL
FT                   HITQQKTGKKVRFEITGRLKEIIDKRLQPETTWLFTNKWGKKLDRQILTVHFREIREKA
FT                   MRAYPELANEIGKVQMRDMRAKAATDISLTATDEQAQKQLGHTSKRMTQHYIRKDKPLR
FT                   PTDEIT"
FT   gene            complement(558525..559046)
FT                   /locus_tag="APL_0489"
FT   CDS_pept        complement(558525..559046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73593"
FT                   /db_xref="GOA:A3MZK7"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZK7"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ABN73593.1"
FT                   /translation="MEKENNGWISVKDKKPELDCVTKSSGYQFNEKELSRMYRWAKIYD
FT                   KSKYLTRYECQQIGKRIDDFLLQHPLSEKLENHLVKKLTDAGFDSWMKIYTAEIDCLKA
FT                   IKGIGEKREKQIIGALVELFKSDDVILDLTTQYSKQNVRVHQAKRDIERQFADSEAVYQ
FT                   MYLEMKASRK"
FT   gene            complement(559253..559663)
FT                   /locus_tag="APL_0490"
FT   CDS_pept        complement(559253..559663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73594"
FT                   /db_xref="GOA:A3MZK8"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZK8"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ABN73594.1"
FT                   /translation="MMNEQIIIDIDVLYLKAASLFAGKNDVRQNLNGVYFNLENGCIQA
FT                   TNGHVAFTTKPNLFASFPKRKGFIMPNELIKQILLIKPFSKEEKFRTLQVAYNKGAITA
FT                   TLGGITVQGKEIEGKFPNLCAVYPLKESNNKT"
FT   gene            complement(559664..559897)
FT                   /locus_tag="APL_0491"
FT   CDS_pept        complement(559664..559897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73595"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZK9"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ABN73595.1"
FT                   /translation="MRLAGVLGNLSKLIIFRNGIYNINEVYSNFYEIVYFLNKLAINKE
FT                   INLESCLSLAWQEIKDRKGRMIDGVFVKEEDL"
FT   gene            complement(560157..560363)
FT                   /locus_tag="APL_0492"
FT   CDS_pept        complement(560157..560363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73596"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZL0"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ABN73596.1"
FT                   /translation="MIKANNFVNILNATTNIANALGYGGKLFVKSYEFPEGELKIVLTT
FT                   EDDKELTFKVQVKNKEEENATAD"
FT   gene            complement(560398..561120)
FT                   /locus_tag="APL_0493"
FT   CDS_pept        complement(560398..561120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73597"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZL1"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ABN73597.1"
FT                   /translation="MISEQDKQAILNGAFGVTREGKKVKFLGKDDSIKDTFWYCIYTAD
FT                   NLVDDFMAYKTLAKRYTNNETRFDIVGLWQEKPEPFDLEKALAGEPVLLRDGSKAYIFH
FT                   CINDEFTKKHNIGYQLLGVIVDSLEGKQLTRSWAKSGIFNEVNPYPDFDIIGMWKEPKP
FT                   QLSSNSLQLPKPLTSPLNTGDGYFTLTTTGGKYVIDSWKWNDKTSDHAFLRNSRIYKTK
FT                   EEVIQVIEAITGKQYEDR"
FT   gene            complement(561319..562221)
FT                   /gene="rdgC"
FT                   /locus_tag="APL_0494"
FT   CDS_pept        complement(561319..562221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="APL_0494"
FT                   /product="Recombination-associated protein RdgC"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73598"
FT                   /db_xref="GOA:A3MZL2"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZL2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P57810"
FT                   /protein_id="ABN73598.1"
FT                   /translation="MFWFKNLMTYRLTQAVDFSNLEEQLKQAAFTPCSKSDVSKFGWST
FT                   PLFASDSLCFRQGSNILLVSHKEEKILPAHVVNKKAEERIKALEEKEQCKLKKTEKQAI
FT                   KDDVTQELLIHAFSKDTFTAAWIDEANKRIYVDSSSSKRAEDTLALLRKTLGSLPVVPL
FT                   SFALLPSEVMTKWVADSTPPDWLNLLEEAELKSFDTASQVRCKHQDLETHEIEQHLQAG
FT                   KFVTKLAVEWENHLSCTIDESGAILKIKFTEDVRDKNDDILKEDVAQRFDADFFLMAEE
FT                   LSTFMKKLIDEFGGIKERI"
FT   gene            complement(565375..566190)
FT                   /locus_tag="APL_0495"
FT   CDS_pept        complement(565375..566190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0495"
FT                   /product="putative DNA-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73599"
FT                   /db_xref="GOA:A3MZL3"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZL3"
FT                   /inference="similar to AA sequence:RefSeq:ZP_01262465.1"
FT                   /protein_id="ABN73599.1"
FT                   /translation="MLHTPLRYPGGKAKFAPIIKQIIEQNNLKGHYVEPYAGGAGVALD
FT                   LLFSGYCSDIHINDLDLAIFNFWKSITERTDDFIRLVNDTPITIEEWHKQKSLLRRENI
FT                   SPLEHGFAAFFLNRTNRSGILKAGVIGGLKQSGDYKLDCRFNKTDLIKRIEKIGNVSKK
FT                   IHVTNFDTENWLPIIDKLVPSNSLIYLDPPYYEKGQGLYRNFYQHKDHVEVKNQLANIK
FT                   TPWVVSYDNHSTIKEIYQQYRQVEYTLNYSASKKRKATEVIIYSDKVSI"
FT   gene            complement(566235..567878)
FT                   /locus_tag="APL_0496"
FT   CDS_pept        complement(566235..567878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73600"
FT                   /db_xref="GOA:A3MZL4"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZL4"
FT                   /inference="similar to AA sequence:INSD:AAO79117.1"
FT                   /protein_id="ABN73600.1"
FT                   /translation="MITDLNIIHYRKLKNLSLVFKPGINLISGTNGTCKSSILHIIGNA
FT                   FQRFKRTSDGVDSSSLSVINAINKYTNPKVENLTKGDKTYNDPAKGTEGELFNIQLDNE
FT                   TYAFRRHNSQDELEDGELKNRFRLILKYPRGEKQSLPFGMVIYLGLSRIVPVGELEDYT
FT                   EEIKKNLPEKYQKELISLYQKMTDISITEPCIENSNEIKHRISFKSEVDGIDSDTISAG
FT                   EDNIMIILTALVSLKYHFESCSNEEYKKSYLLIDEFDATLHPSLQFKLLSLLREFSRDF
FT                   NIQIIFTTHSLYLIDKALKAEDNIIYLMKLANNSVSIMQNPDIFKIEMHLNSETRQDLY
FT                   RDKKLPIFSEDNEARIMINFIFDILSEKDQKFASIRHYFHLVQMKSGCDNLKTLFKDKV
FT                   LTANTLKAMCILDGDNRTHELTHNIISLPGQASPEKLTFQHLSELISKEIYNDFWCNEY
FT                   LQQEGYSFEWAKSNVFPRASGLVSAYDRDKAKSLFNEQSYHHFFTIVMKDWLLRHWEDR
FT                   EMKGFIKDLNILFHNLADYYGIHTAYWPRL"
FT   gene            complement(567934..568200)
FT                   /locus_tag="APL_0497"
FT   CDS_pept        complement(567934..568200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73601"
FT                   /db_xref="GOA:A3MZL5"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZL5"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00133511.1"
FT                   /protein_id="ABN73601.1"
FT                   /translation="MEPEFIAGDIVIIDPRVEPHAGEFVAAINGDYEATFKKYRPLEDL
FT                   DEYGRQHFELVPLNPDWHSMSSLKQEIRIIGTMVEHRIYRRKR"
FT   gene            568720..568908
FT                   /locus_tag="APL_0498"
FT   CDS_pept        568720..568908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73602"
FT                   /db_xref="GOA:A3MZL6"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZL6"
FT                   /inference="similar to AA sequence:RefSeq:YP_541673.1"
FT                   /protein_id="ABN73602.1"
FT                   /translation="MKKNDVIEYFGTLEKVAASLGISVSAVSQWGEIIPEKNAYRLQEI
FT                   TKGKLKVQHSFYRNSGK"
FT   gene            568967..569662
FT                   /locus_tag="APL_0499"
FT   CDS_pept        568967..569662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73603"
FT                   /db_xref="GOA:A3MZL7"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZL7"
FT                   /inference="similar to AA sequence:RefSeq:YP_249171.1"
FT                   /protein_id="ABN73603.1"
FT                   /translation="MNLLLNISEQNSSTLTMSSREIARLCEKQHGHVCRDIENLNHTYA
FT                   EMGLSKIGEGYFTHPSTGNQQHREFLLTREQCIDLITGYRADVRIRINRRWAELEGKQG
FT                   IPKTFSQALRLAAEQQEVIEQQNHQLAIQAPKVAFVEHYVEVGTTKSLRETAKILNFPE
FT                   KRLIECLERDRVLYRQSGNLLPYSDKQSKQLFTVKTGTAEHGHNFTQTRVTAKGIEWLA
FT                   QRYASELGQ"
FT   gene            569818..570690
FT                   /locus_tag="APL_0500"
FT   CDS_pept        569818..570690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73604"
FT                   /db_xref="InterPro:IPR011741"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZL8"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ABN73604.1"
FT                   /translation="MKFTGAGKTQVIEACKKLVDLGLLVKTIGKRNVSVYAANLFTNRT
FT                   GSETEQVQKVNITGSETEQVTGSETEHTKNNIKNTIQNNTPLNPPVGETQGDSVAVLDY
FT                   LNDRLAELGKAIEQPLPKFKPVPNTLKIIKARLAESSRAECETVVDYLVAKWGRDGKMR
FT                   EYLSPKTIFRASNFADYLPKSTAWAESGKPVAVNGKWMSEAEANRKAQIADMPSVDEVR
FT                   GVYQRYLSTPTLFNRTDFRDLRKKFVYYCVIKTKNAHPTEHNINSVIAGNIKAVAEQIH
FT                   DLPIPTLGA"
FT   gene            570693..571217
FT                   /locus_tag="APL_0501"
FT   CDS_pept        570693..571217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0501"
FT                   /product="possible DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73605"
FT                   /db_xref="GOA:A3MZL9"
FT                   /db_xref="InterPro:IPR008593"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZL9"
FT                   /inference="similar to AA sequence:RefSeq:YP_719612.1"
FT                   /protein_id="ABN73605.1"
FT                   /translation="MTNFDKNTWQTPPECANYVKRRWAIKWDGAATVENKICDYFITPE
FT                   IDFLNFESIDRIIENNARIFINPPYGRGYVEKFVKQAVRLMNEKRCFVVMLLNADKSTE
FT                   WFKLIREHATEVIDIVGKRVAFINPITKKPVEDNPKWQMFAVFDPYAEGFVTSYVSYDK
FT                   IKQVGTNDNNA"
FT   gene            571412..572434
FT                   /locus_tag="APL_0502"
FT   CDS_pept        571412..572434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73606"
FT                   /db_xref="InterPro:IPR010373"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZM0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P76162"
FT                   /protein_id="ABN73606.1"
FT                   /translation="MTEALLLKPYFQTEAGIVFYRIPPTVNKLAFGERTILMPATDSLK
FT                   TQPSGKIGVAKNLQNSTACPQLADFTKSELVRKAAGGEAELSKWVRKIAICQCRDGAYC
FT                   HKEMTVTRTATGFIRTCWHHDGIAHRGEASEEELNALAEANWVQFIGYKIRQDLQMQAD
FT                   ESLNLGCLLAWAIAKNCVSAIDESDLRRLLNLPQKEVPDHRESTTYAAEQADPHKIFKT
FT                   LAQPILKLKADPEPPASFMAKPKEKRFESSKWLQFVKSQPCVCCGKRADDPHHIIGQGR
FT                   GKMGSKEHDLFVIPLCRVHHNELHCNAQLFEQNYGKQTDLLFRFLDRALSLEALSVNDR
FT                   "
FT   gene            572506..572874
FT                   /gene="rusA"
FT                   /locus_tag="APL_0503"
FT   CDS_pept        572506..572874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rusA"
FT                   /locus_tag="APL_0503"
FT                   /product="predicted Endodeoxyribonuclease RusA"
FT                   /EC_number="3.1.22.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73607"
FT                   /db_xref="GOA:A3MZM1"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR016281"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZM1"
FT                   /inference="similar to AA sequence:RefSeq:YP_215331.1"
FT                   /protein_id="ABN73607.1"
FT                   /translation="MSDYLEIALPYPPSVNHYWRHTKAGTHYISREGKAFRAKVLNICK
FT                   QFDPFNGAVKIQIYVYYPDNRSRDPDNLQKALFDALTASGLIKDDNNKIIKDYRVVGMD
FT                   EIRKGGMVVIKIKGLDDA"
FT   gene            572867..573379
FT                   /locus_tag="APL_0504"
FT   CDS_pept        572867..573379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73608"
FT                   /db_xref="GOA:A3MZM2"
FT                   /db_xref="InterPro:IPR010534"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZM2"
FT                   /inference="similar to AA sequence:INSD:BAE79908.1"
FT                   /protein_id="ABN73608.1"
FT                   /translation="MRKFSELKPLTEEQERFVDENMYEWGAWIRSGRIDKSPLNIIAKL
FT                   MQSAIPAEPGERMCDDEKGMMISQVIEQFFLKNDRLLHFIIFSYYVNKRTVNFIAVKLR
FT                   DNCGAYLNAARVPGKSNIRVPSQQTMRRKVEKELILAKAIIHELLVTCLVWLRTGGEKA
FT                   KSIKISY"
FT   gene            573751..574293
FT                   /locus_tag="APL_0505"
FT   CDS_pept        573751..574293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0505"
FT                   /product="putative endolysin"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73609"
FT                   /db_xref="GOA:A3MZM3"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZM3"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00348115.1"
FT                   /protein_id="ABN73609.1"
FT                   /translation="MSSNKWGTLGKVGGACSVLTMIAIMVTNYGDEFRTSVEGLEIIGN
FT                   AEGCRREPYKCPADVLTVGVGSTAAGGELIEANKIYSDDEIARRWKNDVVIAERCVNRL
FT                   ANGKQMPQSVFDSVVSITFNVGCGALSKSTLFRKANAQDWQGVCNELPRWVYSGGRKLK
FT                   GLMLRREKEKALCLSGL"
FT   gene            574385..574756
FT                   /locus_tag="APL_0506"
FT   CDS_pept        574385..574756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73610"
FT                   /db_xref="InterPro:IPR022538"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZM4"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00348114.1"
FT                   /protein_id="ABN73610.1"
FT                   /translation="MLDGFTKAMGLLVGGLALLVVALGGWSLYQSSKIDTLNAEVKAKD
FT                   SLIAEQQAVNQELITQLETEKQAVEYQQKITNELKAQMETERENVKTILIKEPCGGVAM
FT                   PSAVIDSIKRLHSVGSNKD"
FT   gene            575285..575704
FT                   /locus_tag="APL_0507"
FT   CDS_pept        575285..575704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73611"
FT                   /db_xref="InterPro:IPR009901"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZM5"
FT                   /inference="similar to AA sequence:RefSeq:YP_544047.1"
FT                   /protein_id="ABN73611.1"
FT                   /translation="MHRQTVSQRVSPITPAQGSNPKLKLYLLRDLLMMGFANKMLADVD
