(data stored in ACNUC1104 zone)

EMBL: CP000571

ID   CP000571; SV 1; circular; genomic DNA; STD; PRO; 3127456 BP.
XX
AC   CP000571; AAHU01000000-AAHU01000105;
XX
PR   Project:PRJNA13953;
XX
DT   28-FEB-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Burkholderia pseudomallei 668 chromosome II, complete sequence.
XX
KW   .
XX
OS   Burkholderia pseudomallei 668
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; pseudomallei group.
XX
RN   [1]
RP   1-3127456
RA   DeShazer D., Woods D.E., Nierman W.C.;
RT   ;
RL   Submitted (13-FEB-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [2]
RC   Protein update by submitter
RP   1-3127456
RA   Brinkac L.M., Harkins D.M., Shrivastava S., Durkin A.S., Sutton G.;
RT   ;
RL   Submitted (12-JAN-2010) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; 6fbb23cc60ab3518a7e24ab1bd738054.
DR   BioSample; SAMN02604035.
DR   EnsemblGenomes-Gn; BURPS668_A0591.
DR   EnsemblGenomes-Gn; BURPS668_A0592.
DR   EnsemblGenomes-Gn; BURPS668_A0593.
DR   EnsemblGenomes-Gn; BURPS668_A0594.
DR   EnsemblGenomes-Gn; BURPS668_A0595.
DR   EnsemblGenomes-Gn; BURPS668_A0631.
DR   EnsemblGenomes-Gn; BURPS668_A1149.
DR   EnsemblGenomes-Gn; BURPS668_A1473.
DR   EnsemblGenomes-Gn; BURPS668_A2524.
DR   EnsemblGenomes-Gn; BURPS668_A2904.
DR   EnsemblGenomes-Gn; EBG00001062541.
DR   EnsemblGenomes-Gn; EBG00001062543.
DR   EnsemblGenomes-Gn; EBG00001062545.
DR   EnsemblGenomes-Gn; EBG00001062546.
DR   EnsemblGenomes-Gn; EBG00001062548.
DR   EnsemblGenomes-Gn; EBG00001062550.
DR   EnsemblGenomes-Gn; EBG00001062552.
DR   EnsemblGenomes-Gn; EBG00001062554.
DR   EnsemblGenomes-Gn; EBG00001062556.
DR   EnsemblGenomes-Gn; EBG00001062558.
DR   EnsemblGenomes-Gn; EBG00001062560.
DR   EnsemblGenomes-Gn; EBG00001062562.
DR   EnsemblGenomes-Gn; EBG00001062563.
DR   EnsemblGenomes-Gn; EBG00001062564.
DR   EnsemblGenomes-Gn; EBG00001062565.
DR   EnsemblGenomes-Tr; BURPS668_A0591-1.
DR   EnsemblGenomes-Tr; BURPS668_A0592-1.
DR   EnsemblGenomes-Tr; BURPS668_A0593-1.
DR   EnsemblGenomes-Tr; BURPS668_A0594-1.
DR   EnsemblGenomes-Tr; BURPS668_A0595-1.
DR   EnsemblGenomes-Tr; BURPS668_A0631-1.
DR   EnsemblGenomes-Tr; BURPS668_A1149-1.
DR   EnsemblGenomes-Tr; BURPS668_A1473-1.
DR   EnsemblGenomes-Tr; BURPS668_A2524-1.
DR   EnsemblGenomes-Tr; BURPS668_A2904-1.
DR   EnsemblGenomes-Tr; EBT00001665282.
DR   EnsemblGenomes-Tr; EBT00001665283.
DR   EnsemblGenomes-Tr; EBT00001665284.
DR   EnsemblGenomes-Tr; EBT00001665285.
DR   EnsemblGenomes-Tr; EBT00001665286.
DR   EnsemblGenomes-Tr; EBT00001665287.
DR   EnsemblGenomes-Tr; EBT00001665288.
DR   EnsemblGenomes-Tr; EBT00001665289.
DR   EnsemblGenomes-Tr; EBT00001665290.
DR   EnsemblGenomes-Tr; EBT00001665291.
DR   EnsemblGenomes-Tr; EBT00001665292.
DR   EnsemblGenomes-Tr; EBT00001665293.
DR   EnsemblGenomes-Tr; EBT00001665294.
DR   EnsemblGenomes-Tr; EBT00001665295.
DR   EnsemblGenomes-Tr; EBT00001665296.
DR   EuropePMC; PMC2386483; 18439288.
DR   EuropePMC; PMC3997201; 24742004.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP000571.
DR   SILVA-SSU; CP000571.
XX
CC   Source DNA is available from BEIresources
CC   (http://www.beiresources.org/).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3127456
FT                   /organism="Burkholderia pseudomallei 668"
FT                   /chromosome="II"
FT                   /strain="668"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:320373"
FT   gene            1..1188
FT                   /locus_tag="BURPS668_A0001"
FT   CDS_pept        1..1188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0001"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85800"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:A3NF86"
FT                   /protein_id="ABN85800.1"
FT                   /translation="MTLDEIRQSIREELDALRVSGARRQDLSLHACKRLFFDLGIRPST
FT                   ANVRELTQTGSASDIPKDIDHFWERIRSASKVRLEGAALPKPLEEKAGALLGALYEEAL
FT                   KQARESLDGERQQASSEVAAAEQKYRDALIRQEALEAAVARSDARAEQLQSRLTDVEVQ
FT                   LASASTQGLAHQDSLQGLIRRMENENALLNQRLEAEQSQNAALRERIDALHAELRENTE
FT                   HYAQQIKDAIAEAERRVKPMLVELDSLRSMASTYQQGLRDVNRKEFDFLQQLSAAKARA
FT                   DRLDAQLREQGDELTAALNEVQILRASQGMTPEIAALIRRLANAGNLDAAAFDTIGTSL
FT                   DQHVTLPARCPKCGDGEPELSHDAHGYELLCPECEHASGTQPSRFAAAACFTRTT"
FT   gene            complement(1282..2325)
FT                   /locus_tag="BURPS668_A0002"
FT   CDS_pept        complement(1282..2325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0002"
FT                   /product="integrase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87309"
FT                   /db_xref="GOA:A3NF87"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A3NF87"
FT                   /protein_id="ABN87309.1"
FT                   /translation="MSLPILTSPPSPPDIPSDLFDRDTSDWLNHPDTAFDAWLAAQEFR
FT                   RSSADVYRAQWGAFLGWLAKRQKNLATVDTETIALFVGELPIKKTQRVRYLRLIERVLD
FT                   HVRKNEFGSTNPARFIAQDGEATWRTARDNEPTSFLAPAERAALLAYLFSPLPAAGAAL
FT                   WKERRDRALIAAFLGGGLKTGEARALTISCVKLGSTMLTIPAAQPEFTRETHLASFAIA
FT                   LFDAWLAERQRCGIPGELVFPASQSGRPMHKATMLRAVDAIVDAADIAQSRTARASPQT
FT                   LRNTFAAELFENGVEPEKVGQWLGFAQPISSNRLHRAWKNWRESLASALPDAESLTDEI
FT                   STEPSQA"
FT   gene            complement(2488..2868)
FT                   /locus_tag="BURPS668_A0003"
FT   CDS_pept        complement(2488..2868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="This functional annotation is a direct result of
FT                   community participation in a Pathema-Burkholderia
FT                   annotation jamboree: http://pathema.jcvi.org."
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86500"
FT                   /db_xref="InterPro:IPR018894"
FT                   /db_xref="UniProtKB/TrEMBL:A3NF88"
FT                   /protein_id="ABN86500.1"
FT                   /translation="MTEQDLAALSFKAAAHDMETIVRHIAERYIRQGVPLTWRLLHAVE
FT                   AEALADLGFASRHDPMVRCLFDRPAELRFPETDDLVDFGQSNALPAVFSFAVAAYERAA
FT                   DARADTAAAPARSARASRAWGD"
FT   gene            complement(2948..3556)
FT                   /locus_tag="BURPS668_A0004"
FT   CDS_pept        complement(2948..3556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0004"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88510"
FT                   /db_xref="GOA:A3NF89"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A3NF89"
FT                   /protein_id="ABN88510.1"
FT                   /translation="MASSSGARRTPAPASPATGATPPRVGEQIQRLRNERKLTLDDLSR
FT                   AAGVSKSMLSEIERDKANPTIAVAWRLTNALGISLDELFAQPKAPETIRVDGPHDIPTL
FT                   AGHDAQYQLRVWGPIELAGKFEWYELTLPANGALVSNPHEPGTREHLTVLNGAVEIEAA
FT                   GTARRLKAGDTARYAADGPHAIRNAGKSEAKALLIVIHR"
FT   gene            3724..4923
FT                   /gene="kbl"
FT                   /locus_tag="BURPS668_A0005"
FT   CDS_pept        3724..4923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="BURPS668_A0005"
FT                   /product="glycine C-acetyltransferase"
FT                   /EC_number="2.3.1.29"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00464; match to protein
FT                   family HMM TIGR01822"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87610"
FT                   /db_xref="GOA:A3NF90"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3NF90"
FT                   /protein_id="ABN87610.1"
FT                   /translation="MRDAYLAHLRGTLEQIRADGFYKTEREIASPQAADIRLAGGTHVL
FT                   NFCANNYLGLADDSRLIAAAQAALEQDGFGMASVRFICGTQTVHKQLEAALSAFLKTDD
FT                   CILYSSCFDANGGLFETLLDENDAIISDELNHASIIDGIRLSKARRFRYKNNDLADLEA
FT                   KLREADAAGARFKLIATDGVFSMDGIIANLKGVCDLADRYGALVMVDDSHAVGFIGEHG
FT                   RGTPEYCGVEGRVDIVTGTLGKALGGASGGYVAARREIVELLRQRSRPYLFSNTLTPSI
FT                   AAASLKVLELLASDEGTRLRERVRANGAHFREKMSAAGFALVPGEHPIIPVMLGDAQVA
FT                   SKMADALLAEGVYVIGFSFPVVPRGRARIRTQMSAAHTREQIDRAVDAFVRVGKTLGVI
FT                   "
FT   gene            4936..5967
FT                   /gene="tdh"
FT                   /locus_tag="BURPS668_A0006"
FT   CDS_pept        4936..5967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="BURPS668_A0006"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240; match to protein
FT                   family HMM TIGR00692"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86720"
FT                   /db_xref="GOA:A3NF91"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3NF91"
FT                   /protein_id="ABN86720.1"
FT                   /translation="MKALAKLERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIW
FT                   KWDDWAQKTIPVPMHVGHEYVGEIVEMGQEVRGFSIGDRVSGEGHITCGFCRNCRAGRR
FT                   HLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNLV
FT                   GEDVLITGAGPIGVMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVSRESLRD
FT                   VMADLHMTEGFDVGLEMSGVPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFKGL
FT                   EIKGIYGREMFETWYKMVAMLQSGLDLSPIITHRFAVDDYEKGFAAMLSGESGKVILDW
FT                   ADA"
FT   gene            5976..6275
FT                   /locus_tag="BURPS668_A0007"
FT   CDS_pept        5976..6275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0007"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85781"
FT                   /db_xref="UniProtKB/TrEMBL:A3NF92"
FT                   /protein_id="ABN85781.1"
FT                   /translation="MRSGAMPGCTSHVTRHTSHVTRHTSHVTRHTSHVTRHTSHVTRHT
FT                   LRYGLRTFNRHPHRIRHSPSRGVQCVAHAKCIARSVFARCCGLTPPKPRWLPEV"
FT   gene            complement(6400..6999)
FT                   /locus_tag="BURPS668_A0008"
FT   CDS_pept        complement(6400..6999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0008"
FT                   /product="YceI-like domain protein"
FT                   /note="identified by match to protein family HMM PF04264"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88120"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A3NF93"
FT                   /protein_id="ABN88120.2"
FT                   /translation="MAASCTPLRVVTHSVSTAEAAVPAGRYTLDPHHWSIVFDVDHFKY
FT                   SRFTMRFDRANAQLDWRPGGGLADSGVSASIDAASVDTRVPLLDKLVAGADALDAARNP
FT                   QIRFESTRFARTSATQGTLTGNLTIRGATHPVTLAVTFNGYGRNPLTKQDTLGFSASGT
FT                   FSRAQFGVTSWYPAVGDDVRVRIEAEFVKEGEAPAQ"
FT   gene            7143..7760
FT                   /locus_tag="BURPS668_A0010"
FT   CDS_pept        7143..7760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0010"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87491"
FT                   /db_xref="GOA:A3NF95"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A3NF95"
FT                   /protein_id="ABN87491.1"
FT                   /translation="MDTKPDLAPAAGARERLLDAAETLIYAGGIHATGVDAIVKRSGAA
FT                   RKSFYAHFESKEALVAAALERRDARWMAWFVEATKKRGKTPRARLVGMFDVLREWFEQA
FT                   DFHGCAFLNAAGEIERADDPIRVVVREHKARLLAFVREQLDAHAAQAGADRRFVARLAR
FT                   QWLVLIDGAIGVALVSGDASAARDARAAAELLLDATLPNRSS"
FT   gene            7861..8340
FT                   /locus_tag="BURPS668_A0012"
FT   CDS_pept        7861..8340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="This functional annotation is a direct result of
FT                   community participation in a Pathema-Burkholderia
FT                   annotation jamboree: http://pathema.jcvi.org.; identified
FT                   by similarity to PDB:2IMJ_D; match to protein family HMM
FT                   PF07080"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85459"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A3NF96"
FT                   /protein_id="ABN85459.2"
FT                   /translation="MSDSTEIRLPVPPFTRETAIQKVRAAEDGWNTRDPERVSLAYTPQ
FT                   SKWRNRAEFATGRAEIVALLRRKWTREIDYRLIKELWAFTGNRIAVRFAYEWRDDAGNW
FT                   FRSYGNENWEFDENGLMAHRHACINDMPIREADRLFHWPLGRRPDDHPGLSDLGL"
FT   gene            complement(8310..8561)
FT                   /locus_tag="BURPS668_A0011"
FT   CDS_pept        complement(8310..8561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0011"
FT                   /product="ttbk1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88386"
FT                   /db_xref="UniProtKB/TrEMBL:A3NF97"
FT                   /protein_id="ABN88386.1"
FT                   /translation="MGSGTAQDTAARPPNSQHSAFGLAAASSPIRNGAAKRSFATPFMI
FT                   SRGSPSPSQAARCCMHRAMLRAFAQPAADQSPRSDKPG"
FT   gene            complement(8562..9578)
FT                   /locus_tag="BURPS668_A0013"
FT   CDS_pept        complement(8562..9578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0013"
FT                   /product="succinylglutamate desuccinylase"
FT                   /note="identified by match to protein family HMM PF04952"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86513"
FT                   /db_xref="GOA:A3NF98"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:A3NF98"
FT                   /protein_id="ABN86513.1"
FT                   /translation="MTESAPVFPHYSIEVDFPDLEAHRTGNAGVDYVHRFDSGVPGPRV
FT                   MINALTHGNEVCGAIVVDALLKRGLRPRRGVLTVSFANVAAYERFDPARPDAARFVDQD
FT                   FNRVWAPAVLDDLSQHSVELDRARAIRPFVDEADWLLDLHSMHERSAPLIVAGPLAKGT
FT                   ALALRIGAPATVIRDEGHPEGKRMRDYGGFGDPASAKNALLVECGQHWEARAVAVARDS
FT                   TARFLMASGIVDERDLPADWFLPLATTMRIVQVTQPVVATSGDFRFADAYTGLEHFAEA
FT                   GAVIGWSDGKPVTTPYPDCVLVMPSLRQLHPGVTVVRLGRVEREVAQRAARGTRGKC"
FT   gene            9577..9762
FT                   /locus_tag="BURPS668_A0014"
FT   CDS_pept        9577..9762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0014"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87936"
FT                   /db_xref="UniProtKB/TrEMBL:A3NF99"
FT                   /protein_id="ABN87936.1"
FT                   /translation="MVSFFGSRETRRARLRRKRVERARTRRAEHASTAACAHTVSDRTG
FT                   ARARSSNCASSEAIFA"
FT   gene            complement(9863..10948)
FT                   /locus_tag="BURPS668_A0015"
FT   CDS_pept        complement(9863..10948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0015"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /note="identified by match to protein family HMM PF00180;
FT                   match to protein family HMM TIGR02089"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88539"
FT                   /db_xref="GOA:A3NFA0"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFA0"
FT                   /protein_id="ABN88539.2"
FT                   /translation="MSEKVYRIAVIPGDGIGVEVMPEGLRALDAVSRRFGLRFAYEPIE
FT                   WASCDYYAKHGQMMPDDWKTQLSGMDALLFGAVGWPETVPDHISLWGSLIKFRREFDQY
FT                   VNLRPARLFDGVPCPLAGRKAGDIDFMIVRENTEGEYSAVGGTMFKGTEREFVVQQAVF
FT                   TRHGTERVLKFAFELAQRRAKRLTVATKSNGIAISMPWWDARAAEMAARYPDVAWDKQH
FT                   IDILCARFVMQPDRFDVVVASNLFGDILSDLGPACTGTIGIAPSANLNPERNFPSLFEP
FT                   VHGSAPDIAGKHIANPIAMIWSAAMMVDFLGAGTGPAREAHDAIVAAIEHVLKHGPRTR
FT                   DMGGRASTREVGDAIVAHLLG"
FT   gene            12562..12996
FT                   /locus_tag="BURPS668_A0017"
FT   CDS_pept        12562..12996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86636"
FT                   /db_xref="GOA:A3NFA2"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFA2"
FT                   /protein_id="ABN86636.1"
FT                   /translation="MNSLTKRALGAQVRFVAMLAVLIFASAGSLRYWQGWIYWFVFSGA
FT                   TTWLARHFLKHDPALVERRMRVGVRAERELSQKIILGVVSVASAGLIVAMGAEWRVLRM
FT                   PCDWRPVALGNALVIAGFAICFAALRANRFASSIVEVKRD"
FT   gene            13000..13239
FT                   /locus_tag="BURPS668_A0018"
FT   CDS_pept        13000..13239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86572"
FT                   /db_xref="GOA:A3NFA3"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFA3"
FT                   /protein_id="ABN86572.1"
FT                   /translation="MISSGPYRFVRHPMYSGAMVIFFGSPIAAQSTWAWPFAAVLAVGV
FT                   VARLVDEERYLSAHLDGYRAYCERVRWRLVPHVW"
FT   gene            13424..14047
FT                   /locus_tag="BURPS668_A0019"
FT   CDS_pept        13424..14047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0019"
FT                   /product="glutathione S-transferase family protein"
FT                   /EC_number="2.5.1.18"
FT                   /note="identified by match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87695"
FT                   /db_xref="GOA:A3NFA4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFA4"
FT                   /protein_id="ABN87695.1"
FT                   /translation="MLKLLGKAPSINVRKVLWTCAELKLAYEREDWGAGFRSTQTPEFL
FT                   ALNPNGLVPVLVDGDFVLWESNAIIRYLANRYGGAHLYPVEPHARARVDQWLDWQTTAL
FT                   NRAWSYAFLALVRDAPDHGDTARIRASCESWARHMAILDAQLGTTGAFVTGADYTLADV
FT                   ALGLSINRWLRTPFDKPDFPAVSAYFDRLAARPGFAEHVDNGLP"
FT   gene            complement(14143..14256)
FT                   /locus_tag="BURPS668_A0020"
FT   CDS_pept        complement(14143..14256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0020"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88414"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFA5"
FT                   /protein_id="ABN88414.1"
FT                   /translation="MRRLCIDRRCFKPPDRTATALSAAPLSFAVRRHIACA"
FT   gene            complement(14473..15006)
FT                   /locus_tag="BURPS668_A0021"
FT   CDS_pept        complement(14473..15006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87028"
FT                   /db_xref="GOA:A3NFA6"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFA6"
FT                   /protein_id="ABN87028.1"
FT                   /translation="MRPARAGRAFRFAVSRFAVSRFAMPIFVVLFALAALIWGAIHMFE
FT                   AIAARFGDAVAIGAATVAAVAIAAAIARSVRRRRDIAPNAREDGWTHVLQRAWGDLRIS
FT                   ATKGLLWLSQDGADGRYTLTDLSGCRAETLDGRWYLVVAVRDDRRAEWKLPMDDKRDAL
FT                   RWARVLTLAKRQRL"
FT   gene            complement(15017..16255)
FT                   /locus_tag="BURPS668_A0022"
FT   CDS_pept        complement(15017..16255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0022"
FT                   /product="phospholipase, patatin family"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86280"
FT                   /db_xref="GOA:A3NFA7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFA7"
FT                   /protein_id="ABN86280.1"
FT                   /translation="MKPRARTEKQAVDPADLHNEAGVPHALEHARTPFHDLPYETIALV
FT                   LQGGGALGAYQAGVFEGLHEAGIPLNWIAGISIGALNTALIAGNPPERRVERLREFWNT
FT                   ICQPAFFPALPAMFEAALFNSHEYVRTFFTASQAASAVMQGQRGFFVPRFPPPLPGSTH
FT                   PPEKVSYYDTSALRATLVKLCDFDRINSGETRVSVGAVNVGTGNFIYFDNTKTTLRPEH
FT                   FMASGALPPAFPPVEIDGEFYWDGGIVSNTPLMEVLHASPRRDTLAFQVDLWSARGPLP
FT                   ESMNEVTERTKDVQYSSRTRFVTDTLQREQRFRNVLRRVLDQVPESIRESDPWCQQAET
FT                   LSCSKRYNVQHLIYQQKAYEQHYKDYQFGASTMRDHWSAGLADIRKTLAVKNGLALPDN
FT                   DAGFVTHDIHRMR"
FT   gene            complement(16252..17037)
FT                   /gene="bdhA"
FT                   /locus_tag="BURPS668_A0023"
FT   CDS_pept        complement(16252..17037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdhA"
FT                   /locus_tag="BURPS668_A0023"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.30"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659; match to protein
FT                   family HMM TIGR01963"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88547"
FT                   /db_xref="GOA:A3NFA8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFA8"
FT                   /protein_id="ABN88547.1"
FT                   /translation="MSNLNGKTAIVTGAASGIGKEIALELARAGAAVAIADLNQDGANA
FT                   VAELIEQAGGRAIGVAMDVTNEDAVNAGIDKVAQTFGSVDILVSNAGIQIVNPIENYAF
FT                   ADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGL
FT                   LGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQTV
FT                   DGVFTTVEDVAKTVLFLSAFPSAALTGQSFVVSHGWFMQ"
FT   gene            complement(17084..18025)
FT                   /locus_tag="BURPS668_A0024"
FT   CDS_pept        complement(17084..18025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0024"
FT                   /product="putative acetoacetate decarboxylase"
FT                   /note="identified by match to protein family HMM PF06314"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88528"
FT                   /db_xref="GOA:A3NFA9"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="InterPro:IPR023653"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFA9"
FT                   /protein_id="ABN88528.1"
FT                   /translation="MRFRRAGDPSYVAAHARSLPHPQHCQCLSFRCRKFRNNLFQLRHR
FT                   TIDSRKHTISAPRQRSDPQGVHMKPSQVRSKAFAMPLTSPAFPMGPYRFVNREFLIITY
FT                   RTDMDRLREIVPEPLEVKEPLVHYEFIRMPDSTGFGDYTESGQVIPVEYKGQPGGYTLA
FT                   MYLNDHPPIAGGRELWGFPKKLAQPTLQTHIDTLLGTLDYGPVRVATGTMGYKHQELDL
FT                   EEQAKRLAGANFLLKIIPHVDGSARVCELVRYYLQDIEMKGAWTGPASLQLAPHALAPV
FT                   ADLPVLEIVEARHLLADLTLGLGEVVYDYLAQ"
FT   gene            18283..18879
FT                   /locus_tag="BURPS668_A0025"
FT   CDS_pept        18283..18879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0025"
FT                   /product="PAP2 family protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87616"
FT                   /db_xref="GOA:A3NFB0"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR033879"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFB0"
FT                   /protein_id="ABN87616.1"
FT                   /translation="MQNFNLAVFSALNAGSTPPLGAVRFGVFAADWLVYAVPALLLLTW
FT                   VMGAHPTRRQAIEAGVGACVALALAQVIGHFWYSPRPFVLGIGTQLIPHAPDGSFPSDH
FT                   TTFVCSVAAGLLIARATRTAGAALAVIAAVIGWGRVYVGVHWPLDIVGGALVGTAGALA
FT                   AHLYGRPVTALLDRVGESVHAVAFTRLRERPIRID"
FT   gene            complement(18902..19138)
FT                   /locus_tag="BURPS668_A0026"
FT   CDS_pept        complement(18902..19138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0026"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86236"
FT                   /db_xref="GOA:A3NFB1"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFB1"
FT                   /protein_id="ABN86236.1"
FT                   /translation="MTRHHTHAGIPRTLKIVGYCGLAAIALALFVAMCAILKDSALDRE
FT                   AARQLQNGNVEMHGGADVEPGSTNDAAQARTPG"
FT   gene            19110..19232
FT                   /locus_tag="BURPS668_A0027"
FT   CDS_pept        19110..19232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0027"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85371"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFB2"
FT                   /protein_id="ABN85371.1"
FT                   /translation="MPAWVWWRVMDAYPGGDARSRAVSFSFDTRKYRGARRAFP"
FT   gene            19332..19580
FT                   /locus_tag="BURPS668_A0028"
FT   CDS_pept        19332..19580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0028"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88277"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFB3"
FT                   /protein_id="ABN88277.1"
FT                   /translation="MWRRADARASRDASGRWNLNARAGRRRCGVDRRENGGEANETALS
FT                   ARGMAAKACDAMGQRGAAALERRGGAVRSGANQSRLP"
FT   gene            complement(19904..20731)
FT                   /locus_tag="BURPS668_A0029"
FT   CDS_pept        complement(19904..20731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0029"
FT                   /product="siderophore-interacting protein"
FT                   /note="identified by match to protein family HMM PF04954;
FT                   match to protein family HMM PF08021"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87744"
FT                   /db_xref="GOA:A3NFB4"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFB4"
FT                   /protein_id="ABN87744.1"
FT                   /translation="MTQPTTERAVVRVRHTLKFRLLQVKRVVDVTPHLKRVTLAGDELD
FT                   DFESASFDDHVKVFFPPPGEDAPARPEFGPNGIVFPQDRPRPVARDFTPRRYDRAAREL
FT                   DLDFVLHHPGPASQWAAQARVGQTLGIGGPRGSFVIPKDFDWHLLIGDDTALPAVARRL
FT                   EELPAGTRVAAVLEVADPSAQIAFETDANLYVVWRHRGDAASGERGASRLVDALRELPL
FT                   PAGEGYVWAAGEAAAMRGVREHLCRERGVAKSRIRASAYWKHGAIAVHESLED"
FT   gene            complement(20771..21475)
FT                   /locus_tag="BURPS668_A0030"
FT   CDS_pept        complement(20771..21475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0030"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86251"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFB5"
FT                   /protein_id="ABN86251.1"
FT                   /translation="MRHAHRFSRRECGMSDSFGHSPFEMFRQMFGGHRRGGGRHGFGPF
FT                   GGFGGGPGGFGGFGDDAMPRGRQFSADDLQLLLLALLAEQPSHGYELIKALDTRSSGFY
FT                   APSPGMVYPALTYLEELGYVTVQAEGNRKRYALADAGRAHLDAQRERVEMLFAKLAHLG
FT                   RKMEFMRRAFAGEAPAAPEDDTRGWLPEFVEARMALKQALFRRSGANADEQRRIAAILR
FT                   RAVADIEGRAQG"
FT   gene            21983..22258
FT                   /locus_tag="BURPS668_A0031"
FT   CDS_pept        21983..22258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0031"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87110"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFB6"
FT                   /protein_id="ABN87110.1"
FT                   /translation="MPTRIKWLVNDDIGPDCEPMRSKELLIFLFDDGPSGEEVLGKCSS
FT                   ERDQQFTLKATLGLVEAWCCDGLQCGRQMLKEYCAIHGYEIWLLLR"
FT   gene            complement(22331..23008)
FT                   /locus_tag="BURPS668_A0032"
FT   CDS_pept        complement(22331..23008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86766"
FT                   /db_xref="InterPro:IPR025683"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFB7"
FT                   /protein_id="ABN86766.1"
FT                   /translation="MGDADYFEERIDEISSALGLSPENCHVIVDFADLTKASVPEILEK
FT                   ADLAVDYLKQLGFRQIIVAGGSMPAFVNEAVDEPDQIGMIHRIEMLVWKAMQRVRNDPS
FT                   IIYGDYGIRNPAAMDGIISKHNNGKIRYTVANQFFILRGHSKQIERIGVQQKALSRQLL
FT                   GSSYYMGPAFSWGDRTVTIAANPADPYMGGPTQWIGIDTNHHIHAVLAEVFEHQTQLAT
FT                   LPF"
FT   gene            complement(23433..24437)
FT                   /locus_tag="BURPS668_A0033"
FT   CDS_pept        complement(23433..24437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0033"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="identified by match to protein family HMM PF06114"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86021"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFB8"
FT                   /protein_id="ABN86021.1"
FT                   /translation="MRQADLVPYFGTRSRVSEVLSRKRPLTVQMIRALSVGLGISAETL
FT                   VGANSIDSDASKKEDVDWSRFPVKEMVARGWLKKLASQAVGSTEDLVKGFISSAGLQFG
FT                   TAAFRRGMSGDAYSPSTMYSLYAWLSRVIQRGRERKASLGKYDPSMFSAAFLRELAQLS
FT                   WSEHGPLLAVEYLERRGIAVVVEPHLKGTLLDGAALKDADGTPIIGLTLRFDRLDSFWF
FT                   TLLHEVAHIWKHVGHDETFLDNLDVSPEDKRELEANRLAKEALIPRVAWKRSDAYLNPS
FT                   PETIDKLSRELKIHPAIIAGRLRKESENYKLFNELIGYNEVRKHFNLTASSEV"
FT   gene            26431..26751
FT                   /locus_tag="BURPS668_A0034"
FT   CDS_pept        26431..26751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0034"
FT                   /product="bacteriophage/transposase fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86775"
FT                   /db_xref="GOA:A3NFB9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFB9"
FT                   /protein_id="ABN86775.1"
FT                   /translation="MFHSDQGCQYTSTRFLAELRARGTIQSMSRRGNCWDNAVVERFFR
FT                   SLKNEWIGDQLYVDHRHAEQDITDYLVDFYNHRRLHSAAKGLPPARFEALAAYPGAVSK
FT                   VA"
FT   gene            27039..27302
FT                   /locus_tag="BURPS668_A0035"
FT   CDS_pept        27039..27302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0035"
FT                   /product="transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85778"
FT                   /db_xref="GOA:A3NE76"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A3NE76"
FT                   /protein_id="ABN85778.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFC
FT                   GMEVSEARRLKDLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            27326..28159
FT                   /locus_tag="BURPS668_A0036"
FT   CDS_pept        27326..28159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0036"
FT                   /product="insertion element IS407"
FT                   /note="This functional annotation is a direct result of
FT                   community participation in a Pathema-Burkholderia
FT                   annotation jamboree: http://pathema.jcvi.org.; identified
FT                   by similarity to SP:P24577; match to protein family HMM
FT                   PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88337"
FT                   /db_xref="GOA:A3NFC1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFC1"
FT                   /protein_id="ABN88337.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHGALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(28300..28458)
FT                   /locus_tag="BURPS668_A0037"
FT   CDS_pept        complement(28300..28458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0037"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87448"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFC2"
FT                   /protein_id="ABN87448.1"
FT                   /translation="MDSGLQVVRNQLFDVAEETRDWIEMVVEIAIWICAISEARYTVAN
FT                   IPVQQPE"
FT   gene            28825..30609
FT                   /locus_tag="BURPS668_A0038"
FT   CDS_pept        28825..30609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87274"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFC3"
FT                   /protein_id="ABN87274.1"
FT                   /translation="MHISRISISNFANFKALDVETTESIVIVGENKAGKSNFIQALQLV
FT                   LDPGLSERDRQLGLEQFWDGLGENKLGATVEIAIELTDFDDDADLVASLVDCLVDVGPP
FT                   TVARLTYRFRPKASLGGAPPLSLADYEYVIFGGDDEDNAIAAMQRRQLPLDVQAALRDA
FT                   EKDLSSWRRSPLRPLIEELTFDLDAEAREEIQQMVSEAQTDLADRDEVVSTAERIGARL
FT                   LAIVGNKHTVPIKLGLAPARVDVLLRSLRILIDNGARGIGDASLGTANLLFLALKSLEL
FT                   DRLVVDGERSHTFFAIEEPEAHLHPHVQRLVYRYFLGESPGHDRPSNITTILTTHSPHI
FT                   ASVAPIRSVVLLRHDPISGATTATSTATAPLTDEDEDDLQRYIDVTRGELFFARGIIFV
FT                   EGDAERFLIPAFAEALDIHLDILGISVCSVSGTNFAPYIKLVGPTGLNIPHVVLTDLDP
FT                   VDDRPPLARKRLLRLLELAVTDEEWDELDEDEPWDLGEEYGYFVNDSTLEPELFQAGLG
FT                   SGIRDVIESELSTSAQTREALACWVDDPTALNNERLLKLIERIGKGRFAQALAGFATAD
FT                   TCPAYIRNALEYIRDAVA"
FT   gene            30596..32395
FT                   /locus_tag="BURPS668_A0039"
FT   CDS_pept        30596..32395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0039"
FT                   /product="UvrD/REP helicase"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86334"
FT                   /db_xref="GOA:A3NFC4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFC4"
FT                   /protein_id="ABN86334.1"
FT                   /translation="MPLRSSSTAYLVQAEELRDNDQQWAAYESEWHCVVLAGPGSGKTK
FT                   TLVLKLARILAEDVRTPRGVACITYSQECARELTRRLEQLGLRESSRLFIGTVHGFCLR
FT                   HLLMPYAHLANLGLPTPIKVATVEHCRQLYSRQGTRLFGVGHPYKQMDIDKHRRVHLDR
FT                   ATPAWREQEELAALAEAYEEALHREGLVDFDDLVIYGERLVSQHDWVLPLVRARFPVLA
FT                   VDEYQDLGLGLHRIVKRLAFDGGVRLFAVGDADQSVYGFNGADSRLLHELANRGDVELV
FT                   RLEMNYRCADEIIQASERALGEARGYRAWDRDRAARVEMVECPEGLAEQAHRAVTEIIP
FT                   AALEAKVGRQLGDIAILYRTADIGDLVAEAVIAAGLDFIRVDNAAPYRKCALTSWIEDC
FT                   AAWCAGGWMEAKPLLRGLLERWLAFRYRRLSDAESRAERRRVTEFLWAHRQNGGGGNFV
FT                   AALRATLLDDVMAAEPSLADQAVQVQSMSTALRSGGVLQDLDMARLGGRDGSPNQLNLL
FT                   TLHSAKGCEYDVVIMLGLDEGSFHWSNVQGDALRESQRLFYVGLTRARDEVYMLYSGWN
FT                   ENKRTGRRYYSGRLRFLNELQAD"
FT   gene            complement(32701..32865)
FT                   /locus_tag="BURPS668_A0040"
FT   CDS_pept        complement(32701..32865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0040"
FT                   /product="ISPsy18, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86006"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFC5"
FT                   /protein_id="ABN86006.1"
FT                   /translation="MTAEAINAATLVFRKALIERALGGEMSHHLGYPLTLPSRTPWPTS
FT                   AMAPVPRLF"
FT   gene            complement(33011..34027)
FT                   /locus_tag="BURPS668_A0041"
FT   CDS_pept        complement(33011..34027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87321"
FT                   /db_xref="GOA:A3NFC6"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFC6"
FT                   /protein_id="ABN87321.1"
FT                   /translation="MGGIVFGPGTLADGLHETIGYKSGLAVSILELCDLLTGTEYPDAI
FT                   LRNEENAVRLRSEDVQDLYYHTLHKVGYSQRRFSGDYLGAFVYKKYAEHRRELEGVTRI
FT                   MNEWWPKMMAAALAAGTKSMDPRPFIQAVFDKYGKIGLDIAMDRIEAISTAQDQDPFSN
FT                   RQHQSVWLDRLHLAELKKRSEATPTHGSYFDQRFINFLANNSEKLGEMHWRRFEQMSAE
FT                   FFHRAGYAVDIGTGGNDDGVDIRAWAEGEDTTAAPTLIVQCKRQKDKIDKVTVKGLAAD
FT                   VEYNKAQYGVLITSAEFSIGAREVVNVRGYPIKEVNAEKVIEWLGALRAPGTGIVRI"
FT   gene            complement(34039..34188)
FT                   /locus_tag="BURPS668_A0042"
FT   CDS_pept        complement(34039..34188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0042"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86113"
FT                   /db_xref="GOA:A3NFC7"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFC7"
FT                   /protein_id="ABN86113.1"
FT                   /translation="MTTASKAIPNAATIVIVGMMDFPVMNLAAAQTATLISIGIFAVAI
FT                   HSKL"
FT   gene            35648..37054
FT                   /locus_tag="BURPS668_A0043"
FT   CDS_pept        35648..37054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0043"
FT                   /product="unspecific monooxygenase"
FT                   /note="identified by match to protein family HMM PF00067"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86800"
FT                   /db_xref="GOA:A3NFC8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFC8"
FT                   /protein_id="ABN86800.1"
FT                   /translation="MNGLPLSLPRVDSTDSLFADPLAFLARARAQCGDVFVLREHGPIF
FT                   SRASDCSGVIAVFGEHRLRQVLTETDTFALPMSAAAKMALPKNLVNLNRGLHSMREPEH
FT                   GRHKRLLTGTANRALFDAHRSGMQTDLSRFCEMLNGDGRISVVSRMRELTAKLASRLFL
FT                   GPQCEEDAELTFLLSAYFTLRREASSPNAHDPLQYRDALIGAGRQLDRALRARIRRYRK
FT                   APAGECAGLLQRLATAGQPGSPALSEDEIVGHANVMFVSSTEPVAISLAWLLLVLSQLP
FT                   DLRRALRAESAARASSPASPYDAPLLERVINETLRLLTPNALMVRATTQAVSLQGVALP
FT                   ARCEIVVCPFLVHREANAFARPHAFSPSRWETARPSPYEYFPFGAGGHFCAGRNLALSL
FT                   IGEVLSTLLSRFDFVLDIEQFIDWRIHIMLMPKGDPTLMAHPVDERRDTPSPKWRGPVA
FT                   ELFHFAPGLS"
FT   gene            37204..37404
FT                   /locus_tag="BURPS668_A0044"
FT   CDS_pept        37204..37404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87769"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFC9"
FT                   /protein_id="ABN87769.1"
FT                   /translation="MATKPKKTKGVSVSIEGKLPKMTLDMPVDAKKIKAIQKCLENGKL
FT                   TITMSKVDLAGGRMGEGYLYD"
FT   gene            37578..38429
FT                   /locus_tag="BURPS668_A0045"
FT   CDS_pept        37578..38429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01261;
FT                   match to protein family HMM PF05114"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86762"
FT                   /db_xref="InterPro:IPR007801"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFD0"
FT                   /protein_id="ABN86762.1"
FT                   /translation="MKAFDRDAGAPRIGLAYGPGMAEFAARHAHLVDYIEVPFELLRFS
FT                   PTIAELQQTIPFVLHCASLSVAGFVPPDDSTVDAIERTAVRTGTPWIGEHLAYISADPI
FT                   GEALGGTHEPTSLSYTLCPQLSDETVRRVADNLAVLAPRFPVPLIVENSPQYFSIPGST
FT                   MGMTDFIRAIADRCDVGLLLDLSHFLITAYNTGADVHREFARLPLERVVEVHLSGMSIQ
FT                   SGAAWDDHSLPASPILFELLERLLAVARPRALTFEYNWSPYFPLSVLTSHIERARALMG
FT                   LA"
FT   gene            38426..39259
FT                   /locus_tag="BURPS668_A0046"
FT   CDS_pept        38426..39259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87958"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFD1"
FT                   /protein_id="ABN87958.1"
FT                   /translation="MNARTIHALIAASAKDPQLIERWRRHPDLLRGAGIAPGDLDWRAL
FT                   EHFVGLSLKVRHNGLRGDFPLSFRLLSVVGLEIEVFAAYASDCAESGHVFAATPQERAR
FT                   DLIAFLDRWLDPAQRNHVLLWDILRHEHALACLRQAGDAPLADARPAARHRARATAGGI
FT                   PTLNGSVVQHVMRCNPDDLAAALHQKEPPLDAIPAVDTYCCYWRSAETGEIRLLRVDTL
FT                   GYCAIEAIDGRRSAADICHRLLGNRRLLPQFLSSLDQLAGIGIVRFARPLGCAAA"
FT   gene            39256..41199
FT                   /locus_tag="BURPS668_A0047"
FT   CDS_pept        39256..41199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0047"
FT                   /product="Fe-S oxidoreductase"
FT                   /note="identified by match to protein family HMM PF02310;
FT                   match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87055"
FT                   /db_xref="GOA:A3NFD2"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFD2"
FT                   /protein_id="ABN87055.1"
FT                   /translation="MKLLLVDNLVMPEEGSLAYLDVHPHLGLLALAAVAEADGHRVRIY
FT                   DPKRLIRDGTLAYDATLYERASRAILAVRPDVVGFTALGCSFLFALNVAALLKRREPDL
FT                   PVLLGGPHATMLHRQILERFPQFDIIVRYEADEILPAVLDCLEQRTFDVIPGLSWRATG
FT                   RGAPLRFTDGKPKVEELDRLPIASYDHYPVDDLGLSMLRIEAGRGCPFACTFCSTAGFF
FT                   QRSFRLKSAERLVHELDILHRRYRVSDFKLDHDMFTVNRHKVMAFCEAVAGRGYRWRAS
FT                   ARIDCVDEALLRKMADAGCVNLYFGVETGSERMQTICRKRLDLRLVEPILAAADSFGIE
FT                   TTASFITGYPQESGQDQDDTLDMIGRCARRPSCLTQLHMLAPEPGTPLFDEHGAQIAYD
FT                   GYGGPYNTRLLGPEDEREVLDHPDIFQTYYYYPAALPRARHIFAVEAVDVLRRAGPIIL
FT                   AYALREFGGRLSRLISAWRRFADETSPGALPDAAGLEAFVAARFGRGHHLHSLFRYALR
FT                   LSAARAPADVVAEGPYEPDRPCMLAENVGLLEDIHNCEALVDRLRRSNDDAPALGDADV
FT                   GGLGAYIVRADGEAVTGYWVESGIAAILDLFRAPRSCRAAAQWLAHVTRNDGVDASIFE
FT                   PLLRRGILVPAR"
FT   gene            41213..42202
FT                   /locus_tag="BURPS668_A0048"
FT   CDS_pept        41213..42202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0048"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87299"
FT                   /db_xref="GOA:A3NFD3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFD3"
FT                   /protein_id="ABN87299.1"
FT                   /translation="MARRKLERWSALDLAEGLQLAHAVAALQTLGVVDAMAEPTTAQTL
FT                   SAACDLDPELLRGVLEYAASRTNLIRKTGDRFSASEHYTAQARFLLNLYAGAYADNASR
FT                   LATLLRRPALAGTTVDLVAHARAFEASEAGGGALAAIISQLHLNHVLDLGCGAGTLLHA
FT                   LAADDREFVGWGLDRNPSMCKAARMRARQAGIAARVKVFQGDGRHPGASIPPRVLARVR
FT                   NVVASQFVNEMFRGGTSRAQAWLRHMRRLLPDRLLVIADYYGRLGHGFQTPHRETLLHD
FT                   YAQLISGQGVPPPNADAWLAMYRAAGCRPLHVIEDRAATTRFVHLVAL"
FT   gene            complement(42374..42994)
FT                   /locus_tag="BURPS668_A0049"
FT   CDS_pept        complement(42374..42994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0049"
FT                   /product="LysE family protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86315"
FT                   /db_xref="GOA:A3NFD4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFD4"
FT                   /protein_id="ABN86315.1"
FT                   /translation="MNWIAFSHGAMLCASLIVTIGAQNAFILRQGIMRSHVGKIVLLCT
FT                   LSDMLLIGAGVGGASVLVERYPAFVHAVLYVGLAYLAWFGLSALRRAFKPGHETLDATG
FT                   AVAAPPAQRAWPIVLMTLAFTWLNPHVYLDTFLLIGTAGAREPEGARGAFAIGAMAVSA
FT                   VWFVALGYGARLLAPWFKRALAWRVLDGAIGGMVLFLAAVQLR"
FT   gene            43102..43995
FT                   /locus_tag="BURPS668_A0050"
FT   CDS_pept        43102..43995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0050"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466; match to protein
FT                   family HMM TIGR03298"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85834"
FT                   /db_xref="GOA:A3NFD5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFD5"
FT                   /protein_id="ABN85834.1"
FT                   /translation="MLDYALLDALAEVIRHGSFERAAKALNVSPSAVSQRVKLLEERVG
FT                   SVLVKRGQPCVATTSGALLCRHTERVRMLEAELSGHMPAFAGAQAGAWPTLRVAVNDDS
FT                   VATWFVDAVGPFCAQSGTLLDLVIDDQDYTAERIRDGSVQGAVTALAEPIQGCRSTRLG
FT                   RMRYHAVCSPAFHARYFGNGVNRDALRRAPCVMFNPKDSLQARFIRRATRVDLDPPQHW
FT                   IPHVAGYLRACEAGLGWGMCPERMVERQIAEGGLIDLSDGRSIDIELYWQSWRLSIGWL
FT                   DEFSAALKASAAQYLD"
FT   gene            complement(44087..44842)
FT                   /gene="fnr"
FT                   /locus_tag="BURPS668_A0051"
FT   CDS_pept        complement(44087..44842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fnr"
FT                   /locus_tag="BURPS668_A0051"
FT                   /product="fumarate/nitrate reduction regulatory protein"
FT                   /note="identified by similarity to SP:P0A9E5; match to
FT                   protein family HMM PF00027; match to protein family HMM
FT                   PF00325"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86965"
FT                   /db_xref="GOA:A3NFD6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFD6"
FT                   /protein_id="ABN86965.1"
FT                   /translation="MLTPVARPAAAAAPVHASSTWAPRQAAHCSTCAMRHLCMPQGLAP
FT                   EALARLESVICTARPVRRGETLFREGDTFDNLYAVRSGSLKTIATRHDGREQVTGLHLA
FT                   GEALGLDGICDDAHPRTAVALEDSSVCVIPYSALKTLCSEAGTMQLRMHKLMSEQIVRE
FT                   TSQTMVLGSLNAEERVAAFLLDVSSRYMKRGYSPNEFNLRMTREDIGSYLGMTLETVSR
FT                   TLSKFHKRGLIEMQGRMVRIVDFDGLHRL"
FT   gene            complement(44992..45459)
FT                   /locus_tag="BURPS668_A0052"
FT   CDS_pept        complement(44992..45459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0052"
FT                   /product="universal stress family protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86529"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFD7"
FT                   /protein_id="ABN86529.1"
FT                   /translation="MYQRILVAVDGSETARHAFDAALDIARTSGAELQPFYVVENAAIY
FT                   YNVPGYDPSILRTQLLQQGNELAKEFAAKMQAAGVKGALKIGEATSLADVPSLIVEGAK
FT                   AFGADLLVLGTHGRRGFKRLVLGSVAEQCVRHSALPVLLIPAAAHPEDRES"
FT   gene            complement(45525..45662)
FT                   /locus_tag="BURPS668_A0053"
FT   CDS_pept        complement(45525..45662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0053"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86250"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFD8"
FT                   /protein_id="ABN86250.1"
FT                   /translation="MPAGQADTPVARKKSGASARNRKNPAPRLLRRVGSLHLRQSSFTL
FT                   "
FT   gene            45883..46113
FT                   /locus_tag="BURPS668_A0054"
FT   CDS_pept        45883..46113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85360"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFD9"
FT                   /protein_id="ABN85360.1"
FT                   /translation="MSYVALEVLTEDANRYSLPELIGVGGVSPDVPHICEMLLADAQWP
FT                   TIQAYLDRQELPYKFARPSTGRRVGRNNPCW"
FT   gene            complement(46254..46562)
FT                   /locus_tag="BURPS668_A0055"
FT   CDS_pept        complement(46254..46562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87687"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFE0"
FT                   /protein_id="ABN87687.1"
FT                   /translation="MRAHDGISASARARAPIDLKPNSHAACVSIDRRYHAHRRRFPAQV
FT                   AGASRGKTPRPGRSNLDTEIGDGAPPRAAPSACACRIAATVVSRSSARAYRAPLVRR"
FT   gene            complement(46549..46857)
FT                   /locus_tag="BURPS668_A0056"
FT   CDS_pept        complement(46549..46857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86759"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFE1"
FT                   /protein_id="ABN86759.1"
FT                   /translation="MRFAMRRAPPADEWVEWVEWVELKNESRRPAGSTDRTAPARMHSI
FT                   IVADGNACAAHPDRRTRARTGRHVLRARAPSGKRMRTRGIPGRDCNRREREPPVEGP"
FT   gene            46891..48471
FT                   /locus_tag="BURPS668_A0057"
FT   CDS_pept        46891..48471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0057"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86725"
FT                   /db_xref="GOA:A3NFE2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFE2"
FT                   /protein_id="ABN86725.1"
FT                   /translation="MQITGEMLIGAAAVRGSEGTMRAYAPAQGVELEPTFGAGGAADVD
FT                   RACRLANAAFDPFRQAPLETRARFLEAIAERIVGLGDPLIERAHAESALPVARLEGERA
FT                   RTVGQLRLFAAIVRDGRWLSATLDSAQPERKPLPRADLRLQKIPVGPVAVFGASNFPLA
FT                   FSVAGGDTASAFAAGCPVVAKAHPAHLGTSELVGRAIRQAVADCGLHEGVFSLVVGAGN
FT                   AIGEALVAHPAIRAVGFTGSRAGGLALMGVAARRREPIPVFAEMSSINPFFVLPGALRA
FT                   RGAQIAQGFVESLTLGVGQFCTNPGLVVALEGPDLKAFVDAAAQALSQKGAQTMLTSGI
FT                   ASSYESAVAARRAAAGVSEVARGVRSDARNAALPALFTTTHTQFVQNPQLEAEIFGPTS
FT                   LVVACRDIDEMIALAEHVEGQLSATLHLEDDDVDLARKLLPTLERRAGRIVANGYPTGV
FT                   EVAYAMVHGGPFPATSDPRSTSVGALAIERFLRPVCYQDLPAALLPEVLADANPLGLWR
FT                   LRDGQLGKA"
FT   gene            48477..49418
FT                   /locus_tag="BURPS668_A0058"
FT   CDS_pept        48477..49418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0058"
FT                   /product="gluconolactonase"
FT                   /note="identified by match to protein family HMM PF08450"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85970"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFE3"
FT                   /protein_id="ABN85970.1"
FT                   /translation="MSEIGSRRYPDPAVRVLDPRFGALRLPSASVECLFQGARWSEGPV
FT                   WFGDGRYLLWSDIPNNRMLRWDEQSGTVGVFRQPSNNANGNTRDRAGRLVTCEHLTRRV
FT                   TRTEYDGSITVLAERFAGKRFNSPNDVIVKSDGSIWFSDPDFGIQSFYEGEKQASEMPE
FT                   RVYRIDPQTGAVDIVVDGVLGPNGLAFSPDEAMLYVVESKGRPRTIRAYDVAADGRTLR
FT                   NERVLIDAAQGTPDGFRIDVNGNLWCGWGMGTDELDGVRVFTPEGDAIGHIALPERCAN
FT                   VCFGGRHRNRLFMAASHGLYSLYVNTQGVPGG"
FT   gene            complement(49475..50236)
FT                   /locus_tag="BURPS668_A0059"
FT   CDS_pept        complement(49475..50236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88191"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFE4"
FT                   /protein_id="ABN88191.1"
FT                   /translation="MTSDAASDAAPVRGTGSRHRFAASVRGIGSRHRFAASVRGIGSRH
FT                   RFSASVRGIGSRHRFAASVRGAHDRRRRPRAVSAPLGRVCIRISKRSRAYVFDLGKRLM
FT                   RTFEGVRRALVALRRLASWRCIDGNFARVEALAMSGHAVTRSRGHAVTRSIVTDIELLE
FT                   RPHRPCDARIERIAARSTQRHRCAPSAKSVPVPTSISSHARAGKQRPSSRAPAARRRPH
FT                   SNGARATCIDTGRQPTCRVAIRRNTRAAAHD"
FT   gene            complement(50288..50704)
FT                   /locus_tag="BURPS668_A0060"
FT   CDS_pept        complement(50288..50704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87487"
FT                   /db_xref="InterPro:IPR021551"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFE5"
FT                   /protein_id="ABN87487.1"
FT                   /translation="MTAMNPFERKTSAAGGRARPRSIELYNDATHDSTVDTDGKNREAA
FT                   RIASGGPISPDQMTTSNASLVNAMPETPDGFAGFDSRPGGNRPQFALRAGYAVVDKGFD
FT                   AAALRNAQMADAFSPPYRPPHRPGRIVELAPVAR"
FT   gene            50972..51208
FT                   /locus_tag="BURPS668_A0061"
FT   CDS_pept        50972..51208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88474"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFE6"
FT                   /protein_id="ABN88474.1"
FT                   /translation="MHSTTTAFTHRGYLLNCAPARASDGSFQPYVVISRSSDGELVANR
FT                   FFPSDLHFNDEDSAIAHARDWAVRWIDASSLTI"
FT   gene            51332..52255
FT                   /locus_tag="BURPS668_A0062"
FT   CDS_pept        51332..52255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0062"
FT                   /product="serine acetyltransferase, plasmid"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85886"
FT                   /db_xref="GOA:A3NFE7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFE7"
FT                   /protein_id="ABN85886.1"
FT                   /translation="MSKSARNWGLEQIVAELRESREKLHRTRHPRGIRELPSRDAVCTI
FT                   VSGLRASMFPTHYGAPDLTDETVDYYVGHTLESTLRLLAEQIRRALRFLPEHAHTPLAV
FT                   LEERAFEIAREFGTQLPRIRALLVSDIQAAYTGDPAAQHITEILLCYPGVLAMMHHRLA
FT                   HALYRLGVPLLARFINEIAHSATGIDIHPGAQIGPSFFIDHGTGVVIGETAIIGERVRV
FT                   YQAVTLGAKSFPADGDGMLVKGNARHPIVEDDVVIYAGATILGRVTIGKGSVIGGNVWL
FT                   THSVPPGSSVAQGKIRESDKDQAEKD"
FT   gene            complement(52556..53359)
FT                   /locus_tag="BURPS668_A0063"
FT   CDS_pept        complement(52556..53359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0063"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87049"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFE8"
FT                   /protein_id="ABN87049.1"
FT                   /translation="MQSSAKPATLPVVLVTGAARRAGRAFALRFAARGYRVAVHYDRSA
FT                   DAAQAVVREIESSGGEAVALQADLAHADAITQLVDAVYTRFGRLDVLVNNASVFWQDHL
FT                   PSFDLAAFDNAWAINCRAPILLTRAYYERAKAALAQGVVINVVDQKIKENFHRDHFSYT
FT                   VAKAALGNLTQMLALSASPVLRVNAVFPGLMLPSDDQTPADFEHASRASTPLARIAGPN
FT                   DVADAILLLTGPAYNGADFVVDAGQNLIRVDQDVLYKHRSPDGKQ"
FT   gene            complement(53360..54070)
FT                   /gene="folE"
FT                   /locus_tag="BURPS668_A0064"