FT                   SMTPSDQLSYWRAKREELEYKKRTGELCEATEVALEMSAMAKAIVQQLETLPDILERDA
FT                   GLPPKALIRVQELVDDFRDQLAIHIQNADSEPEEE"
FT   gene            575707..577824
FT                   /locus_tag="APL_0508"
FT   CDS_pept        575707..577824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0508"
FT                   /product="predicted bacteriophage tail assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73612"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZM6"
FT                   /inference="similar to AA sequence:RefSeq:NP_460006.1"
FT                   /protein_id="ABN73612.1"
FT                   /translation="MFASPKEIRKDIALSVKAPRRMQIADAVSEYMRVPMGGANSVKWD
FT                   RNTAAYMLEPMNCLNSREYDSVVFVGPARTGKTIGLIDGWITYAIVCDPSDMLLVQLTQ
FT                   EKASEHSRKRLDRMFRCSPEVAKRLSPRKNDNNVHDKYFRAGNLLKIGWPSINVLSSSD
FT                   YKYVALTDYDRWPNDIDGEGDGYSLASKRTTTFMSAGMTLVESSPGKDIADVKYRPSST
FT                   HEAPPTTGILSLYNRGDRRRFYWPCPSCSEYFEPSMANMVGYRDDLDLVKASENARLQC
FT                   PHCSHLVSPDLKRELNIKGVWLKEGQTIDKRGVISGEGRNSRIASFWLEGPAAAYQTWA
FT                   QLTYKLLNAEKEYEDTGSEETLKAVINTDWGLPYTPRSALEQRRSDELLERTEQTEKRT
FT                   VPERCRFLLAAVDVQGGKKRRFVVQVVGYGENGERWLIDRYNIRYSLRANEHGEALPID
FT                   PSAYQEDWNLLITDVLDKQYRLSDDENRFMPITAMAVDSGGEDGVTDNAYKFWRYCRAN
FT                   KISKRVYLIKGDSTKRSKLITKSYPNNMNRSDRHADARGDVPIYLLQTDLFKDQIANAL
FT                   NRETVGANYIHFPNWLGEWFFEELVYEERGPDGKWRKPGKGNNEAFDLFCYAHAIAILR
FT                   GYERIKWGDEKDVPSWAKLPDINPNIIREQNTMSGQAVEIEEKTAKSNPNPTKAKNSWL
FT                   SGSGRKTGGWL"
FT   gene            578045..579565
FT                   /locus_tag="APL_0509"
FT   CDS_pept        578045..579565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0509"
FT                   /product="bacteriophage capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73613"
FT                   /db_xref="GOA:A3MZM7"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZM7"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00834714.1"
FT                   /protein_id="ABN73613.1"
FT                   /translation="MNLLEKTIATLSPKWAAERSRNRYVLNAYEAALPSRTHKAQREGK
FT                   GANTAIRQSAVSLREQARALDQNHDIVIGILDKMEERVIGSKGIHIEPQPLTLTGDVHE
FT                   DLAEQIRKLWAEWSVKPDVTGLYTRPLLERMLLRTWLRDGEVFVQLVKGKVAGLEHSSP
FT                   VAFSLEALEPDFVPMQTDEAKNGLVQGVFLNAWRKPTAYQVYLDNPQESTAMYGKIKTV
FT                   PAENMLHLAFRKRLHQIRGVSMLHGVIVRLADLKEYEESERVAARIAAAMTMYIKKGDA
FT                   ALYDDESNNDGERLFDIAPGAVIDDLKPGEDVGLINSNRPNVNLETFRNGQLRATAAGT
FT                   RSSYSSIARDYNGTYSAQRQELVESFEGYAVLQDAFVAAISRPIYREWLKMAIASQAIE
FT                   IPPEIDEKSLFNAVYSGPVMPWIDPIKEANAWKERIKGGLATEGQAIRASGNNPAEVKR
FT                   QRIVEIKENAREGLKFDTDLTNTQGISNEKKTNGSSPDGEGSSSNQDE"
FT   gene            579501..581525
FT                   /locus_tag="APL_0510"
FT   CDS_pept        579501..581525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0510"
FT                   /product="putative Clp-like protease"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73614"
FT                   /db_xref="GOA:A3MZM8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018774"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZM8"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00714007.1"
FT                   /protein_id="ABN73614.1"
FT                   /translation="MRKKQMVLAPMAKAVAVTKTNNQSWFTIKAAANDTAEISIYDEIG
FT                   FWGVTAQQFANDLKALGNNLKQINLHIHSPGGDVFDGIAIYNLLKNHPANKTVYIDGLA
FT                   ASMASVIAMAGNEIIMPENAMMMIHKPWGIQGGDADDMRKYADLLDKVESTLIMAYVAK
FT                   TEKSEEELAEMLKEETWLTGKECVEQGFADKLAEPLVAMACIQSKKLEDYTKMPDKIKN
FT                   MLFAPQGNAGANPKPEQPQTPPQAGENPQNVAKPDAMVALAQRNATIKATFAAFGTQFD
FT                   GLLAECLADVSMTAEQAKDKLLAKLGENTTPSVPQNHIHAGNGNIVGDSVKQSLMARAG
FT                   QDTDKTNARDNTYNAMTLRELARASLVDRGVGIAGYTPMQMVGLAFTHSSSDFGQILID
FT                   VAHKSLLKGWEVSNENYEQFTSRGILTDFRPAKRVGLGEFGYLPTVGEGEEYTYGTLGD
FT                   EGASIALATYGQLFSITRQAIINDDMHLLTTIPQKMGQAARATIAKLVFALITGNATAQ
FT                   DGKKLFDASHKNSLTGAKLDVEHIDKAVQLMNGFVNSRGEPLAIEPEFMLLPTSLHTKA
FT                   KQILGSSSVEGADINSGIINPIRDIVSPIKSPRLQIADAKSWYLINKEAIEVSYLDGVD
FT                   SPYIEQQQGFSVDGVTTKVRIDAGVNVIDYRGIVKVTNQ"
FT   gene            581599..581922
FT                   /locus_tag="APL_0511"
FT   CDS_pept        581599..581922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73615"
FT                   /db_xref="InterPro:IPR011231"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZM9"
FT                   /inference="similar to AA sequence:INSD:AAT40799.1"
FT                   /protein_id="ABN73615.1"
FT                   /translation="MAKNYIQDGNTVRLTAAKAIVSGDVLVSGDLIAIAVTDAAKNDAV
FT                   VGLTTGVFNVKAKQADDIKQGAVLYWSETEGATLTAGGNKRLGIAWRDSGTSSDEVDVK
FT                   INV"
FT   gene            581915..582217
FT                   /locus_tag="APL_0512"
FT   CDS_pept        581915..582217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73616"
FT                   /db_xref="InterPro:IPR025601"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZN0"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ABN73616.1"
FT                   /translation="MCSPFEQAMKQADQVIMATMMSEWQLQGQPYPAVYDEAPKVFEGL
FT                   HFNEDTAINGTSRTLTLYRSSGYKPRTGDEAVREGKVFFVKSYYHQDNLLILRLE"
FT   gene            582220..582747
FT                   /locus_tag="APL_0513"
FT   CDS_pept        582220..582747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0513"
FT                   /product="putative phage tail component"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73617"
FT                   /db_xref="InterPro:IPR010633"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZN1"
FT                   /inference="similar to AA sequence:RefSeq:NP_459891.1"
FT                   /protein_id="ABN73617.1"
FT                   /translation="MSVKIDGMAEISANIAKLTKQKLPQAAKKSLNTLARRAMKGATQT
FT                   VAKEIGVPHKTIRNRAKLTKPAEKTRLEARIKVIRSNMPAIRLFENRSTKMWVGRGGIV
FT                   VGKYAIKRGFKQTLKNGRTHLMQRQGKARYSIDVVKIPLSQPLTQAFSHELKDYQQDIQ
FT                   KELTKQLSEVFK"
FT   gene            582744..583157
FT                   /locus_tag="APL_0514"
FT   CDS_pept        582744..583157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73618"
FT                   /db_xref="InterPro:IPR009312"
FT                   /db_xref="InterPro:IPR035934"
FT                   /db_xref="InterPro:IPR038512"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZN2"
FT                   /inference="similar to AA sequence:INSD:BAB19572.1"
FT                   /protein_id="ABN73618.1"
FT                   /translation="MIIHSQIREEILECLKQALPNEINWYNGRPSFIDIDEEQSAVAVF
FT                   IDEANCTPVTTCQEEWEAKLNIVLYQKALNDAETRLDKTAQNVVDVLQEVEFKNLSAMQ
FT                   LSGYTYDQDEQHSTWHIAIIQFEINYERTTGAD"
FT   gene            583157..583813
FT                   /locus_tag="APL_0515"
FT   CDS_pept        583157..583813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73619"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZN3"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00731859.1"
FT                   /protein_id="ABN73619.1"
FT                   /translation="MATQTTPFQGTKFYIGTGLNQEKAITACTVTPNATITAAGHGAKV
FT                   GDFVKITGLGSLDGFYPVKTVATDTLTFADEVDWTGQDKPTDFSTAKFAVVKWSSNFCA
FT                   IKNIEGDGDTLSEEDVTTMCSEGTETEAGEIEYGSIKLTFFYAPATAMQSDLRKKFFAK
FT                   ETFPWMMVLKNKQGSLYGTGFIQTSPNWSGEVKGKFESGVTIKKSKRDYHLPTTA"
FT   gene            583872..584264
FT                   /locus_tag="APL_0516"
FT   CDS_pept        583872..584264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73620"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZN4"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00731858.1"
FT                   /protein_id="ABN73620.1"
FT                   /translation="MTIGTRESLLANNKPKLKKIKIGDAEYFIREFNVGDMNRSLYGQQ
FT                   KVMCELAEAQGIVLNYDNPEELVKQLSKVYDPYRLARNLALRLCDADGNNLFDFENVDD
FT                   LEALSRLDKSVSEELSRALMDEEPKN"
FT   gene            584288..584563
FT                   /locus_tag="APL_0517"
FT   CDS_pept        584288..584563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73621"
FT                   /db_xref="InterPro:IPR025116"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZN5"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00731857.1"
FT                   /protein_id="ABN73621.1"
FT                   /translation="MLSLALGKTLTEIEEMPESHFQEYMLFYDEQPFGLWRDDYRTAQI
FT                   SHLLTAIHSDPKQKATTLSDLMPFFSKKNSHEYDEDDGTEAYLANR"
FT   gene            584929..588360
FT                   /locus_tag="APL_0518"
FT   CDS_pept        584929..588360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73622"
FT                   /db_xref="InterPro:IPR009302"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZN6"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00731856.1"
FT                   /protein_id="ABN73622.1"
FT                   /translation="MASLGNLNISLNLETVQFQQGLNKSAYQSQKFARQFEANFSAAQN
FT                   RARQFSERTTQYLNNIERAANSINKTANIGLFSNIAGWATGNLSAATSQTLKYADSYTE
FT                   LQNRIRLVTDSQNEMVAATNTVFDIALRTNQAVGATSEVYQRFAKNADTLKLSQQQVAE
FT                   LTETVSKAVAMSGASAASAEAALMQFGQAMAGGVLRGAELNSVMEQTPALAQAIADGLG
FT                   VSVGALKDMGKNGELQISKVIEALQKAKDTVDTDFEKRVKTLSMSFTNLETSMIQFVGQ
FT                   VDSTYGVTQKLAEGVDFVSENLETLIKVAGALIGALAIGHISKYSATLLQTGYNSAKNA
FT                   IAHTREAQAILAKATAMRTAAQVEMASLAAQFQLAQSERTRYALREQMKVQAGQIIALA
FT                   EAEATAKRNLAAANTLASTTARGLQSAMALLGGPAGVIMIAASALMYFSSQVDQARQKA
FT                   LDTAGANERLKESYEGLSAAALSLKITQQQEELENYKNQIQQLQSDISALEANWFTTGL
FT                   PIPDSVKKEIAELSDQIELLKENSNIDFSVLENQLEALARAMLSSGKSLDDIRAKFKLL
FT                   GIDASETEWILAGIPSTLNDIGNSAEKAAGETLNLDDAMKKLQERSVTLAQKLEVAKLE
FT                   QQGQAESAYVLAGLYELLGVEGAKYNEVLISIATGTITAANAADKAIGLSQETLKKILD
FT                   GKAMLQGMFKNETQIQTIKTELRENAKVANPKKEKKAKKSNGENARENWLSFYDDLRKK
FT                   SGSTLNEINLEETRMFQRLEEHMKKGVVSHAEYETAKAAITQRFAKERLELAGKYAPEK
FT                   LLSANLKDELSAIQELRKAGQLTEGEYQVAEQQLKFDYAQNKSQQAISPLDQVRGMYDS
FT                   EQELKNQQAQELAQLQAFYEQKLMTEEEFQKRKRQIIASYENDRWQKEMSTYATGLNDL
FT                   GGAFDMLTSAVEQSAGKQSAAYKAMFAVSKAFAIAEATVKLSQAVAQAMADTTALTPAQ
FT                   KFANMAAVAAAGANVISQITSVGFSSGGYTGDGGKYTPAGIVHRGEYVLTKEATARLGK
FT                   GYLDYLNYGTRRGFSNGGGVSVPSVNYSGFTGGGNNISVKVINNGEPVNATVNSQQNGN
FT                   ELEITIELLKKMDQIADQRYRTNQLKDMRNGGVLSR"
FT   gene            588612..588947
FT                   /locus_tag="APL_0519"
FT   CDS_pept        588612..588947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0519"
FT                   /product="predicted phage minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73623"
FT                   /db_xref="InterPro:IPR010265"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZN7"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00731855.1"
FT                   /protein_id="ABN73623.1"
FT                   /translation="MALKTLSWCPQPGYTVEEEPRRKVLNYGNGYQQRIEDGINTLLRK
FT                   YSVTYKIKNKESVQFRGFMKEHGGVRAFYFKDVALGGELVKVVCTKFPRQAGKKHTIFT
FT                   CEFEEVI"
FT   gene            589800..590663
FT                   /locus_tag="APL_0520"
FT   CDS_pept        589800..590663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73624"
FT                   /db_xref="InterPro:IPR018875"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZN8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P03037"
FT                   /protein_id="ABN73624.1"
FT                   /translation="MTNQISTQTLSFYGSDLITLKVEDVIYTAVRPLVEAIGLDWASQS
FT                   VKLNKNKVKFNCCDIATVGADGKIRQMLCMPLKKLNGWLFSINPEKVRADLREKVIQYQ
FT                   EECFEALYNYWHFGKAERKTTVDERTGLRNAVNMLVGKKALMYNEAYNLVHQRFNVESI
FT                   EDLTAEQLPQAVEYIHKIYLEGELIIDEPKTNNDIQISADVFEAIMKHTRLAKRLAEQV
FT                   EPFHRQLHQMLGLERWQKNDIASLAYGVRAEFNYWLDEGEKLIEKYRREKAEINYANAR
FT                   LRKATA"
FT   gene            590784..591521
FT                   /locus_tag="APL_0521"
FT   CDS_pept        590784..591521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0521"
FT                   /product="phage-related minor tail protein L"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73625"
FT                   /db_xref="InterPro:IPR006487"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZN9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P03738"
FT                   /protein_id="ABN73625.1"
FT                   /translation="MPKALPSKMAQELPKLEQGALIELWEIDLRHIPNSNGSDTTGELY
FT                   RFHNGMSQGRTNIWWQGHEYQAYPIKADGFEISGQGPSSRPTLTVSNLYGIITGIAANF
FT                   GQGVGGKVTRRLVYAQFLDPRNFTGGKNSKADPTQEAVSYFIIEQLKSLDDEQATFELA
FT                   SPAETDNAKIPLLMITSDVCIWQYRSAQCGYTGGPVADEFDKPTTDRKKDKCSHCIRGC
FT                   KLRFGENAVLSFGGFPSTTQYGN"
FT   gene            591682..592296
FT                   /locus_tag="APL_0522"
FT   CDS_pept        591682..592296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0522"
FT                   /product="phage-related tail assembly protein K"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73626"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZP0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P03729"
FT                   /protein_id="ABN73626.1"
FT                   /translation="MDPDDFVKAELMGEIVALVHSHPDSVMEKGLPYLSTADRECQIRT
FT                   QLDFWLVVDNEIKQFRNIAPLIGRQFENNKQDCRNIILDSYMLAGIELPDQSTYEFEWF
FT                   EHSNLYEEGLIRCGFERLSQDESPQLGDVVLSCVGSNVANHAGIYLGDQLMLHHSQGRL
FT                   SARVPYDGFWLQFTHSVWRFKEWQKLHFTAILNDLSMSRSN"