FT   CDS_pept        complement(53360..54070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="BURPS668_A0064"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227;
FT                   match to protein family HMM TIGR00063"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87763"
FT                   /db_xref="GOA:A3NFE9"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFE9"
FT                   /protein_id="ABN87763.2"
FT                   /translation="MTAGKAAAPAAHQAARRTSNKASKTASSAATHEPAGAPANRPSRD
FT                   EAEAAVRVLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEPRDILARTFSEVDGYD
FT                   EMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQIQEKMT
FT                   VQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPATRREFL
FT                   SIVANPSSVNLTNT"
FT   gene            complement(54226..55149)
FT                   /locus_tag="BURPS668_A0065"
FT   CDS_pept        complement(54226..55149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0065"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85561"
FT                   /db_xref="GOA:A3NFF0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFF0"
FT                   /protein_id="ABN85561.1"
FT                   /translation="MPDLDLNLIPYLVALNEARNVSRAGELLGVSQPRVSAALGRLREH
FT                   FGDPLFVRTSRGMEPTPRALALIPAARDALASIERGLGAPHEFDPAKSARTFSIALSDV
FT                   GEIVFLPRLLQAFAQHAPHANLRSASLSHAEVAHALEDGGVDLAVGYFPDLGGTNFFQQ
FT                   RLFTHRFICLLRRGHPLAERPLTLERFLACGHAVVRAEGRSQEVLEQYLMKRRLTRRAV
FT                   LETPHFMSLPFILSRTDLIATVPHAIGYAYAAEHASITLVEPPLPLPRFDLKQHWHRKF
FT                   HNDPSITWLRGVVAQLFNDALDEWPK"
FT   gene            55248..56489
FT                   /gene="pobA"
FT                   /locus_tag="BURPS668_A0066"
FT   CDS_pept        55248..56489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="BURPS668_A0066"
FT                   /product="4-hydroxybenzoate 3-monooxygenase"
FT                   /EC_number="1.14.13.2"
FT                   /note="identified by match to protein family HMM PF01494;
FT                   match to protein family HMM TIGR02360"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86261"
FT                   /db_xref="GOA:A3NFF1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFF1"
FT                   /protein_id="ABN86261.1"
FT                   /translation="MFRRRTMRTQVAIIGAGPSGLLLSHLLRLQGVDSVVLETRSREYC
FT                   ENRIRAGVLEQGTVDTLNDAGLGARMRREGLVHRGIELLFDGRRHRIDFGELTPGRAIT
FT                   VYGQHEVVRDLIEAALEHGQPIHFDVRDVALHDVATERPSVTFMHADGRPDRIDCDYVA
FT                   GCDGFHGVARQAIPAERRRTFERVYPYAWLGILADAAPSLDELVYAHHALGFALFSMRS
FT                   PTVTRLYLQCRPDENLAEWPDARIWEELGTRFENDGGWTPTPGRITQKSVTPMRSFVSE
FT                   TMQHGRLFLAGDAAHIVPPTGAKGMNLAVADVRALSRALVARYRHGRGDLLDAYSSTCL
FT                   ERIWRAEHFSYSMTNMLHPCADDSPFVNRLKLAELKYVTRSRAAAQSLAENYVGLPFDE
FT                   TAGDAPSFGEAAAA"
FT   gene            56562..57410
FT                   /gene="pcaI"
FT                   /locus_tag="BURPS668_A0067"
FT   CDS_pept        56562..57410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaI"
FT                   /locus_tag="BURPS668_A0067"
FT                   /product="3-oxoadipate CoA-transferase, A subunit"
FT                   /EC_number="2.8.3.6"
FT                   /note="identified by match to protein family HMM PF01144;
FT                   match to protein family HMM TIGR02429"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87492"
FT                   /db_xref="GOA:A3NFF2"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFF2"
FT                   /protein_id="ABN87492.1"
FT                   /translation="MIGKPFANRIRVRYSNQSDRRAKRAALRANACRGGRRARIRIGRD
FT                   MVNKIFDSIQSAVADVHDGATIMIGGFGTAGMPAELIDALIAQGARDLTIVNNNAGNGE
FT                   TGLAALLKARRVRKIICSFPRQADSQVFDALYRAGEIELELVPQGNLAERIRAAGAGIG
FT                   GFFSPTGYGTKLAEGKETRVIDGKHYVFETPIHADFALVKAYRGDRWGNLVYRKTARNF
FT                   GPVMAMAAKTSIVQVSQVVPLGALNPEHIVTPGIFVQRIVEVPQAAHAAELAAERAASA
FT                   A"
FT   gene            57429..58085
FT                   /gene="pcaJ"
FT                   /locus_tag="BURPS668_A0068"
FT   CDS_pept        57429..58085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaJ"
FT                   /locus_tag="BURPS668_A0068"
FT                   /product="3-oxoadipate CoA-transferase, B subunit"
FT                   /EC_number="2.8.3.6"
FT                   /note="identified by match to protein family HMM PF01144;
FT                   match to protein family HMM TIGR02428"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88274"
FT                   /db_xref="GOA:A3NFF3"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFF3"
FT                   /protein_id="ABN88274.1"
FT                   /translation="MKRLTRDDMAKRVAQDIPEGAYVNLGIGVPTLVANHLDPSREIFL
FT                   HSENGLLGMGPAPAPGAEDDELINAGKQHVTLLTGGAYFHHADSFAMMRGGHLDYCVLG
FT                   AFQVSAHGDLANWHTGAPDAIPAVGGAMDLAIGAKHVFVMMEHLTKQGESKIVAECSYP
FT                   VTGVRCVDRIYTDLAVLDVISDGLAVREICAGLSFDELQQLTGVPLIDATQKAAA"
FT   gene            58221..59579
FT                   /gene="pcaB"
FT                   /locus_tag="BURPS668_A0069"
FT   CDS_pept        58221..59579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="BURPS668_A0069"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /EC_number="5.5.1.2"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR02426"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86032"
FT                   /db_xref="GOA:A3NFF4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFF4"
FT                   /protein_id="ABN86032.1"
FT                   /translation="MLEDSARLTALVCGSEPLNRIWSPHATLQRMLDVEAALARALAAN
FT                   GVIPANAVRPIEAACAASELDAQALMRDAALGGNLAIPLVRQLTARVKVRDAEAAKYVH
FT                   WGATSQDIIDTAAVLQLRDTLDWLDPLLRDTCTALATLAAAHRTTPMIGRTWLQQALPI
FT                   TLGLKFAQWLDALLRHRERIVALRERALALQFGGAAGTLASLRDAAPAVARSLADDLRL
FT                   ALPAVPWHTQRDRIAETAVCFGMLIGTLGKIARDISLSMQTEIGELAEPAAAGKGGSST
FT                   MPHKRNPVGCAAVLTAAVRAPGLVSTVLAGMVQEHERALGGWQAEWDALPELARLAGGA
FT                   LAQVAQIVEGLNVDVARLADNLDATRGLVLGEAVMLALGDRIGRLDAHHLVERASKQAV
FT                   RSGRPLYDVLAADPDVAAHLTPQALRQLLDPAHYVGEAHAYVDAVLALHASRH"
FT   gene            59592..60377
FT                   /gene="pcaD"
FT                   /locus_tag="BURPS668_A0070"
FT   CDS_pept        59592..60377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaD"
FT                   /locus_tag="BURPS668_A0070"
FT                   /product="3-oxoadipate enol-lactonase"
FT                   /EC_number="3.1.1.24"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR02427"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86738"
FT                   /db_xref="GOA:A3NFF5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFF5"
FT                   /protein_id="ABN86738.1"
FT                   /translation="MPFASVDGVRLHYRIDRAARADAPWLVFSNSLGADLSMWAPQIGP
FT                   MTAHFNLLRYDTRGHGHSDAPAGSYTIEQLAGDVIGLLDHVGVARAHFCGISMGGLTGA
FT                   ALAARHAKRVDRVVLSNTSAKIGSPEIWAPRARKARAEGMAALADAVLPRWFTAAFFER
FT                   EPRLIDVIRDTFNHTDKDGYAANCDALNAADLRDEAKGIAVPTLVVTGAHDLSTPPEQG
FT                   RALAASIAGAKHVEFDCAHISNIECADGFNRTLIDFLTA"
FT   gene            60393..60779
FT                   /gene="pcaC"
FT                   /locus_tag="BURPS668_A0071"
FT   CDS_pept        60393..60779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="BURPS668_A0071"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="identified by match to protein family HMM PF02627;
FT                   match to protein family HMM TIGR02425"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85825"
FT                   /db_xref="GOA:A3NFF6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFF6"
FT                   /protein_id="ABN85825.1"
FT                   /translation="MNDDQRYEAGMNVRRAVLGDAHVDRSLANRTDLTDEFQNLITRYA
FT                   WGEIWTRAGLPRHTRSLLTIAMMVALNRGEELALHLRAAKNNGVTRDEIKEVLLQTAIY
FT                   CGVPVANSAFHLAQRIFGEEDSAS"
FT   gene            60947..62302
FT                   /gene="pcaK"
FT                   /locus_tag="BURPS668_A0072"
FT   CDS_pept        60947..62302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaK"
FT                   /locus_tag="BURPS668_A0072"
FT                   /product="4-hydroxybenzoate transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86542"
FT                   /db_xref="GOA:A3NFF7"
FT                   /db_xref="InterPro:IPR004746"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFF7"
FT                   /protein_id="ABN86542.1"
FT                   /translation="MTDLARQLDVQQFIDERRFSPYQWLILILCFLIVAADGFDTAAIG
FT                   FVAPALAQQWHVTKAALGPVMSAALVGLALGALAAGPLADRIGRKRVLVGSVVLFGLFS
FT                   IGCAFTQSVTELAVLRLLTGLGLGAAMPNATTLIAEYAPHAKRSFLVNTMFCGFTLGSS
FT                   AGGLVAAALIPEHGWRSVFIVGGIAPLALGALLIALPESIRFMVLRGAPHERIAAVLRR
FT                   IAPDAAFDGVRFVLPDDRGEQRRSGAAVVLSPRYRAGTAMLWLTYFMGLLVYYLMTSWL
FT                   PTLIRDTGFTVRDAALVTALFPLGGGIGAIACGWLMDRIEPHRVIAFTYALTALFVWMI
FT                   GLQAGHLALLATVVFVAGVCMNGAQSSLPALAAAFYPTSGRATGVAWMLGVGRFGGILG
FT                   AFSGGLLLQAQLGFGTIFSMLAVPALIAAGALMVKRSAASRETQPDAPTRAA"
FT   gene            complement(62370..62618)
FT                   /locus_tag="BURPS668_A0073"
FT   CDS_pept        complement(62370..62618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85567"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFF8"
FT                   /protein_id="ABN85567.1"
FT                   /translation="MKPLLKAGDRIEGLHWVAEYRHRARLIRVLRERVEVGTYGAPSAL
FT                   FGDEEEMGASTPADHRGREAALRAYLRHFAKVHDAEE"
FT   gene            complement(62719..63336)
FT                   /locus_tag="BURPS668_A0074"
FT   CDS_pept        complement(62719..63336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0074"
FT                   /product="translocator protein, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86162"
FT                   /db_xref="GOA:A3NFF9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFF9"
FT                   /protein_id="ABN86162.1"
FT                   /translation="MNYLTLSALPAGMLFALVTSITPGPNNTMLLASGVNFGFRRTLPH
FT                   MFGISAGVAILMLSVGFGLGEAFKRIPILYTLLETASVVYLLYLAWRIGTSGEVRAHNG
FT                   KSRPMTFVEAIAFQWVNPKAWMMVLTAATTIQLSADYGRNAVWMALVFVFVGLPCISVW
FT                   AAFGQGLRGFLSNPRWLRVFNLTMATLLVLSLYPMFAKVSGH"
FT   gene            64096..64212
FT                   /locus_tag="BURPS668_A0075"
FT   CDS_pept        64096..64212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0075"
FT                   /product="Orn/DAP/Arg decarboxylase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87777"
FT                   /db_xref="GOA:A3NFG0"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFG0"
FT                   /protein_id="ABN87777.1"
FT                   /translation="MATARPGDLLVVFQSGAYGLTASPNGFLSQPAAREVIV"
FT   gene            64368..65393
FT                   /locus_tag="BURPS668_A0076"
FT   CDS_pept        64368..65393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88501"
FT                   /db_xref="GOA:A3NFG1"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR016986"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFG1"
FT                   /protein_id="ABN88501.1"
FT                   /translation="MKWPMPHILLIVLCLLTSVAHAAGSQLLRVPPSDGRPALMGMVWY
FT                   PCADDIGASAAGAAARNGARCPMRGDALPLVVISHGSASSFGAHYDTAEALAEHGFVVA
FT                   AINHPGDTTNDESEIGSLSALLVDRPADMKRLIDFMLTGWHDAARLDPRRIGFFGFSRG
FT                   ALTGLIVAGGKPELSRMIVECENEPTWGVCQNPILPRRPLPRDARIRAMVLADPVFGAI
FT                   FANGLAGVTIPVQLWASEYGGDGMSPSDVEAVARGLPEKPAYFVVPRAAHFAFIAPCDR
FT                   ASMEAVPRICNDGEGFDRIRFHQAFNARVVGFFEQTLRDPRPAATPGVGQPRAQNETSR
FT                   T"
FT   gene            complement(65533..66261)
FT                   /locus_tag="BURPS668_A0077"
FT   CDS_pept        complement(65533..66261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0077"
FT                   /product="IS6 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86798"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFG2"
FT                   /protein_id="ABN86798.1"
FT                   /translation="MKPKALYHGHRFPAAIISQAVRWYFRFQLSLRDIEELLFERGVIV
FT                   SYETIRRWCDKFGAAFARRVKAARRKPGRTWHLDEMFVNLRGEPWLLWRAVDEHGAELD
FT                   ILLQKRRDKAAAKRSFQRVLRSCPAPCNIVTDQLRSYPAAKAGIPELANVKHVFVKAAA
FT                   RVNNRAENSHQPTRERERRMRGFRGPKRTQAFLASFGPIRQHFALKRHLLRASLYRKHL
FT                   AVRFSTWREFTEVTQNPSAA"
FT   gene            complement(66266..66745)
FT                   /locus_tag="BURPS668_A0078"
FT   CDS_pept        complement(66266..66745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0078"
FT                   /product="LysE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87524"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFG3"
FT                   /protein_id="ABN87524.1"
FT                   /translation="MHARMDAWKRRLGPLRKSGLGHRFRESCPLWARRKGVFGPLDRSR
FT                   TWTSFLRTPHASCLRKDVLGHENSQKSRLWECRGLAWASRRNLPTSSVVDVRLSTRRRR
FT                   TGCAINVRIVCIEQSAMDPDLACNSTLPHGFDQFLASLRDSKSGRCHVGGCGRVR"
FT   gene            complement(66772..67809)
FT                   /locus_tag="BURPS668_A0079"
FT   CDS_pept        complement(66772..67809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87294"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFG4"
FT                   /protein_id="ABN87294.1"
FT                   /translation="MNSLKKRRIGIAALLALSAALALSGLAAHRALRAARPAPALLALK
FT                   QVADIPLPGGATRFDYESIDPNRRLLYIAHLGDAEIVVFDLRASQVTARIGDISSVHGV
FT                   LAVTELSRVYASATGTDEVVAIDARTRKIVARIPGGRYPDGMAYAPEAFKLYVSDEYGE
FT                   TETVIDTRTNRRIATIALGGEAGNTQYDPSSRHVFVNDQTHARLVEIDPALDRIVNRFD
FT                   LPGAKGNHGLLIDPRDRLAFIACEGNDKLLILDMRSMRIVQSFDIGGSPDVLAFDPSLA
FT                   TLYVAGEAGVISRFRVEASGVRKIDEGRLAAHAHVVAVDPSTHRSYFPLKNIGGRPVLR
FT                   VMRPA"
FT   gene            complement(67867..68790)
FT                   /locus_tag="BURPS668_A0080"
FT   CDS_pept        complement(67867..68790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07485"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88009"
FT                   /db_xref="InterPro:IPR011094"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFG5"
FT                   /protein_id="ABN88009.1"
FT                   /translation="MLLLNKLAPAIAAAVIAHAVANPALAQRRAALDTGRIEQIVGLKG
FT                   VYSAKENVFKISKPRDDVKIQVDEWTMPPFMGLTSWAAFAPGHHGQAMMMGDTVLLEDE
FT                   VNPAMSAALDAGLEVTALHNHFFFDRPRVYFMHIGGTGDPASLAEGVKKIYDKVAEIRS
FT                   AHPAPESAWPGRIAEPSTITAAPLEAILGRKGQTNNGMFKVIVGMTAGMHGIKIGNEMG
FT                   VNTWASFAGSDDEAVVDGDFAMREDELQTVLKRMRASGINIVAIHQHMTGETPRILFLH
FT                   YWGKGRAASLAKGVRAALDARAALPR"
FT   gene            complement(68906..70162)
FT                   /locus_tag="BURPS668_A0081"
FT   CDS_pept        complement(68906..70162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0081"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87930"
FT                   /db_xref="GOA:A3NFG6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFG6"
FT                   /protein_id="ABN87930.1"
FT                   /translation="MPASSGRFSASLAGRIPPAGADKTAALVLASRGMRGFCDGFIAVL
FT                   LPAYLLALGFSQLDVGLVSTVTLLGSALATIAVGMLAGRVAHRRMLMLAAALMAATGIG
FT                   FASLSTLWALIAVAFVGTLNPSAGDVSLFLPLEQSRLAEAAAGDARTALFARYSLIGAL
FT                   SAAAGSLAAGLPLWLAAHTSIPLPGAMRGMFVVYAGAGVAVWLLYRHLPLPEAHAPAAP
FT                   PPLGPSRRIVTRLAMLFSVDAFAGGLVVNSLLSLWLMQRFGLSVAAAGRFFFCAGLLSA
FT                   GSQLAATPLSRRIGLLNTMVFTHIPSSVCLIGAAFAPSLPLTLALLLLRSALSQMDVPT
FT                   RTAFVMAVVTPAERPAAAGLTSVPRSLAAAIAPALAGGLLGLGWLGAPLVACGALKIGY
FT                   DLTLLASFRHVEPDGGPGR"
FT   gene            complement(70149..70577)
FT                   /locus_tag="BURPS668_A0082"
FT   CDS_pept        complement(70149..70577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0082"
FT                   /product="ChrB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85598"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFG7"
FT                   /protein_id="ABN85598.1"
FT                   /translation="MKWITRERPKIDRIACPWLIARFVDKAAEFLYVPDADVLRIAKET
FT                   GAIPFDVPDVELGHHGELCSFDAFLEKYALHDPALLKLAAIVRGADTGRYDLAPEASGL
FT                   HAISVGLSGNFRDDLEQLRYGMVMYDALYAWCRRDACL"
FT   gene            70618..70782
FT                   /locus_tag="BURPS668_A0083"
FT   CDS_pept        70618..70782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0083"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86892"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFG8"
FT                   /protein_id="ABN86892.1"
FT                   /translation="MMPCISRRRRLRRPRRSGTARRRAAPLPAPARSETAGRDVSFVVR
FT                   RPISTALHP"
FT   gene            complement(70979..72169)
FT                   /gene="chrA"
FT                   /locus_tag="BURPS668_A0084"
FT   CDS_pept        complement(70979..72169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /locus_tag="BURPS668_A0084"
FT                   /product="chromate ion transporter protein ChrA"
FT                   /note="identified by match to protein family HMM PF02417;
FT                   match to protein family HMM TIGR00937"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85940"
FT                   /db_xref="GOA:A3NFG9"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFG9"
FT                   /protein_id="ABN85940.1"
FT                   /translation="MTTTVTPHAPAYSMSQLVGYMLRLGTFGFGGPVALAGYMRRDLVE
FT                   RRGWISEADYKEGLTLAQLAPGPMAAQLAIYLGYVHYRILGATLAGFAFVLPSFLMVVA
FT                   LGFAYAHFGGLPWMQAVFYGVGAAVVGIIAMSAYKLTTKTVGKDKLLGAIFVTLAAVTF
FT                   VTESEIAWLFIAAGLIGWLWRAPPKWLGSSGANALAAAHLPATGGFVSGLMRGVDVSVL
FT                   AQIGLFFAKAGAFVFGSGLAIVPFLYGGVVTGHHWLNDKQFVDAVAVAMITPGPVVITV
FT                   GFIGYLVAGFPGALVAALGTFLPCYLFTVVPAPYVKKYGHLPSVKAFVDGITAAAVGAI
FT                   TGSVLVIAKRSIVDAPTAAVALVTIVLLWRVKKLQEPVIVAAAAVVGLLAYPWLHR"
FT   gene            complement(72166..73161)
FT                   /gene="chrB"
FT                   /locus_tag="BURPS668_A0085"
FT   CDS_pept        complement(72166..73161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrB"
FT                   /locus_tag="BURPS668_A0085"
FT                   /product="chrB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87116"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFH0"
FT                   /protein_id="ABN87116.1"
FT                   /translation="MSNIRYMKIASTWSLLVLTLPTENATARMRFWRALKAKGCAVLRD
FT                   GVYLLPHTEAREGMLRELADAIAESGGAAHLLRVPSLDASQEAEFRALFDREEDYAGFV
FT                   RDLAQARKTLASQSAAELARLLRRLRKDFEAIRAIDYFPDDAATRAELAWQDFVSLVDT
FT                   VLSPGEPHAAERAIRRLAIDDYQGRTWATRQRMWVDRVASAWLIRRFIDTRARFIWLAS
FT                   PSECPDGALGFDYDGAAFTHVGERVTFEVLLASFGLDQDPALLRLGTIVHALDVGGPGA
FT                   PETVGFEAVMAGARRRAENDERLLEQMSDVLDSLYAYFATNETDKTGSRS"
FT   gene            complement(73365..73790)
FT                   /locus_tag="BURPS668_A0086"
FT   CDS_pept        complement(73365..73790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86157"
FT                   /db_xref="GOA:A3NFH1"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFH1"
FT                   /protein_id="ABN86157.1"
FT                   /translation="MIMAGMRRFAATRIRHWNASIVAGLAFVASVAAAQCGLPAVEEVP
FT                   PALPGALPWKFRAAAIAMQAVPWAVIGLLFGYLAARSGIPGRRDAGVGFRPAPISTPAS
FT                   PTAAAFLAPARAGRLPGFANASRGIDCSVGRARANRR"
FT   gene            74103..74651
FT                   /locus_tag="BURPS668_A0087"
FT   CDS_pept        74103..74651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85873"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFH2"
FT                   /protein_id="ABN85873.1"
FT                   /translation="MTPMHTLSFAALLSALPLAAHAQDAQLTDPQIAAIVVTANQVDID
FT                   AGKLAQGRTHTKQVKDFANLMVTDHTSVNEAAVALATKLSLKPEDNATSGALKRGGDDN
FT                   IATLKTLRGHEFDKAYIGHEVAYHQQVLDAMDKALIPAAKNGELKALLVKVRPAFAAHL
FT                   GHARDLQSKLGGDRDRKAD"
FT   gene            74704..75006
FT                   /locus_tag="BURPS668_A0088"
FT   CDS_pept        74704..75006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0088"
FT                   /product="copper binding protein, plastocyanin/azurin
FT                   family"
FT                   /note="identified by match to protein family HMM PF00127"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86601"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR035668"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFH3"
FT                   /protein_id="ABN86601.1"
FT                   /translation="MAAAVAAVGPAAAGATHTVAIEGMRFNPDSLTVERGDKIVWVNKD
FT                   LVAHTATATAAHAFDSHEIAPNASWAYVARSPGRFAYVCALHPTMKANLIVKSKR"
FT   gene            75015..75710
FT                   /locus_tag="BURPS668_A0089"
FT   CDS_pept        75015..75710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0089"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87340"
FT                   /db_xref="GOA:A3NFH4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFH4"
FT                   /protein_id="ABN87340.1"
FT                   /translation="MTTEQRSGDMQPSRVDDRALAARVAGGDHAAFEQLMRRYNRRLYR
FT                   LARATLRDDAQAEDVLQEAYLAAFRTIGRFRGDASLSTWLSRLVLNACFTRQRRGARRD
FT                   NIAPMVNTSSIAGFERTTMDADLTSSPDHALMRTELRALLERKLDALPEAFRLVFVLRC
FT                   VEELSVEETAQCLGIPEATVRSRHFRAKRLLRESLAREIDSAGRDVFSFAGERCDRIVR
FT                   GVLARLISP"
FT   gene            76187..82102
FT                   /gene="uvrA_2"
FT                   /locus_tag="BURPS668_A0090"
FT   CDS_pept        76187..82102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA_2"
FT                   /locus_tag="BURPS668_A0090"
FT                   /product="excinuclease ABC, A subunit"
FT                   /EC_number="3.1.25.-"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88071"
FT                   /db_xref="GOA:A3NFH5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFH5"
FT                   /protein_id="ABN88071.1"
FT                   /translation="MSSSNLIRIRGARQHNLKHIDLDLRTGEMTVVTGPSGSGKSSLVF
FT                   DTLYAEGQRRYVETFSAYARQFLDRMDRPQVERVDGVPPAIAIDQTNPVRSSRSTVGTM
FT                   TELNDHLKLLYARAAELFDRRTARLVRHDTPETIYADLFARTQAHDPRIAITFAVELPE
FT                   NASDEEVEQWLSASGYTRVQARRDVASPTGPRKVLDVVADRFRLHQIDKARAIEAIEAS
FT                   LKRGGGRVSIYVLAQAPEGADGGAAQSQVWRYSTGLHDPDSDLRYADPQAALFSFNSAY
FT                   GACETCRGFGRVIGVDLGLVIPDARKTLRGGAVKPMQTPAWKECQDDLMRYAAKANIRR
FT                   DTPWAELTPAEQDWVINGSPDWNGKWQSQWYGVKRFFGYLESKAYKMHIRVLLSKYRSY
FT                   TPCAVCGGARLKTEALLWRLGTKANADAVLASADRFMPRGVDWTRAQLEALPGLTVHDL
FT                   MLLPIERIRRFFDDISLPSALLDDALKLLLAEVRTRLKYLCDVGLGYLTLDRQSRTLSG
FT                   GEVQRINLTTALGTSLTKTLFVLDEPSIGLHPRDLNRIVEAMRRLRDAGNTLVVVEHDP
FT                   SVMLAADRLIDMGPGPGERGGTIVYDGTPGAIRSARTLTGEYLGGRKHVAHASNWARRP
FT                   VDARTPRIVLEGASEHNLRDVTVEIPLQRLVCVTGVSGSGKSTLLQDVLYPAMARHFGK
FT                   ATESPGAYRRLAGAEQVGDVVFVDQSPIGKTTRSNPASYVGAFDEIRKLFAKAPLALQR
FT                   GYSAGTFSFNSGDGRCPSCGGSGFEHIEMQFLSDVYLRCPDCDGSRYRAEILEVRIERG
FT                   GRALSVADVLDLTVSEAAACFAADADVLRVLQPIVDVGLEYVKLGQPVPTLSGGEAQRL
FT                   KLAGFLAESAKARDGRRVVTEEARVARARLFMFDEPTTGLHFDDIAKLMQAFGKLLASG
FT                   HSLIVIEHNLDVIRAADWLIDLGPEGGDGGGLVLCAGTPDDVKACAGSHTGAALLQYER
FT                   AMNVGADADVSGDAGVPLQAALNAARARRAIEGENVVRIVNAREHNLKALDVDIPHGKF
FT                   NVVTGVSGSGKSTLAFDILFHEGQRRYLESLNAYARSIVQPAGRPEVDAVYGIPPTVAI
FT                   EQRLSRGGRKSTVATTSEVWHFLRLLYVKLGLQHCIHDGTPVTSQTVESIAAQLLRDHR
FT                   GEHVGLLAPLVVNRKGVYTDLAKWAKARGNTHLRVDGEFVTVDPWPKLDRFREHTIELP
FT                   VADLVVSPDNEAELRQRLDETLELGKGVMHLLAPLDGLRHAMDNRLCTAGVGAIKVLSV
FT                   KRACPVCGTSYPELDPRMFSYNSKHGWCTTCVGTGLALTREQRAAYDDTVLAEDGRGRE
FT                   QTLPSDEQEPEGVGDEPCPDCGGTRLNPSARAVTFGRHSIVDVAQWTVTDTRRWIEGLQ
FT                   LAGRDAQIARDIVGEIGSRLAFLEEVGLGYLSLDRAAPSLSGGEAQRIRLAAQLGSNLQ
FT                   GVCYVLDEPTIGLHPRDNQILLSALRKLGDKGNTLVVVEHDEDTIRRADHIIDIGPGAG
FT                   RRGGTLVAQGGVADLSAQSASVTGRLLAQPMTHPLQPRRSVNPPGKRNGHAVPQAWLTV
FT                   HRARLHNLRDVTVGIPLARLVAVTGVSGSGKSTLARDVLMTNLLDAVGRSVLSSPAARR
FT                   ARKAAQQDAPRAAKSRASVLARSAPRPVLNVTHAWQGCESISGWEHIDRVLEVDQTPIG
FT                   KTPRSCPATYIGVWDAIRRLFADTLEARARGYTASRFSFNTGEGRCPACEGQGVRTIGM
FT                   SFLPDVKVPCDVCHGQRFNPETLAVTWRGRNIGDVLTMEIDEAVEFFAPLSNIAHPLQL
FT                   MKDVGLGYLTLGQPSPTLSGGEAQRIKLVTELSKVRDDVTRRGQKAPHTLYVLDEPTVG
FT                   LHMADVAKLIRVLHRLVDAGHSVVVIEHDLDVIAEADWIVDLGPEGGAGGGTIVAAAPP
FT                   EGLAEVSASHTGRALGAVLARTGADRDEPLRSGTARAG"
FT   gene            complement(82661..82780)