FT   gene            592320..592841
FT                   /locus_tag="APL_0523"
FT   CDS_pept        592320..592841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0523"
FT                   /product="putative phage tail assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73627"
FT                   /db_xref="GOA:A3MZP1"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZP1"
FT                   /inference="similar to AA sequence:RefSeq:NP_459900.1"
FT                   /protein_id="ABN73627.1"
FT                   /translation="MNGLLTQIQGFREHLRNGYYKVRIGKNYLNNDQLQTNPMIALDDK
FT                   SSIHFTPVIAGAGKGMGIGQLVLGVVLVAAAFYTGGASLLAWSSGATMMGAMGASLILG
FT                   GAISLLSKTPEMSSGVKEGEKKQSTSFSNIRNLTPQGRPIPLLYGRMLTSLVLISQGIE
FT                   TFDDVEELNR"
FT   gene            593159..598756
FT                   /locus_tag="APL_0524"
FT   CDS_pept        593159..598756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0524"
FT                   /product="predicted phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73628"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015406"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZP2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P03749"
FT                   /protein_id="ABN73628.1"
FT                   /translation="MGGKSGGGGHTPYEAPDSLKSAQRLRAIGLISLGPIKGPVNKWKS
FT                   TFFDNTPIQNENGVDDNDEASFNFKNTEVSFTLGTQDQLPLQGFEMSEREVSVSTEVKY
FT                   TTPITRTVTDPDVTRLRVTLGVNALYEQNDQGDTNGTSVSFRILINGLPRATYEINGKS
FT                   SSRFYRSYIVDNLPERPFTITVERMTADSKSQRLQNATNWVSYTEIIDTKLSYPNMALV
FT                   GIKTDSRYNPNFPNVNFLLYGRLVKVPSTYDPETRTYATALWKGDWKQAWTNNPAWVFY
FT                   DLVTDPLAGLGKRVGDYGLDKFQLYQIAKYCDELVDDGYGGKEPRMTANLWLTDQRSAY
FT                   DVLSDMASVFRAIAVWNGTQFTAIQDRTADPVCTYSQANVIDGKFSRQYAAMKSIYTAA
FT                   EVEYADERNMYQKAVEYVADDAMIARYGYNVKKMTAYATTSRGQAHRWGKWVLATSLLE
FT                   QCTITFSVGRQGLLHLPGDIIEVADNDYAGKTLGGRVVAVNGKVVTLDQPIEISGKSYL
FT                   SYLNDEMKVVKVTISSVDSKNKAVVTLATVPTGLEPMDDWVLKTPNISTQLYRAIGITE
FT                   NDDGSYTITALQHEPQKEAIVDGSASFVPVATTAHTGGVQKVANAEASIHENGVKLTWA
FT                   MPSSNSIVKYEVRLYRNGVLYQTYLDVESTELTFDDLPDGSYVAEIRSKNTNGQLSDPV
FT                   TRAFEINLRIPRFVTKSLLFAIELDWDLPKTATVGNYTELWRASENDVSKAVKVATLAY
FT                   PQNNYTINGVSLNESYYFFARCGDKAGNKGEFTEGVFGEADHNTENLVNALEGKITQSH
FT                   LGKSLIESLKADIDEAVGGESKERQGAVANALAQILAETQARVKALQDEAKARTAAITA
FT                   ETNNRTKAIQAESASLTKKIQDEAKVRSTAVTQLQQTDAQQAQLITAVTAKADQAITGL
FT                   QEEKTARANADKAEAQARNALTSRVANAESGIAEVRQSIATANSSIAEVSQNLNAKIDG
FT                   LSVGGRNLLLKSNATNLINFVRSSQDVLDNTDFRTPVVRINCIQDSWFGRKTAITPGKL
FT                   LAGKYTLSFKYRTNATINNTFIGYGNNQQRRLITSNAVGDEAWQACKLTFETTEDYQDI
FT                   FIIIGGYGTADVSYIEFAELKLERGTIATDWTPAPEDADSAISAVSADLTSYKQTQAIK
FT                   EQATSQQINGLTTRLANTESGISRVEKAVSDNQSSTATQLNQLSANLTKAQTDLNAKIT
FT                   QEQTARADADKANADRITSVTSRVANAESSISNIQSTKASKTEVASLAQQSLQAVWQAD
FT                   AQAKVDALSVGGRNLLLKSNATNLINFVRSSQDVLDNTDFRTPVVRINCIQDSWFGRKT
FT                   AITPGKLLAGKYTLSFKYRTNATINNTFIGYGNNQQRRLITSNAVGDEAWQACKLTFET
FT                   TEDYQDIFIIIGGYGTADVSYIEFAELKLERGTIATDWTPAPEDADSAINAISSKVDSV
FT                   QQTLTTANQALGSRIDTVTASVNDAKSQVSQVSKAVSDVSGKLSATSTLKTQVIAGGRK
FT                   AIAGIVLGAESDGVTTESSVIVMADKFGVVKNAADGNVVSMLSVVNNKVAINGDLIADG
FT                   AILGKHIRASQTLSSPNINGGTITGNTITGGTITGTTVSGGTVTGATVSGGVVKGSRIE
FT                   GGVISGSTILGDIVKAVILRKNGNNFEGTVPASEVSSRTVVVPSLSFKANSGETSTIAI
FT                   YIDGEKVAESSVTGIKQEVPIMATIAPTEIRGTVSVSVSGDVGGDLSGTVSGTVNGQAR
FT                   GDVSGQVSGYVNGGTVSGRASGTATGSLSGQVSGRATGRASGRVSGTASGFATGTTPMT
FT                   NIRTSFMLQVPTSGSISGYKQITGKSVIVRVTANNANALSGQNSLIALVA"
FT   gene            598815..599156
FT                   /locus_tag="APL_0525"
FT   CDS_pept        598815..599156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73629"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZP3"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00731873.1"
FT                   /protein_id="ABN73629.1"
FT                   /translation="MKFIEKQIEEQRTGALANHHVVTGLQVDYVNGSTFVTIGSYVSKA
FT                   KKDEGKESLSVNTFTIQAVPAWDQIPYQWALAELVKTQPDDFVPETYTGYVNPYMFAGG
FT                   KVKDVPEAK"
FT   gene            600117..600758
FT                   /locus_tag="APL_0526"
FT   CDS_pept        600117..600758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73630"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="InterPro:IPR016537"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZP4"
FT                   /inference="similar to AA sequence:RefSeq:NP_874010.1"
FT                   /protein_id="ABN73630.1"
FT                   /translation="MKLIKFAFLCFIAFLSAQVAAHPHSFLDLKNKILVEGTNLKGFQM
FT                   EWTMDEIASAELIYEVKSSSDKEATKKSITAEMVQTAIENHYFSYLYNAKDEPLKFTTK
FT                   PSNTTFRIAGNKVIFYVTFYLSRPYDLKNNPIRLYTYEPSYYMAMEYNNKADLTISNSA
FT                   CKATLEQPKVNSELRLYASSLDKTQTPDMPEGEDNTLGAQFAQKVVAVCE"
FT   gene            600881..601744
FT                   /locus_tag="APL_0527"
FT   CDS_pept        600881..601744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0527"
FT                   /product="predicted ABC-type transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73631"
FT                   /db_xref="GOA:A3MZP5"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZP5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44136"
FT                   /protein_id="ABN73631.1"
FT                   /translation="MTGLSENRQQAGITLLIISFLYGVFHAVGPGHGKFILTGYLSLEK
FT                   TKLNQAMKISFLSALAQGFVAIALVSIIVVAFTLSRSYFNLTLKWVERGSFVLMILFGI
FT                   YWCYQALKAFKRKSDTIPKIQRISAINLQKNSKITPLIRPQKHFHTEYCGCGHQHLPSS
FT                   TKIHQAKDWKAQSMIILSIGARPCSGAILVLFLAYTLDIYVWGMLSALAMAIGTGMTLT
FT                   LFAWLVIIARNRAIRLSTWYISEQTSRQAMLILKILVGMILVIFGVTLFHSSFIETSGG
FT                   AGLFKR"
FT   gene            601844..603292
FT                   /locus_tag="APL_0528"
FT   CDS_pept        601844..603292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0528"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73632"
FT                   /db_xref="GOA:A3MZP6"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZP6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44555"
FT                   /protein_id="ABN73632.1"
FT                   /translation="MDFIVSGFENVLTWIVNTIDGPLWDITILILLGTGLFFTITTGFV
FT                   QLRLLPRSLREMWGGRSAEGKSLTPFQAFTTGLASRVGVGNIGGVATAIALGGPGAVFW
FT                   MWITALMGMSSAFAESSLAQLYKTRDPNGMFRGGPAYYITRGLKFKPMAIAFAIALIFT
FT                   FGFAFNAVQSNSIVAATSKAWEWDGQYIGLILVIVTGIIISGGVKLIGQVSAKIVPMMA
FT                   LFYLIIAVIILGMNIERVPAVFGLIIDSAFDFSAAAGGMFGALVSKTMLMGIKRGLFSN
FT                   EAGMGSAPNSAATSDAKHPASQGLIQMLGVFVDTMVVCTCTAVIILMSDNYGGDSLKGV
FT                   ELTQTALQYHLGEFGVHFLAFILLLFCYTSIIGNYAYAETNIRYIKNKPWFVWAFRAVV
FT                   LFFVYFGAVRDGGIVWAFADTVMASMAVINLIAILILAPIVWRLLKDYVRQVKAGQEPV
FT                   FKIEEHQDLIHRGVDPLIWKSKED"
FT   gene            603683..604414
FT                   /pseudo
FT                   /locus_tag="APL_0529"
FT                   /note="internal stop codon"
FT                   /inference="similar to AA sequence:RefSeq:NP_246203.1"
FT   gene            604407..605156
FT                   /locus_tag="APL_0531"
FT   CDS_pept        604407..605156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0531"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73633"
FT                   /db_xref="GOA:A3MZP7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZP7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q57306"
FT                   /protein_id="ABN73633.1"
FT                   /translation="MFKHLFKIGGLSLLLILLWQAVVTGFALPHYMLPAPLTVFEQIDN
FT                   QFPLLWQHGQVTFIEIIAGLSLGFLLGVMSALALSLSKWLNGFLLPLLVISQAIPVFAI
FT                   APLLVLWLGYGMASKIAMTVLIIYFPVTAACYDGLRNTPKAYLELAKTLEIKPLAILLR
FT                   VRLPAALPALASGLRIAVSVVPIGAVVGEWVGSSQGLGYLMLHANARMQTDLLFAALTV
FT                   LLLMTLCLYFITDRLLRRWLPWVQYMR"
FT   gene            605200..605481
FT                   /locus_tag="APL_0532"
FT   CDS_pept        605200..605481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0532"
FT                   /product="predicted dinucleotide-utilizing enzyme involved
FT                   in molybdopterin and thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73634"
FT                   /db_xref="GOA:A3MZP8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZP8"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00824509.1"
FT                   /protein_id="ABN73634.1"
FT                   /translation="MSLSDQDFLRYSRQILLEECGIEGQQKLAKSRVLVVGCGGLGSPV
FT                   AQYLASAGVGKLYLADFDKVDLTNLQRQTLFGMKDLNKPKSEQARLNL"
FT   gene            605569..605949
FT                   /gene="thiF"
FT                   /locus_tag="APL_0533"
FT   CDS_pept        605569..605949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="APL_0533"
FT                   /product="predicted dinucleotide-utilizing enzyme involved
FT                   in molybdopterin and thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73635"
FT                   /db_xref="GOA:A3MZP9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZP9"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00827816.1"
FT                   /protein_id="ABN73635.1"
FT                   /translation="MLDCSDNMATRHAVNKVCVENQIPLISGSAVGMDGQLLGVFPPYQ
FT                   HGCYACLFSDTEIGNLNCRTAGVLAPIVGIIGSLQALEALKFLLGLPVSCDGKFGVFDG
FT                   RSLMWQQIEMVKDKRCRVCGTL"
FT   gene            605980..606180
FT                   /gene="thiS"
FT                   /locus_tag="APL_0534"
FT   CDS_pept        605980..606180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="APL_0534"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73636"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZQ0"
FT                   /inference="similar to AA sequence:KEGG:K03154"
FT                   /protein_id="ABN73636.1"
FT                   /translation="MQIFINNQPLDVAENTSIQTALALSQANLQGVVVALNQQIVPKNE
FT                   WQSYPLQEGAKLTVFKAIAGG"
FT   gene            606616..607026
FT                   /gene="thiG"
FT                   /locus_tag="APL_0535"
FT   CDS_pept        606616..607026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="APL_0535"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73637"
FT                   /db_xref="GOA:A3MZQ1"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZQ1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q6DAM4"
FT                   /protein_id="ABN73637.1"
FT                   /translation="MLVKEGFIVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGTNQGLK
FT                   TQDFLRIIIEQSRVPVVVDAGIGAPSHAAQAMEMGADAVLVNTAMTVARDPIQIAQAFK
FT                   LAVEAGRLGYLAGLGKVSQTAQATSPLTGFLG"
FT   gene            607036..608181
FT                   /gene="thiH"
FT                   /locus_tag="APL_0536"
FT   CDS_pept        607036..608181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="APL_0536"
FT                   /product="thiazole biosynthesis protein ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73638"
FT                   /db_xref="GOA:A3MZQ2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZQ2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P30140"
FT                   /protein_id="ABN73638.1"
FT                   /translation="MKTNQFAHFSDYWQTLDWGHLALSLRAKTSADVENALQSSNRDLN
FT                   DFMALISPAAEAYLEPMAQLAQQLTRQRFGNTVGFYLPLYLSNVCTNDCTYCGFSMSNR
FT                   IKRKILDEQEILNEIKAIKSMGYEHLLLVTGEHETKVGMAYFREKLKLIRPHFSALLME
FT                   VQPLQSEEYVELKTLGLDGVLVYQETYNAAEYAKHHLRGQKQDFIYRLDSQDRLGQAGI
FT                   DKIGLGALIGLSNDWRTDIYFVGEHLNYLQNKYWQSRYSISFPRLRPCVGGLQPASQMS
FT                   DKQLLQIICAFRLCFPEVELSLSTRESANFRNNVIPIAINTISAGSKTQPGGYAEEDDK
FT                   HLEQFSPDDERPPQIIAAELVKRGLQPVWKDWEPYLGRTLS"
FT   gene            608236..608859
FT                   /locus_tag="APL_0537"
FT   CDS_pept        608236..608859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0537"
FT                   /product="putative transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73639"
FT                   /db_xref="GOA:A3MZQ3"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZQ3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44659"
FT                   /protein_id="ABN73639.1"
FT                   /translation="MQSTYWRTYTEHLFVQKMADGSLPKSSFQHYLKQDYLYLYQYCRA
FT                   LSLGVYKAENFDQMRYALDATQAILNEVELHLQFCREWGIEEQEVRKTPESSACVAYTR
FT                   YVLDCGMRGGLADLFMAIAPCAIGYAEIGKKLAQTAVENTPYQAWIDTYAAPEYQAAVA
FT                   KLADFLNQLCENLSLEQLTKLQEIFTTATRMEVAFWQMGLDKTM"
FT   gene            608882..609826
FT                   /locus_tag="APL_0538"
FT   CDS_pept        608882..609826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0538"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73640"
FT                   /db_xref="GOA:A3MZQ4"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZQ4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44658"
FT                   /protein_id="ABN73640.1"
FT                   /translation="MKYVKKLAFLTACSLAVQAHAGEKMTVLLDWFVNPDHAAIIVAQQ
FT                   KGYFKQNGLEVELVEPADPSMPPKPVAAGQADIAVDYQPQLQLQVDQGLPLVRFGTLVP
FT                   TPLNSLIVLKNGSVKNIADLKGKKIGYSVSGFEDALLNTMLANSGVSAKDVELVNVNWS
FT                   LSPSLISGQVDAIIGGFRNFELNQMQLEKQEGKAFFAEDFGVPVYEELILVAHKDKAND
FT                   AKFSAFLTSLEQATQYLKQSPDEAWNSFVSYKPKELDTALNRLAWRDTLPKLADEPRKL
FT                   DREKYQKFSEFMQKNDLTKTVPELKVYTVELKP"
FT   gene            609992..610450
FT                   /gene="thiD"
FT                   /locus_tag="APL_0539"
FT   CDS_pept        609992..610450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="APL_0539"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /EC_number="2.7.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73641"
FT                   /db_xref="GOA:A3MZQ5"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZQ5"
FT                   /inference="similar to AA sequence:RefSeq:NP_246198.1"
FT                   /protein_id="ABN73641.1"
FT                   /translation="MGVFDIHSVPLSTIESQLKAIAADFQISAFKIGMLGTAEVIECVA
FT                   NALRQYNFGKLVLDPVMIAKGGAPLLQQNAINALKTHLLPLADVITLNLPEAEALTGVK
FT                   IIDDMTAYQAAKKLQDLGVKTVVIKGGHLADSQSAHCRDWVFTPMPSI"
FT   gene            610464..610877
FT                   /gene="thiE"
FT                   /locus_tag="APL_0540"
FT   CDS_pept        610464..610877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="APL_0540"
FT                   /product="thiamine monophosphate synthase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73642"
FT                   /db_xref="GOA:A3MZQ6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZQ6"
FT                   /inference="similar to AA sequence:RefSeq:NP_438579.1"
FT                   /protein_id="ABN73642.1"
FT                   /translation="MDDNVALAIEIDADGVHVGQKDMSPIMIRQMTDKPLIIGLSNNTL
FT                   EDLWRSEQMIEVDYCGLGPVFPTNSKEKHNPPIGLDFVKKAREAGIRKPIVSIGGVKAE
FT                   HVATLKQNGVDGIAVITAISLASDVSQAVKRLL"
FT   gene            611049..612848
FT                   /gene="lepA"
FT                   /locus_tag="APL_0541"
FT   CDS_pept        611049..612848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="APL_0541"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73643"
FT                   /db_xref="GOA:A3MZQ7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZQ7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VL73"
FT                   /protein_id="ABN73643.1"
FT                   /translation="MKMQNIRNFSIIAHIDHGKSTLSDRLIQTCGGLSDREMEAQVLDS
FT                   MDLERERGITIKAQSVTLNYKAKDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVV
FT                   DAGQGVEAQTLANCYTAIEMDLEVVPILNKIDLPAAEPERVAEEIEDIVGIDAMDAVRC
FT                   SAKTGLGIEDVLEDIVKKIPAPEGDPDAPLQALIIDSWFDNYLGVVSLVRVKNGTIKKG
FT                   DKIKVMSTGQSYNVDRLGIFTPKQVDTAELKTGEVGWVVCAIKDILGAPVGDTLTHHHN
FT                   SATEVLPGFKKVKPQVYAGLFPISSDDYEAFRDALGKLSLNDASLFYEPENSTALGFGF
FT                   RCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVVQTNGETIYVDSPSKLPPISNIA
FT                   EIREPIAECNMLVPQEYLGNVITLCVEKRGVQTNMVYHGNQIALTYEIPMGEVVLDFFD
FT                   RLKSTSRGYASLDYGFKRFQTADMVRVDIMINGDRVDALALIVHKDNAPYRGRELVEKM
FT                   KELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRKKKLLQKQKEGKKR
FT                   MKSLGNVDVPQEAFLAILHVGKD"
FT   gene            612953..613912
FT                   /gene="lepB"
FT                   /locus_tag="APL_0542"
FT   CDS_pept        612953..613912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="APL_0542"
FT                   /product="Signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73644"
FT                   /db_xref="GOA:A3MZQ8"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZQ8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44454"
FT                   /protein_id="ABN73644.1"
FT                   /translation="MAQIMPIIFIAILYGVWNTLDSMQLPNTISILLVALVVICGGFWA
FT                   FYKFSADPRRNAAIAREEKRLNRPLTEEEKAEIQPRSSIGDFFASLFGVLFFVTVLRSF
FT                   IFEPFQIPSGSMEPTLRVGDFLVVNKFSYGIKDPIWQNTLIETGHPERGDVIVFKAPKQ
FT                   AHVDYIKRVVGVGGDRVKYDSHTQQLTVTHADGKQTVFEYGEGKPNADFFYHGEMQIER
FT                   TEKGDVTHQILNNPFAFNYEPYLFAQEGMPSGEWIVPEGHYFVMGDNRDNSEDSRFWGF
FT                   VPEKNVVGKATFIWLSLDKKPNEYPSGLRFDRMFTSIN"
FT   gene            614009..614680
FT                   /gene="rnc"
FT                   /locus_tag="APL_0543"
FT   CDS_pept        614009..614680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="APL_0543"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73645"
FT                   /db_xref="GOA:A3MZQ9"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZQ9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VL75"
FT                   /protein_id="ABN73645.1"
FT                   /translation="MQLERLQKKLSYQFTNLDYLLQALTHRSAGAKNNERLEFLGDSIL
FT                   NFAIGKALFEKFPKANEGELSRMRATLVREQTLAILARQFGLGEYMRLGAGELKSGGYR
FT                   RESILSDCVEAIIAAIYLDAGMDKAIEQVHLWYQDLLAEMKPGDAQKDPKTRLQEFLQG
FT                   RKLPLPTYEVLDIKGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVLAKLTT
FT                   K"
FT   gene            614750..615664
FT                   /gene="era"
FT                   /locus_tag="APL_0544"
FT   CDS_pept        614750..615664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="APL_0544"
FT                   /product="GTP-binding protein Era-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73646"
FT                   /db_xref="GOA:A3MZR0"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZR0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VL76"
FT                   /protein_id="ABN73646.1"
FT                   /translation="MTEQNQQPKTYCGFIAIVGRPNVGKSTLLNKILGQKISITSRKAQ
FT                   TTRHRIVGIHTEDQYQAIYVDTPGLHIEEKRAINRLMNRAASSAIGDVDLIIFVVEGTK
FT                   WTDDDEMVLNKLRSAKAPVVLAINKVDNIKEKDELLPHITELSQKFDFAEILPISAQRG
FT                   KNVHILQKIVRKSLREGVHHFPEEYVTDRSQRFMASEIIREKLMRFTGEELPYSVTVEI
FT                   EQFKLNERGTYEINGLILVEREGQKKMVIGAKGQKIKTIGMEARADMERLFDNKVHLEL
FT                   WVKVKAGWADDERALRSLGYMDE"
FT   gene            615674..616396
FT                   /gene="recO"
FT                   /locus_tag="APL_0545"
FT   CDS_pept        615674..616396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="APL_0545"
FT                   /product="DNA repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73647"
FT                   /db_xref="GOA:A3MZR1"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZR1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VL77"
FT                   /protein_id="ABN73647.1"
FT                   /translation="MIENWHRGFVLHRREYSETSLLVDFFTEEHGRVTLLAKGARRPRS
FT                   PLKAVLQPFTPLLLRWSGKGDLKTLTKAEPASLTLPMQTLALYSGFYVNEVLARVLENQ
FT                   TAYPELFQHYLQCMTRLATQPKQIEPILRTFEFQMLKALGYGVNFSICAATGDPVSPSM
FT                   TYQFRENQGFIASLLQNNYTFLGKDLLAFEQLNFSDKATLQAAKRFTRMALKPYLGSQP
FT                   LKSRELFQSILPNKLKSS"
FT   gene            complement(616487..618049)
FT                   /gene="tadG"
FT                   /locus_tag="APL_0546"
FT   CDS_pept        complement(616487..618049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadG"
FT                   /locus_tag="APL_0546"
FT                   /product="tight adherence protein G"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73648"
FT                   /db_xref="GOA:A3MZR2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZR2"
FT                   /inference="similar to AA sequence:RefSeq:NP_873730.1"
FT                   /protein_id="ABN73648.1"
FT                   /translation="MKITSLSQARRFIQDESGVYTVMGGLLALPILALIFVSLESAGII
FT                   QDQARLSDSLEQAVLSLTAENNSGRKDNDYKLSGSSNKENDSFDISSEVGKRDTQMVTT
FT                   FVQAFLPQTNEKAMRLTPTCKTVTTDNKKGHTSSSEVTCTVSGTVEHKSWFPLKVGNLE
FT                   VIPQQVDVASKSRAFKKNTFNIPIDLMVVADLSGSMNFDLDNKKIINNAKPSKIRILKE
FT                   VLEELAAKSLFNQDSNNNNRIAVAPFALGAQHSNNQCIIPFILKKYSKDRISEKNIKSY
FT                   LSANNNISAKDFALSLSYLVDIDKTINSIGGTFSSNSIIFNKNKFCLGRSNKNTHHWYN
FT                   RDESSNFFSFIKRLHAEGSTLASSGLITASNIMLKEESRSKSLGEQTKRVILVLSDGND
FT                   ELRLNDEGTPFTQYSRITENLLLGQEEQTTDTYPYFMSKPPKKLTSNINVCDRIRNKLD
FT                   EHNEDKNTKIVFVEFGYASKAKQAWQHCVGNGNYYSANDKASLLNSFKQAIGETDDVGR
FT                   SIN"
FT   gene            complement(618073..618669)
FT                   /gene="tadF"
FT                   /locus_tag="APL_0547"
FT   CDS_pept        complement(618073..618669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadF"
FT                   /locus_tag="APL_0547"
FT                   /product="tight adherence protein F"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73649"
FT                   /db_xref="GOA:A3MZR3"
FT                   /db_xref="InterPro:IPR031582"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZR3"
FT                   /inference="similar to AA sequence:RefSeq:NP_873731.1"
FT                   /protein_id="ABN73649.1"
FT                   /translation="MKKIKQLLNNNQGSVTVEFIFIFFLFSVLLIFLVDVAILQSTTGK
FT                   LQRTSYSLLNVVKERNISDGGKEEVTEADVKKLKQLAVKLMGETDDKLIDVTVTYYGSE
FT                   PIKPQDPKSSSATRPEKKLKSSTFSTGNQCKAAYSTNITDAAPLTENFKGSNRYAAIYY
FT                   VTVCRKMTNLFKGLTLAKQDYESDRLRASALGVGR"
FT   gene            complement(618641..619126)
FT                   /gene="tadE"
FT                   /locus_tag="APL_0548"
FT   CDS_pept        complement(618641..619126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadE"
FT                   /locus_tag="APL_0548"
FT                   /product="tight adherence protein E"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73650"
FT                   /db_xref="GOA:A3MZR4"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZR4"
FT                   /inference="similar to AA sequence:RefSeq:NP_873732.1"
FT                   /protein_id="ABN73650.1"
FT                   /translation="MKKTLYRFINNVKGVATIEFSLTIGLFILVLFMIAEGCRVALLSS
FT                   YLDLSVSEASRTTRKNPAGSDYQKLFNDSLKNNGRLWSFLSQDAITEVKVKYANTFDDL
FT                   VEQRLKDESKGSAFAQYSFQYRYTPLFFWVPKGAVEPLFNRNIVVLQEYEKDKATSK"
FT   gene            complement(619129..619881)
FT                   /gene="tadD"
FT                   /locus_tag="APL_0549"
FT   CDS_pept        complement(619129..619881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadD"
FT                   /locus_tag="APL_0549"
FT                   /product="tight adherence protein D"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73651"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZR5"
FT                   /inference="similar to AA sequence:RefSeq:NP_873733.1"
FT                   /protein_id="ABN73651.1"
FT                   /translation="MSSKLLKTIFVSTVLLSLSACSNLTANLSPAQKAEQEKLYEDTKN
FT                   YSALISLYRNQLKLNQDPLVQYKLAKSYYLSGDSKSSLLYLEPLRFKQLPFNEDIELLY
FT                   IRNQIQAGAYNEAYLAATDLIFQSPRSSEAYNLRAISLAQLGKLAAAEKDLNKSRELFI
FT                   HDTIAINNLAMLSILNNDYRNAANLLLPQYLNGSKDSRLIHNLVFALVKAGDTEYALDI
FT                   IRKEHLNSSPEDLVNALQKTEKSPKVGR"
FT   gene            complement(619871..620716)
FT                   /gene="tadC"
FT                   /locus_tag="APL_0550"
FT   CDS_pept        complement(619871..620716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadC"
FT                   /locus_tag="APL_0550"
FT                   /product="tight adherence protein C"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73652"
FT                   /db_xref="GOA:A3MZR6"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZR6"
FT                   /inference="similar to AA sequence:INSD:AAL92472.1"
FT                   /protein_id="ABN73652.1"
FT                   /translation="MNLILFFLGIIVFGIFVLTMAFSHKKKIDKNKEILEGIRPKDNVE
FT                   DNSQKGKTKQQIELELLLVNKNPLLKFLGLVDKNIKVKLLVIALLTLINYIVSDDQTTF
FT                   LLGCAVVVVLAIMFPSITIGVILKSKIKRIMNDIPGFIDLVAVNVQTGISIEAAFKQVA
FT                   IDFEHLNADLTYVILRIIRKAELTSLSTALQDMAISLPTKEIRMFCTVMQQSLNFGSSL
FT                   YEHLTQLSADIREMQLLVMEEKLGTLSAKMSIPLILFIMFPIIILIVAPGAMRVLPNVF
FT                   "
FT   gene            complement(620716..621603)
FT                   /gene="tadB"
FT                   /locus_tag="APL_0551"
FT   CDS_pept        complement(620716..621603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadB"
FT                   /locus_tag="APL_0551"
FT                   /product="tight adherence protein B"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73653"
FT                   /db_xref="GOA:A3MZR7"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZR7"
FT                   /inference="similar to AA sequence:RefSeq:NP_873735.1"
FT                   /protein_id="ABN73653.1"
FT                   /translation="MTLLYYFVFAFGVLLLLFTASAWFKTHKKINARETGFTEKLNKTT
FT                   KKVNDTVQLWIYYFTSGDKNNLVRNIIIHFLIFIGLYYLNANYIRFPNQAFMIAEVIGF
FT                   IFVIWKLGQRRNRKLFNEKFPEVIQVLNSATSSGVSLLQALERCGKDITGPIGEEFAII
FT                   YKRLARGEDVMAVFQDSYSRYPYKEFYFFISIIRTNLSRGGQMREVISRLGRAIADSNK
FT                   MEQKKKAMTSEARMSAAIVACFPVGFFLFMKVTTPENFDFVVNDPAGRIILYYVVGSEL
FT                   LGMFIIWWLMRKST"
FT   gene            complement(621603..622880)
FT                   /gene="tadA"
FT                   /locus_tag="APL_0552"
FT   CDS_pept        complement(621603..622880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="APL_0552"
FT                   /product="tight adherence protein A"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73654"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZR8"
FT                   /inference="similar to AA sequence:RefSeq:NP_873736.1"
FT                   /protein_id="ABN73654.1"
FT                   /translation="MLTKEQQIFFRTELLSNLDVEKLDEIQNERNKLIDELTQSLYRIS
FT                   NLHSIYLTPADAAYMAGLVADEIGGYGPIRELMEDEGVNDILVNGPDNIWVERAGILEK
FT                   TDKKFINNEQLTDIAKRLVARVGRRIDEGMPLVDSRLPDGSRLNVVIQPIALDGTSISI
FT                   RKFSKSKKSLQDLVNYGSMTLDMANFLIIAARSRVNIIVSGGTGSGKTTLLNALSHYIS
FT                   HTERVLTLEDTAELRLEQPHVVRLETRLAGVERTGEISMQDLVINALRMRPERIIVGEC
FT                   RGAEAFQMLQAMNTGHDGSMSTLHANSPRDALARLESMVMMSNASLPLEAIRRNIASAV
FT                   NIIIQASRLNDGSRKVTNITEVMGMENGQIVLQDIFSYEPSKYRDEDNKIIGQFTNHGL