FT                   /locus_tag="BURPS668_A0091"
FT   CDS_pept        complement(82661..82780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0091"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86851"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFH6"
FT                   /protein_id="ABN86851.1"
FT                   /translation="MTEIGVRSTTLCPSPLIVPWVPDISHAIAREARITNSAQ"
FT   gene            82779..82982
FT                   /locus_tag="BURPS668_A0092"
FT   CDS_pept        82779..82982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86092"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFH7"
FT                   /protein_id="ABN86092.1"
FT                   /translation="MEQAKQYGGYQKAAEQIESNRLAIVNSTRYSASVRRQVNDGLSKN
FT                   VATLKCWAAACVDKPDNPACRF"
FT   gene            complement(83135..83395)
FT                   /locus_tag="BURPS668_A0093"
FT   CDS_pept        complement(83135..83395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03693"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85896"
FT                   /db_xref="GOA:A3NFH8"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFH8"
FT                   /protein_id="ABN85896.1"
FT                   /translation="MRTTRTLSISLPYEMADYIRAKVSTGEFATESEVIRDALRTLIAR
FT                   DRVVEAWLRDAVNSGEFALDPDAEWAADKDEAKPARPRRRP"
FT   gene            complement(83537..83944)
FT                   /locus_tag="BURPS668_A0094"
FT   CDS_pept        complement(83537..83944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0094"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88462"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFH9"
FT                   /protein_id="ABN88462.1"
FT                   /translation="MKTTAVRSPTGSDDPPARLSSPQQSFLAEVSRYGISHTTFELAPA
FT                   MIPMPSFAVWRTVFMRDLAHAGLRDIAATHAIGEWVKLGTLEQRRTRDTARPLPVYRLP
FT                   ECFCTRSILGLSASLQGAQHGFQDERRTSER"
FT   gene            83935..84057
FT                   /locus_tag="BURPS668_A0095"
FT   CDS_pept        83935..84057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0095"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87194"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFI0"
FT                   /protein_id="ABN87194.1"
FT                   /translation="MSSSSCRLAANAACYSPIRRFADWGCIDPLRELFSQSCGA"
FT   gene            84054..84326
FT                   /locus_tag="BURPS668_A0096"
FT   CDS_pept        84054..84326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86612"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFI1"
FT                   /protein_id="ABN86612.1"
FT                   /translation="MSEEVGRWRHALRRFSMNTTLEDLKTRLEAGRMPIGARGVAMERV
FT                   EVTAAQTTDILAARHGDGNAEEEYFQRNDDAWQWRWRAPDYYEIV"
FT   gene            complement(84609..84935)
FT                   /locus_tag="BURPS668_A0098"
FT   CDS_pept        complement(84609..84935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0098"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86442"
FT                   /db_xref="GOA:A3NFI3"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFI3"
FT                   /protein_id="ABN86442.1"
FT                   /translation="MLDWIKGENMSTYLELKAKADEILRQAEEARRSELETVLKEVRTR
FT                   VAEYGLTPEQVFGARRGRRGQQVHASPTVPKYRDPKTGATWSGRGREPGWIKGKKRERF
FT                   LIQQ"
FT   gene            complement(84941..85108)
FT                   /locus_tag="BURPS668_A0099"
FT   CDS_pept        complement(84941..85108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0099"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86121"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFI4"
FT                   /protein_id="ABN86121.1"
FT                   /translation="MRAARNPIAPRRRALHEHRAIPKMDPREVQCASPAGENSMSGPTI
FT                   FLKISYYPLY"
FT   gene            85459..86811
FT                   /locus_tag="BURPS668_A0100"
FT   CDS_pept        85459..86811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0100"
FT                   /product="MFS transporter, metabolite:H+ symporter (MHS)
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87900"
FT                   /db_xref="GOA:A3NFI5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFI5"
FT                   /protein_id="ABN87900.1"
FT                   /translation="MEPTFTETGARASEPHATTLAGRAASSGDKLQRLKSIFSASAGNL
FT                   IEWYDWYVYSAFALYFAHSFFPAGNQTAQLLNTAAVFAVGFLARPVGGWLMGIYADRYG
FT                   RRPALLVSVVLMCVGSLIIALCPGYDVIGTAAPVLLVVARLLQGLSVGGEYGTSATYLS
FT                   EVATARDRGFYSSFQYVTLVAGQLVALALLIVLQQFVLTTQQLESWGWRIPFFIGAACA
FT                   LAAMRLRSSMEETGEFKRTLNARDKRGTLAELSKHPRAVLTVVGLTMGGTIAFYTYSIY
FT                   MQKFLVNTVGMSKHDATLVSAASLALFAILQPIVGSISDRIGRRPVLIAFGVLGTLFTV
FT                   PIMTAISRTHDVWTAFFLNMAALVIVSGYTSINAVVKAELFPAKIRALGVGFPYALTVS
FT                   IFGGTAEYLALWLKQAGHESLFYWYVTAAIFCSLLVYVCMRDTGKHSLIKD"
FT   gene            86864..88795
FT                   /locus_tag="BURPS668_A0101"
FT   CDS_pept        86864..88795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0101"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87566"
FT                   /db_xref="GOA:A3NFI6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFI6"
FT                   /protein_id="ABN87566.1"
FT                   /translation="MRLRGIRRLHRPAAVLAVIACCVATAWLGYSVALRYYFRAHMNEV
FT                   AQRSSLYALTLESQLARYESIPRIAALEPVLSRLLNDPGERALRDEANAYLNAVQKNAE
FT                   LSAAYVMNARGETLAASNSNEPGSFVGSNYAFRPYFADAMKRGFGRFYGVGNTTGQAGY
FT                   FLAVPIRHPGQPARAPIGVVAIKASLDRYEAALTKSGDVVLLVDRDGVAFLSSVASWRY
FT                   RTLTPIPAATLRKLAATRQYGDAALEPLSDTPPALAGAGRSSTQADSAPTPESLHLSLS
FT                   GGRPAWYHVVYRAAGPLGWRVAVLVDSTDDERRTLFASGGVAAATALVFALIMVAWLRH
FT                   SREKERQRARTALLAAQRDLERRIAERTAELTAANAALEEKVDALDAARRILRDTRDTA
FT                   IQAGKLAALGQMAAGITHELNQPLAAIMTLSSNAVRMAALGRSADLTRNLELVNDLAGR
FT                   MGKIVAHMKGFARHESVSREAVSISEALQQALTLIEAHRKAAKVSVRVEPVPGQGIVLA
FT                   SSIRIEQLLVNLLTNAIDASAAGMDNRQVVVTTDVAGDIVRISVADSGKGIPADVMPRL
FT                   FEPFFTTKQTGKGLGLGLAISQAIVDEFGGRLHARNGSGVEPELGGAVFIVELHRVSRK
FT                   FSSHDERR"
FT   gene            88782..90125
FT                   /locus_tag="BURPS668_A0103"
FT   CDS_pept        88782..90125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0103"
FT                   /product="C4-dicarboxylate transport transcriptional
FT                   response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF02954; match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87131"
FT                   /db_xref="GOA:A3NFI7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFI7"
FT                   /protein_id="ABN87131.1"
FT                   /translation="MNADNAYGREAVYVIEDDAAVRLGCSQALALEGIGVREFEGAESA
FT                   LAALKRDPPAAIVSDVRLPGMGGLALLDSMKAHPRDADIPVILMTGHGDVAMAVGAMRC
FT                   GAYDFIEKPFHSDRLVDTVRRALEHRKLVIENRSLRAQLSGERPLLGSAPAMQRVHALI
FT                   DAIGPTSADVLIIGETGTGKEVLARALHAASRRTGPFVALNCAALPEAVFESEIFGHEP
FT                   GAFTGAQQRRIGKFEYASGGTLFLDELESMPLSLQAKLLRALQERSIERLGSNVSVAVD
FT                   VRVIAAVKQDLKQLVADGLFRSDLYFRLNVASIELPPLRRRTDDIPELFSHFLRAAAVR
FT                   FEKPEPVWTQEDMMRWQLYDWPGNVRELKNTAERFCLGLEDGLPRSPAGFDSLASRMVS
FT                   AERAYIEEALRNAGGQVAKAAELLGLPRKTLYDKITRHGIDMTAFRCT"
FT   gene            complement(90082..90243)
FT                   /locus_tag="BURPS668_A0102"
FT   CDS_pept        complement(90082..90243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0102"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88579"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFI8"
FT                   /protein_id="ABN88579.1"
FT                   /translation="MIGFAAQLSPRRTALGHTPSAASRRTGFAPAPSTRVAKRVTCSET
FT                   PSYRCHAA"
FT   gene            complement(90240..90416)
FT                   /locus_tag="BURPS668_A0104"
FT   CDS_pept        complement(90240..90416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87822"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFI9"
FT                   /protein_id="ABN87822.1"
FT                   /translation="MNEINILHEPLTAASSNYPDIAITGGQGMTAAAIRFSSMRPHGRA
FT                   TYSRAITSNYEPL"
FT   gene            complement(90559..90678)
FT                   /locus_tag="BURPS668_A0105"
FT   CDS_pept        complement(90559..90678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0105"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85658"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFJ0"
FT                   /protein_id="ABN85658.1"
FT                   /translation="MFDAGNRRSCGKTRISGAALLGATSGSDNGRSRSFVSST"
FT   gene            complement(90919..91149)
FT                   /locus_tag="BURPS668_A0106"
FT   CDS_pept        complement(90919..91149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86374"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFJ1"
FT                   /protein_id="ABN86374.1"
FT                   /translation="MPTLAKSLLLTLMACFAFSGEAGAAQKTFCYFHHNCPADGKLPKG
FT                   KPPEQYTKRQCKNIGGKSWGDGPTSCENVNK"
FT   gene            91262..91411
FT                   /locus_tag="BURPS668_A0107"
FT   CDS_pept        91262..91411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0107"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86276"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFJ2"
FT                   /protein_id="ABN86276.1"
FT                   /translation="MVNDFLSGENKAVSIDLVFIFEFYMPGRRLFRKAVAQACIGLRNI
FT                   ARIG"
FT   gene            complement(91594..92151)
FT                   /locus_tag="BURPS668_A0108"
FT   CDS_pept        complement(91594..92151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87676"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFJ3"
FT                   /protein_id="ABN87676.1"
FT                   /translation="MRVACRVPCFVQGAENAERRHATPARGACIPARDRPESHYNPTFV
FT                   PMTAPRTMLLLRHAILTALAATACASAHAQTADDAPVAAPACAIAIVTGVGGAATNLRE
FT                   YLAARERDRYRYLADHPLDCRVSEDGRASGCTGLAYLRRERVSVYDDGDDTVQNVVARV
FT                   DLDHGTYPAIIAVQKRDVRCEQ"
FT   gene            complement(92210..92500)
FT                   /locus_tag="BURPS668_A0109"
FT   CDS_pept        complement(92210..92500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0109"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88205"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFJ4"
FT                   /protein_id="ABN88205.1"
FT                   /translation="MTGRRDRGDRRDRRGEEHNVDASRFDHAGALLNMAIIPVNDRSAR
FT                   FATSVIGQIFVVTAGAARSLSCVRRAVNVHATNAPPPGIGGRRAPRFDEGA"
FT   gene            92793..94364
FT                   /locus_tag="BURPS668_A0111"
FT   CDS_pept        92793..94364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85384"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFJ6"
FT                   /protein_id="ABN85384.1"
FT                   /translation="MTRARELSIQVSASTDQPRVDVVTGLATVGSLLYASDFYGNRVRL
FT                   FTTDGVWQRDIGVAGPGALAVDRAGNVWVARKRAGEIVEFSAAGALLNTLRMPGGSQPS
FT                   ALYFDAPSGQLMVGDEGPDMNIKRYAVTGAPALVGTFGIQGGYLDTTTGIKGQVGARRF
FT                   TRVAGIGKDAAGNLYVLHNPWGGSWDLGRNGATDIHAYDSAGNLQWTLQSLNFEGIAAA
FT                   DPATDGALFYGGTHIYAGSAGGTFVANTVDPFSYPSDPRIDMNDTQRDEHFGQLVAVGA
FT                   NRILVASGQNPPIFYFFHFNKANGYVAIPDASLPGAAFNTAQRVTSGFCIDSEGGVWAG
FT                   LEKTGAIYHYPLAGFDASGKPTWGAGVPTRIPASIQPLTRIVYLAESDTMILAQGIVGS
FT                   ADWTSIGTRIEVYHGWRAGNTAAPDPVITLANAGAKSIDAAGNHLFVGYWFGGGGPARP
FT                   NVDAFNLATGKLDATLVNTSRATVDASSAVDSMYGVRAYQRSTGEYVVTKNNVKGNSIT
FT                   VYRWKP"
FT   gene            94615..95127
FT                   /locus_tag="BURPS668_A0112"
FT   CDS_pept        94615..95127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0112"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86348"
FT                   /db_xref="GOA:A3NFJ7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFJ7"
FT                   /protein_id="ABN86348.1"
FT                   /translation="MPRQAFSIRVRLRVRGRLPKARFRAPDNRLRLPASGLPRRLALAN
FT                   NEAHAQALGQLDREMARLNLDGPALADRVRAALTLTESGYPSLARLASKLFLSERTLKR
FT                   RLQAHGTSYRNMLEAARYRDACRLLTRTDRCVADVSTRLGYVNPSAFTRAFRRWAGIAP
FT                   SRYRDDR"
FT   gene            complement(95328..95444)
FT                   /locus_tag="BURPS668_A0113"
FT   CDS_pept        complement(95328..95444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0113"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85616"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFJ8"
FT                   /protein_id="ABN85616.1"
FT                   /translation="MNRRCAHAPARTATAAAALHIEPPPRLGNSQAECKVSA"
FT   gene            95478..97673
FT                   /gene="plcN"
FT                   /locus_tag="BURPS668_A0114"
FT   CDS_pept        95478..97673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcN"
FT                   /locus_tag="BURPS668_A0114"
FT                   /product="non-hemolytic phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /note="identified by similarity to SP:P15713; match to
FT                   protein family HMM PF04185; match to protein family HMM
FT                   PF05506; match to protein family HMM TIGR03396"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86511"
FT                   /db_xref="GOA:A3NFJ9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFJ9"
FT                   /protein_id="ABN86511.1"
FT                   /translation="MNARRRFLQGTATTGIAAATLAAFPLSIRRALAIPANNRTGTIRD
FT                   VEHIVILMQENRSFDNYFGTLRGVRGFGDRFGIPLPNALTVWQQRNATGALVLPYHLDG
FT                   SKGNAQRVSGTPHSWGDGQNAWDGGRMYQWPRYKNTASMGYFRESELPFQFALANAFTV
FT                   CDAYHCSMHAGTNSNRMFMWTGTNGPTGAGVASVVNEWDDIGPSTFGYEWKTYPERLQE
FT                   AGVSWKVYQNMPDNFTDNALAGFRQYRRANEASGKPVSNSDKVVSPAYDPASDDVRNPL
FT                   YKGIANTMPDGGFLGAFKEDIRAGKLPQVSWVVAPAAYSEHPGPSSPVQGAWYIQEVLD
FT                   ALTATPDVWSKTVLLVNFDENDGYFDHVPSPSAPSLNPDGSPAGKTTLPEADIAFERFT
FT                   HPKPPGTKSQPQPDARVYGPGVRVPMYVISPWSRGGWVNSQVFDHTSTLRFIEARFGVR
FT                   EPNISAFRRAVCGDLTSAFNFVRPNNEPLPTLAGRKTRAQADALRAAQQQMPQIVPPAN
FT                   GLLPRQETGTRPSRALPYELHVNAVARTLDGTLRLVFANTGQAAAVFHVYDKLNLGRLP
FT                   RRYMVEAGKQLDDVWAAMTDNGGKYDLWVLGPNGLHRHFTGDMNRLRAGGAPVPEVRAE
FT                   YDRQHGNVQLLLRNEGARECVFTVRAKAYRDDGPWTFKVKGGAERKHHWKLDGSGNWYD
FT                   FVVTCDADTGYSRRFAGRVETGEHSVSDPAMGFGDRF"
FT   gene            98165..98911
FT                   /locus_tag="BURPS668_A0116"
FT   CDS_pept        98165..98911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0116"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88317"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFK0"
FT                   /protein_id="ABN88317.2"
FT                   /translation="MGRPMPARKAGDRSSRDSAAFQHFVKYRYRVYAIGYNWLQSNEKS
FT                   ARDVIEGMDFDDKKTDKKMRLMGIKEIIAENDSGKAIILIHSMGGLVACMAIAMHSAAD
FT                   LMHGVFHNVLPATGAPIAAKRFRTGGGSEGGLNGFINGALLGSNADEFVVMAANAPGAL
FT                   ELLPMPDYHNGEPWWIFARLNGEPVMKLPQQGDVYNEFYINPKWYGLVPEQANSLLDPA
FT                   GIVKKRLESQPIEITEPHRNRGGWLV"
FT   gene            complement(98908..99243)
FT                   /locus_tag="BURPS668_A0115"
FT   CDS_pept        complement(98908..99243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0115"
FT                   /product="putative transposase subunit, IS401"
FT                   /note="identified by similarity to GB:AAA25862.1"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87557"
FT                   /db_xref="GOA:A3NFK1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFK1"
FT                   /protein_id="ABN87557.1"
FT                   /translation="MLRRSVKSAQYVSIRYIERLAEAGIEPSVGSRGDSYDSALAETIN
FT                   GLNKTELIYRRAPWKTRESVELATLGWVASYNHHRLMEPLGYIPLAEAEANYYRQLSTA
FT                   AELPALT"
FT   gene            100237..100356
FT                   /locus_tag="BURPS668_A0117"
FT   CDS_pept        100237..100356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0117"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85917"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFK2"
FT                   /protein_id="ABN85917.1"
FT                   /translation="MESGCVSRTGQRWQVTGQRLFATLSRQRSRYYPSICADH"
FT   gene            100248..100634
FT                   /locus_tag="BURPS668_A0118"
FT   CDS_pept        100248..100634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0118"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85379"
FT                   /db_xref="GOA:A3NFK3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFK3"
FT                   /protein_id="ABN85379.1"
FT                   /translation="MRVKNGPALAGHGAEAVRNAIATKIALLPEHLRRSLTWDQGAEMA
FT                   QHVQLRIDTALEIYFCDPQSPWQRGTNENTNGLLRQYFPKGTDMSRYTERELDAVANIL
FT                   NCRSRKTLGWKTPAEAFHELLSAT"
FT   gene            complement(100738..101076)
FT                   /locus_tag="BURPS668_A0119"
FT   CDS_pept        complement(100738..101076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0119"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86545"
FT                   /db_xref="GOA:A3NFK4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFK4"
FT                   /protein_id="ABN86545.1"
FT                   /translation="MPKVWKQMNREGIVVVRCTIERLMRLQDLHEVVRGKRVRTILADA
FT                   SVPRPLDRVNRQFKADRPNQLWVSHFTYVSTWQGRLYMAFVIDVVARRIVGGRVSSSDD
FT                   HGLCSGCT"
FT   gene            complement(101274..101387)
FT                   /locus_tag="BURPS668_A0120"
FT   CDS_pept        complement(101274..101387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0120"
FT                   /product="ISAfe7, transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87313"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFK5"
FT                   /protein_id="ABN87313.1"
FT                   /translation="MHQGSGAEVKELRRTNEILKLASAFFAQMAFHRRLKS"
FT   gene            complement(102248..103252)
FT                   /locus_tag="BURPS668_A0121"
FT   CDS_pept        complement(102248..103252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0121"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87436"
FT                   /db_xref="GOA:A3NFK6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFK6"
FT                   /protein_id="ABN87436.1"
FT                   /translation="MAVTRTAAQRPAPLHTIFITLEVMKRIGLSRETLLEGTGISPSDV
FT                   ERPNAMVTHAQEMVLFANALKATGNSAIGLHIGNEIPVTAYGLRAHAMLVSPTLGDAMR
FT                   LAFEHPLLGISYFRMKLLIDGEVARIIVGGYTYRHDLLVINTDMCFTAVRRQMIDLIGR
FT                   SPHFTRIGFAYPKPSHADSYSEYFSCPAIFDSEINFLEFDASILMTKLPLAHPIEYEVA
FT                   RKACEKREFELAHWMPTDLVGQLLCMMYENPISQDVFEFADRLGMSLRSLQRKLKDMGT
FT                   SFSALQDLVRQDIASKYLTEKHYTAKEIAARLGYKNASAFSRAMRRWSKISVD"
FT   gene            104272..105144
FT                   /locus_tag="BURPS668_A0122"
FT   CDS_pept        104272..105144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0122"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88384"
FT                   /db_xref="GOA:A3NFK7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFK7"
FT                   /protein_id="ABN88384.1"
FT                   /translation="MIFDPLLLAMTLGVVLPLAVLAVASINAPLEFGGVAWGEFTLRAY
FT                   QRVIFDRDWDGSLVLQQGYISIFIRSMMMAISATILCLLLGFPTALFISTRTSKWKAAL
FT                   LVLVTIPFWTCVVVQMTGWIIVLADNGLVAQTLGFLGLLHGPLSLLYTDIATLIGLVYA
FT                   FTPFMILPIFAALDDFDWQLVEAAYDLGAHQMAVLWHVIVPVCWPGVMAGVGLVFVPAL
FT                   GAYAIPGLLGGNHAFMVGNLIDFQFAGGRDWPLGAAMSFVLLAFVLLAMLALRLKSIFL
FT                   HPESDDEFA"
FT   gene            complement(105757..105876)
FT                   /locus_tag="BURPS668_A0123"
FT   CDS_pept        complement(105757..105876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0123"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85420"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFK8"
FT                   /protein_id="ABN85420.1"
FT                   /translation="MNESATTAMETALIFGEIPIFSELKMYIGKVLIPAPARK"
FT   gene            105979..107010
FT                   /locus_tag="BURPS668_A0125"
FT   CDS_pept        105979..107010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0125"
FT                   /product="putative ABC transporter, periplasmic
FT                   solute-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87024"
FT                   /db_xref="GOA:A3NFK9"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFK9"
FT                   /protein_id="ABN87024.1"
FT                   /translation="MKKAIGAMLLAAVGTATAAELHVGSWPVIMPVALLKKFQAETGIE
FT                   TTLDTYASDAALTQKLQAGGGGYDVVIAGDYYVPVLVRSGLLLKLDKNRLSNMANIKPE
FT                   YRHPSFDSDRDYAVPFTVVLTGFAYDSARVPGGKLDDSWKSFFEPPEALRGQIGDLDVE
FT                   EELYMAASWYLGQDECTENPADAKRVLDVLQKQKPFVKTYSNDGTVDRLASRQIAVQHV
FT                   WNGAAVRAQERLPSIKFVYPKEGVRLFMDSLLVPAKARNIDSAYKFLNWMMQPENIALV
FT                   TNAVRYNNEIIGSERYVDAALLDNPAVKTPEQYKARLRPYKLCSLAAIQLRNKVWLKLK
FT                   GNR"
FT   gene            complement(106965..107081)
FT                   /locus_tag="BURPS668_A0124"
FT   CDS_pept        complement(106965..107081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0124"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86247"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFL0"
FT                   /protein_id="ABN86247.1"
FT                   /translation="MFAASPAAASLRIASGEAVIGNVAYRFPFSFNQTLLRN"
FT   gene            107598..107903
FT                   /locus_tag="BURPS668_A0126"
FT   CDS_pept        107598..107903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0126"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87748"
FT                   /db_xref="GOA:A3NFL1"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFL1"
FT                   /protein_id="ABN87748.1"
FT                   /translation="MATYEELKAQLDALNKEAEAAKAREISTALSQIRETVLRYEIRPD
FT                   QIFPQWTRLRSPDKRRGPLPPKYRNPMTGETWCGRGRAPKWMSGSPREVFLIDRPA"
FT   gene            108223..111009
FT                   /locus_tag="BURPS668_A0127"
FT   CDS_pept        108223..111009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0127"
FT                   /product="Rhs element Vgr protein"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM TIGR01646; match to protein
FT                   family HMM TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87324"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFL2"
FT                   /protein_id="ABN87324.1"
FT                   /translation="MTNLNDTLRNFASGAVDWNKRPVALHFGAAQAALGHLLALQHASV
FT                   QEGLMTGIHGRLTCVSTRRDLPPGVLLGIPVSIRLITDRGQPHTVNAIISDVQIGQSDG
FT                   ELCVYQLTVCDALSLMDKRTNSRVFRKRSVIEVLATLFNEWQQRSPALARAFEFDLSGL
FT                   RADRYPPRELTRQVNESDAHFVRRLLRREGITVFAKAGPAKGERPLQGDAPVHTLVCCD
FT                   DPMSLPQAPAGTVRLHPRDGGAAQRDTVTLFALRRQLAPGKAGRPSWDYKKARIDESSV
FT                   ASSLDQGEAGNDLAKLLTDIAIDIAHAGDSWRDHERLTRARMLAHEFEAERHDGVSSVR
FT                   DLAVGAWITLTGDPDWDRQLADKRQFVITSIDHDIWNNLPKGLNERVHALFAASRNLAC
FT                   APRALPSALANDADTRYENTFTCVRRGVPLAPAYDPQADLPPAHLLTGTIVGAEGEEVF
FT                   CDEDGRVRVRLHGLDPADHAHAQGAGTNGNAGDSAPIRVASSLAGAYFGASFLPRVGME
FT                   VLLGCLGGDPDRLVIIGVLGNGAHPPATFSHAGGLPGNRYLSGIKTKEIRGQRYNQLRL
FT                   DDTPNQISAQLASEHAHSQLNLGYLTQPRENGHGNDRGEGVELRTDAAAALRAAQGMLL
FT                   TTYARTQASGGQLDRDELIRLLGECAELFKALGDYAGQHGGQAADTAGQHAVAAAFKRW
FT                   APGTGTDGADAPSDGAARALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQ
FT                   RLNATAGQGMQLFARGAGVQAVAGEGPMLLQAQAGTLTANAQKGVKITTNEHEVFVSAP
FT                   KIRLVAEDGSYLELGGGITLGTNGDIKLLSASHQWGGPSTAQAAKSGFGNQPTDQRFKL
FT                   HYPGEDGDLQAAANKRFRITLDDGRVIEGKSDASGLTDLVKDDAMRIAKIDYLKPKL"
FT   gene            111023..113263
FT                   /locus_tag="BURPS668_A0128"
FT   CDS_pept        111023..113263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86649"
FT                   /db_xref="InterPro:IPR021692"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFL3"
FT                   /protein_id="ABN86649.1"
FT                   /translation="MNGINDQCFTAARGAGVTMSNRPGDRPVPIPRDLPGVVIFIHGVN
FT                   DPGAAYATVERGLCQGLNERLSRSDLRPGEYGRRYAAASAAKAEGDSVRYAEVLGDPDM
FT                   YLYQRAETGGTHSMFLPFYWGYRASDNEIAKISHPGEVKSRVADSDGNLMTRGQYQDIH
FT                   GNRLDAHFGKGGGFFANATNNIPQMYSPGFEPDKLERTVMQNALAGNTIFAGKSPERRY
FT                   FVLAAARLANLIKTIRTIQPSALALEHGMDPQHETITVMGHSQGTIITLLAQAMLRQQG
FT                   QRCVDCIIMVDTPYSLQFTQDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSA
FT                   HSCGRAGQHWSKTQGKRPDKGGKHWITFDERDNRGKVYLYFCPEDTVVGLDKVRGIGTF
FT                   GVPDEVPADGAAASRGKTMPAMTVLEPKRFFQRMWTRLERDQDGRGKRSKVAVGTPPAR
FT                   VPVRDPFQRLTPGPDTDGTMLGTLVESGKNMALQASFKRNDIRFINGEQLKPAYEPDLY
FT                   GGEVRKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFKWKDVATTGDPGAGIEPHKQA
FT                   FNRGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMRTDADQ
FT                   LEANNYHSGVLLSSENHRWVTAMDVAIGQAVTLDDPDWRQLLLLMADWKMTPSAQKKIT
FT                   NCKSFARLDDHTQGFIDACAKYYQKGLFPSEKFVSLALPSLITSELKLDQKT"
FT   gene            113552..114940
FT                   /locus_tag="BURPS668_A0129"
FT   CDS_pept        113552..114940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85943"
FT                   /db_xref="InterPro:IPR021531"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFL4"
FT                   /protein_id="ABN85943.1"
FT                   /translation="MDPSENNGASALLAQSGGKFVLEVRGLGLVTGKETNEEIWKAIET
FT                   KADNHSTYMSQNSADYPANEDERMTEVGLSTRISFKYGARHSVEYWPVPVFIWEPPKAS
FT                   HVSRPANELSGIRQEASLGVTLLLWQEDANTNDGSTIIEKLFAFFDAHPDIPEAIIVTF
FT                   DGAATRDLNQTPGYVDTFKQSNIPTMPDSMVTLLVSRSDRVDRLIRPYAVEQTENVDKN
FT                   TTEYDITKLWNFFWEKNNGEGPGSFEAYYQEQQKAAGIQPRAFLGFMSAQWWQTQLPDF
FT                   WKTISNKGPGEFKPTPYIPVRWTTWQVRQFDNAPLLGYLHRPIDVKLADAHGKPLKTAQ
FT                   QAQALKAGWQQAVDTLPTGETPKRIFYDTTGDRAWVAPINQALAQSGPSAPSLDDVKEG
FT                   YDIGRRIGNTGISSPLVQIGLGLIASYHEGGASATIHRRPNGTATIVMVSPPTHKQPDV
FT                   NPFR"
FT   gene            114950..115213
FT                   /locus_tag="BURPS668_A0130"
FT   CDS_pept        114950..115213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0130"
FT                   /product="PAAR domain protein"
FT                   /note="identified by match to protein family HMM PF05488"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88544"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFL5"
FT                   /protein_id="ABN88544.1"
FT                   /translation="MRGVIRIGDSTSHGGRVETGREGSTVMGRAVACVGDRCTCPMNGH
FT                   EHCVIVEGDEDVRIEGRAVAFDGHRTSCGATLVSSIPTSGRV"
FT   gene            complement(115628..116047)
FT                   /locus_tag="BURPS668_A0131"
FT   CDS_pept        complement(115628..116047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01894;
FT                   match to protein family HMM TIGR00149"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87832"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFL6"
FT                   /protein_id="ABN87832.1"
FT                   /translation="MQQSIQHITVEARGRGLVEFTPQVRAFVEVQSVSTGLLTVFCRHT
FT                   SASLLIQENADPSVQRDIERYFAALAPEDDARYEHDTEGADDMPAHLRTALTQVQLSIP
FT                   VEHGRMVLGTWQGIYLFEHRRAPHRRDVVLHLIGE"
FT   gene            complement(116067..116393)
FT                   /locus_tag="BURPS668_A0132"
FT   CDS_pept        complement(116067..116393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0132"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87119"
FT                   /db_xref="GOA:A3NFL7"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFL7"
FT                   /protein_id="ABN87119.1"
FT                   /translation="MHSSQAYTADAPTRAEVDALAGATVIEFGANWCGICAGAQPAIRD
FT                   AFSVHADVRHLKIEDGPGRPLGRSFGIKLWPTLVFLRDGTEVARVVRPTHAEQIETIGF
FT                   AALV"
FT   gene            116631..116852
FT                   /locus_tag="BURPS668_A0133"
FT   CDS_pept        116631..116852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0133"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86596"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFL8"
FT                   /protein_id="ABN86596.1"
FT                   /translation="MRVAIRRTAVSARRGKPCMIHGCDRPAVMALDGAGANSVRDCSER
FT                   DARFLDSGPRIECSACTRREISGPFSSM"
FT   gene            116864..117556
FT                   /locus_tag="BURPS668_A0134"
FT   CDS_pept        116864..117556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0134"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86534"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFL9"
FT                   /protein_id="ABN86534.1"
FT                   /translation="MNSQHARFIRPVLGTLCIVSLAALSGCRGDACFGFDGCFDDGGVQ
FT                   TVTLSGTAATGPALASATVNVDCARGSVATLSDGGGHYSVTFDAALPCAITVTSGGTSL
FT                   HSLAYAGGTFNTTPQTELLLVYLAAQLGTSPARLIGDLPNSSRLQQALENQTNVQAAQT
FT                   AVVANLQQRYAVMFAVPGFLTTPFFVGQPGVDSDLGALANAGAIDANGMPDALAVSLLQ
FT                   QAGAAHPL"
FT   gene            complement(118142..118903)
FT                   /locus_tag="BURPS668_A0136"
FT   CDS_pept        complement(118142..118903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87625"
FT                   /db_xref="GOA:A3NFM1"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFM1"
FT                   /protein_id="ABN87625.1"
FT                   /translation="MTARPRTRRHARAHADAGANANADANADANADTNADANADADANV
FT                   NMKADARCDTRKHAQRHCTHAFVAHDPRLMTRDVAENRRVWLLKRNCALSPRQSLISMG
FT                   LLAALTLAIAMPFAIAGAWAVFACAIGEIAAMCGCFLRYARHAVDYDCVALTEQRLEVI
FT                   QCDGAQLRRYDWNPLWVAVDLDAAHARDPTIRIRHGSETALVGRHVTLARRRHVARELN
FT                   AALAASAGDFGDTDFAPSVRQRQPEPLAAHR"
FT   gene            complement(118900..120495)
FT                   /gene="ctaD_2"
FT                   /locus_tag="BURPS668_A0137"
FT   CDS_pept        complement(118900..120495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaD_2"
FT                   /locus_tag="BURPS668_A0137"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by match to protein family HMM PF00115;
FT                   match to protein family HMM TIGR02891"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86195"
FT                   /db_xref="GOA:A3NFM2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFM2"
FT                   /protein_id="ABN86195.1"
FT                   /translation="MSEISTNMPHVRDAAHHAPTGWRRWLFATNHKDIGTLYLLFSIVN
FT                   LMIGGVMALMIRAELFEPGLQLMRPEFFNQLSTEHGFIMIFGAIMPAFVGLANWMIPLQ
FT                   IGASDMAFARMNNFSFWLLPVSSALLIGSFFVPGGAPAAGWTMYAPLSTQMGPGMDLSI
FT                   FAIHIAGASSIMGAINIVVTVVNMRAPGLTLMKMPMFAWTWIITSFLLIAIMPVLAGAV
FT                   TMVLFDRHFGTSFFNASGGGDPVLYQHIFWYFGHPEVYVMILPGFGMISQVIPAFSRKP
FT                   LFGYASMVYATASIGILSFMVWAHHMFVTGMPVAGQLFFMYATMTIAVPTGVKVFNWVA
FT                   TMWRGSLTFETPMLFSIGFIFVFLIGGLTGVTLAMAPLNVALHGTYYIIAHFHYVMVAA
FT                   SLFSIYAGWYFWVPKWTGYFYDERRGRIHFWGSMISFNVTFFPMHFLGLAGMPRRYADY
FT                   PAQFTDFNQIATIGAFAFGLMQVYFLFWVALPTYLGKTRRCVDAKPWDGAQGLEWTLPS
FT                   PAPYHSFETPPAVK"
FT   gene            120466..120732
FT                   /locus_tag="BURPS668_A0138"
FT   CDS_pept        120466..120732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85622"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFM3"
FT                   /protein_id="ABN85622.1"
FT                   /translation="MRHVRGDLAHCVVASFSKIRNGGRCAGCRHCVATAIFDALAALGR
FT                   TSPCARGRLNDASRVAKTKRRSPLRAIRRGSLGRCPARRAADA"
FT   gene            complement(120760..121014)
FT                   /locus_tag="BURPS668_A0139"
FT   CDS_pept        complement(120760..121014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0139"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87637"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFM4"
FT                   /protein_id="ABN87637.1"
FT                   /translation="MHHRYAARAAARFVVQPSREGWPIRRKPARHTHSSALASHRIHRK
FT                   NIRAPPARRHTNGFVVHRRRQLLHDFSCHLLLETIGCAN"
FT   gene            complement(121017..121151)
FT                   /locus_tag="BURPS668_A0140"
FT   CDS_pept        complement(121017..121151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0140"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87132"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFM5"
FT                   /protein_id="ABN87132.1"
FT                   /translation="MKTALGHGPSALDNAVGPREIKSLAVFSAEAIEVRIAIKRRPTH"
FT   gene            complement(121645..123225)
FT                   /locus_tag="BURPS668_A0141"
FT   CDS_pept        complement(121645..123225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88294"
FT                   /db_xref="GOA:A3NFM6"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFM6"
FT                   /protein_id="ABN88294.1"
FT                   /translation="MRNASDHRATSRPCVRLIVPAPTFAAAIHPRFVPPLRISISMPIR
FT                   QTHIWIFGFMIACVLAMSGPLTYTFENTFRQTVDIDRKKQGTVAEATAFDARSAEQPSA
FT                   PDADRMHELPRIDAARSPTDHFDELPIHLAAFGGGEPSPSGPLPPGPLPDTSFAPFPFQ
FT                   HGFDTAIHAGPPIPAPPESTLARTDAPPRDETPFEPDMPQPSETVDTQLSFYADMVAQA
FT                   IERTAYDSIALAKLDSDTTAPPDTTPERHDALANVNAPMFYADMLTASIHVPPSNDRTL
FT                   SVPSLLTHQAIGIAWTELFARELPATATQAAPTRHAVSFAATLQAEPFDLAQWSEPDEA
FT                   HSDGPPLELDGQRTVAPPYPPADTLPPGTRPTYTDSPPDTGIVQATAMLATGFESAGKH
FT                   AATLRGQPPGADECRMGARAIGLGRSGMERLAIEQFVSSARAAYDCARARIHGRASAFA
FT                   NAPASAQPSNHLDANGDPMRIAFLPRFASEPFQEAFSIPGDTAGIASAFAVADDQTGHR
FT                   NRMAAANSD"
FT   gene            complement(123262..123450)
FT                   /locus_tag="BURPS668_A0142"
FT   CDS_pept        complement(123262..123450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0142"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87548"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFM7"
FT                   /protein_id="ABN87548.1"
FT                   /translation="MRSLPAHAAESNHRCFARSSLEGEAIYAIPGLPAAQARQSHGRRS
FT                   GTRARQSMHDYRALLRA"
FT   gene            124250..124432
FT                   /locus_tag="BURPS668_A0143"
FT   CDS_pept        124250..124432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0143"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88273"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFM8"
FT                   /protein_id="ABN88273.1"
FT                   /translation="MNFAFIRVMRIVLPHELPGLGDLIMARLPCHPRRGESALRARPIH
FT                   FRWCPFHSMIANWKW"
FT   gene            124390..124515
FT                   /locus_tag="BURPS668_A0144"
FT   CDS_pept        124390..124515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0144"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87568"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFM9"
FT                   /protein_id="ABN87568.1"
FT                   /translation="MVPVSFDDRELEMVTRASAIALKWKRDDVIFRKGRAVIPSD"
FT   gene            124580..127054
FT                   /locus_tag="BURPS668_A0146"
FT   CDS_pept        124580..127054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0146"
FT                   /product="hemagglutinin family protein"
FT                   /note="identified by match to protein family HMM PF05658;
FT                   match to protein family HMM PF05662"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85612"
FT                   /db_xref="GOA:A3NFN1"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFN1"
FT                   /protein_id="ABN85612.2"
FT                   /translation="MRYGINRRGRGAENRLGRQESSRFNVTPRAALVTLLLAAWSAPSV
FT                   AQALHPGSGAQSVEVGAGSNASGSQSTALGNGAQATGSHSTATGQDATASGTSSTATGQ
FT                   GSQATGSNSTATGQDANASGESSTATGQGSQATGSNSTATGQDANASGESSTATGQGSQ
FT                   ATGDNSTATGQGATASGESSTATGQGSQATGSNSTATGQDANASGESSTATGQGSQATG
FT                   DNSTATGQGATASGESSTATGQGSQATGDNSTATGQDATASGESSTATGQGSQATGSNS
FT                   TATGQDATASGESSTATGQGSQATGSNSTATGQDAIASGESSTATGQGSQATGDNSTAT
FT                   GQDANASGESSTAMGQGSQATGSNSTATGQDAIASGESSTATGQGSQATGDNSTATGQD
FT                   AIASGESSTAMGQGSQATGSNSTATGQDATASGESSTAMGQGSQATGSNSTATGQDATA
FT                   SGESSTATGQGSQATGSNSTATGQDATASGTSSTATGQGSQATGSNSTATGQDANASGE
FT                   SSTATGQGSQATGSSSTATGQDATASGGSSTATGQGSQATGSNSTATGQDATASGGSST
FT                   AMGQGSQATGDNSTATGQNAAASGESSTATGQGSQAAGSNSTANGAGAAATGHQSTALG
FT                   AGAQAAGSQGVASGWNANASGTQGVAIGGNASAQGNQSIALGANASATGDHSIALGAGS
FT                   QATGSNSVALGQGSIADRDNSVSVGSDGGERNVTNVANGWHDTDAVNFRQLREVARYAY
FT                   SGIAAATALAMIPDVDAGKTFSIGVGTGGYLGYQAVAVGASARLGQNLKVRVGAGISAA
FT                   STTWGAGASYSW"
FT   gene            complement(127121..128572)
FT                   /gene="pqaA"
FT                   /locus_tag="BURPS668_A0147"
FT   CDS_pept        complement(127121..128572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqaA"
FT                   /locus_tag="BURPS668_A0147"
FT                   /product="PqaA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85960"
FT                   /db_xref="InterPro:IPR009199"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFN2"
FT                   /protein_id="ABN85960.1"
FT                   /translation="MLSLAYPRAEAAPIAFPCPIDARRDLTDTLACYRQTVENQPLNYT
FT                   MTGIVQLPGIEQRTYRLVSQSWSPDQLVRPDTWVHEVALYIPQGALPRRALVIANDGTR
FT                   HPGEGETPRTPNDFLPDTLADIARSTRTAVISVSDVPNQLLSYADDGKPKAEDDSVARS
FT                   WTLFMQSPHTRGAMPLHVPMAASIWRAMSLAERELTSLGIHRFVVSGISKRAWTTWLAL
FT                   IGDQRVDAIAPFAIDLLSTRAALENMYRSYGGNWPLAFYPYYAEGIDRTLDSPAFGLLM
FT                   RIEDPLSYLGTRHGSRLAVPKYIVNASGDDFFVPDNSQRYFDKLPGAKALRMVPNSSHS
FT                   DIRRATLDSLVPFVKRIQHGKALPQVDAAPIETNGQTILRLRTSERPRQLLLWQATNPL
FT                   ARDFRYACGIRYTSTPIAMNGARPQQLVLVPPTNGWRAYFVEATFDDGFVATSQTYILG
FT                   DGYPSTPPPAVGGSCRTLPGRDTHS"
FT   gene            128644..128859
FT                   /locus_tag="BURPS668_A0149"
FT   CDS_pept        128644..128859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0149"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87437"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFN3"
FT                   /protein_id="ABN87437.1"
FT                   /translation="MAIVGEPPEELIDRLLRACRPLAPILPIAPMPQAKRRDERRVLQG
FT                   KTWREMHRALVPFDRRTIQKEKPAAR"
FT   gene            complement(128832..129323)
FT                   /locus_tag="BURPS668_A0148"
FT   CDS_pept        complement(128832..129323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0148"
FT                   /product="putative outer membrane protein"
FT                   /note="This functional annotation is a direct result of
FT                   community participation in a Pathema-Burkholderia
FT                   Annotation Jamboree: http://pathema.jcvi.org/.; identified
FT                   by match to protein family HMM PF07437"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86984"
FT                   /db_xref="InterPro:IPR009998"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFN4"
FT                   /protein_id="ABN86984.2"
FT                   /translation="MPNARASDYSIAIGNGYQSVSRTPTGTGFGFLLDATRSGEDAYSI
FT                   GSGLSFAVRIGAVSLTAVGKALHVRSADGRSGLTTPIGVIAGIPAASRLSLVARAFYTP
FT                   RAVFNAALGAYTQATAGVRWTYKPINLEAGWRYEALKGRNGTRDTRLTNGPYLAAGFSF
FT                   "
FT   gene            130010..130555
FT                   /locus_tag="BURPS668_A0150"
FT   CDS_pept        130010..130555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0150"
FT                   /product="fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86799"
FT                   /db_xref="GOA:A3NFN5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFN5"
FT                   /protein_id="ABN86799.1"
FT                   /translation="MKKKVVSFAVATLFGLVAAQSVFAQSIDQGQVKFTGELTANTCTI
FT                   DAGSKDQIVPLPKVSTSALAAPGDVAGSTAFEIKVSKCAADVKKVAAHFEMENMDPNTR
FT                   TLKNEATGADAATNVTIQLVNSDGTELPVGSTGSYFDVTGTDDARGATMIYGGQYYALD
FT                   TTTAGKVESHTLFTLAYE"
FT   gene            130647..131357
FT                   /locus_tag="BURPS668_A0151"
FT   CDS_pept        130647..131357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0151"
FT                   /product="fimbrial assembly chaperone protein"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87747"
FT                   /db_xref="GOA:A3NFN6"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFN6"
FT                   /protein_id="ABN87747.1"
FT                   /translation="MAAACCLASTLSQAAIVITGTRVVYPESSREVNVRLNNVEQSPVL
FT                   VQAWIDDGNAGASPDEIKVPFVLMPPVFRVEPKKGQTLRVMYTGDDLPKDRESVYWLNV
FT                   LEIPPKPTVEAEQNLLQLAFRTRIKLFFRPSALEDGNAAQARDQLKWKIVRNEKGVSVL
FT                   RAENRSPYYISISQATAKSGDKSVQFDPGMVPPFGSKEFVSKHDISTLSTHAEIAYKLL
FT                   NDYGAEVAGSATAE"
FT   gene            131470..134214
FT                   /locus_tag="BURPS668_A0152"
FT   CDS_pept        131470..134214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0152"
FT                   /product="fimbrial usher protein"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88434"
FT                   /db_xref="GOA:A3NFN7"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFN7"
FT                   /protein_id="ABN88434.1"
FT                   /translation="MMIAAGAVACGVGSLCMPVVAAEFDGTRTGEQSRPDAMGEAPSGA
FT                   EPGARGRQALLVASHASPSAPTTVSFNSRLLMGGGIDLSRFERGNPVVAGIYPVDVTVN
FT                   GERRGRMDVEFRDVRGGDSAAPCFTRAMLDRLGVEGDIVAKRLDAARDATGAASGQTPT
FT                   LSASACIGLRDALPDATYTLDSADLTLDLTIPQVDMRKTARGYVDPSRWDNGVNAGLLQ
FT                   YNLSGYASENKFFGSHASSLFLGLQAGANIGAWRVRQRSNLMWANRSAGMSWRSLETYV
FT                   QRDITALRSQITLGDSYTTGEIFESFGVRGMQLASDDRMLPVSLQSYAPTVRGVADTNA
FT                   RVAVRQRGNVIYEASVPPGPFEFDDLPPTGYGGDLDVTITESDGRTKHFTVPFASVRQL
FT                   LRPGMQRFNFTVGQYRDALSNGKPWVAQLTYQRGMTNLLTGYAGLLSSTGYASGLIGVA
FT                   LNTPIGAFAFDVTSARTHLPGQGVRNGFSSHLSYSKMVPSTGTHFSMAAYRYSTANYYS
FT                   LADAVTARYGYNAEERAWRNDYRARTRLQLNVNQRIGDRSSAYVSSSLLNYWDGRGRDI
FT                   QFQAGFSSVFKRVSYTVYAQRSRSSDDRTVTQVGVNLSIPLGSGAYTKRNAFSSLTTSL
FT                   SRASNGDSSIQANLSGSTAHVVPIDYGVNVSRSVTGDSNFASLGVYGTYRSPFGTYSGN
FT                   ASVDNRARQASFGANGAVVLHRGGVTLSPPLGSAAALVEAKGARGGKLINGQGATIDRF
FT                   GYAVIPSLMPYRANTVAIDPSELPDDVELANTSEEVVPRNNSIVFVKMETKRGRPVFAA
FT                   TETEDGKPLPMGSELFDVEGKSLGGVGQGGMAFLRGLQGAGNVVAKWGAGASEQCTMPY
FT                   LVPADQAQAKQSRAIVRIRLRCEPRLSADASQTPDGDGGTRND"
FT   gene            134207..134779
FT                   /locus_tag="BURPS668_A0153"
FT   CDS_pept        134207..134779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0153"
FT                   /product="major fimbrial subunit protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85519"
FT                   /db_xref="GOA:A3NFN8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFN8"
FT                   /protein_id="ABN85519.1"
FT                   /translation="MIEMNGLKFRRGAARRWPSIAAAAMFAASAACGAPPSPTVTIKFK
FT                   GSYNPVTCTVVEGNENKTVHLPTISTSSLANAGETAGATGFDISVLCDGYAGNVLAYFE
FT                   NGPTTNENGNLDVEDPSDGQSASGVQVQLLNGDGSPIKVGDISTMKTVSVEASTPTPIP
FT                   FFARYYATGKSGAGKVRTYVTFVIQML"
FT   gene            134811..135500
FT                   /locus_tag="BURPS668_A0154"
FT   CDS_pept        134811..135500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86458"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFN9"
FT                   /protein_id="ABN86458.1"
FT                   /translation="MSIEMPAQPLRMLLQDTMLHVALLTQGARISRVHDWRARCIALVR
FT                   QFEQALQDGGYRGGIANELSLAQCVFLDEITMRNLSPEQKEEWLRELLQFRFHSTRDGL
FT                   SKVRARVDRLCRGHSANAALLEMYSLFHEFGLLGDKQGHALADARVSEARPTPGKKAVE
FT                   TAEIWKDGGAANEAAHGRSWRIVGGLLAFAALMTMWLVIDTRLSHEVEQMEVTSGDEAA
FT                   IHPASGD"
FT   gene            135503..137179
FT                   /locus_tag="BURPS668_A0155"
FT   CDS_pept        135503..137179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0155"
FT                   /product="OmpA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87044"
FT                   /db_xref="GOA:A3NFP0"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFP0"
FT                   /protein_id="ABN87044.1"
FT                   /translation="MSRQIRFWLVWGAIPFVVLASLCLPLRMQPDWSHVLTIVLIIAAI
FT                   VLAIEIFEHSRETAQDRTAEAEIDDHELAVIIVAGPHASSLFNSSGDDTAFRREAGALW
FT                   LRADSVEQLRDTMMRVKASRGRFPDAAVVPLVSESDDESDMRQAFAKWRTELREALCYP
FT                   DAAYVLPCYLAVYTCLGFKGADGARPKWTGDAIEIGTRQMNAASKVGELLASIRQQLLR
FT                   PSPTGSSAQCALGLGVFDWLDATALLSSMTMLANTPPFMLKGLTLADVGRRPIRPGAWT
FT                   RWLTVRTGLHIRQTKSSMAPLPVPRVAKHAESGIREGWSSARHLVSTRASFVPALVFST
FT                   VSTLGIAVAVSGWMNSRMIQRVSNDIADYRSGADEWIGRKRFAQARLEHDRTAIVQTLL
FT                   DGVPTGFGWGLYRGQELLVKLDTVLDSPRAASIAMQLDTVSLFAAGKATFSPGAAQREL
FT                   QHALRMILANPEQRVLIVGHADSSGSDAANFQLSEARARAIRDWFVDQGVLKTRFIVQG
FT                   AGDTHPIADNDSPSGRAQNRRVEVLLIPDVSSDRKASGTEL"
FT   gene            137205..137522
FT                   /locus_tag="BURPS668_A0156"
FT   CDS_pept        137205..137522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0156"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87972"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFP1"
FT                   /protein_id="ABN87972.1"
FT                   /translation="MTPARVPHACRSRNRSAWKFKGARTSERLGFARAFQAKCEVRCGM
FT                   QCEVQRGMQAGMHASIRKLSNLSDVERTPAKGEFDPTSSPLRGEIEGVTFCKFLLHGQC
FT                   R"
FT   gene            137568..138107
FT                   /locus_tag="BURPS668_A0157"
FT   CDS_pept        137568..138107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05591;
FT                   match to protein family HMM TIGR03358"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88425"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="InterPro:IPR033851"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFP2"
FT                   /protein_id="ABN88425.1"
FT                   /translation="MAISNSSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLAD
FT                   LSGKPLEPLPAVGDRKFFSIDIDNFDERMKAMKPRVAFSVPNTLSGDGQLMVDITFESM
FT                   DDFSPAAIAKKVDALSQLLDARTQLANLQTYMDGKSGAENLVSKVLKDPALLSALAKAP
FT                   KPVAEQAENRESKEKH"
FT   gene            138141..139640
FT                   /locus_tag="BURPS668_A0158"
FT   CDS_pept        138141..139640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05943;
FT                   match to protein family HMM TIGR03355"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86065"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFP3"
FT                   /protein_id="ABN86065.1"
FT                   /translation="MAARESQARSADAQLATHSDFNALLSREFKPKTEQAREAVEHAVK
FT                   TLAEQALANSVTLSDDAYKSIEAIIGEIDRKLSEQINLILHHDDFQQLESAWRGLHHLV
FT                   TNTETDEKLKIRFMDVSKDDLRRTMKRYKGVAWDQSPFFKQIYEEEYGQLGGEPYGCLV
FT                   ADYYFDHTPPDVDLLSSIGKVAAAAHAPFITGASPSVLQMDSWQELANPRDLTKIFTQN
FT                   LEYAPWNSLRNSEDARYIGLAMPRFLARLPYGIRTNPVDEFDFEESTDGSDHRKYVWAN
FT                   AAYAMAVNINRSFKHYGWCTLIRGVESGGVVENLPCHTFPTDDGGIDMKCPTEIAISDR
FT                   REAELAKNGFIPLIHRKNTDYAAFIGAQSLQKPAEYYDPDATANANLSARLPYLFACSR
FT                   FAHYLKCIVRDKIGSFKEREDMQQWLNEWIMNYVDADPANSSQETKARRPLAAAEVVVE
FT                   DVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVAKLPSVKEAA"
FT   gene            139840..140322
FT                   /gene="sciM"
FT                   /locus_tag="BURPS668_A0159"
FT   CDS_pept        139840..140322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sciM"
FT                   /locus_tag="BURPS668_A0159"
FT                   /product="SciM protein"
FT                   /note="identified by match to protein family HMM PF05638"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86626"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFP4"
FT                   /protein_id="ABN86626.1"
FT                   /translation="MSHDIFLKINGIDGEAEDATHKGEIEVLSWSWNVSQQSNMHLGSG
FT                   GGAGKATIDDLQFEHYIDRASPNLVQYCLLGKHIDEARLVVRKAGGSPLEYIKLTMSDV
FT                   LVTQVSPAGVAQDESRPRELVRLSFSRLKQEYVVQNAQGGSGGAITATFDIKKNAA"
FT   gene            140360..140992
FT                   /gene="sciN"
FT                   /locus_tag="BURPS668_A0160"
FT   CDS_pept        140360..140992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sciN"
FT                   /locus_tag="BURPS668_A0160"
FT                   /product="SciN protein"
FT                   /note="identified by match to protein family HMM TIGR03352"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87168"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFP5"
FT                   /protein_id="ABN87168.1"
FT                   /translation="MGRGPEAAVRGARIASAANSGFSRGDRIIQMAFPFFFRREAARQT
FT                   AVKRVVAAMVCASLAACASLPARKETADLIVKIKVSEGANPDEHQRPAPVMVRLYELKS
FT                   AGAFENADFFTLQSDSRKVLGDDAIATDEFVMRPGDTRDIHRRADSAGTSIGVLVGYRE
FT                   LGKSVWRAVHKLRPAPEDAWYRAFTPRTKIKLNVDVGQQTVTITELE"
FT   gene            140998..142347
FT                   /locus_tag="BURPS668_A0161"
FT   CDS_pept        140998..142347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05936;
FT                   match to protein family HMM TIGR03353"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87656"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFP6"
FT                   /protein_id="ABN87656.1"