FT                   LTRSVVYQNAQMFNLSDELQNIFKEK"
FT   gene            complement(622889..624016)
FT                   /gene="tadZ"
FT                   /locus_tag="APL_0553"
FT   CDS_pept        complement(622889..624016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadZ"
FT                   /locus_tag="APL_0553"
FT                   /product="flp operon protein D"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73655"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZR9"
FT                   /inference="similar to AA sequence:RefSeq:NP_873737.1"
FT                   /protein_id="ABN73655.1"
FT                   /translation="MLLLDQEGHGKEGVDSIRKIVIISETNRINNQIAQQLRSRGLENI
FT                   EIINTNFLDADSLAFSAEETLGVIIDIKNETQLPKIIERIHSVIPQNVWCCVVGESDSI
FT                   SLSQKFLEQGVLYFHAETQLTQMVARILAGVNIPLVRHTIKISVLGCKGGIGASFISAH
FT                   IAQTISTEKKVPVLLAQGNNGSQDLDLLFDKKIQNDVTEYSASLDLYRGMPSQLTGETL
FT                   HKYNFIIYDQPIFNVSKEDYANMLQHSNTFVLVIERKISSLRVAKQFLDECERMRANTG
FT                   RLIRTFICISDHKQETAKLMATADIERLLKCEIDGVMPYSKRSTNSDTVNIANLDRKGQ
FT                   KEVQTLAMKVIGTLSRQAAKRNKKMEMSFFQKLFK"
FT   gene            complement(624179..624682)
FT                   /gene="rcpB"
FT                   /locus_tag="APL_0554"
FT   CDS_pept        complement(624179..624682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcpB"
FT                   /locus_tag="APL_0554"
FT                   /product="rough colony protein B"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73656"
FT                   /db_xref="InterPro:IPR031579"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZS0"
FT                   /inference="similar to AA sequence:RefSeq:NP_873738.1"
FT                   /protein_id="ABN73656.1"
FT                   /translation="MKKLIAILCSGLGLALTTHAIANAELLENIHPVQPTHSNLVANKS
FT                   LLVQRFVLADKSDVGFENLVTEIKRHAASDKDSQAIHIISNTQSAKDLAKKISKRLKAL
FT                   NVKPNIHITHNKTKNGLYPLYVEIRQIAKRNSLCRIETAEDHMGYDPYYDCALKHNNQI
FT                   QLKY"
FT   gene            complement(624679..626067)
FT                   /gene="rcpA"
FT                   /locus_tag="APL_0555"
FT   CDS_pept        complement(624679..626067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcpA"
FT                   /locus_tag="APL_0555"
FT                   /product="rough colony protein A"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73657"
FT                   /db_xref="GOA:A3MZS1"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZS1"
FT                   /inference="similar to AA sequence:RefSeq:NP_873739.1"
FT                   /protein_id="ABN73657.1"
FT                   /translation="MQINKFSKTLLSSALLGLLALSHSAMAKTFTLEQGQSQLIKTNAK
FT                   IDTIFVSSSEVADYEILDDNSFMLYAKAEGRSEVIAFDANGTPLTEDFVNVNNAINNIA
FT                   ATNQQIQTRFPNSNLTVKKVGKAYVLEGKAKNAAESDEINRIVGESLGAGKKVIETKLK
FT                   HNDSEENVPFLDKYQYEGVINNANEENATQINVKLTVAEVNKTFSDEIGINWSNLSGNF
FT                   FRNLGNAAIQGNFNKNGGQLALVNSNNLNVLISALDNQNNGKILAEPNISMLSGETADI
FT                   LVGGEVPFVQRDKDGELSVLYKEFGIKLAVGAKVQKSDRIRLVLSQSVSTIAGNYEIVN
FT                   SRIPIFNTRRSKSTFEVGNGESFIISGLLNKQDIEGIKKVPVLGDIPILGAFFRNASSS
FT                   RESKELVVVATVNLVKPVDGSQVLYPTFENTGTMERFFNSSSLKNVYHKTLTTNFLKNG
FT                   GFIQ"
FT   gene            complement(626057..626875)
FT                   /gene="rcpC"
FT                   /locus_tag="APL_0556"
FT   CDS_pept        complement(626057..626875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcpC"
FT                   /locus_tag="APL_0556"
FT                   /product="flp operon protein C"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73658"
FT                   /db_xref="GOA:A3MZS2"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZS2"
FT                   /inference="similar to AA sequence:RefSeq:NP_873740.1"
FT                   /protein_id="ABN73658.1"
FT                   /translation="MNYRVLLIISLVIIVLGFGGLFMLPTNEGTTTENVGTTTTSEESS
FT                   NSPVTEKVITTVTLNRDLEKGTLIQPEDYTLSELTVAETSPLVDSDLKALLDAEPNHSL
FT                   QGFLVTENLKMGSLLTPNLIITPEDPRFILLSLEPSQEVAYRIYVQDAEQYILDSVRGG
FT                   DLVSVYSVQQDLAHPEREQNSLVKIADNLKVLQVKSFTQEEVKQGESQNKKDFLGYISL
FT                   KIDATMLKEFYSLDKQAKLIALPSGLEATEKPLNHRGMFIRQLRGKNNAN"
FT   gene            complement(626904..627332)
FT                   /gene="tadV"
FT                   /locus_tag="APL_0557"
FT   CDS_pept        complement(626904..627332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadV"
FT                   /locus_tag="APL_0557"
FT                   /product="flp operon protein B"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73659"
FT                   /db_xref="GOA:A3MZS3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZS3"
FT                   /inference="similar to AA sequence:RefSeq:NP_873741.1"
FT                   /protein_id="ABN73659.1"
FT                   /translation="MTLFISTLIAIMVCLLLVVCWTDLRYRLISNRVIMALLLVIIPFS
FT                   YLMYGTLSWLPAVLCLVIGFVLFLLNVIGAGDVKLLAVLMLAVPSSFAIFFLFLTACSG
FT                   LLIIIIGWLFYRQTIREKGLPYGIAISTGFLTTLLLFN"
FT   gene            complement(627377..627568)
FT                   /gene="flp2"
FT                   /locus_tag="APL_0558"
FT   CDS_pept        complement(627377..627568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flp2"
FT                   /locus_tag="APL_0558"
FT                   /product="minor fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73660"
FT                   /db_xref="GOA:A3MZS4"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZS4"
FT                   /inference="similar to AA sequence:INSD:AAP43982.2"
FT                   /protein_id="ABN73660.1"
FT                   /translation="MEKLLQFYRQQQGITSLEYGLIAVAMAVFVVAVLYGDSSFTDETL
FT                   KKFKQLSELVTSALLSTS"
FT   gene            complement(627628..627858)
FT                   /gene="flp1"
FT                   /locus_tag="APL_0559"
FT   CDS_pept        complement(627628..627858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flp1"
FT                   /locus_tag="APL_0559"
FT                   /product="fimbrial protein Flp precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73661"
FT                   /db_xref="GOA:A3MZS5"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZS5"
FT                   /inference="similar to AA sequence:INSD:AAL93276.1"
FT                   /protein_id="ABN73661.1"
FT                   /translation="MLSNLTTKAYISVTEGIRRFKENQQGVTAIEYGLIAVAVAVLIVA
FT                   VFYNKEGFIQKLQAKFGDLTKAIQNATTTVK"
FT   gene            628451..629671
FT                   /gene="rhlB"
FT                   /locus_tag="APL_0560"
FT   CDS_pept        628451..629671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="APL_0560"
FT                   /product="ATP-dependent RNA helicase RhlB"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73662"
FT                   /db_xref="GOA:A3MZS6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZS6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9CJS1"
FT                   /protein_id="ABN73662.1"
FT                   /translation="MSKHLTEQRFIDFPIHENVLAALDSKGFEFCTPIQAKTLPITLAG
FT                   QDIAGQAQTRTGKTLAFLIAVFHYLLTNDSVTNKNQPRAIILAPTRELAVQIGSDAELL
FT                   VKHSDLKLALAYGGDGYDKQVQAIEQGVDILVGTTGRVIDYVKQGIINLDKVQVVVLDE
FT                   ADRMFDLGFIKDIRYLMRKCPKPEQRLTMLFSATLSARVRELAYEDMNNAQYIEIEPLQ
FT                   RTGHRIKEELFYPSNEDKMALLLTLLEEEWPDRCMIFANTKHKCEEIWNYLVADGHRVG
FT                   LLTGDIAQKKRLALLDSFTKGQLDILVATDVAARGLHIPEVTHVFNYDLPDDCEDYVHR
FT                   IGRTGRAGESGHSISFACERYAVNLPAIEAYIGHHIPVSQYDSGALLTLPKPTRSRTTR
FT                   SYQTKKR"
FT   gene            629789..630211
FT                   /locus_tag="APL_0561"
FT   CDS_pept        629789..630211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73663"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZS7"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ABN73663.1"
FT                   /translation="MKKLVFLTIPFGLSACGSADLQTVWQDVSNLDKLFEPEQRKGVAV
FT                   TKGYPVSDVAMNSTPQKTGKKVVTKQSMTHQRINTAQCKDADDWYLDGYRVGRSFASQK
FT                   AAMYQQRVSYCKGMLSHADQFQQNWEKGFKVGVKKA"
FT   gene            630262..631746
FT                   /locus_tag="APL_0562"
FT   CDS_pept        630262..631746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73664"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZS8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P39342"
FT                   /protein_id="ABN73664.1"
FT                   /translation="MAQYALAQTKTGQIISLNSKMANRHGLIAGATGTGKTVTLRKFAE
FT                   AFSDDGVPVFLVDVKGDLSGLAQAGSLSGKIAERVEQFQLGGESYLSGYPVSYWDVFGE
FT                   TGIPLRTTISEMGPMLLSRLLNLNDTQEGLLNLVFRVADDRGLLLIDLKDLRALLKFVA
FT                   ENAKEFQVEYGNVSAASVGAIQRALLALENEGATNLFGEPALNLQDWMQTRDGKGVINV
FT                   LNSEKLINSPRMYGAFLLWFMAELFETLPEVGDPEKPKFVLFFDEAHLLFDDAPKVLVD
FT                   KIEQVVRLIRSKGVGVYFVTQNPLDLPDSVLGQLGNRVQHALRAFTPRDQKAVKSAAET
FT                   FRANKGVDVVEAITQLGVGEALISVLDEKGMPTPVEVAYIYPPKSQLTPLVVAERDALV
FT                   KQDDLYAYYSQYVDNESAYELLNAQVAQQPAEAEKAEEENDFFGGMIASIFGTKKKKDQ
FT                   TVAEQVVSEVTKSVAKKLTNQVSKQIMRGILGAITK"
FT   gene            631946..632977
FT                   /gene="afuA_2"
FT                   /locus_tag="APL_0563"
FT   CDS_pept        631946..632977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuA_2"
FT                   /locus_tag="APL_0563"
FT                   /product="Fe3+ ABC transporter, iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73665"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZS9"
FT                   /inference="similar to AA sequence:RefSeq:YP_718855.1"
FT                   /protein_id="ABN73665.1"
FT                   /translation="MKAKLTTLALIASAASALLSANTAQAEGRLTVYCTVQNEVCENLT
FT                   QKFAKQYQVETQFIQGGTGTIFGKIKAEKDNPQADIWVGGTIEPHFQAGELGLLESYRS
FT                   PKQAEILPQFKSLMEKRGDKTSIIYMLVLGFGVNSEKLQKLGVKLPQSWDDLLNPAFKG
FT                   EIQLPDPRSSGTTYTIMATLIQKLGEEKAFEYLKKLNENVSQYVKSNLVTANLSRGEST
FT                   ASIGFVHAYATEKEKGALVETVIPAGKVGYALGGASIIKNARNLENAKLFMDYVLSAEA
FT                   QELPWREHGVYQIPTNVNAKASPNSVDPKKLDLLDFDFDKFGSSEEGKRLIDKWLTEIK
FT                   LAK"
FT   gene            633109..635109
FT                   /gene="afuB_2"
FT                   /locus_tag="APL_0564"
FT   CDS_pept        633109..635109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuB_2"
FT                   /locus_tag="APL_0564"
FT                   /product="Ferric transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73666"
FT                   /db_xref="GOA:A3MZT0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZT0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q44123"
FT                   /protein_id="ABN73666.1"
FT                   /translation="MLQRFSHSYFWILLALLAFACLPSQALDYGLFGATKSELAAAMGW
FT                   SNVNISWLWFGGLLIFPAFRFIKDRILRSRIELGLVLLLTLFLLSSAVYLSYRFGYAII
FT                   FLAFALLAISSNALANLKVLQADRFMIVSLLVVILTIALFILYPITTIFSTMFSEGDSF
FT                   AILEQSYLLRIIWNSLSVSATVGLLSTILGLCFALYTTRMASKRTRLLSKFFSVLPIVT
FT                   PPFVVSLGIALMLGRSGYITDFLVEYFGFSASWLYGFTGITVSHTLALTPMAFMILEGA
FT                   LKSSNVALEEASYTLRANNWQTFRFILLPLLKPALANSFLVITVQSLADFSTPFVLGGN
FT                   FDVLASQIYFYLVGTQLDYAAASGLGTILLGFSLLFFLIQYWWIGNGSYVTVSGKGYRG
FT                   TFQPLPSGLKSLIFCILAVWVGFTVLLYGSIFYGSFTVNWGVDHSFTLENYRNLFGQGL
FT                   DQGGFPSLIQTVLFSLIAAPISAVLGLLIAYLLTRRNFVGKQSLEFVTLLCFAVPGTVA
FT                   GVSYVLAFNHSPLYLTGTAVIIVLSMVTRNMPIGMRACMAALQQLDKSLDEASFSLKGS
FT                   SLKTLLFVTLPLLKPAFLSALVTSFVRSMTTISAIVFLVSPSTRVATSYILNRVEDGAY
FT                   GLAVAYGSTLIMVMVLIIGLFGWLMKDKRQF"
FT   gene            635398..638538
FT                   /gene="cirA"
FT                   /locus_tag="APL_0565"
FT   CDS_pept        635398..638538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="APL_0565"
FT                   /product="hypothetical ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73667"
FT                   /db_xref="GOA:A3MZT1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZT1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P45221"
FT                   /protein_id="ABN73667.1"
FT                   /translation="MQADEAATLEQVDVAAQFEKAKAAGDKQKEIVNLSLLGRQTAFTS
FT                   PISVVNYDEKAFEDKAPRNVVDAIAKTDASVMNFGGESNTLSGVYVRNLQLDMRQVSVN
FT                   GLAGLYSTYNSPTVAVASAQLIKGASTATTGMDPEGSAGASMNIETKRATDEEINKIGF
FT                   GWYSNNRLQETFDFGRRFGANNEWGVRVSGKYRDGDTARHDYDEMNKELAIGADYRGDA
FT                   LRVGLDYMYSKRDTDGGRARLQDLQNLAYTVPVAPNGKTNLNPHWLGQTTEDETVMGTF
FT                   EYDLPYGMMLSGGLGHMESRYSGAFGQITSPKQNGEFEVSGIRGFDFRSRTTSGNLKLQ
FT                   GDFEAGAISHNWNLAFDSVIRQRDHDQSSKTNGKIKGGTIYAPNFAQLKNFDLTANTQG
FT                   VDSKLSANSLAFADTLGFVENTVRLTLGGRFQWIKQQDKKAGTEVKADRFSPMVTLAYV
FT                   PNPDLVLYGNYLEDLEPGNIDVETGEMNSPRVSKQIEVGVRKNWDNWLTTTLSAYEIRR
FT                   PGIIRGNKAALKAQAGKEHGKERNRGIEFNTYASLLNNTLRPSLGLTYNQAKVFDFPTY
FT                   ADVITDGVQVTSPRWMAKANVEWDTPFVANLTLNAALQYYGKSYQDTAANYRLPPYTTV
FT                   DFGAKYVVKVADKQTLTLRGWVDIPKGVVFFIYLFIILATALSVWIGRPLIRLNFNKEK
FT                   LQGDYRYSLIRVRDNAESIAFYSGESREQHNLTAKFDYIIANRWKIVRKMLGLDGFNTG
FT                   VTQVAMILPLMLQAPRFFAGQATLGDMHQTVQSFNRLMRALSFFRLFYEEFTLYQARLN
FT                   RLYGFFITLDKLDQMPVNAPYPCSRGFVLKDFGVKDASGQILLKNINIELHTGDSLLIQ
FT                   GASGTGKTTLLKALAGIYPFETFGIAERACLEQPLFLPQRPYVPQGSLREAICYPNLSV
FT                   TDEQLKAAMQECCLHKYVDSLDFDTDWQATLSPGELQRVAFVRILLAKPELIFLDETTS
FT                   ALDEPTEAILYRTIRERLPNSIIISVGHRCTLQQFHNKQINLSERERCECMDCGYCS"
FT   gene            638803..639519
FT                   /gene="rpsB"