FT                   /translation="MSWHNKVVWNEGLFLLPQLFQQQERYFEYFAHKRAAVLSPFFWGF
FT                   SRYEIDQESLSFGKLVFKSGAGIFPDGTPFDVPGHTPPPPPLTIAAEHQDQVIYLAVPL
FT                   RLPNTEETAFDEQAGSLARYSAFEIELRDSNAIGQGPKPVQLANMRLRLLPEKELTQSW
FT                   IGIALTRVKTLHADGSVALYDGDHIPPVSQYGANPLLREWATQLHGLAKLRADALATRL
FT                   SGSDGRAGAAAEVADYLLLQVLNRYEPLLEHICRIREMPPVTLYRELSMLAGELSTFVR
FT                   PQTRRPRPTPGYDHAQLYASIRPLVDEVHYLLNQVLIRGAQPIPLTEQPHGIRVATMLP
FT                   SELAGYSSLVLAVGAQMSPDVLQQQFASQTKISHPQRLPELIRSHLPGMTMIPLPVPPR
FT                   QIPFNSSYIYYELSRTGPFWEQIAQQGGLAMHIAGHFPELKLELWGVRHK"
FT   gene            142344..143645
FT                   /locus_tag="BURPS668_A0162"
FT   CDS_pept        142344..143645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0162"
FT                   /product="SciP protein"
FT                   /note="identified by match to protein family HMM PF00691;
FT                   match to protein family HMM TIGR03349; match to protein
FT                   family HMM TIGR03350"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87970"
FT                   /db_xref="GOA:A3NFP7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFP7"
FT                   /protein_id="ABN87970.1"
FT                   /translation="MNSGAFDEAAFDFLVSDEGGANVAADRARSAAKAARAEPARDRID
FT                   ASVNVQHRLDEVRAAANPLLEAATPLLRMLADMPATLDTSEAVASLRTLLVREVALFQN
FT                   LCEKADLPWKHMAVVRYCLCTALDEAANRTRWGGGGVWASQSLLITYEGEVDGGEKFFL
FT                   LIGRMATDPQEYVDILEILYRVLGLGFEGRYSVVADGRRHLEQIRQRLWTLITGARDAI
FT                   QPELSLRWRGAEPGRLPLLRSVPAWASGALVFLLLFGLFAFYQYRLLTERNALEARILA
FT                   IAKEEPATPPQRLRLSILLKNEIARGLLTVDEDDRRSVVVFRGDAMFRSGESRVLPEIE
FT                   PVLDKVAREVARVGGRVTVTGHSDNQPIRRADIPNNLVLSEKRAAYVAQILVQRGTPAD
FT                   RIRSEGRGDAQPVAENATPAGRSRNRRVEIAVTL"
FT   gene            143660..147568
FT                   /locus_tag="BURPS668_A0163"
FT   CDS_pept        143660..147568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0163"
FT                   /product="ImcF/SciS family protein"
FT                   /note="identified by match to protein family HMM PF06744;
FT                   match to protein family HMM PF06761; match to protein
FT                   family HMM TIGR03348"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85618"
FT                   /db_xref="GOA:A3NFP8"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFP8"
FT                   /protein_id="ABN85618.1"
FT                   /translation="MSYLKRFLRFVFSWQMLACIAVLLVCAAVWFVGPLLAFDELRPLA
FT                   GVVVRVAVIVLLVALLAFWLLRWPLSPIGVAALCLLIWHAGPLFAFGDHRPFGPAWVRV
FT                   LIVAAMLFCYAMYGLYRLWQAVRTNDALLKRILEPSAGKPDAAAQANIRAVSVAVSKAI
FT                   GQLKRLRGGAFGWRRLLESGRYLYELPWYMVVGAPGAGKSAAIARSGLKFPLADQMEAS
FT                   SERARGGTANCEWWFANEAVLIDTAGRYVRHEVPGDEEATVANGAEWKGFLGLLRKHRP
FT                   RAPVNGVVLSVSVEELVGRTPAERTAHAATLRARLGELHQELGIHFPVYVIVTKLDLLP
FT                   GFPEYFQSLTAEGRTQIWGFTLPYDAENRRSAVGALREHCADELKRLEMRIDAGLNNRL
FT                   LEEYENDRRKRLYALPQEFRSLSAALSDMLALVFLDSRYDDAQLQNTLRGVYFTSAEQS
FT                   DQVLAADRETILQRLKRQLGRMLGGDAGAQTRDSGAVSGSRGYFLRDVFQHVIVPEAHL
FT                   VRPNVRWEVRFRLMRWAGHLLAVALLVWLASALTVSFDNNRGYLDAISEKTAALAARVN
FT                   AYNKAPKPAQIGGVLDGARDLPQHGNLDLDAPGASFRYGLYVAPGIVDASDATYRSLLR
FT                   RSLLPQIVRRVENALSAQIDAKHADEVYRTLTVYLMLDDAARHDAKAVKDWVMRDWERS
FT                   DSAAEMGGRNLMARHLDALFVDARPFEPSGHRNAALVQRARLFLNANPAPRRLYERAMA
FT                   AIEKEAPENFTLARAVGLQGAGTFRLADGSRFQRGMPGLYTYDGYHQVFSARLPEFLAR
FT                   AQSDDAWVMGNAGPAARWGDAIRNTQAVAGRSSLADDIRRQYLTDYGNYWQQYLADIRP
FT                   ASSGEDGAGGTLAFDLATLRALAAPDSPLVRLARAVVRETSLSVVDAREDASLTDAALS
FT                   SLGRRSGAAKEVADGAQKLAARRPEQRLEKELVDNRFAALREVVTGQADTGSGPAMTDV
FT                   PVAAGGRALQLDAILTLINEQYTRLVVADNALSSQSMPPALDIGTTLQMEAEKLPAPLR
FT                   TVLGGIATQAADKVGREVGSLLAMQVDSSVGNACRAAVDGKYPFARSAQEVDIEDFNRL
FT                   FAAGGLFDAFFQKALAPHVDTHSKPWRYKALNPGMPPIRGPSLEPFERAAAIRDVFFRE
FT                   PGAKRMAWKMDAKVASIDPEITELIIDVDGQSQRYVHGPVLPFSVNWPGPRGGAIAEIT
FT                   AKPRIRPDTSTIATTGPWALFRLIERGRLTGTTSASRLMLDFDFDGRHAALELRTNGQM
FT                   NPLTSGLLTHFRCPGSVG"
FT   gene            147599..147721
FT                   /locus_tag="BURPS668_A0164"
FT   CDS_pept        147599..147721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0164"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86478"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFP9"
FT                   /protein_id="ABN86478.1"
FT                   /translation="MRPKAARFAAGAARRAAPYRDALARATAERVKRGCAGIPR"
FT   gene            147758..148327
FT                   /locus_tag="BURPS668_A0165"
FT   CDS_pept        147758..148327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0165"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88372"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFQ0"
FT                   /protein_id="ABN88372.1"
FT                   /translation="MNIRNADTYTFDKLPSRHESSTQALERAIASNCTTLRTRIREYRE
FT                   IVAFRRQPHSKKLARALWTAAWRLPRVDEDWVAALSSRGNLATIAGVLGEWLGTHAMPV
FT                   GRVAAIDPPGGGDEIPEPRAAYCMRCVVEFGQKVVDARAPIDLDLAASHLVDAALSIGA
FT                   NLLIDVLLRRARVRIRHPSSAGGDGA"
FT   gene            148425..151217
FT                   /locus_tag="BURPS668_A0166"
FT   CDS_pept        148425..151217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0166"
FT                   /product="Rhs element Vgr protein"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM TIGR01646; match to protein
FT                   family HMM TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85966"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFQ1"
FT                   /protein_id="ABN85966.1"
FT                   /translation="MPNHFSNGRTNQSRTVVIRSGAMPRLLGQPALEFLSLRGEEHLGK
FT                   LYTYELLLRTPDDFHVPLATSANLDLKAMIGTEMTVCIQLDGIGTGAQGGVGAGAREIS
FT                   GLVVKAGFLRCEGRYNVYRIELRPWLWLATLTSDYKIFQDKSVVEIIDTVLHDYPYPVE
FT                   KRLDIDKYSVAGESARNEPRAFQVQYGETDFDFVQRLMEEWGIYWFFEHSDNKHRLVLC
FT                   DHIGGHRKAPSEAYHEIAHHPEGGKIDIEYINYFSTDEALRPGRVVIDDFDFTRPLASL
FT                   VTSNHQPRETNWGEGELFEWPGDYTDSKHGDLISRVRMEERRATGSRAYGRGNVRGLAC
FT                   GHTFVLSKHKHDGANREYLVIESALMLTEVADETGSGYRYECDNELVVQPSNEVFRMPR
FT                   ETPKPTTSGPQSAIVVGPPGHEVWTDEFGRVKIRFLWDRYARNDATDSCWVRVSQAWAG
FT                   VNFGGIYIPRIGQEVIVGFMNGDPDRPLILGSLYNTITPPPWDLPGDATKSGFKSKSIT
FT                   GGRENYNGIRFEDKLGAEEFHMQAEKDMNRLTKNDESHTVGANFSIGVGLTHTRAVGAM
FT                   FSSIVGGAASYAVGGAESTMIGGAYALNVGGAHAVAVGGASSVSVGGAYARNVGGAYAL
FT                   TVGGVLSIVCGASSITMTACGSIKIVGKNIRIIGSDEVVVQGAPLQLNPGDSDCGGGGG
FT                   GGGGGGAIPPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTP
FT                   TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
FT                   PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP
FT                   TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI
FT                   "
FT   gene            151286..151561
FT                   /locus_tag="BURPS668_A0167"
FT   CDS_pept        151286..151561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0167"
FT                   /product="Rhs family protein"
FT                   /note="identified by match to protein family HMM PF05488"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86936"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFQ2"
FT                   /protein_id="ABN86936.1"
FT                   /translation="MNMTIPAARVGDAIGHGGVLVTGSGDVFMNGIPAGFVAGSVAVCA
FT                   LHASAQAVVAASGTVFINRLPAAFVGGVTSCGAPIVSGSPDVMIGS"
FT   gene            151574..155026
FT                   /locus_tag="BURPS668_A0168"
FT   CDS_pept        151574..155026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0168"
FT                   /product="Rhs1 protein"
FT                   /note="identified by match to protein family HMM PF03527;
FT                   match to protein family HMM PF05593; match to protein
FT                   family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87023"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFQ3"
FT                   /protein_id="ABN87023.1"
FT                   /translation="MSGISGLGGMLAGLEARHVTSLDVERRIDRYGNQPGNWAARHGVE
FT                   RALSGLLQRSVDAGSGNKVCLAADEVDIKLPGRLPIMWARYHSSALKNAGLLGPGWRTA
FT                   WEATLRREEDRLAYTDDQGRVLSLPMPHRGSQVIVSSEQLHVAHLPDGRMVVADLTPHY
FT                   SVFGEFDEAGVARLKYIEDLHKQRIGCIWDDAGRLKRMRGTCGHELKMHYGSDGHRLTG
FT                   IECVDGGPTGWLVHYGYDDDGRLAEVRNRIGDVVRRFVYENGRIVREVGPLGQTTQYKW
FT                   EVRRGAARVIERSTCRGARDRFNYDPDEGRCEVIDTFGHAAQWKFDRQGNISSHTDFAG
FT                   GRYTFVYDSAGWPTQLNLPGDRQVRITFDNLGRVTRETDPLGGERSTIYAFATREPVTV
FT                   RESDGRLWVWRHDDRLRAIHHQSPSHGSTQIAYSEHERGETHSYVTDRGTSITIERDRR
FT                   GQVIGLGTAPDKATTYRRDAEGRVVEIVDPVGAVTKIENDLLGRPLIVTLPGGRQERRV
FT                   WNAAGQLVKITGPDGYSRLWHRDSYGRVVQFVDEEGSVTAHEYDAHGRRIRTASGNGAT
FT                   QEFEWGPADRLVSIVDADRVTRTLSYSMAGWLQQIATTAESMTRREIFVHDAVGRLIGR
FT                   ETEHAHYHYAYTQQGLLGTIDCSPTEAGEAIGVAADTIRFEYNPFGLVTAEHGAAGVLH
FT                   YEYDERGRTRAVTLPDGCVVKSERDEDGRVALIGMTCREESRGIAAFRYDNLGRQVLRS
FT                   QGELYLRSVYTSASELERCFAMSVVRTPNNEMQAGEVRYWREFQYSIAGNITQVGDRFE
FT                   GKTYCDYDRRGRLLRMLSDEVGIEYFTWDAAGNLFDTAHVAASVVACPDHRMREYKGYQ
FT                   YEYDAWGNVICKRSAAAEQSFTWDAEGRLMEVRSRQARVRFRYDALGRRTSKSIERHDA
FT                   DHARQANSSTEVVHFVWEGERLMQERSEKEIRTFLYQPAADGFMSYAPLARVDQVRDAD
FT                   GNVQPMRLYHYHVDAAGTAVAMTDDAGALAWAGRYSAWGRILPPTSLKVQIDQPLRFAG
FT                   HYADDEVRLHLNGTRYYDPDTGRYLSPDRSAEPGTSPYRYVSNPQTACNPTGRAVTLAR
FT                   PRAGKRLGSSVKRTFDLGEPAAGLVAKLDDVVDGALIQLGQEV"
FT   gene            complement(156310..157338)
FT                   /locus_tag="BURPS668_A0169"
FT   CDS_pept        complement(156310..157338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87932"
FT                   /db_xref="GOA:A3NFQ4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFQ4"
FT                   /protein_id="ABN87932.1"
FT                   /translation="MKKKFSRFLAALVLLAATVDALAAGCNMLTAENIAWLTEQGKIAR
FT                   AHSSFPISFSSGMVDVDPNLEIGGLIAEAKSIPSEELHFIWCSAPSGNVHFALNSSPLP
FT                   SELGNSIYETGVPGVGFRITQVRQSGSIGAIPRDTPWIEEKPGQDSSLNFGAGTVFRIE
FT                   LIKTSEALPSESTISLGNLSRVYGDDHKTVVDFNAGSVKLRVLPICHVDQQEKNVDFGQ
FT                   FGPKDVSFDSGPTKDVKFDVQCSGPTPPVSITATLAATPDSHDQSLIANAGDAMNLAIR
FT                   LRDASTQQVLRPNDPSSEIKVEPGGAMEHGFALEATVLRVGTAPPTAGTIDATSIITLT
FT                   IL"
FT   gene            complement(157393..158463)
FT                   /locus_tag="BURPS668_A0170"
FT   CDS_pept        complement(157393..158463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0170"
FT                   /product="type VI secretion-associated protein, ImpA
FT                   family"
FT                   /note="identified by match to protein family HMM PF06812"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85592"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFQ5"
FT                   /protein_id="ABN85592.1"
FT                   /translation="MNATPPAAALRYADLLEPVSPDAPCGPDLEYDPAFVMLQSAIAPR
FT                   KDAQYGEFVEAPQPANWAEAERDCLALLLRTKDIRLVVILMRCRIRQSGAEGLRDGLAL
FT                   LNELLARYGEALHPVPFFEGERDPVVYANAIATLADPDATLADIREIPLPKASGLQLQL
FT                   RDIEKALAVTRVKDALAPESASRLLKEWWNRRDKTIAALAQAQRIVADLIASTRESLGD
FT                   DAPDLSGIAKLLHPFAQAQLESPYSANAAQPQGDAKPATGDAAHARAADTSAQAGDTDT
FT                   QAPAAMPIAPAQPPMDRWGALAAIQATRLWFEQNEPSSPVIVLLRQSERMVGKRFSEIA
FT                   NAIPAELLAQWDAIDV"
FT   gene            complement(158482..159531)
FT                   /locus_tag="BURPS668_A0171"
FT   CDS_pept        complement(158482..159531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06996;
FT                   match to protein family HMM TIGR03347"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86391"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFQ6"
FT                   /protein_id="ABN86391.1"
FT                   /translation="MTAHPPAARPIDAHSPLHPDALRAWFDPQAPWRAGFLSLLRAIAA
FT                   RDTRMPLPGTACLPKEEAFRIGQRPSMAFAPREIASLDVQRGRLDIQLFGLGLWGPQGP
FT                   LPLHMTELAYNRAESYQDHAIAHFSNLFHHRALALFYRAWASSQATVSLDRAEHETFSF
FT                   YIGSLMGTDPEEAARTHPPTHARYAACAHLVREARNPDGVAATLSHYFGVPIAVDEYVF
FT                   HWIRIAPPERCLLGARAASTVMGEGALLGDMVADCQHKFRLVIGPLDLDQYLRLTPHGN
FT                   DLPTLVDWVRAFVGHEYDWEIKLLVKPRAAPPARADTTHRLGYSTWLGESRDDRPVVGM
FT                   VFEPEKYCS"
FT   gene            complement(159528..161408)
FT                   /locus_tag="BURPS668_A0172"
FT   CDS_pept        complement(159528..161408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05947;
FT                   match to protein family HMM TIGR03359"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85674"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFQ7"
FT                   /protein_id="ABN85674.1"
FT                   /translation="MDPQFLDHYNRELTYMRELSAEFAAQHPKIARRLGMQGIEVADPY
FT                   VERLIEAFCFMSARTQLKLEAEFPRFTQRLLEVAYPNYVAPTPSMAVARLRPSLREGDF
FT                   SKGFKVPRHSMLRSSIPPGEQTACEFRTGQDITLWPIEIAGATLTAVPPDLPDLQRSLL
FT                   PHTKLRGALRLRVRTVGEIRFSQITGLDRLSLYIGGDERIASHLFELIHASSVASVVRA
FT                   PGAARSEGAVVAKNAVDFEGLSPDQSLLPLVWNTFHGHNLLHEYFTCRQRFYFFALTQL
FT                   NAGLSRIDGKEAEIVLLLDRLPDELVTHVEAARFLLFCAPIVNLFPKRTDRVEINRAQT
FT                   AFHLIPDRTRPLDYEVFSVSRVFGQKAETSTEVTFNPLYQTLHSDIGNYGRYFSILREP
FT                   RTTSTNARKYGTRTPYVGTEVYVSLVDQAEAPYADDIRYLSVDAWVTNRDLPRLIPRNG
FT                   VNDLTMQDSVPIEGVSLVHPPSAPREPYATGETAWRLIRQLSFNYMPLAELDHRDGGQA
FT                   LRNMLRLFVGTSEREQATQIDSLVGARTEPVVRRLPGHGLLVYGRGVRCELTVDESGFS
FT                   GLSPYLFGLVLEQYLTRHVSINVFTETELRSMQRGLVTRWKPRMGGRGAV"
FT   gene            complement(161410..161928)
FT                   /locus_tag="BURPS668_A0173"
FT   CDS_pept        complement(161410..161928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04965;
FT                   match to protein family HMM TIGR03357"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87850"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFQ8"
FT                   /protein_id="ABN87850.1"
FT                   /translation="MRHPEGRHRAAYLPSLLDRLQDDAPHALSESPDAYAPSADEMRRI
FT                   VQRDLSLLLNTSNLDDEVDARRYPLVSASVVNYGVPPLAGSYLHDRNRETIERLVRTAI
FT                   AHFEPRLIADSLAIRPLAAQPGASYNKLTFEISALVQWSPYPLELRIQSTFDLELNRVT
FT                   LEKTTLNGN"
FT   gene            complement(161915..162721)
FT                   /locus_tag="BURPS668_A0174"
FT   CDS_pept        complement(161915..162721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0174"
FT                   /product="ImpE/SciE family protein"
FT                   /note="identified by match to protein family HMM PF07024"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87133"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFQ9"
FT                   /protein_id="ABN87133.1"
FT                   /translation="MLRDALRAQSFEEIKARTAEAVRKRPSDTRERWLLFQLLCIDGAW
FT                   ERALKQLQTWAGLEPQGEARAQLHRGLIRCEMFRADVFAGKRTPGFIDAQPAWVDTLLQ
FT                   ANAKLGAGDVAAADTLREAAFHCAPVTRGESAEMGSFAWLTDSDTRLGPIFEIAVAGGY
FT                   RWIPFEQLKSITFTPAGTLTDLVWRPVTALMLDATVLRGYAPTRYSGSENGATAIRLAS
FT                   ETTWRDIGTTNVVALGQRTWTTDQGDWGMLQIGGCRFTGESDDAAS"
FT   gene            complement(162753..163808)
FT                   /locus_tag="BURPS668_A0175"
FT   CDS_pept        complement(162753..163808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0175"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87804"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFR0"
FT                   /protein_id="ABN87804.1"
FT                   /translation="MSKNGSPLKSDRSRHASAHHEAPDVPTPLVSLARYEGRDASPPRQ
FT                   HAIGAAGCVYFVQANRFEAWDARIGIPNDGIIFAAEPDGSLRMENHCARADCRVNGEAV
FT                   APGACRHLERGDVIAVAAAELTIQDGASAREPSAPRQPPVDLIALGNALPRSEPAHFAD
FT                   LAELANLPAAAHPHGRASAGAAAPLVILDEEALSDAAPPAFDSTNHDPLAHLLTEYRRA
FT                   LIHQERSYAHVLKSIERPQIAVPLPDDPFLDAPGRYRRGSLLGDLLGSRQNIDYVLDEM
FT                   NPFRAEALFADEARHDVLLLLAPRRRKKAHFPQTALLARHEHHLMSVDSHFPTLGAETD
FT                   IQQEEPNDESI"
FT   gene            163814..163963
FT                   /locus_tag="BURPS668_A0176"
FT   CDS_pept        163814..163963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0176"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87090"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFR1"
FT                   /protein_id="ABN87090.1"
FT                   /translation="MSGERELSVWRLVGAHSIHAGCAIRGIKRNTPILSWVEFATYENS
FT                   SKSG"
FT   gene            complement(164098..164220)
FT                   /locus_tag="BURPS668_A0177"
FT   CDS_pept        complement(164098..164220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0177"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86835"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFR2"
FT                   /protein_id="ABN86835.1"
FT                   /translation="MNMRRLHTKPENRVPYPVSSRASALAWKGTTLIATDDEAQ"
FT   gene            164196..166883
FT                   /gene="clpV"
FT                   /locus_tag="BURPS668_A0178"
FT   CDS_pept        164196..166883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpV"
FT                   /locus_tag="BURPS668_A0178"
FT                   /product="type VI secretion ATPase, ClpV1 family"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02861; match to protein
FT                   family HMM PF07724; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR03345"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86104"
FT                   /db_xref="GOA:A3NFR3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFR3"
FT                   /protein_id="ABN86104.1"
FT                   /translation="MCANVAYSRIHDRDMTVSRQALFGKLGYSLFRSIESATAFCKLRG
FT                   NPYVELVHWLHQMLQAADGDMQRIARHCDIDLGELERDMVRALGELPAGASSISDFSHH
FT                   IETAIERAWVLATLDFGDRRIRGAWLLAALLKTPELRRVLLSISSAFGRIRVDELDAML
FT                   PAWIDGSPEANETPYDNSDFGAAIPGEASSAMQQKGGGSPLEQFCLDLTARARAGQIDP
FT                   VVGRELEIRTMIDVLLRRRQNNPLLTGEAGVGKTAVVEGLARAIAAGDVPPKLADARLL
FT                   SLDVGALLAGASMKGEFEARLKGVLEAAAKATLPVILFVDEIHTLIGAGGQAGTGDAAN
FT                   LLKPALARGTLRTIGATTWAEYKRHIEKDPALTRRFQVLQVPEPDEAAAIDMVRGLTRT
FT                   FSRHHGVVVLDEAIRAAVKLSHRYIPSRQLPDKAISLLDTACARVALSQHAPPRELQDV
FT                   RRRLEAARVRLELLDGEQRIGLGDEAALAQSRAEIAALEVEEQSIDACWRQQIEAAQTL
FT                   LSAREAAGDAAASAIDALRELEHALSNLQGDHAFVFPEVNEAIVADIMSDWTGIPVGRM
FT                   VTDEVSAVRALPDTLAARVIGQRDALHQIGDRVQTARAGLTDPKKPLGVFLLAGPSGVG
FT                   KTETALALAEALYGGEQNLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRR
FT                   PYSVVLLDEIEKAHPDVHEMFFQVFDKGYMEDGDGRYIDFRNTTILLTSNAGSDLVSGL
FT                   CMDEACAPDADGLCAALASELLKTFPAAFLGRVTLVPYRPLAQETLSRIVRLHLDRVVT
FT                   RMAENQGVALRYSDNVVDYVVNRCLVQETGVRLLIGFIEQHVLPLLAKLWLDSLASKHV
FT                   LTRVDLDVADPAAAPAEAFALRAS"
FT   gene            167146..167265
FT                   /locus_tag="BURPS668_A0179"
FT   CDS_pept        167146..167265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85655"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFR4"
FT                   /protein_id="ABN85655.1"
FT                   /translation="MSLAGCFPCRRGNSARAHARFRAGLRSPRTFGAVGTLEA"
FT   gene            complement(167274..170318)
FT                   /locus_tag="BURPS668_A0180"
FT   CDS_pept        complement(167274..170318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0180"
FT                   /product="response regulator/sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF01627; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87554"
FT                   /db_xref="GOA:A3NFR5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFR5"
FT                   /protein_id="ABN87554.1"
FT                   /translation="MPGKLKELLIQPFKLNHRKALFDPRRMLAHQRLLTYGGAIGISAF
FT                   ILFCLLLMIRMEAMDYVSNARSEFLIQQSKLTIKLQIRRTALMRAVMHAEGLWNRRIEP
FT                   STELLSQFDAHQGYAVLHTPQGAPAALAVGIPAPGRSASAFAPYLALLETQLLMGDGQS
FT                   PLPDDRVEGYSFSPDGTYLSLLWSREDQAPEAFIESHSASGLIGDAMRGIRYLRDASTI
FT                   VPLRADRRTVWLPPHPDPLTGKPMIRIVQPAIDATGKLFAIYVRSLPLDMFYSNLNDAP
FT                   AGSTLTIVDRKGNVILGSSNQHGGDGGATASALGIRSLGDGFGGLVERYQDGMFVTSDQ
FT                   LPGTDWVLVHAYSWKTIAAALALRFSLVTGLVAGIIVMLWLFAIQFDRKGLIPNYRRAQ
FT                   RLLESEVLNRTILRTAPVGLGLLSAQDGSVLLQNNAMLELSARTSDEPLPIRLWEAYRH
FT                   AVGRSSDEDGALLQHDLAIEREGANPVYLQANVVAARYRGANVLLCTLLDISLRKESEL
FT                   KLKEARIAADQANKAKSTFLATMSHEIRTPLNAIIGNLELLRRSPLSEQQSERLHVVES
FT                   CSNALLHIINDILDLSKVESGQMTLENIPFDIHALLQETVDAYAPLAESKGLALLSSIG
FT                   EGVARHYTGDPTRIRQVLSNLIGNAIKFTERGHISIDVHRAKAARDGSAIEIWVNDTGI
FT                   GIRPDRIATLFDVYTQADASIHRRFGGSGLGLPLCQRLVTIMGGSIEIDSLPDFGTTVT
FT                   VALPLREARHATALSNGPAARRRNATALARPTLHVLVAEDHPANRALLRDQLEALDHRV
FT                   DVVENGREALRAFGEHQYDIVLTDLGMPELDGYGFARFANKMRAGTPIVAMTAHATDED
FT                   YQRSKKVGIAEIVLKPLSLTTLEKVLQRHAMRAPAEEIVTAAGPGPAHAEPRMRALPPA
FT                   VAAALRTATLQSIDKIAQALAARNFETIRQELHSIKGGFALTGNRLLIARCAATEELAE
FT                   AEDLDTLRAAWRKLEASLLEALERL"
FT   gene            170361..170492
FT                   /locus_tag="BURPS668_A0181"
FT   CDS_pept        170361..170492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0181"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85581"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFR6"
FT                   /protein_id="ABN85581.1"
FT                   /translation="MDARSSSFFEFGAGFLGIKIDSSVYYALSLLRYSPSRLKMKEN"
FT   gene            170520..170633
FT                   /locus_tag="BURPS668_A0182"
FT   CDS_pept        170520..170633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0182"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87787"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFR7"
FT                   /protein_id="ABN87787.1"
FT                   /translation="MNERRAGKVRQLVSRGVFFDEATARWRVFLNGYCGDY"
FT   gene            170677..170823
FT                   /locus_tag="BURPS668_A0183"
FT   CDS_pept        170677..170823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0183"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86346"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFR8"
FT                   /protein_id="ABN86346.1"
FT                   /translation="MPRMLDEIRVAEIFLFAFEACGRRPNFTSKIRRVRLDRPLAYCPA
FT                   GRR"
FT   gene            complement(171102..171296)
FT                   /locus_tag="BURPS668_A0184"
FT   CDS_pept        complement(171102..171296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85589"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFR9"
FT                   /protein_id="ABN85589.1"
FT                   /translation="MSHSQKVASLMLEFASLPEEARREFLVLLNNFIFLSPAARRKTQA
FT                   EWKRIAAMDVSPHSGTTKR"
FT   gene            complement(171324..171530)
FT                   /locus_tag="BURPS668_A0185"
FT   CDS_pept        complement(171324..171530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88254"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFS0"
FT                   /protein_id="ABN88254.1"
FT                   /translation="MHEINTNTPRLLPDFCFVQYALEYHIRIFRINQLDPFTSCPVASI
FT                   PIQLDRLSFPIKHLRISRHLDRS"
FT   gene            171667..171834
FT                   /locus_tag="BURPS668_A0186"
FT   CDS_pept        171667..171834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0186"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87385"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFS1"
FT                   /protein_id="ABN87385.1"
FT                   /translation="MSLTGDGHGRIGAQQYANSNCLELSYARVSAAMSRASAAASGAFY
FT                   AEICRSADDA"
FT   gene            complement(171921..172583)
FT                   /gene="rcsB"
FT                   /locus_tag="BURPS668_A0187"
FT   CDS_pept        complement(171921..172583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsB"
FT                   /locus_tag="BURPS668_A0187"
FT                   /product="regulatory protein, LuxR:Response regulator
FT                   receiver"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87896"
FT                   /db_xref="GOA:A3NFS2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFS2"
FT                   /protein_id="ABN87896.1"
FT                   /translation="MTAFSIKVIIADDHPAVLTGLLHALAPVSSIEVVSACRNSTELLA
FT                   ALNEHPCDVVISDYSMPDDNFGDGISLFSYVQRRYPGTRLIALTMISNPAIIQNLISHG