FT                   /locus_tag="APL_0566"
FT   CDS_pept        638803..639519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="APL_0566"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73668"
FT                   /db_xref="GOA:A3MZT2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZT2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VL79"
FT                   /protein_id="ABN73668.1"
FT                   /translation="MAQVSMRDMLNAGVHYGHQTRYWNPKMKPFIFGARNGVHVINLEK
FT                   TLPLFNEALAELTRISSNNGKILFVGTKRAASEAVKAAAVDCQQFYVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQTQDGTFDKITKKEALMRTRELETLELSLGGIKDMAGLPDAIFV
FT                   IGADHEHIAIKEANNLGIPVFAIVDTNSTPDGVNYIIPGNDDATRAIQLYLDAAAAAVK
FT                   EGRGSNVEAELEATAE"
FT   gene            639615..640466
FT                   /gene="tsf"
FT                   /locus_tag="APL_0567"
FT   CDS_pept        639615..640466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="APL_0567"
FT                   /product="elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73669"
FT                   /db_xref="GOA:A3MZT3"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZT3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q4QLZ5"
FT                   /protein_id="ABN73669.1"
FT                   /translation="MAEITASLVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSG
FT                   QAKAAKKAGRVAAEGVILARIGAGFGVLVEMNCETDFVAKDAGFLGLANEVADFALANK
FT                   GTTIETLAAQFEEKRAALVAKIGENMNIRRVQYLDGQVIAQYLHGAKIGVLVAGEGSDE
FT                   ELKKVAMHVAASRPEFVNPEDVSAEVVAHERQIQIDIAINSGKPKEIAEKMVEGRMKKF
FT                   TGEVSLTGQAFVMDPSQSVGDYLKSVNTKVTNFIRLEVGEGIEKVEEDFAAEVAKITGG
FT                   NA"
FT   gene            complement(640596..642149)
FT                   /locus_tag="APL_0568"
FT   CDS_pept        complement(640596..642149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73670"
FT                   /db_xref="GOA:A3MZT4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZT4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P71367"
FT                   /protein_id="ABN73670.1"
FT                   /translation="MIQKLTKQQIIYTVIAVLLAIFSGYVMLKGSGFFPSPTLAEILFA
FT                   VILIIALGSSKLSFYGLLLPIAIGYALYTPIGLSFGAPSYQYIASLFATDLLEGREFLS
FT                   QLPLTDYLLAVGMLVAVIFFRKITKKHRINFLNNRAFIVCSLVISLFSLAPFKFFHEFF
FT                   NESMKVKQELEALNNGTEIPSEWGTSTLSADSKYDDYVLVIGESARKDYHHAYGYPVEN
FT                   TPFMSNAKGTLIDGFTAGGTNTIASLKLLLTKPNTQTWEGNYRLNLVELVKSAGIKTYW
FT                   ISNQGYLGRFDTPISSLANKSDEKIFLKTGDSFSQNISDFALLPKFNQIVSQNAQGKRF
FT                   IVVHLYGSHPITCDRLTDYPKIFDDAKIAQKYHNVNCYLSSMKKTDELLEKLYNELNQN
FT                   KAKTGRSFSMVYFSDHGLIHSEDDKGIHILNTAQGKLHFDVPLFKISSDDTERHVYKVF
FT                   KSGLNFTDGIGKWIGITNEKLNPQADLFSNQNDKDDYGLKQVIEKIPAKADPAIVIPIK
FT                   "
FT   gene            642261..642974
FT                   /gene="pyrH"
FT                   /locus_tag="APL_0569"
FT   CDS_pept        642261..642974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="APL_0569"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73671"
FT                   /db_xref="GOA:A3MZT5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZT5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VL82"
FT                   /protein_id="ABN73671.1"
FT                   /translation="MSNPIYKRILLKLSGEALQGDEGFGIDPSILDRMALEIKELIEMG
FT                   VEVGVVLGGGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRADVNAKLMSA
FT                   FQLNGICDTYNWSEAIKMLREKRVVIFSAGTGSPFFTTDSAACLRGIEIEADIVLKATK
FT                   VDGVYDKDPAKFADAKLYNQLTYAEVIEQELQVMDLAAFTLARDHGMPIRVFNMVKPGA
FT                   LKQVITGTAEGTIIS"
FT   gene            643158..643715
FT                   /gene="frr"
FT                   /locus_tag="APL_0570"
FT   CDS_pept        643158..643715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="APL_0570"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73672"
FT                   /db_xref="GOA:A3MZT6"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZT6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VL83"
FT                   /protein_id="ABN73672.1"
FT                   /translation="MINEIKKDTQDRMEKSLEALKSHISKIRTGRAQPSLLDGIQVEYY
FT                   GSATPLRQLANVVAEDARTLAVNVFDRSLISAVEKAILTSDLGLNPSSAGATIRVPLPP
FT                   LTEERRRDLIKIVKGEGEQGKIAIRNVRRDANDQIKALLKDKEISEDEERKAQDEIQKI
FT                   TDGYVKKVDEVLAAKEKELLDF"
FT   gene            complement(643793..645193)
FT                   /gene="gntR"
FT                   /locus_tag="APL_0571"
FT   CDS_pept        complement(643793..645193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="APL_0571"
FT                   /product="HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73673"
FT                   /db_xref="GOA:A3MZT7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZT7"
FT                   /inference="similar to AA sequence:RefSeq:NP_873986.1"
FT                   /protein_id="ABN73673.1"
FT                   /translation="MRSEVKKLSYLLNKQQTTPLYLQLYQQIKRSIYSQELQLGDKLPS
FT                   KRHLCEYLQISQNTVESAYAQLLAEGYIESKPRSGFFVCFQAELTYPSANVVKNFINST
FT                   ASTEYEIDFNSNKIDSQSFPLNRWKKCANWTNKDFLNMGDKQGDLNLRQQISQYLLASR
FT                   GVNCEPEQIVIGAGVESCLQQLILLFQQLNPAMNWAMESYGYPTVEKLLNLYQKPIFKM
FT                   PFSSENYQLDIPFLEQNRINVAYLTPSHLYPFGHILTIGQRQQLLEWAAAQDGRYIIED
FT                   DYDSEFRYTGKPIPSLQSLDRQDKVIYLGSFSKLLMPSLRITFLVLPRNLLREYQKYCE
FT                   FFNASVSRLEQQRLAKFIQSGEFEKHINRMRKIYRRKMELLCELLSPYTKQINYYGEHS
FT                   GFYLLIELLNETRTLDQLVELAKAQKIKVYPIHHQQRRLFSLGFGHLSEEQLREGLDKL
FT                   LYCWGIAC"
FT   gene            645280..646167
FT                   /gene="pdxS"
FT                   /locus_tag="APL_0572"
FT   CDS_pept        645280..646167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="APL_0572"
FT                   /product="pyridoxal biosynthesis lyase PdxS"
FT                   /EC_number="4.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73674"
FT                   /db_xref="GOA:A3MZT8"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZT8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VL86"
FT                   /protein_id="ABN73674.1"
FT                   /translation="MTKILGSDLIKRGMAQMQKGGVIMDVVNAEQARIAEAAGAVAVMA
FT                   LERVPSDIRAAGGVARMANTAIVREVMEAVSIPVMAKARIGHIVEARVLEAMGVDYIDE
FT                   SEVLTPADEEFHLLKSDYTVPFVCGCRDLGEALRRIGEGASMLRTKGEPGTGNVVEAVR
FT                   HLRKVNAQLRKVINMSHDELMTEAKHLGAPFELLLQIKTLGKLPVVNFAAGGIATPADA
FT                   ALMMELGADGVFVGSGIFKSENPEKFAKAIVQATTHYQDYDLIARLSADLGEPMRGLEI
FT                   SELAVQDRMQERGW"
FT   gene            646167..646742
FT                   /gene="pdxT"
FT                   /locus_tag="APL_0573"
FT   CDS_pept        646167..646742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="APL_0573"
FT                   /product="glutamine amidotransferase subunit PdxT"
FT                   /EC_number="2.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73675"
FT                   /db_xref="GOA:A3MZT9"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZT9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VL87"
FT                   /protein_id="ABN73675.1"
FT                   /translation="MNDYTKYTIGVLSLQGAVSEHIAQIETLGAKAIAVKSLSELQQVD
FT                   ALVLPGGESTAMRRLMHSSGLFQALKSFDKPILGTCAGLILLANKLEGGEPPHLAKMNI
FT                   QVQRNAFGRQVDSFQTDLMIKGFADSFPAVFIRAPYISRIGSEVEVLAEWQGNVVFAKQ
FT                   GNLLACAFHPELTSDTRVVELFLQQLKE"
FT   gene            complement(646816..647385)
FT                   /locus_tag="APL_0574"
FT   CDS_pept        complement(646816..647385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0574"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73676"
FT                   /db_xref="GOA:A3MZU0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZU0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44931"
FT                   /protein_id="ABN73676.1"
FT                   /translation="MLLEQAVSFFLFFAIMFIKPQITQCSLTISEQDIHFMRYALELAD
FT                   RAEAIGEIPVGAVLVDQEGNIIGEGWNQVIQLSDPSAHAEMLAIRQAGKVQRNYRLLDC
FT                   TLYVTLEPCTMCAGAILHSRLRRLVFGASDYKTGAIGSRFHLFEDYKMNHFLEIRGGVL
FT                   AEECSQKISRFFQRRRQEQKRQKQAV"
FT   gene            complement(647423..649282)
FT                   /gene="deaD"
FT                   /locus_tag="APL_0575"
FT   CDS_pept        complement(647423..649282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="APL_0575"
FT                   /product="cold-shock DEAD box protein A-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73677"
FT                   /db_xref="GOA:A3MZU1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZU1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44586"
FT                   /protein_id="ABN73677.1"
FT                   /translation="MTTNSLTFADLGLPQSILDAVNDMGFVTPSPIQQETIPHLLAGRD
FT                   VLGMAQTGSGKTAAFSLPLLAQIDPTKRHPQMLVMAPTRELAIQVADACEQFTKNMKGV
FT                   NVVTVYGGQRYDIQLRALKQGSQVVVGTPGRILDHIRRGTLDLSALQSIVLDEADEMLR
FT                   MGFIDDVETVMAELPENHQTALFSATMPEPIRRITRRFMQDPQEVKIQATQRSAPDITQ
FT                   SYWLVNGFRKNDALLRFLEVEEFDAAIIFTRTKTGTIDITELCERNGYRTAALNGDMTQ
FT                   QAREQTLDKLKSGRLDILVATDVAARGIDIERISLVVNFDIPLDAESYVHRIGRTGRAG
FT                   RSGRALLFVEPRERRLLRNIEHLMKKPIDEVAIPNHEILMAKRREKFKARVSKQLEHHD
FT                   LEKYRELLEDLFTADQDHEELAAAMMMMLQEKQKLILPPDPEIRAARGERGRRDRDDRR
FT                   GGRDERRGGREHRENNGVAMDLYRIELGREDGVEVRHIVGAIANEGDISSRYIGHIKLH
FT                   DTYSTIELPQGMPNHIVQHFAQKARVLNKQMQMSLLGPAGGVNSQPFEERRGGGRRNDR
FT                   NDRNDRRSDRGGRSDRREGGFNDRKKGGFKEKRFNDKGRGRRD"
FT   gene            complement(649504..650445)
FT                   /gene="nlpI"
FT                   /locus_tag="APL_0576"
FT   CDS_pept        complement(649504..650445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpI"
FT                   /locus_tag="APL_0576"
FT                   /product="lipoprotein NlpI-like precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73678"
FT                   /db_xref="GOA:A3MZU2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZU2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44585"
FT                   /protein_id="ABN73678.1"
FT                   /translation="MCLLIFKVFHLRFLMLNLLALLFLTGCISRHSSEMVSSNRLALAE
FT                   LNPQLRFEQEVMVVRLTQVLQEAKLNPDERAALHFERGVLYDSLGLWSLARYDFTQAIG
FT                   LNQKMVAAYNYMGLYLLLEDDYDSAIDAFNAVLELDPNYNYTYLNRGLAFYYSGRYSEA
FT                   QRDLLRFYDAEKQDPYRALWLYFNELELKPTEAKNNLIKRAETLSPEFWGTNVVHYFLG
FT                   DLTLSELRARMDAEAQPNTASYAEILTETYFYLAKQKLKLNKTDEAITLFRLSLANQVF
FT                   NFVEYRFALFELSQLRGGSNVAVQDDPVVGKN"
FT   gene            complement(650506..652653)
FT                   /gene="pnp"
FT                   /locus_tag="APL_0577"
FT   CDS_pept        complement(650506..652653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="APL_0577"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73679"
FT                   /db_xref="GOA:A3MZU3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZU3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44584"
FT                   /protein_id="ABN73679.1"
FT                   /translation="MNPIVKQFKYGQHTVTLETGAIARQATAAVMASMDDTTVFVTVVA
FT                   KKEVKEGQDFFPLTVDYQERTYAAGRIPGGFFKREGRPSEGETLIARLIDRPVRPLFPE
FT                   GFFNEIQVIATVVSVNPQISPDLVAMIGASAALSLSGVPFNGPIGAARVGFINDQFVLN
FT                   PTTSEQKISRLDLVVAGTDKAVLMVESEADILSEEQMLSAVVFGHQQQQVVIENIKEFV
FT                   KEAGKPRWDWVAPEPNTALINQVKALAEARIGDAYRITEKQARYEQIDAIKADVIAQLT
FT                   AQDETVSEGAIIDIITALESSIVRGRIIAGEPRIDGRTVDTVRALDICTGVLPRTHGSA
FT                   IFTRGETQALAVATLGTERDAQIIDELTGEKSDRFLFHYNFPPYSVGETGRIGSPKRRE
FT                   IGHGRLAKRGVLAVMPTAEEFPYVVRVVSEITESNGSSSMASVCGASLALMDAGVPIKA
FT                   AVAGIAMGLVKEEEKFVVLSDILGDEDHLGDMDFKVAGTREGVTALQMDIKIEGITPEI
FT                   MQIALNQAKGARMHILSVMEQAIPAPRADISDFAPRIHTMKIDPKKIKDVIGKGGAVIR
FT                   ALTEETGTSIDIDDDGTVKIAATDNNAAKAVMARIEDIVAEVEVNAIYKGKVTRVVDFG
FT                   AFVSILGGKEGLVHISQITNERVERVADYLSVGQEVTVKVVEIDRQNRIRLTMKDLNND
FT                   TPVAENVTEEAEVSSEQQAEI"
FT   gene            652954..655200
FT                   /gene="parC"
FT                   /locus_tag="APL_0578"
FT   CDS_pept        652954..655200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="APL_0578"
FT                   /product="DNA topoisomerase 4 subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73680"
FT                   /db_xref="GOA:A3MZU4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZU4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P43702"
FT                   /protein_id="ABN73680.1"
FT                   /translation="MSIEINYEGVEQMPIKRFTEDAYLNYSMYVIMDRALPFIGDGLKP
FT                   VQRRIIYAMSELGLNASAKYKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPL
FT                   IDGQGNWGAPDDPKSFAAMRYTESKLSKMAEVLLGELGQGTVDYQPNFDGSLEEPKYLP
FT                   ARLPHILLNGTMGIAVGMATDIPPHNINELAEASVMLLENPKASLAELMTVVQGPDYPT
FT                   EAEIITPKADIAKMYEQGKGSIKMRAVWKKEDGEIVISALPHQASPSKVIEQIATQMRN
FT                   KKLPMVDDIRDESDHENPIRIVIVPRSNRIDFEALMDHLFATTDLEKSYRVNMNMIGLD
FT                   GKPAVKNLQTILTEWLTFRRTTVTRRLNYRLDKILNRLHILDGLMIAFLNIDEVIEIIR
FT                   NEDEPKTALMARFNLSEAQAEAILNLRLRHLAKLEEHELQAEKSQLEKERDELQLTLGS
FT                   ERRLNTLIKKEIQADAKAFASPRRSPLVERAEAKAISESDLTPTEDVTVILSEKGWVRC
FT                   AKGHDIDVQGLSYRAGDGYLAHAYGRSNQPVVFLDSTGRAYALDPTSLPSARSQGEPLT
FT                   GKITLPEGATVQQVLMANSDTKVLMASDSGYGFICSFEDLVSRNKAGKAVISLTENAKV
FT                   LPPQLIDNEAELSLVAMSSVGRMLVFPITELPQLSKGKGNKIINISAQAAKEGNELLAR
FT                   LLLVKPTQSLVFVSGKRKITLKPSDIDNYRGERARKGSQLVRGLSATSTVEIVD"
FT   gene            655340..656671
FT                   /gene="mukF"
FT                   /locus_tag="APL_0579"
FT   CDS_pept        655340..656671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mukF"
FT                   /locus_tag="APL_0579"
FT                   /product="chromosome partition protein MukF"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73681"
FT                   /db_xref="GOA:A3MZU5"
FT                   /db_xref="InterPro:IPR005582"
FT                   /db_xref="InterPro:IPR033439"
FT                   /db_xref="InterPro:IPR033440"
FT                   /db_xref="InterPro:IPR033441"
FT                   /db_xref="InterPro:IPR036141"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038198"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZU5"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VL94"
FT                   /protein_id="ABN73681.1"
FT                   /translation="MQNELAQTIPELINWTKEREFSLSLSSDRLAFLLAISIYNNEQTD
FT                   GELLESDLIDLFRYVSEVFDQSEATLTQRANNAINDLVKQRFLNRFSSEFTEGLAIYRI
FT                   TPLGVGVADYYVRQREFSTLRLSIQLSIVADEIQRASSAAEEGGDERFWRNNVFAPLKY
FT                   SVAEIFDSIDLSQRMMDENQHQIRERIAELLSQNWHEAILSCEQLLDETSGNLRELQDT
FT                   LNAAGDKLQAQLLRIQSCLIGRDDLDFVDQLIVNLQNKLDRIISWGQQAIDLWIGYDRH
FT                   VHKFIRTAIDMDKNRVFGQRLRQSIQDYFKCALVTLYCEAESLLDLRDDETMLNEAEAV
FT                   GELPSELEYESLSDVQEQIISVMQAHLAPFRAEGKPIDLGAVLREQLALYPQSRHFDVA
FT                   RIIVDQAVKLGMASLDSQAVYPEWQAINDKGAEVQANVIDQYNK"
FT   gene            656751..657464
FT                   /gene="mukE"
FT                   /locus_tag="APL_0580"
FT   CDS_pept        656751..657464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mukE"
FT                   /locus_tag="APL_0580"
FT                   /product="chromosome partition protein MukE"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73682"
FT                   /db_xref="GOA:A3MZU6"
FT                   /db_xref="InterPro:IPR007385"
FT                   /db_xref="InterPro:IPR042037"
FT                   /db_xref="InterPro:IPR042038"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZU6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VL95"
FT                   /protein_id="ABN73682.1"
FT                   /translation="MTEQIQDVISPKLTVAIANPIFPELDSQLRAGRHINTEQLDEHAF
FT                   LMDFQAELESFYRRYHVELIRAPEGFFYLRPKASTLIARSAMSEMEMLVGKVLCYLYLS
FT                   PERLAQQGIFSQDDVYEELMNLADESKLLKAVNPRSTGSDLDKAKLAEKVGGALRRLAR
FT                   IGIITRIGDQNSKKFVISESVFRFGADVRVGDDPREAQLRLIRDGEATTPAILAEQAVE
FT                   FAENSATDELEDETE"
FT   gene            657485..661975
FT                   /gene="mukB"
FT                   /locus_tag="APL_0581"
FT   CDS_pept        657485..661975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mukB"
FT                   /locus_tag="APL_0581"
FT                   /product="chromosome partition protein MukB"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73683"
FT                   /db_xref="GOA:A3MZU7"
FT                   /db_xref="InterPro:IPR007406"
FT                   /db_xref="InterPro:IPR012090"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032520"
FT                   /db_xref="InterPro:IPR042501"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZU7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VL96"
FT                   /protein_id="ABN73683.1"
FT                   /translation="MTDTNELFEDQTTALQNSAPIAPLANPQHTVSRGKFRSLTLINWN
FT                   GFFARTFDLDELVTTLSGGNGAGKSTTMAGFVTALIPDLTLLNFRNTTEAGSTSSSRDK
FT                   GLYGKLKAGVCYAVLESLNSRGQRVITGVRLQQVAGRDKKVDIRSFSLQNVPMSDSIIS
FT                   ILTEQVGEKARVLPLADLKDKFDGSEVLFKQYHSITDYHSFMFDLGVIPKRLRSSADRS
FT                   KFYKLIEASLYGGISSVITKSLRDYLLPENTGVRQAFQDMESALRENRMTLEAIKVTQS
FT                   DRDMFKRLITESTNYVSADYMRNANERRGNVQIALEQRRAWYESKSKLELEQQRLIEFS
FT                   REVADISENESSLEAEYNSANDHLNLVMNALRHQEKIERYQNEVAELNEKLEEQQIALE
FT                   EVSEQVETAQARADDADDQVEELRSQMADYQQALDAQQTRALQYQQAIAALEKAKQLCG
FT                   LPHLDLHNVEDYHAEFAAQADDLTDQVFELEQRLSVSDMAKTQFEKAYELVCKISGEID
FT                   RSEAWNEARSLLTAFTDQKMQATQAVALRQKLADLEQRLHQQQNAERLLAEFNQKAQTQ
FT                   FETAEELEGYFEQQQARLEDVEAELAEFVEVRSTQRQQREQLNQQYNQLAKTAPAWHTA
FT                   QSALARLEEQCGEKFEASQSVMQFMQNMLTKEREATLARDELARREAALDAQITRLSQP
FT                   DGSDDVRLNQLAERFGGVLLSELYDDVSIDDAPYFSALYGEARHAIVVRDLESVKAQLE
FT                   KLDDCPTDLYLIEGDPSAFDDAVFTAEELAEGVVVKVSDRQWRYSKFPEVPLFGRAARE
FT                   KHLETLKAERDEVSEQHAERAFDVQKCQRLHQHLSQFVGTHLSLAFQPNPEEQMQEIAA
FT                   ERTEIERELNQAAGNEQQLRSQLDSAKAKLQMLNKILPLVSLLEDETLADRAEECRAQL
FT                   DEAEEDEQFVRQFGNYLTQLEPIAASLKSDPAKFEQLEQDYRQAKAEQKQVQQKVFALS
FT                   DVIQRRVHFSYEEAIGSEGSALTEQLRTRLENAQREREQARDQLRQAQAQFTQYNQVLT
FT                   GLRSSCDAKTQMLQELIREIDDLGVRGDIGAEERARSRRDELQQRLSQQRSRKGYLDKQ
FT                   LGTIEAEIDNLTRTLRKAERDYHTQRELVVQAKVSWCLVLKLSRNSDVEKRLNRRELAY
FT                   QSAEELRSISDKALGALRTAVADNEYLRDSLRASEDSRKPENKVAFFIAVYQHLRERIR
FT                   QDIIKTDDPIDAIEQMEIELSRLTNELTSREKKLAISAESVANILRKTIQREQNRILQL
FT                   NQGLQNIAFGQVKGVRLVVNIRDTHAILLNALSNGREEHKDLFDSQKLSFSEALAMLYK
FT                   RVNPHIEMGQRTPQTIGEELLDYRNYLDLEVETFRGADGWMRAESSALSTGEAIGTGMS
FT                   ILLMVVQSWEEESRRMRAKDILPSRLLFLDEAARLDATSINTLFELCERLDMQLLIAAP
FT                   ENISPERGTTYKLVRKITNNQEYVHVVGLKGFGQQ"
FT   gene            662052..663227
FT                   /gene="sotB"
FT                   /locus_tag="APL_0582"
FT   CDS_pept        662052..663227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sotB"
FT                   /locus_tag="APL_0582"
FT                   /product="putative sugar efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73684"
FT                   /db_xref="GOA:A3MZU8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZU8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q9ZK31"
FT                   /protein_id="ABN73684.1"
FT                   /translation="MITRKEHRKLSFLRVFVFSLSAFIFNTTEFIPVALLSDIAVSFEM
FT                   ETATTGLMITAYAWVVFLAALPFMLLTAKVERKRLLLVLFAIFIVGHIVSYFATSFTML
FT                   LISRMGIALTHAIFWSITASLVIRVAPKDKKQQALGLLALGNSLAMIFGLPLGRMIGQA
FT                   FGWRETFALIGIIALGIMLIMWKLLPHLPSKNSGSLAGLPILIKRPMLVGIYLLTAVVI
FT                   SGHFTGYSYIEPFMVKISQMSEQTGTAILLVFGLAGVAASFLFGRLYPKAPKKFIISNM
FT                   ALIMLMQMCLLPFSNHIAAMFGIVFIWGIGITAMSIALQMQVLDLAPDATDVATAIYSG
FT                   IYNVGIGGGALIGSQVIQHIGLPYIGWIGGGLAGFAILWFVFISLRYRVIK"
FT   gene            complement(663279..665018)
FT                   /locus_tag="APL_0583"
FT   CDS_pept        complement(663279..665018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73685"
FT                   /db_xref="GOA:A3MZU9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZU9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44898"
FT                   /protein_id="ABN73685.1"
FT                   /translation="MLNRLRRLLPSNSLQYREETSQRITWGHWFALFNVVLALLIASRY
FT                   AFNADWPNTLSGKLYFFTSLFGHFSFIVFAVYLLLLFPLSFLIKNERTFRGLSVILATI
FT                   GQTVLLLDTEVFKQFYLHLSPLVWDLLVNPDQGELTRQWQLLFVPMPLILLVEMLYSRW
FT                   CWQKLRSFNRQTWGKYVAYFFVSCFTATHLVYAWADMTLYRPITAQKANYPLSHPMTAR
FT                   TFLQKHGLIDQAELQQEIEESGRLDSFYLNYPKHTLIFTQKPTTNLLFINLSGLNNDAI
FT                   TAEYMPTLTEISRKSHRFMQHYSSGDSAAAGVLGLFYSLSGKYLDAVLGNKETSPLLLA
FT                   FRQSGYQLGLFSHNGFADPIYHQAVFAGILLSESQNNLDAIAQWKQWVTQRSLNEPFFS
FT                   YLDLAMPSANDYVQQTKLLDWQLNEIWTQLETHALLANTLVILTADQAIPSDKQSENSF
FT                   AKQHIQVPMMMYWQGEGKQYDFLSSHVDILPTLLNQFFKIKNPLSDYAQGIDLTTQNKR
FT                   LWLLASNHKWDVAIMPDGEQYHIDKRGHFENFNAQGEKVKSERPPLALFLHMIQQSNQF
FT                   VEK"
FT   gene            complement(665021..665242)
FT                   /locus_tag="APL_0584"
FT   CDS_pept        complement(665021..665242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73686"
FT                   /db_xref="InterPro:IPR009857"
FT                   /db_xref="InterPro:IPR023202"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZV0"
FT                   /inference="similar to AA sequence:RefSeq:NP_873916.1"
FT                   /protein_id="ABN73686.1"
FT                   /translation="MATQSKYQSKQFDALSGDLIAILEKHKAPVDLSLMALGNMVTNIL
FT                   LENVQTGAQRLALAEAFSNALKNSLKIK"
FT   gene            665452..666030
FT                   /locus_tag="APL_0585"
FT   CDS_pept        665452..666030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73687"
FT                   /db_xref="GOA:A3MZV1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZV1"
FT                   /inference="similar to AA sequence:RefSeq:YP_248592.1"
FT                   /protein_id="ABN73687.1"
FT                   /translation="MSKKERLNDMARQILSAAELLIAKEGLQNLSMRKIASEAGIATGT
FT                   LYLYFKTKDELLDCLAEQLHERYYRYLNIQFNPNSSFFDQYREIWNRKRHFLTDNPIIA
FT                   ANLSQYQAMLGFNSILCRIMNDSEFIWNRFVEEGKKQGVIIPLPNDLLYCMSIGVATDI
FT                   AYLEQVKQEPVSTEFFEETILRTWKAIAC"
FT   gene            666063..667268
FT                   /locus_tag="APL_0586"
FT   CDS_pept        666063..667268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0586"
FT                   /product="putative RND efflux membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73688"
FT                   /db_xref="GOA:A3MZV2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZV2"
FT                   /inference="similar to AA sequence:RefSeq:NP_873915.1"
FT                   /protein_id="ABN73688.1"
FT                   /translation="MTTENQKPGKGRKFLIAITLVVVLVAFVGVAGMQKFIASKKAEAA
FT                   ANMPETVSEITAMTISTQEWTPSISAVGYIRPNQGAMLSAEASGTVTKVHVRSGQRVNK
FT                   GDLLVEFDSAVEEATLRASQAQLPNVKANYERYRNLIASNSASKAEFDNAQSAYNQLLA
FT                   NIESLKASIARRKVYAPFNGLAGIVNVNVGQYITTGTQIVRVEDQSSMKVRFTLPQTDV
FT                   EKIVVGQKVTAVVDALPGQTFPASIVAIDPAVDHTTGLINVEAVITENQNKLLSGMFAR
FT                   LNVALPTEKDQIVVPQIAVTYTMYGETLYVLQPLSEADKQLATKMAEQNPKLKVEKMYR
FT                   VKQVEVKTLDRSGIYAQLAKGVKTGDLIVTGGFQRLSNNALVIVSDQEAVGVTQPAKES
FT                   RL"
FT   gene            667281..670400
FT                   /gene="acrB"
FT                   /locus_tag="APL_0587"
FT   CDS_pept        667281..670400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="APL_0587"
FT                   /product="acriflavine resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73689"
FT                   /db_xref="GOA:A3MZV3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZV3"
FT                   /inference="similar to AA sequence:RefSeq:NP_873914.1"
FT                   /protein_id="ABN73689.1"
FT                   /translation="MKFTDIFIKRPVLAVCISLLITILGLQSINKLQVREYPEMTISIV
FT                   TVKVNYSGADASLMQALVTSQIEEAVAQADNIDYVTSSSGPSSSTTTIKMKLNTNPQMA
FT                   LADISAKVNAIRANLPSGIDDPSISVSSGSNDALMYIRFVSDELSTPQITDYINRVVKP
FT                   QFFTVNGVSSVDIFGAANFGLRIWLDPDKMAGNNLSGAAVLSALSANNLNTAAGNANGY
FT                   YTVYKNKVESSTPSVEELENVTISTTSDGRIVKLKDIAKVELDKYQDASRAIADGKEAV
FT                   VLAVSAATTANSLTVAKDIYPVFDLITKNLPSSVNGQIMYDKTVAINSSINEVIKTIGE
FT                   ATVIVLAVIILFLGSLRAMIVPIITIPISLIGVLFFLQMFGFSINLLTLLALVLAIGLV
FT                   VDDAIVVLENVERHVKEGKTPFDAAIIGTREIALPVISMTITLAAVYSPMALMEGVTGS
FT                   LFKEFALTLAGAVFISGIAALTLSPMMSSRVLKEHNEENESRFSKCINTMLDKMTACYT
FT                   NMLRGVMSVRWLVVIFAMSIFAVLPTLLTSLSSEVAPTEDRGFVVGIGNGPSNTNLDYT
FT                   QAATEKFNEDVGKIPEVASMMTVSGFNGANSALSIISLKDWSERERERKPISADVSAIA
FT                   KNVVGMDINAISFPEISTGENGLPFSLVITTADNYVKLADVANDFLKKAQASGQFFFSS
FT                   LDLKFDTVTMKWKFDREKMGTYGVTMQQVSGTLGAYLSGAIITRVDIDSRAYPIVSQAV
FT                   RQDRLNPQDLVNYYVTTASGESVPLSSFVSLELSTEPAALPRMNQLNSATISGVVSSSI
FT                   GDAVNWAKAELDRSLPQGYQYDFKSEARQYVQEGNAMAMTFALAVVIIYLVLAIQFESW
FT                   RDPMVILVSVPLALSGALVVLNVLGIAGIAGATLNIYSQVGLVTLVGLITKHGILMCEV
FT                   AKEEQLHNGLSRFDAIVHSATIRLRPIMMTTAAMVAGLIPLLFAMGAGAIARFSMGMVI
FT                   VAGLSIGTLFTLFVLPVIYTFLGQEHKPLREFDEEKYAKASVEKIEHTGM"
FT   gene            670619..671992
FT                   /gene="glmU"
FT                   /locus_tag="APL_0588"
FT   CDS_pept        670619..671992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="APL_0588"
FT                   /product="bifunctional protein GlmU"
FT                   /EC_number="2.3.1.157"
FT                   /EC_number="2.7.7.23"
FT                   /note="Includes: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   Glucosamine-1-phosphate N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73690"
FT                   /db_xref="GOA:A3MZV4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZV4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VLE6"
FT                   /protein_id="ABN73690.1"
FT                   /translation="MTQLSVVILAAGKGTRMYSDLPKVLHTVAGKPMVQHVIDTAKQID
FT                   AKQIHLIYGHGGELLQQRLSSEPVNWVLQAEQLGTGHAMQQAAPFFADDENILMLYGDA
FT                   PLITKETLERLIAAKPANGIALLTVELENPTGYGRIIRENGSVVAIVEQKDANAEQLKI
FT                   REVNTGVMVASGASFKKWLANLNNNNAQGEYYITDVIAMANQDGYKVQAVQASEFMEVE
FT                   GANNRLQLAALERFYQKTQAEKLLLAGVRLIDPARFDIRGSLTHGKDVEIDVNVIIEGE
FT                   VKLGNRVRIGAGCVLKNCEIGDDVEIKPYSVIEDAVVGKAAQIGPFSRLRPGANLAEET
FT                   HVGNFVEIKNAQVGKGSKVNHLTYVGDAEVGSNCNIGAGVITCNYDGANKFKTIIGNNV
FT                   FVGSDSQLVAPVTIADGATIGAGATVTKDVAENELVISRVPQRHIQGWQRPTKKKIAD"
FT   gene            complement(672091..672408)
FT                   /locus_tag="APL_0589"
FT   CDS_pept        complement(672091..672408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73691"