FT                   ISTVLSKSDEVGHIIAAVHASYAKGSYLSPTMEAIVNNGHGKTQGGEVSLSPREMEVVR
FT                   LFTSGLSVNEIANRLKRSKQTISSQKANAMRKLGLNSDIDLLKYALKVKLVEDTTSH"
FT   gene            172666..172866
FT                   /locus_tag="BURPS668_A0188"
FT   CDS_pept        172666..172866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0188"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86949"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFS3"
FT                   /protein_id="ABN86949.1"
FT                   /translation="MWLEVSKRFSLSLSIQGFDAPEFRKTMARSHGPRKKRRFTKVKRQ
FT                   LRAPMRSRLEGHDISTKQLTR"
FT   gene            173181..173396
FT                   /locus_tag="BURPS668_A0189"
FT   CDS_pept        173181..173396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86475"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFS4"
FT                   /protein_id="ABN86475.1"
FT                   /translation="MRIEWRGGSQGTRDPARSSILRHAPVSNFPNGACRSRREARWRRE
FT                   RQGARRLGMDSRRGGRRNLIAMHMSA"
FT   gene            173494..174198
FT                   /locus_tag="BURPS668_A0190"
FT   CDS_pept        173494..174198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0190"
FT                   /product="capsula synthesis response regulator
FT                   transcription regulator protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85601"
FT                   /db_xref="GOA:A3NFS5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFS5"
FT                   /protein_id="ABN85601.1"
FT                   /translation="MSVIMLDDHEVVLSGITYQLKRERDIAVLGTFSRSRQLFDYLAQH
FT                   GPALAHTRPVLLLDYALAPQDTDGIALIRRLCVQFPVCPILIVSGHHQPSIVRLALMAG
FT                   ARGYIGKNCTLEELVEAIRRVAGGERYVHPSLAERDDLVLPAAIEMRRGEAERATLASL
FT                   LSPRELEVLRLTLQGFEVGQIAEKLSRSNKTISTQKRSAYRKLGISGDRELFKLERELL
FT                   DSSGDAGSPYAN"
FT   gene            complement(174264..176756)
FT                   /locus_tag="BURPS668_A0191"
FT   CDS_pept        complement(174264..176756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0191"
FT                   /product="sensor protein EvgS"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF01627; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87425"
FT                   /db_xref="GOA:A3NFS6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFS6"
FT                   /protein_id="ABN87425.1"
FT                   /translation="MNDPLRACSILPAVEVEARRSARVRRLLHWTAGLSIALAPFAAFH
FT                   ARAATLFTSEEQHWIDTHPVVRFAAGPGAQPFDYVEDGKHRGLTADYLDALARISGLEF
FT                   ERVDTTRWGSPTAAFAAHEIDLLPNVAYGLQNDVLQREATFSSPYLVGSAVIVTRESQT
FT                   VIFDLDKLSGQTIAVRSGGAYERFLRQHHPSIRLLSTLEQRDMLDAVATGRADAAIGLD
FT                   AMLVPAIRSSYSHRLYISGAVANMPAVIVMATRKDLPVLASIIDKSLNSLTARDVNELT
FT                   THWLYSSDFGAPSLRAITHYYTIEIVLGVFVVSGFAMLAFRSRAQYRLTAESEARKSRF
FT                   IAVMSHEIRTPLNAIVSAIDLLSRAKLGPMEKQLADTAVKASASLVGMLDDVLDISKLH
FT                   AKKLRLAHVASDIRTVAESAVIIMRAQADAKGLPLELHLDAPDHLDVYIDQTRIRQILV
FT                   NLLSNAIKFTDAGRVCVDVKLAIADPPTHAPGELTLKVSDTGIGIPKNRQDRLFDAFEQ
FT                   ADSTTTRRFGGTGLGLTICKELVALMGGTLALDSKERVGTSVTVVIPVDTAQREVCAPV
FT                   DRDAVADSPSNARADRPRVLVVEDQPLNAELIRLQLAELHCDATIANTGQAALGLLDDQ
FT                   AFALVLLDCNLPDIDGYEVARRIRAARRNATTYLPVIAISALTDHAHLHECIAAGMDGS
FT                   LRKPLMLDDVASIIDLWCRAAGVADGSAGSPGSSSPAERDIDLPRLASLFATTCAEDSA
FT                   LIGSALARGDFKRAASCAHRIKSAAHVMRQHDIAQTAERLERALSAPDVNVNAARRNAA
FT                   KLARLISGIAPDRLSFDV"
FT   gene            complement(176944..177060)
FT                   /locus_tag="BURPS668_A0192"
FT   CDS_pept        complement(176944..177060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0192"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88371"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFS7"
FT                   /protein_id="ABN88371.1"
FT                   /translation="MGHGEAVPASGRNGTRLDAADAWRRRFALARTVRFDYR"
FT   gene            177059..178645
FT                   /locus_tag="BURPS668_A0193"
FT   CDS_pept        177059..178645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0193"
FT                   /product="glycosyltransferase, group 2 family"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85973"
FT                   /db_xref="GOA:A3NFS8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFS8"
FT                   /protein_id="ABN85973.1"
FT                   /translation="MRSAPNGGSRAVPRGVHGVDSGSIQFIGGFIVGHRAVARKNGRVS
FT                   RLASKLLAQSPVVAVDAFPFVSVVCPTWQRRAFLPYLVYMFQYQDYPANRRELVILDDS
FT                   AHSSQDLVEQLAAADPAGSVIRYYHVAERMTIGAKRNRLNELARGDYIVCMDDDDYYPP
FT                   DKVSHAVRAMQERCATFSGSDRIYIWYSHIDRIYQTYSFGPHHALNGTFAYHRHYLADH
FT                   RYDDTAVLAEESSFLGCFTASVLQIDPKRAILCVSHSANTFDKDFVLASCERAPFKLED
FT                   FVTDVRLLAHYRRLSHAPVSSRVEWRRFERIVINAGRDAGRLAAFHALLLELGVDERQI
FT                   VEFRSASGDGADTQSHLDLAKLARANGWRNYLLLDDRLEFVRQEKAVANVNRFLRALDG
FT                   FDWEVVLLGADVRSGVPLLTLPGAQRVNLAGEAVAYAVNQSYYASFIDHLERVLSVRGA
FT                   GAQGAHERIDQAWLPLMASSRWLGLYPSFAYLSHREDGKDLIPGFFRKMRENADTPSGA
FT                   PASFTPSRSTS"
FT   gene            178642..179577
FT                   /locus_tag="BURPS668_A0194"
FT   CDS_pept        178642..179577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0194"
FT                   /product="queuine/archaeosine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86883"
FT                   /db_xref="GOA:A3NFS9"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFS9"
FT                   /protein_id="ABN86883.1"
FT                   /translation="MTEIGSYVPQFILRGKTRISQCQCASCRVRSPLVTHAWTNHVRQS
FT                   ALLQCETVSREALFERDAFELQTIPADVGQDAELDAWQNGVNQACIYLLLEQGLSIPER
FT                   LHAIGVLLSRVSHAGDAQRDPALPIAVVEELIGLAGHGVLQERVAQMPIIEQYKRAYLR
FT                   RLARVRMCLDLDLTSSMLLNLKLTELQVISDGFLADALHEFEQSRAVEKFFDKHDYVWQ
FT                   NYFLYRCFHEVFPGADPELYDLAFLDMCLDYFCLRSLCAILVSSQVDLDEDVVSSLFCA
FT                   WQRNGKTSLGRDDHTDPLLIGFTLVGEVHD"
FT   gene            179570..180358
FT                   /locus_tag="BURPS668_A0195"
FT   CDS_pept        179570..180358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87947"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFT0"
FT                   /protein_id="ABN87947.1"
FT                   /translation="MTDAAANAKTPMNDECRIANRHVPIDYQATYRFFKGRAAGGADKV
FT                   VQVLYQDDNPALAHARSEAECRILERALSFDGRSVLDIGCGTGRLADHIIDRVGYYFGF
FT                   DLLAEFVETAKASLVARAIPESRYGFMALPCNARSIEMVTRRKRFDIVMMSGVSIYLND
FT                   EDFLGSLRCIAAAMHSGASLYLRDPIETADTRLTLNRFMSNQLSAEYSVIYRGADEYRR
FT                   TVAEAFDASYDIGPLTPMYRDPALNGGWSTRQHYMVITRK"
FT   gene            180355..180963
FT                   /locus_tag="BURPS668_A0196"
FT   CDS_pept        180355..180963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0196"
FT                   /product="HAD-superfamily hydrolase, subfamily IB"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01488"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85959"
FT                   /db_xref="GOA:A3NFT1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFT1"
FT                   /protein_id="ABN85959.1"
FT                   /translation="MSDTLICFDLDGTLSKQEILPRIAELADISEEIAALTQATIQGVI
FT                   PFEMSFKLRVRLLRDICPRKISDYVAETVELDERILRYIRNGSGADCVVVTGNLDCWIE
FT                   GLVRRIGVPYVSSLGEVKNGRLLGVANVLRKDAPVAQFRRDYRRIIAVGDGENDIPLFR
FT                   QADVGIAYGGVHAPSANLANMADYIVYSSEALCDLLSMQ"
FT   gene            180939..181598
FT                   /locus_tag="BURPS668_A0197"
FT   CDS_pept        180939..181598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86198"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFT2"
FT                   /protein_id="ABN86198.1"
FT                   /translation="MRPVEHAVIPCAGVGSRLNRGIPKSLTEIDGHTLLGRTLLALEHI
FT                   PHVFLVVGFRKELVISEALRYRRNLIFVPNEYFDRTNTQYSVKLASRLIRDDFLMVDGD
FT                   VVFDPSSFAALLERFQACDGPAIAYSRRTTEDGVKVHLEGARDETTCTGFFRGEGAHEW
FT                   TGIGRLNNRVISGDSLFVYESIERHMPAPAYLVDSMDIDTPADLEIARATYGRHDR"
FT   gene            181579..182733
FT                   /locus_tag="BURPS668_A0198"
FT   CDS_pept        181579..182733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04464"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87350"
FT                   /db_xref="GOA:A3NFT3"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFT3"
FT                   /protein_id="ABN87350.1"
FT                   /translation="MAVMTVKKKIRFLFQAASHWYCFASVYRAFGNDCRYDVEVVALPF
FT                   LKNDVQLGEPSWAFLEAQGIPFVHYLQYDTDADAPDVVFLHCPYDETRPPAFHAAALHE
FT                   HNVRLAYIPYGPDVGGGERNRRFQYGLDTQLLAWRIFARSEAHRMRYARNLPGSAKRVV
FT                   VTGHPKLDELRGAPADNPFSPLVDGKCVLLWNPHFSVGFPAELRWSTFDRYVNAMCRLA
FT                   AQRDDVAIIMRPHPNLFHTLMLREPGKRLIATLIAFANRHRNFVIDQSPLYKAAFDASH
FT                   AMMTDTSSLMYEYLACDKPILHLDCDGGAGLNEEGRQLVRGMSRARAERDIVAFVDDIV
FT                   RGRDATQALRRRVIAGVLGECDGKNGERVKLAVDRSDLWQSVPA"
FT   gene            182847..183737
FT                   /locus_tag="BURPS668_A0199"
FT   CDS_pept        182847..183737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0199"
FT                   /product="flagellin protein"
FT                   /note="identified by match to protein family HMM PF00669;
FT                   match to protein family HMM PF00700"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87268"
FT                   /db_xref="GOA:A3NFT4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFT4"
FT                   /protein_id="ABN87268.1"
FT                   /translation="MLSLHTNIASMRIQGALGRTQQDLTTSMTRLGTGYRINSASDDAA
FT                   GLQIATRLKSQHLGMGVAAQNTQNATSMLQTAEGAFKEVENILHRMNALATQAADSAWT
FT                   QADRDSLQKEYDALGTELKNIVDNTSYGGEKLFAAGASGAPGGKLTEKLTFQVGNTSGE
FT                   VMELDVSTALAAAVKAFEGASQVFGGGASGASGNTDITSISGANALLDNLSTALSAVGS
FT                   LRAEIGAGQNRLTHIANNLTNMRDNTQDAEGRIRDVDYASETANMTKLNILQQAGGSML
FT                   KQASQMSQLVLSLLQ"
FT   gene            184022..184141
FT                   /locus_tag="BURPS668_A0200"
FT   CDS_pept        184022..184141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0200"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88182"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFT5"
FT                   /protein_id="ABN88182.1"
FT                   /translation="MAGRLPYRQSPDRRARRPERNDIESNVMRQRRCAYSERR"
FT   gene            184149..185000
FT                   /gene="motA"
FT                   /locus_tag="BURPS668_A0201"
FT   CDS_pept        184149..185000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="BURPS668_A0201"
FT                   /product="chemotaxis protein MotA"
FT                   /note="identified by match to protein family HMM TIGR03818"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85572"
FT                   /db_xref="GOA:A3NFT6"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFT6"
FT                   /protein_id="ABN85572.1"
FT                   /translation="MQLAIGILLVFGCVFGGFVLHGGALSSIWQPTEILIISGAAAGAL
FT                   VMGNPRSVLSEMGSQIKHVIARKSNGVEFQRELLLMLYELLETVRDGGLKALDQHVEEP
FT                   RESDLFRKYPMILAQPRLIAFIVDNFRLMAMGRITQHELEGMLDQELEAIESELMQPSR
FT                   SLSKIAESMPGFGILAAVLGIVTTMANIGGSVSEIGLQVAAAMVGTFIGILLCYGVLEP
FT                   LASAMVHRVKSDMSALECVKVVLCAQVAGKPTLLAVDAGRKLIQLDVKPSFSKLESWIM
FT                   EI"
FT   gene            185019..185954
FT                   /locus_tag="BURPS668_A0202"
FT   CDS_pept        185019..185954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0202"
FT                   /product="chemotaxis LafU protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86717"
FT                   /db_xref="GOA:A3NFT7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFT7"
FT                   /protein_id="ABN86717.1"
FT                   /translation="MSTNKESGHGPTIIRRAHKRHEEHSGGAWKVAFADFTLALMALFM
FT                   VLWVMNVTPEKERKQVAAEIAGRPFFDGGVGIFEQRSRKPVVAPFDAQQPDRMRRRTSG
FT                   AARERTIDSLQQRRALAARIMDEASRLGMDGNVATAINDDGVRITIHDSDKQGMFERRS
FT                   DALNPPFIRLLTALVPVLGTVTNKMVIVGHTDATQYADASVFSNNWNLSSRRALRARQV
FT                   LADGGMDAQRMFQISGMGDSVPAVPDNPNHDMNRRVELLLLTSRAENTWRRLFRSEDVD
FT                   VRPSADGIGLTVGQAQPGADRPAFASEPVR"
FT   gene            185962..186333
FT                   /locus_tag="BURPS668_A0203"
FT   CDS_pept        185962..186333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0203"
FT                   /product="chemotaxis response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86920"
FT                   /db_xref="GOA:A3NFT8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFT8"
FT                   /protein_id="ABN86920.1"
FT                   /translation="MANVKKILSVDDTVTIRRLIAHVLTTSGYEVDEAQDGCAGLEKAA
FT                   KNDYDLILTDYNMPHMDGISMLRAIRALPAHGATPIVVVTTEFGADLKQQGRDAGATGW
FT                   MVKPIHPGKLVEMVRRLIG"
FT   gene            186330..188606
FT                   /locus_tag="BURPS668_A0204"
FT   CDS_pept        186330..188606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0204"
FT                   /product="chemotaxis protein CheA"
FT                   /note="identified by match to protein family HMM PF01584;
FT                   match to protein family HMM PF01627; match to protein
FT                   family HMM PF02518; match to protein family HMM PF02895"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87629"
FT                   /db_xref="GOA:A3NFT9"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFT9"
FT                   /protein_id="ABN87629.1"
FT                   /translation="MNDGKRYISDAWRKDRMSIDLTQFSEVFFEEAEEHLRAMETLLLA
FT                   CDVSHPDAEDLNGIFRAAHSIKGGAGAFGFAELTGVTHVLETLLDRIRKRELPLRAAMV
FT                   DAFLRATDLLAVMLAAYRSGEALPEQSIEATKRSLERLSQGEGAYGADAVMPDAEPVPA
FT                   SSEHDGDAHPLPEVLGDAYRKTSPAVMPPPGCLHVRIAAGAPIDDEGVMSCLASYGRVI
FT                   EHYPGGCDQPWRYLCETSRDAADIHGTLTFLIDPDRLTIDQAAPEGGELPPEWEEEHDG
FT                   YGFFVPVPTIGDGDAAHEAEARDEAGHARAETGRSDAQANASAGGSSVASAGVPALASP
FT                   SPPRSRQAGDAAGGDSMAKRNGAGGSSIRVSVEKVDQLLNLVGELVITQSMLAQAAIEL
FT                   DANQRERLVGGIGQLERNSRELQEAVMSIRMLPISAVFNRFPRVVRDLAMQLGKQVELQ
FT                   MIGEHTELDKGFIEKLADPMMHLVRNSVDHGIEAPQARVRRGKPATGRLTLRASQQGSD
FT                   IAIEVIDDGGGLQRERILEKARESGLPVSESMTDREVWMLIFEPGFSTAAAVTDVSGRG
FT                   VGMDVVRRNIQAMGGRIDVDSTPGVGTAISIKLPLTLAILDGMSVRIGGSRYIVPLAFI
FT                   TEAVMPADTDIRTVQRSGRVVNVRGEYLPLRSLADLFETGEDTTDGSLALILACDSQKV
FT                   ALLVDELLGQHQVVIKNLETNYRRVRGAAGATIMGDGRVALILDVMSLVMSARNSANVS
FT                   EAESV"
FT   gene            188616..189089
FT                   /locus_tag="BURPS668_A0205"
FT   CDS_pept        188616..189089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0205"
FT                   /product="chemotaxis signal transduction protein"
FT                   /note="identified by match to protein family HMM PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87092"
FT                   /db_xref="GOA:A3NFU0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFU0"
FT                   /protein_id="ABN87092.1"
FT                   /translation="MIETENTQRETLVFRLGAQEYGVDILKVQEIRGYDASSVTSIVTE
FT                   PHYIKGVINLRGNIVPVIDLRGKFGLGDAQYGGTTVTIILNVSGRTVGIVVDGVSDVVV
FT                   FKRDQIRPAPALGAAIRAEYVDGLGLLDARMIILLGIERLLMSGDFELPPAVA"
FT   gene            189110..191491
FT                   /locus_tag="BURPS668_A0206"
FT   CDS_pept        189110..191491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0206"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87835"
FT                   /db_xref="GOA:A3NFU1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFU1"
FT                   /protein_id="ABN87835.1"
FT                   /translation="MTFNQKIISAFAVIIAGVIGMLGMEMWSLNNIESRVTELHDQRLA
FT                   TLTVMSSIEDDALKVSLGIAQAADYIWVKKVKAMSAGGVVGIGEEVVDRKSFESHVEGA
FT                   ERALARTIEKLEHNKINREGLSADEAAKIERIRVQLAQLQPDAVKDARRILDIAASGES
FT                   DPDRYLAAYLSMRWQPFYEKVSELSRASTAATSKSITDTLDTVRERRRHVAVVSLFALV
FT                   VLAGIVVWQIWYIKRSLGGSMEALSRHMTSIAHDDLSGDISVDERDKQSLMSSLAVMLE
FT                   RLRGAKAMVVENARIRVALDSGSANIMVVDDSRKIDFASHSLMRAFAAMQGALRREAPQ
FT                   FNSNQIVGALIDTVLERRVADELLGASSQQRCEVKVGGRDWLLVSSVIVDNGKRLGFVI
FT                   EWIDRTNELQIEREVEAVIAAVAGGDFSSQVAEAGKTGFHQMLAQRLNRLTKTVADVVT
FT                   EVATTFGKLADGDLRTRMTGAYQGVFAELKENCNRSIAQLERMAIRIRDGAHTINGAAR
FT                   EIASGNANLSSRTEQQAASLEQTAASMEELTSTVKQNAENAQQANTLALNASSIAQRGG
FT                   QVVGQVVETMGRITASAKKVADITTVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVA
FT                   SEVRNLAQRSAAAAKEIGALIGESVVETDSGAALVQSAGTTMDEIVNAVSRVVGIVGEI
FT                   SSACVEQSSGIEQVNQAVSHMDENTQQNAAMVEQAAAAAESLQEQAQLLHGTVEMFKVG
FT                   ERPAIDALPEVRAVEPPPAVPAATRRRAGAASAADEWTDF"
FT   gene            191612..192424
FT                   /gene="cheR"
FT                   /locus_tag="BURPS668_A0207"
FT   CDS_pept        191612..192424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="BURPS668_A0207"
FT                   /product="CheR methyltransferase, SAM binding domain
FT                   protein"
FT                   /EC_number="2.1.1.80"
FT                   /note="identified by match to protein family HMM PF01739;
FT                   match to protein family HMM PF03705; match to protein
FT                   family HMM PF08241"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86171"
FT                   /db_xref="GOA:A3NFU2"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFU2"
FT                   /protein_id="ABN86171.1"
FT                   /translation="MDFEYTNADFRRIARHVYQRAGIVLTEAKRSLAYGRLVRRLRVLG
FT                   IGRFSDYLDQLEADRSGDEWQHFVNALTTNLTSFFRESYHFDLLATQMQAASGPFRIWC
FT                   AAASTGEEPYSLAMTACDARGTAANRVEIVASDIDTKVLAAAQAGIYKLHQLDKMPLRR
FT                   KQAYFQRGSGSNGGTVRIKPALREMVTFRQINLLTESWPLDGSFDAVFCRNVLIYFDAP
FT                   TQQKVLRNMARHLKSHGRLYVGHSENLRALDDLYAPCGRAVYELVNGR"
FT   gene            192414..193016
FT                   /gene="cheD"
FT                   /locus_tag="BURPS668_A0208"
FT   CDS_pept        192414..193016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="BURPS668_A0208"
FT                   /product="chemotaxis protein CheD"
FT                   /note="identified by match to protein family HMM PF03975"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86257"
FT                   /db_xref="GOA:A3NFU3"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFU3"
FT                   /protein_id="ABN86257.1"
FT                   /translation="MGVDGVGYHFYFDREFGRQAVRVNPGGFAIASADVMLATVLGSCV
FT                   SVCMFDSAARVGGMNHFMLPGSGNGARHDSLSSLYGVNAMERLINGLLRRGALKCRLRA
FT                   KLFGGGCVMPSLSDTRIGERNAAFVRAYLDAEGIRSVGGDMLGTRPRRVCYFPLTGRAL
FT                   CKRLVCGSDVADIATSERAYDGDLARRLPVAGSVELF"
FT   gene            193084..194148
FT                   /locus_tag="BURPS668_A0209"
FT   CDS_pept        193084..194148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0209"
FT                   /product="chemotaxis response regulator protein-glutamate
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01339"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88441"
FT                   /db_xref="GOA:A3NFU4"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFU4"
FT                   /protein_id="ABN88441.1"
FT                   /translation="MIRVVVVDDSMSMRTLLERIINGCDGMTCVGAAQDANAAREMIRA
FT                   LDPDVVTLDVEMPGMDGFEFLRRMMLLKPTPTIMVSGRTTSGSDAALRALELGAVDVIA
FT                   KPVLTGPADLADYARDIAELIRGAAAARVKGGVLAAASPARGERACIQRPRGAKKVGIA
FT                   ATRLSRVIAIGASTGGTEALRAVLQDMSGTPPPILICQHMPEGFTASFAARLDTICGIR
FT                   VKEAEQGEPLRYGCAYVAPGHSHLSLAATGRHYVCRLEASPPVNRHRPSVDVLFDSVAR
FT                   LAGKRALGAILTGMGKDGAAGLLRMRASGARTFAQDEQSCVVFGMPKEAIAMGAVDEIL
FT                   PLARMGARLREALQ"
FT   gene            194206..195255
FT                   /locus_tag="BURPS668_A0210"
FT   CDS_pept        194206..195255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0210"
FT                   /product="chemotaxis response regulator protein-glutamate
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01339"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85783"
FT                   /db_xref="GOA:A3NFU5"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFU5"
FT                   /protein_id="ABN85783.1"
FT                   /translation="MIRVLVIDDSATMRILLKKLIDKNEHMECVGVAPNPVAAQDLLRE
FT                   ARPDVITLDIEMPKMNGLDFLDRIMRLMPVAVIMISTLTEAGSESALRALELGAIDFIA
FT                   KPKLDFAEGVQAYAEEIYRKIETAGRAKVKKLTRDVPPVRMDAEPPAKPLLAEAGTEGR
FT                   VVAVGASTGGTEAVKELLLGLPADCPPLLIAQHMPEPFMRSLAKRLDLLCAMRVKMAED
FT                   GETLRRGCAYIAPGHSNLTVEATAAGYACRIVRNAGEAQAGSSVDELFRSVAAAAGARA
FT                   VGVVLTGSGSDGAAGARAMMAAGAFNIAQDAETSVVYSMPDAAIAACGINEVLPLEKIA
FT                   GKLMELDRA"
FT   gene            195341..195457
FT                   /locus_tag="BURPS668_A0212"
FT   CDS_pept        195341..195457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0212"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88062"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFU6"
FT                   /protein_id="ABN88062.1"
FT                   /translation="MRPETRDSASFSGRARKTARRERPAAAADHSSVPAISI"
FT   gene            complement(195427..197517)
FT                   /gene="flhA"
FT                   /locus_tag="BURPS668_A0211"
FT   CDS_pept        complement(195427..197517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="BURPS668_A0211"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="identified by match to protein family HMM PF00771;
FT                   match to protein family HMM TIGR01398"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87317"
FT                   /db_xref="GOA:A3NFU7"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFU7"
FT                   /protein_id="ABN87317.1"
FT                   /translation="MNKLTHLFADLRQYQYATPILLLAVLSMVILPLPPVILDLLFTFN
FT                   IVLAIVVILVSVSVKRPLEFSVFPTIILATTLMRLTLNVASTRVVLLKGHEGTNAAGHV
FT                   IEAFGKVVIGGNFVVGLVVFVILMIINFVVVTKGAERISEVSARFTLDALPGKQMAIDA
FT                   DLNAGLINQEQAQARRRDVTTEADFYGAMDGASKFVRGDAIAGILILLINMLGGLAIGV
FT                   FAHGQAFGEAFQRYGLLTIGDGLVAQIPSLLLAAASAVIVTRVSDSGDFEEQVGRQMLA
FT                   SPNVLYSGAAVMMILAIIPGMPWLPFSAFAGVLGYVAWRVAKRPAPEREETQIHALETA
FT                   LRESNVQDLDWDSISHVHPLGIRVGYRLVDLVDPAHGAPLRRRVDGMRRTMSESMGMLV
FT                   PPITVRDDLSLPSSHYAIHLHGVEIDRAELHPDHLMAIPSPTTYGSVDGIPAADPAYGI
FT                   PVTWIRPQDKAHAIGLGYQVVDGASVVATHVDKLLRDHLGELLTHDDVGSLLQRLGQVA
FT                   PRLLEALEKAMPHNLIRKVCRVLLTDRVPLRNIVAIATALLENAEATQDPILLGAEVRC
FT                   ALRREIVAGIVGHRRSVPVFNLAGELEGILLAAFNQAQQSAKAPLDNFAIAPDLLTNLQ
FT                   SSLPGVQERMRTLGHAPILFVPPQLRPLLARYARVFAPGLHVLSYNEIPDERQIEIAGT
FT                   LE"
FT   gene            complement(197514..198653)
FT                   /locus_tag="BURPS668_A0213"
FT   CDS_pept        complement(197514..198653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0213"
FT                   /product="flagellar biosynthesis pathway, component FlhB"
FT                   /note="identified by match to protein family HMM PF01312"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85499"
FT                   /db_xref="GOA:A3NFU8"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFU8"
FT                   /protein_id="ABN85499.1"
FT                   /translation="MANQDSGDKSEKATPQKLRNARKQGQIARSRDLSTAIGVLVSLKM
FT                   LVLLAPSWLAEFRALFLLELVDVTGDGALANAWSVALPVSIALFLKMIAPFFVVPLCVV
FT                   LGSLLPGGWILSGAQLKPKFSRLNPMTNLGRLVSARHYGTFALSLLKALALIAMLAYLS
FT                   ATTLAAFLRLQHLPLQEALTRGFGLTLDGALALAAVMLVFALADVPFQRFVFLRGQRMT
FT                   KQEVKDEHKNAEGRPEVRSRIRQLQRQAAQRVLSKTVPSADVVVVNPTHYAVALKYDTN
FT                   RAEAPFVIAKGVDDMALAIRRIAQEHGVEVLSLPPLARAIYDTSQVNQQIPAALYRAVA
FT                   QVLTYVLQLKAFRQGRRGLRPERPTDVAIPDFLDRTRPS"
FT   gene            complement(198646..199422)
FT                   /locus_tag="BURPS668_A0214"
FT   CDS_pept        complement(198646..199422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0214"
FT                   /product="flagellar biosynthesis pathway, component FliR"
FT                   /note="identified by match to protein family HMM PF01311"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86140"
FT                   /db_xref="GOA:A3NFU9"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFU9"
FT                   /protein_id="ABN86140.1"
FT                   /translation="MDAIVAAAAEWLARAWWPFCRILAALSAAPFIGESTVPARMRVTI
FT                   ALFLALIALPAVDPVAIPVFSARGALAAAEQILIGLLFGMLFHFVQAVFMMLGYLVASQ