FT                   /db_xref="GOA:A3MZV5"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZV5"
FT                   /inference="similar to AA sequence:RefSeq:YP_254069.1"
FT                   /protein_id="ABN73691.1"
FT                   /translation="MFKVYGLTVDDQTRCQHYHSVLDIIAIKFKCCNKFYPCYQCHQAC
FT                   ETHDIERWQATEFDKHAILCGNCRQTLTIRQYMQVTHCPYCQAQFNSGCQKHYSIYFEV
FT                   E"
FT   gene            complement(672412..673032)
FT                   /locus_tag="APL_0590"
FT   CDS_pept        complement(672412..673032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73692"
FT                   /db_xref="InterPro:IPR015037"
FT                   /db_xref="InterPro:IPR037226"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZV6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44134"
FT                   /protein_id="ABN73692.1"
FT                   /translation="MLKLAKKALNKFLRKTINRRNRQQLQNHTMSVLSINCNGAFILHD
FT                   LNEQFRSPFVNLYLSPTDFLKYLKNMPHYMQAELTFIASEKNYPVGKLDDLTIHFMHYN
FT                   SEQEAASKWAERSKRINLDNLFVMMTDRDGCTYQDLQEFDRLPFANKVVFTHKPYPELK
FT                   SAFYIEGFENQTQVGDLFEFSGWDGKKYYDQLDYVNWFNGKGF"
FT   gene            673326..674984
FT                   /gene="pgm"
FT                   /locus_tag="APL_0591"
FT   CDS_pept        673326..674984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="APL_0591"
FT                   /product="phosphoglucomutase/phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73693"
FT                   /db_xref="GOA:A3MZV7"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZV7"
FT                   /inference="similar to AA sequence:RefSeq:NP_246011.1"
FT                   /protein_id="ABN73693.1"
FT                   /translation="MSTIFTIAQNWLAQDTDQETRAELAQLIEMAHAGDEKALAELTAR
FT                   FDGRLQFGTAGLRGRLQAGSMGMNRVLVAQAAGGLADYLKGYDKEPSIVIGYDGRKNSD
FT                   VFARDTAEIMAGAGIKAYLLPRKLPTPVLAYAIKYFDTTAGVMVTASHNPPEDNGYKVY
FT                   LGKANGGGQIVSPADKDIAALIDKVAAGNIADLPRSQDFTVLDDEIVEAYIEKTAALAK
FT                   EQAAEINYVYTAMHGVGYEVLSKTLEKAGLPQPHLVAEQIQPDGSFPTVNFPNPEEKGA
FT                   LDLAIKLAKEKNAEFIIANDPDADRLAVAMPDAQGNWKGLHGNVVGCLLGWYLAKQYHA
FT                   QGKQGVLACSLVSSPALAEIAKKYGLQSEETLTGFKYIGKVNGLLFGFEEALGYLVDPD
FT                   KVRDKDGISAAIVFLDFIRNLKAQGKTLQDAITDFNNEFGAYVSGQISIRVSDLSEIGK
FT                   LMTALRNNPPSAIGSFNVVQLIDHTKTDRQSDILVFVLENGSRLITRPSGTEPKIKFYL
FT                   DAKGKDAADADKVLSQFDESVRELLRQEQYGKQDC"
FT   gene            complement(675066..676637)
FT                   /gene="guaA"
FT                   /locus_tag="APL_0592"
FT   CDS_pept        complement(675066..676637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="APL_0592"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73694"
FT                   /db_xref="GOA:A3MZV8"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZV8"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q65UI1"
FT                   /protein_id="ABN73694.1"
FT                   /translation="MTNIHNHKILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQI
FT                   REFNPTGIILSGGPESTTEENSPRAPEYVFNAGVPVLGICYGMQTMAMQLGGLTETSDH
FT                   REFGYASVDLQATDALFAKLNDNLTASEPKLDVWMSHGDKVTRLPQGFQVTGITPTCPI
FT                   AAMSDESRRFYGVQFHPEVTHTKSGLELLTNFVVGICGCECKWTAENIIERRVARIKEQ
FT                   VGDDEVILGLSGGVDSSVTALLLHRAIGKNLHCVFVDNGLLRLNEGDQVMEMFGDKFGL
FT                   NIIRVNAEDRFLDALKGIDEPEAKRKTIGKVFVDVFDDESKKLTSVKWLAQGTIYPDVI
FT                   ESAASKTGKAHVIKSHHNVGGLPDYMKLGLVEPLRELFKDEVRKIGLALGLPAEMLNRH
FT                   PFPGPGLGVRVLGEIKKEYCDLLRKADAIFIEELYKADWYYKVSQAFTVFLPVKSVGVM
FT                   GDGRKYDWVVSLRAVETIDFMTAHWAHLPYDLLGKISNRIINEVNGISRVVYDVSGKPP
FT                   ATIEWE"
FT   gene            complement(677056..678519)
FT                   /gene="guaB"
FT                   /locus_tag="APL_0593"
FT   CDS_pept        complement(677056..678519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="APL_0593"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73695"
FT                   /db_xref="GOA:A3MZV9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZV9"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44334"
FT                   /protein_id="ABN73695.1"
FT                   /translation="MLRIKQEALTFDDVLLVPAHSTVLPNTADLSTQLTKDIRLNIPML
FT                   SAAMDTVTETKLAISLAQEGGIGFIHKNMSIERQADRVRKVKKFESGIVSEPVTVSPDL
FT                   TLAELAELVKKNGFAGYPVVDSENNLIGIITGRDTRFVRDLTKTVAKVMTPKERLVTVK
FT                   ESANREEILELMHQHRVEKVLMVDDNFKLKGMITVKDFQKAEQKPNACKDEFGRLRVGA
FT                   AVGAGPGNEERIDALVKAGVDVLLIDSSHGHSEGVLQRVRETRAKYPNLPIVAGNIATA
FT                   EGAIALADAGASAVKVGIGPGSICTTRIVTGVGVPQITAIAEAAAALEGRGIPVIADGG
FT                   IRYSGDISKAIAAGASCVMVGSMFAGTEEAPGEIELYQGRAFKSYRGMGSLGAMSKGSS
FT                   DRYFQSDNAADKLVPEGIEGRIPYKGFLKEIIHQQMGGLRSCMGLTGSATIEDLRTKAQ
FT                   FVRISGAGIKESHVHDVTITKEAPNYRMG"
FT   gene            678772..679398
FT                   /gene="ftsJ"
FT                   /locus_tag="APL_0594"
FT   CDS_pept        678772..679398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="APL_0594"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73696"
FT                   /db_xref="GOA:A3MZW0"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZW0"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VLF2"
FT                   /protein_id="ABN73696.1"
FT                   /translation="MGRKRSASSSRWLAEHFKDQFVQKAHKQKLRSRAYFKLDEIQQTD
FT                   RLFKPGMTVVDLGAAPGGWSQYAVTQIGSKGRIIACDILDMNPIVGVDFLQGDFREESV
FT                   LNALLERVGDDMVDVVMSDMAPNFSGMPSVDIPRAMYLVELALDMCRQVLAPKGSFVVK
FT                   VFQGEGFDDYLRDIRAMFTTVKVRKPEASRDRSREVYIVATGYKG"
FT   gene            679502..681424
FT                   /gene="ftsH"
FT                   /locus_tag="APL_0595"
FT   CDS_pept        679502..681424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="APL_0595"
FT                   /product="cell division protease FtsH-like protein"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73697"
FT                   /db_xref="GOA:A3MZW1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZW1"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P71377"
FT                   /protein_id="ABN73697.1"
FT                   /translation="MVKNIILWVVVAIVLMTAFEGFNSNFGNNNTVAYSTFLNDIKSNN
FT                   LKEVDFKRNDETISVTKNDGTQYQTVMPMYDEYLLADLAKTNATVTGQPEERRGLLSQI
FT                   LISWFPMIMLIGFWLFYMRQMQGGGGRGAMSFGKSKAKMLTAEQVKTRFTDVAGCDEAK
FT                   EEVGEVVDFLKDPSKFQKLGGRIPKGILMVGPPGTGKTLLAKAIAGEAGVPFFTMAGSD
FT                   FVEMFVGVGASRVRDLFEQAKKNAPCIIFIDEIDAVGRKRGGAGFSGGHDEREQTLNQM
FT                   LVEMDGFEGSEGVIIIAATNRADVLDDALTRPGRFDRQVTVDLPNVKGREQILKVHMKK
FT                   VPLAPDVDPMVVARGTPGYSGAQLANLVNEAALFAARKNQRVVTMLDFEQARDKINMGP
FT                   ERRSNTMTEKELMNTAYHEAGHVIVGYLMPEHDPLNKVTIVPRGQALGFAQFLPEGDRV
FT                   SETFTKLESQLSTLFAGRIAEGLIFGEDKITTGASSDIHRATQIARAMVTQWGFSKELG
FT                   PLFYQNEDGMGAIKGVSEESQKLIDQEMRKLIDRNYERAKKTLEDNIDILHAMKDALLK
FT                   YETLDRKQIDDLMNRRPVGEPAGWNDKGDDSSSSDSATTSKSDEEQPSKDIPHTDAVAD
FT                   KQADA"
FT   gene            681662..682876
FT                   /gene="tyrP-A"
FT                   /locus_tag="APL_0596"
FT   CDS_pept        681662..682876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrP-A"
FT                   /locus_tag="APL_0596"
FT                   /product="tyrosine-specific transport protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73698"
FT                   /db_xref="GOA:A3MZW2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR013061"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZW2"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44727"
FT                   /protein_id="ABN73698.1"
FT                   /translation="MQNKTFGSTLIVAGTTIGAGMLAMPLTSAGIGFGWTVALLIALWL
FT                   LLSFGALLFVELYQNAESDAGIGTLAEKYYGNFGRIVSTAVLVIFLYAILSAYVSGGSS
FT                   LLAGIMPTIGDSETTKRIAGVIFTLVFGTFVVIGTTSVDVVNRILFLTKIGAFFLVLAL
FT                   LLPNISVDNLLEMPIDNALLISATPVFFTAFGFHGSIPSLNKYLDGNVKALRISILVGT
FT                   AIPLVAYVLWQLATHGLLNQTEFLQLIEKDPTLNGLAEAIQQMTGSSLIGGTVKLFSAL
FT                   ALITSFLGVALGLFECLEDLFKRVHINAPRISLGLLTFIPPMLFAFFYPEGFIAALGYA
FT                   GQMFAFYALVLPIAMVWKFRKQYPEAKYKVFGGNIALLVALLLAIFIINVPFIIEAGYL
FT                   PKVVG"
FT   gene            682972..684189
FT                   /gene="tyrP-B"
FT                   /locus_tag="APL_0597"
FT   CDS_pept        682972..684189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrP-B"
FT                   /locus_tag="APL_0597"
FT                   /product="tyrosine-specific transport protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73699"
FT                   /db_xref="GOA:A3MZW3"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR013061"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZW3"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44747"
FT                   /protein_id="ABN73699.1"
FT                   /translation="MKNKILGSALMIAGTTIGAGMLAMPLTSAGMGFGATVVLLVCLWA
FT                   LLAYTGLLFMEVYQTAPKQDVGVASLAEQYFGITGRVLATASLLILLYALLAAYITGGG
FT                   SLLSGLLPEIGDAHTTTQVGILLFTVLLGSFVVIGIKGVDGLTRLLFIGKIVAFVFVLL
FT                   MMLPKAKLENLTAVPLDNLFVVSAVPIFFTSFGFHVIMASINTYLDADIRKIRIAIYIG
FT                   TAIPLVAYLLWQLATHGVLTQAEFVEILKQDPTLNGLVKATSQITGSTILGEMVRLFSA
FT                   LALITSFLGVAMGIFECVGDLLKRVNLPANRLWLTLATFIPPVLFALFYPNGFIAALGY
FT                   AGLLFAFYGMLLPIGLAWKARQQHPNLAYRVIGGKAALIVALIAGIIIMIIPFLIQLGY
FT                   LPQVAG"
FT   gene            684296..686848
FT                   /gene="glnD"
FT                   /locus_tag="APL_0598"
FT   CDS_pept        684296..686848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="APL_0598"
FT                   /product="uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73700"
FT                   /db_xref="GOA:A3MZW4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZW4"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q4QJM6"
FT                   /protein_id="ABN73700.1"
FT                   /translation="MNIDVKSQLAEFNTKQCHDFSQEDVFELIYQRSDFYDELLVSLWR
FT                   QFGFEKRSDMALIAVGGYGRREMFPLSDVDILVLTEQSVDEETAEKLNALFNVLWDCKL
FT                   QVGASIRTLFESLDIGREEISVATNIYEGRFLTGNKKLWTALVEQIYQADYWPIEAFFQ
FT                   AKIEEKNERYARYHNTSYNLEPDLKHSPGGLRDLHLVSWIFLRHFGTYSFESLLNKGIL
FT                   FAEEFKELNSAQAVLFRMRFALHLQLKRYDNRLRFDRQLQLSELLGYQGEGNQPVEAMM
FT                   KSYFQATQTISQLSQLLLNSFEQQVLRPQNNLEKQPLDQHFYLQGSEIYCQDRRCFTHT
FT                   PASILDLFFYLTQYPDAKASATMLRHLRLSLHKLGQPLSELPEARTRFIRLFEQPNVVK
FT                   KAIVPMHQLGVLTAYLPQWRHIVGLMQFDLFHIYTVDEHTIRVMLKIESFLDAETTEQH
FT                   PLCCQYFTACQHKPLLYLAALFHDIAKGRESDHAEVGALDMEQFALQHGFDPMQVTKMV
FT                   WLVREHLTMSITAQRRDIHDPFVIKAFAEKVENRTALSDLMCLTVADICATNETLWNDW
FT                   KRSLFAQLFQFTNQQLTKSLDYRKEAETNRQQALELIKFALKPDERTRLQQFWQVCPDS
FT                   YFLRHKPKQLVWHALAYLKQRIMPLVLVSNEYARGATEIFIYCEDQAQLFLRIAQILSQ
FT                   KKVSIHDAQIITSQNGLVLDSFIVTELNGKPLEEMRCEQIKQSLEKVLNTSEPKVCNLE
FT                   RKPVKHQSFKRQTKVRFLADSQQNRTAFELFTLDREGLLARVSSVFNQLGLNLINAKIT
FT                   TIGERVEDFFVVTTQQHQALDDKAQKALKSALLDELSE"
FT   gene            complement(686881..687279)
FT                   /locus_tag="APL_0599"
FT   CDS_pept        complement(686881..687279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73701"
FT                   /db_xref="GOA:A3MZW5"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:A3MZW5"
FT                   /inference="similar to AA sequence:RefSeq:NP_873904.1"
FT                   /protein_id="ABN73701.1"
FT                   /translation="MEQWTPDVWLAIGAAFFVGIIVGCAIVRVLKGNVKQHIQLETELK
FT                   ATKEKVEEQKQQLEQHFEQSAALLSTLAEDYKKLYTHLANGSEKLVPEAKQAEFFKQPQ
FT                   ITHNVENTNGNQPRDYSEGSSGLLKTQS"
FT   gene            687584..688012
FT                   /gene="rplM"
FT                   /locus_tag="APL_0600"
FT   CDS_pept        687584..688012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="APL_0600"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73702"
FT                   /db_xref="GOA:A3MZW6"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZW6"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:P44387"
FT                   /protein_id="ABN73702.1"
FT                   /translation="MKTFVAKPETVKRDWYVVDATGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVINAEKVAVTGKKETDKIYYWHTGYVGGIKDATFKEMIARRPEAVIEIA
FT                   VKGMLPKGPLGREMFRKLKVYAGNEHNHAAQQPQVLDI"
FT   gene            688029..688424
FT                   /gene="rpsI"
FT                   /locus_tag="APL_0601"
FT   CDS_pept        688029..688424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="APL_0601"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73703"
FT                   /db_xref="GOA:A3MZW7"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZW7"
FT                   /inference="similar to AA
FT                   sequence:UniProtKB/Swiss-Prot:Q7VLF7"
FT                   /protein_id="ABN73703.1"
FT                   /translation="MTAANQNYGTGRRKSSSARVFIKPGNGNITIDQRSLDVYFGRETS
FT                   RMVVRQPLELVELLDKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRPALRAAGF
FT                   VTRDARRVERKKVGLHKARRRPQYSKR"
FT   gene            688546..689328
FT                   /locus_tag="APL_0602"
FT   CDS_pept        688546..689328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APL_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APL_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABN73704"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MZW8"
FT                   /inference="similar to AA
FT