FT                   MGLAMAVMNDPLNGATSDVVSGFMLVASILLFFAIDAHLVVVQVLYTSFRVWPVGTPID
FT                   LPSLKPLAYQAAWLFSTTTLLAAPLVFATVVLQIGKSYLSRATPSINLFSLGFAIMTVF
FT                   GLLMLGAMLKGLPAHYASMTRHVLDVLEHHLGAARG"
FT   gene            complement(199427..199699)
FT                   /gene="fliQ"
FT                   /locus_tag="BURPS668_A0215"
FT   CDS_pept        complement(199427..199699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="BURPS668_A0215"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="identified by match to protein family HMM PF01313;
FT                   match to protein family HMM TIGR01402"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88420"
FT                   /db_xref="GOA:A3NFV0"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFV0"
FT                   /protein_id="ABN88420.1"
FT                   /translation="MLTSDLAVELVGNAIRLVTLMVAVIIAPGLLVGLVVALFQAATQI
FT                   NEQTLSFLPRLLATLAILVLAGHWLVQTLMDYCVATFTRAAQLVG"
FT   gene            complement(199699..200466)
FT                   /locus_tag="BURPS668_A0216"
FT   CDS_pept        complement(199699..200466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0216"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="identified by match to protein family HMM PF00813"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85610"
FT                   /db_xref="GOA:A3NFV1"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFV1"
FT                   /protein_id="ABN85610.1"
FT                   /translation="MTRLRFRAARLATALTAAAALSAITATPALAEPLKLPLESLGLRG
FT                   DYSVKTQILLFMTLLGLLPALAIVMTSFLRFAIVLALLRQALGLQQGLPARVITGVALL
FT                   LTLLVMRPVGLDVWRHAIEPYDRDEITFREAIARAEQPVSRFMLAQTSKASLEQISRLS
FT                   GERDVAKPEDHAFVVKAAAFMMSELKTAFQIGAMLFLPFLIIDLVVASTLMAMGMMMLS
FT                   PLVISLPLKLLLFVLVDGWTLTVNTLTTSIQAY"
FT   gene            complement(200463..200810)
FT                   /locus_tag="BURPS668_A0217"
FT   CDS_pept        complement(200463..200810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0217"
FT                   /product="flagellar motor switch/type III secretory pathway
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM TIGR02480"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87389"
FT                   /db_xref="GOA:A3NFV2"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFV2"
FT                   /protein_id="ABN87389.1"
FT                   /translation="MDSNEPNDLDALLDDLPADAPADTATAAHAPRRDPRQLLAKIPVQ
FT                   LTLEVGTATVSLAELMNIDEGTVLELDRLAGEPLLVKVNGTTVGHAEVVVSGENYGLKI
FT                   IDLENLGDFAP"
FT   gene            complement(200814..201746)
FT                   /locus_tag="BURPS668_A0218"
FT   CDS_pept        complement(200814..201746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88342"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFV3"
FT                   /protein_id="ABN88342.1"
FT                   /translation="MANHPTKKPSRSIRHQTLDPRMLGRPTHLLDGFGATLRQYLDQFF
FT                   TTSLGRRHGVAVAVRNVSFASHVPELEARPWRRETVDRAAIGVHIERALLLLLLELRYG
FT                   PAISPVMPPAAPADAGDTPPASDGETASAPPTPAETAATHAPPIPETTTERRLAERLAA
FT                   ELARTVARAIPFDAPAGEPPAPSSGAHLFAICSIEGAASRTVGEICFALDPVWQQRLFD
FT                   HLKSSMSRARSVKRERPSPSTQLRLKLTAQLVEMSVPFGDVLRLRPGTVLPVRLHTPAR
FT                   VMTHDAQLFTASIAEHNGKLCLTSFVYVE"
FT   gene            complement(201752..201880)
FT                   /locus_tag="BURPS668_A0219"
FT   CDS_pept        complement(201752..201880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0219"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87897"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFV4"
FT                   /protein_id="ABN87897.1"
FT                   /translation="MCNSIHALAVSLIFNSVPEIRVTKRCLAMTKASNIATSLNLI"
FT   gene            201922..202071
FT                   /locus_tag="BURPS668_A0220"
FT   CDS_pept        201922..202071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0220"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85563"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFV5"
FT                   /protein_id="ABN85563.1"
FT                   /translation="MKDWKLAISRFPGRSMPDSEAHILSHPWRRPEMNKRALPAVAVKD
FT                   AEKP"
FT   gene            202228..202356
FT                   /locus_tag="BURPS668_A0221"
FT   CDS_pept        202228..202356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0221"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88316"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFV6"
FT                   /protein_id="ABN88316.1"
FT                   /translation="MEIIRCDWRGEWRGVDQDYRQFMTFQCESLSFTGDLYSVDRK"
FT   gene            202498..202830
FT                   /gene="fliE"
FT                   /locus_tag="BURPS668_A0222"
FT   CDS_pept        202498..202830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="BURPS668_A0222"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /note="identified by match to protein family HMM PF02049"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86014"
FT                   /db_xref="GOA:A3NFV7"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFV7"
FT                   /protein_id="ABN86014.1"
FT                   /translation="MESIQQVSSQLRGRMAELAGQAASLSGAIVGQSGGSGEVNFTHML
FT                   GSMLKEVDDRQLDAAEKAVAVDSGRSDDVIGAVLSSQEASLSFSMLTQVRNKLSTALDD
FT                   LLKMQI"
FT   gene            202923..204521
FT                   /gene="fliF"
FT                   /locus_tag="BURPS668_A0223"
FT   CDS_pept        202923..204521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="BURPS668_A0223"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="identified by match to protein family HMM PF01514;
FT                   match to protein family HMM PF08345; match to protein
FT                   family HMM TIGR00206"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85785"
FT                   /db_xref="GOA:A3NFV8"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFV8"
FT                   /protein_id="ABN85785.1"
FT                   /translation="MMPSPAALSRLLPLVVLAVALTAAATLYMRYDQANYKPLFGAREP
FT                   VQLDDVVSTLDAQRIPYRIHPDTGQVLVARSDVARARMTLAARGVTAKAAPGLEQIDQD
FT                   DPLGTSQFVQDVRFRRGLESELAQSIATLEPVERARVHLSIAKSSSFVMMDGDKSAASV
FT                   VLTLKPGRRLAKEQIAAVINLVAGSVPNLAPAKVSVVDQHGAFLSARVDLDGDLTGTDE
FT                   IAARFREDVTRNVEDLLAPSLGLGNFRVSVTALVNNDRVEETREQFGEAPKVMNEATRN
FT                   EQNRDRVALGVPGSLSNRPVDVPASEPQADGGTQRAATTRQFAYDRNITQIKRGRGQLE
FT                   KLSVAVVLNNAVSPAKGKPWSPEQLRRIDEILRSGLGIDKQRGDQLIVSSLDFAAPAAA
FT                   EPWWKERDTLEQGGWYLTYALAALFGYLALARPMLRMLQQWVQHRYGAPAAAASASRLP
FT                   APEGGHAQAALPAADDARPPLAAMLPLLDDVELPPADSGVEVLIDHLRSLSEKEPERVA
FT                   EVVKQWIRNDGNASS"
FT   gene            204502..205515
FT                   /locus_tag="BURPS668_A0224"
FT   CDS_pept        204502..205515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0224"
FT                   /product="flagellar motor protein"
FT                   /note="identified by match to protein family HMM PF01706"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86693"
FT                   /db_xref="GOA:A3NFV9"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFV9"
FT                   /protein_id="ABN86693.1"
FT                   /translation="METPVADSNAQGSIEQAAIILLSIGEERAADVLRCLSRPELLRIT
FT                   QTMSSMAGVKVDVVKDALQRFFDQYREQSGIHGASRVYLQRALDLALGRDIANTVLNSV
FT                   YGDSIRPKMARLQWVSPRWLADHIVHEHVRMQAVFLAFLPPAQASQVIEMLPPHTRDTI
FT                   LINVAKLDEVDHTLLVELEELIELCLKDLDLQGTTVEGVRQAAEIINRLPGDRMQMIEL
FT                   LRAHDPGVVTEIETSMYHFDMLARQSDNAIGRIVEVAPVEQWAIALKGADPAVLAALQR
FT                   VMPRRQVQAFDDTIRRTGPLPSTRIEQVRRDIMARVKALADEGEIELRLVEEDVVS"
FT   gene            205512..206240
FT                   /gene="fliH"
FT                   /locus_tag="BURPS668_A0225"
FT   CDS_pept        205512..206240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="BURPS668_A0225"
FT                   /product="flagellar assembly protein FliH"
FT                   /note="identified by match to protein family HMM PF02108"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87183"
FT                   /db_xref="GOA:A3NFW0"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFW0"
FT                   /protein_id="ABN87183.1"
FT                   /translation="MKAYQRFRFPPLRSVARDVSAREPAAPAAAAQGSDIDARIEEGFR
FT                   QGMEDGYRAGFEHGEAEGLKQGRDAGFAAGAQQARDALRGEYAGIAKTLDAMRDAFARV
FT                   QAEYLAARRTELVDVVAKVAKQVIRCELTLQPSQMAALIEETLETMPASGEAPEVHLSP
FT                   DDHARLAGLLPERARHWRLVPDARLEAGECRVLLGGNEADAGCQHRLDACVERIGEQLP
FT                   GAPSDVAAGATISDVQEEAS"
FT   gene            206237..207544
FT                   /gene="fliI"
FT                   /locus_tag="BURPS668_A0226"
FT   CDS_pept        206237..207544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="BURPS668_A0226"
FT                   /product="flagellum-specific ATP synthase FliI"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM TIGR01026; match to protein
FT                   family HMM TIGR03496"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88121"
FT                   /db_xref="GOA:A3NFW1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFW1"
FT                   /protein_id="ABN88121.1"
FT                   /translation="MILSALRNLELDSVPVARMTGRLTGVTGLLLKASGCRLETGERCV
FT                   IESADGDRIDAQVVGFNREETFLMPFKKPVGLVAGAQVLSCERQGLLRIGRSWLGRIVN
FT                   GLGEAIDGRGPLGGDAVLRAHPAPVNPLRKRPVRDVLDVGVRAINGLLTLGRGQRIGLM
FT                   AGSGVGKSMLLGMITRATQADVVVVGLIGERGREVREFVDHALGEAGLAKSVLVAAPAD
FT                   ESPLMRLKAAELCHAIAAHFRDTGANVLLLVDSLTRYAMAQREIALSVGEPPATRGYPP
FT                   SVFGMLPQLVETAGNGEGAGSMSAIYTVLAEGDDQNDPVVDTARAILDGHIVLTRELAE
FT                   RGHYPAIDVPRSVSRCMSQVAGAEHGALARKVKEMIGRHEQIRDLIALGGYVQGADPAT
FT                   DEAVAKAARIDTFLRQDMLDVARHDATLAALKELIA"
FT   gene            207541..207978
FT                   /locus_tag="BURPS668_A0227"
FT   CDS_pept        207541..207978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87883"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFW2"
FT                   /protein_id="ABN87883.1"
FT                   /translation="MNEQRKVTRIAGWLAARQAEVDRLAADTARQEAVCQRYRRYLGAM
FT                   QRLYDGSAAATAAALPMLAQNHAGYRQTLLDTLAQLRAALKVQEDNLEVSRALLAAKTL
FT                   RCEVWRRELDRRRRALELARRRSEQRVQDELAVQAWRRTPA"
FT   gene            208054..209379
FT                   /locus_tag="BURPS668_A0228"
FT   CDS_pept        208054..209379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0228"
FT                   /product="flagellar capping protein"
FT                   /note="identified by match to protein family HMM PF02465;
FT                   match to protein family HMM PF07195"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88580"
FT                   /db_xref="GOA:A3NFW3"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFW3"
FT                   /protein_id="ABN88580.1"
FT                   /translation="MLRVTDPQAMAKTFAEAYMESARWQLERQANDVKRNKDALSGLGS
FT                   LLTTFRDKQRELVAGGSMIQNTVTQSNDAFASVATTSGAKPGSYQFHVEQLATAHQLTI
FT                   DVPSGIPAADAGSVKIKLADGSEFTVDLTAAKGEDGNVSAEELARVINSSSGASGNVHA
FT                   AVIGGQLMLTSANTGADSKISFEIDSTSPLAGAFDGAVTISEAQNAKVKIGDPTNGKTI
FT                   ELQGNTLDSIEGLSITFRQVGSGTITVASDKEKTTESVKAFIDAYNELIDKLAELTRVG
FT                   DAAKGDPGGPFSSDAGVRALVSQLRSELNKSVDGVKLYELGIDTDKKGKLVLDEKRFEQ
FT                   AFKASPDRFDKLFGDAQTGLVGNLGKALDGWLNEKNGQLKTRNESVAQAEKQLLAKQQE
FT                   YDRRYQDVFERYTQEFTRLQVLQLQMDNTLDQIKNLFSTSKD"
FT   gene            209413..209799
FT                   /gene="fliS"
FT                   /locus_tag="BURPS668_A0229"
FT   CDS_pept        209413..209799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="BURPS668_A0229"
FT                   /product="flagellar protein FliS"
FT                   /note="identified by match to protein family HMM PF02561;
FT                   match to protein family HMM TIGR00208"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86486"
FT                   /db_xref="GOA:A3NFW4"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFW4"
FT                   /protein_id="ABN86486.1"
FT                   /translation="MENIGYRSYHAANLESQIANASPIQLVLVLTDGLLDEIARARAHI
FT                   VSRRIEAKGASIGRCIELLNGLASSLDMTAGSEVVTNLAALYDYCVRRLNVAGIELNVE
FT                   PLDEAAHLIGVLREGWQGAQDGGL"
FT   gene            209810..210115
FT                   /locus_tag="BURPS668_A0230"
FT   CDS_pept        209810..210115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0230"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85437"
FT                   /db_xref="GOA:A3NFW5"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFW5"
FT                   /protein_id="ABN85437.1"
FT                   /translation="MGDLSAALTTRARRLADAAMQRDWASVTALDAELNAIVRRCAADG
FT                   EPTRDMHAALQAVARVYERAAATIGDAHGELASRLVELAENRHAWIAYATIAEGGQ"
FT   gene            210112..211254
FT                   /locus_tag="BURPS668_A0231"
FT   CDS_pept        210112..211254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0231"
FT                   /product="putative flagellar hook-length control protein"
FT                   /note="identified by match to protein family HMM PF02120"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87215"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFW6"
FT                   /protein_id="ABN87215.1"
FT                   /translation="MNAITAMTGPATDASGRAGAACTVLLGAGTVRGRPAGASDDEART
FT                   QGAESPPETDRLEDVSQSGAFAGVIAALEVQAPVRDVQATDDSARDSEDAARERVAAAA
FT                   ADAVTVGGTVRALRDGLGGLAFGQSPMIEAGKALRVPPARDGVRLPNEDPLRDGERLRD
FT                   ETGGARAGMRDSVSPAGAASAARVGQPAAGAPRDQQALSQVPGQPAADKPAAGAPGPQD
FT                   GAIGAPVDVPRAAARAYSPQSAPVRLGAELTRVLGERIDVQLQRGVERAVIRLDPQSMG
FT                   TLHIAIRHEGGTVQIQMIASHEEVARQLQTMSEALRQDLSSRHHGDVTVVVRHGQGMEQ
FT                   GARHGDGGAHREEKRPGTALAEADVPDGDEGFHLGGRDVI"
FT   gene            211279..211743
FT                   /locus_tag="BURPS668_A0232"
FT   CDS_pept        211279..211743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88105"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFW7"
FT                   /protein_id="ABN88105.1"
FT                   /translation="MKKKTVVSMIVGATLLVGGAIGGTWAFLSRNASHRPAPVAAQDKY
FT                   KYVGESQIVVMLRQQDGQNATSIDAQAHYAMLDLVLKTTPEKEAIVRDHMLLLRSLTVD
FT                   AVSQYTLEQLRQMNVAELANVLDRAFRQSYKTRAVAMPFESVMIGKLLAE"
FT   gene            211749..212459
FT                   /locus_tag="BURPS668_A0233"
FT   CDS_pept        211749..212459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0233"
FT                   /product="RNA polymerase sigma factor for flagellar operon
FT                   FliA"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02479;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85818"
FT                   /db_xref="GOA:A3NFW8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFW8"
FT                   /protein_id="ABN85818.1"
FT                   /translation="MTTLDDCAAARTAYARAGAGAEQRWLVEYAPIVKRAARQLKSQAV
FT                   GMLTLDDIEQIGLMGLLEALRRYGMPDAAFPCYAATRVRGAILDELRRHDWRPRSVRLE
FT                   AHRTRDCERELCRSLGREPTEAEVSDALGISTTEYRERVMANNAEAMASFDSVLDDDAL
FT                   THEESPEREIVRRRCLEQALARLNEREQRVIQLYYEFDLSLREIASVLGLTEARVCQIN
FT                   KAALKKMREVLSDA"
FT   gene            212514..212792
FT                   /locus_tag="BURPS668_A0234"
FT   CDS_pept        212514..212792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86562"
FT                   /db_xref="GOA:A3NFW9"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFW9"
FT                   /protein_id="ABN86562.1"
FT                   /translation="MFSTKYGVPAQRSNGASRASTTTHEGGARGAAAGDAGLEVELLRP
FT                   AREVLRELPDFDAARVAALRAALQEGRLPFDAGKLAGLIQRFHGAKE"
FT   gene            212789..213214
FT                   /locus_tag="BURPS668_A0235"
FT   CDS_pept        212789..213214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87679"
FT                   /db_xref="GOA:A3NFX0"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFX0"
FT                   /protein_id="ABN87679.1"
FT                   /translation="MTRKEAFSRMLAGLEADRSRCEELRGLLEQQFDAALRRDGSLLMA
FT                   AGSAIRALVQALGTSHEARRQCARVLAAPKRPASMSELCALLRGAARDALTLEWQSFDA
FT                   LMCECRRLNQRNATVLMSQFEIVQRVLHGESDTYVHP"
FT   gene            213201..213995
FT                   /locus_tag="BURPS668_A0236"
FT   CDS_pept        213201..213995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0236"
FT                   /product="flagellar protein FlgJ"
FT                   /note="identified by match to protein family HMM PF01832"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85511"
FT                   /db_xref="GOA:A3NFX1"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFX1"
FT                   /protein_id="ABN85511.1"
FT                   /translation="MFIPEFDGRSSDWARAASAGPGVASWSAARGEFRAEFSRLQRDIA
FT                   ATIAQGFDTSGDGGRVRIQGSAPFAGANAIVRLLDGGSAHAAPEKAAFIERILPYANEA
FT                   GKALSVSGELVAAHAALESGWGRRPLTTGEGANTHNLFGIKAGANWTGHVADVLTTEYV
FT                   GGEPIKTVERFRAYPDYRSAFADYAALLRGSSRFREVIGTGDDAAAFAAALARGGYATD
FT                   PAYSSKLRRIAADVAASLAAAGGISETRPALAGQSARLSPDR"
FT   gene            214818..215192
FT                   /gene="flgB"
FT                   /locus_tag="BURPS668_A0237"
FT   CDS_pept        214818..215192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="BURPS668_A0237"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM TIGR01396"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86243"
FT                   /db_xref="GOA:A3NFX2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFX2"
FT                   /protein_id="ABN86243.1"
FT                   /translation="MAFDLASGLGLHPAALKLRAERTKVIASNLANLDTPGYQARDLDF
FT                   KRSLAEAGGDGAHARPGDALTGGVTLGYRVPYQAAQDGNTVELGIEQAAFAQNAVDFQM
FT                   SLTFLNTKIKGLQTAITGNA"
FT   gene            215229..215645
FT                   /gene="flgC"
FT                   /locus_tag="BURPS668_A0238"
FT   CDS_pept        215229..215645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="BURPS668_A0238"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR01395"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87362"
FT                   /db_xref="GOA:A3NFX3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFX3"
FT                   /protein_id="ABN87362.1"
FT                   /translation="MSFKDIAQIAGSAMSAQTVRLNTIASNLANADSASGTEDATYRAR
FT                   KPVFASIFQLDAQGEPRGAAVQVLDVVKSTEPLRKVHQPGHPLADAEGNVLYPNVNPVE
FT                   EMTDMLSASRAYSTNVEVLGRVNGMQLELLKLGQ"
FT   gene            215642..216367
FT                   /locus_tag="BURPS668_A0239"
FT   CDS_pept        215642..216367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0239"
FT                   /product="flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86504"
FT                   /db_xref="GOA:A3NFX4"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFX4"
FT                   /protein_id="ABN86504.1"
FT                   /translation="MTARDRYEDNMSNTIQPRAGDMQQPGAGQHTPSPYANGANSPTDL
FT                   FAKLLAAQIQNQNPLEPMDASQFVTQIMMGQQTEALGVVANLTQNSAALMESMLVVSLG
FT                   SQVGTQVMVRTDSLELKDDTRDARIVLDNAESDVTVVLTDSAGNSHRIALGAQAKGDVN
FT                   FTIDPEELGLPAGQYKIRVETASGAKAGVEIEGTLENVRLAADGKVILHVAGVGDVETS
FT                   SISSFLGRRPANETRKETV"
FT   gene            216364..217551
FT                   /locus_tag="BURPS668_A0240"
FT   CDS_pept        216364..217551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0240"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM PF07559; match to protein family HMM TIGR03506"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87041"
FT                   /db_xref="GOA:A3NFX5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFX5"
FT                   /protein_id="ABN87041.1"
FT                   /translation="MSFNIALSGINAINSQLNTISHNIANANTYGFKAGRANFATMVAG
FT                   TQANGTYIGSITQSVGTRGGFLPTGRALDGAIDGNGFFVTKDSDGSMLFTRFGYFQRDA
FT                   DGYIVDGFGRRAQGYGASGAYGDIRVPTDTEPAKASDSLEYVGNLSADWAAPKNPNFDK
FT                   DDDTSFNHSVASTVYDSLGRQHIVTQYFVKGQPPSTDVIAYYAMDGEIVGGNTPVQTVL
FT                   QFDTNGQLTAPNSPVDLDLGTPAGASALAIKVNYAGTTQVAGETTTTVNRDNGYAAGVP
FT                   GEVMLDEDGGVVVQYSNGKQRKVGSLALATFANQDGLSAVGDTAWRASAASGNPLIGSA
FT                   GSGALGKVVAGSLELSNADVTQELVDMMSAQRNYQANSKVLSTENQMMQALMQAL"
FT   gene            217555..218280
FT                   /gene="flgF"
FT                   /locus_tag="BURPS668_A0241"
FT   CDS_pept        217555..218280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="BURPS668_A0241"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR03506"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88457"
FT                   /db_xref="GOA:A3NFX6"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFX6"
FT                   /protein_id="ABN88457.1"
FT                   /translation="MDALIYTVMSGADRTLHGIAVHANNMANAQTDGFRAELEMAESQP
FT                   VRGYGYDSRHLLNPRANALNGEAGVVVDTGRELDAAINGGGYFTVDAQGSEAYTRAGNF
FT                   EIDADGALTVNGRPVIGEGGPIVLPEFTSLRIGEDGTISITSPGDTEVQAVERLALVDA
FT                   PASALVKNEAGLLVARDGQPLPASNEVKVLGGHLERSNVSPVEEMIATMSLNRAFEVQM
FT                   RMFNAAGEMADAGNRLIRG"
FT   gene            218312..219100
FT                   /gene="flgG"
FT                   /locus_tag="BURPS668_A0242"
FT   CDS_pept        218312..219100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="BURPS668_A0242"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR02488; match to protein family HMM
FT                   TIGR03506"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87733"
FT                   /db_xref="GOA:A3NFX7"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFX7"
FT                   /protein_id="ABN87733.1"
FT                   /translation="MNQAMWISKTGLQAQDAKLQAVANNLANVNTVGFKRDRVVFEDLF
FT                   YRVERQPGAQLDQDNASPSGIQMGSGTRIVGTQKIFTDGSVQTTGQSLDVAVMGKGFIQ
FT                   VLMANGDTGYTRAGQLSINAEGLLVNAQGLPLQPEISIPENATDIAIGENGIVAATMPG
FT                   ASSPSEVGQIQLANFVNPAGLLALGDNLYMETVASGPPNEGEPGTDVFGKIKQGALEGS
FT                   NVQVVEEMVDMIAAQRTYEMNTKVLSAADNMLQQLSQAAR"
FT   gene            219097..219753
FT                   /gene="flgH"
FT                   /locus_tag="BURPS668_A0243"
FT   CDS_pept        219097..219753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="BURPS668_A0243"
FT                   /product="flagellar L-ring protein FlgH"
FT                   /note="identified by match to protein family HMM PF02107"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88304"
FT                   /db_xref="GOA:A3NFX8"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFX8"
FT                   /protein_id="ABN88304.1"
FT                   /translation="MMRILLALTGLACLGACASIEPPRPDFADDDLPPIATAPAAGRSG
FT                   GVFNAVTAWSLASDGRAYRPGDTLTVTLEETTQASKRADTKFGKNGDMAVKPGVLFGSA
FT                   IPFDSSFGAKRNFDGGGSSSQQNTLRGEITVIVNQVLAGGLLQVKGEKVLSLNQGEEVM
FT                   RLSGYVRQADIDTNNRVSSRRLANARIKYVGKGALSDSNSAGWLTRFFNSPWMPF"
FT   gene            219753..220916
FT                   /gene="flgI"
FT                   /locus_tag="BURPS668_A0244"
FT   CDS_pept        219753..220916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="BURPS668_A0244"
FT                   /product="flagellar P-ring protein FlgI"
FT                   /note="identified by match to protein family HMM PF02119"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85866"
FT                   /db_xref="GOA:A3NFX9"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFX9"
FT                   /protein_id="ABN85866.1"
FT                   /translation="MKLRFRDHYSRRRTRAQRVCAFAAILSLLSVLLMAASRSSDAAPL
FT                   GTLVSVEGVRDNQLVGYGLVVGLNGSGDGQQIRYTGQSIANVLKQFGVTLPEGIRLRSR
FT                   NVAAVMVSANFPAGYVPGQKIDVTVSSMGDAKSLRGGTLLLTPLRAADGVVYALAQGNL
FT                   VVPGVSAQGRSGSSVTINATAAGRIPQGATIEQEIPSDIDAKPFVRLSLKRPSFQTATS
FT                   IVAAIDRMAGPGAATSRDGTSVEVRAPEDPTARVAFLAKLTAINVTPQKEPPRVVFNSR
FT                   TGTVVISQGMTVSSAAVSHGTLKVTISEGAIVSQPNPLGGGKTAVVPLSQVDVQQDGNR
FT                   MFNWPAGVSLQKIVDTINSTGASPDDVMAILQALDEAGALNGELVVI"
FT   gene            220927..221280
FT                   /locus_tag="BURPS668_A0245"
FT   CDS_pept        220927..221280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0245"
FT                   /product="peptidoglycan hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85656"
FT                   /db_xref="GOA:A3NFY0"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFY0"
FT                   /protein_id="ABN85656.1"
FT                   /translation="MMSNGTIGAGVRMAPAARMPGLAAQPAANESDERKAAYAAEQFEA
FT                   LFASQLLREMRNAIREISPEGSMFRDAVGSGLMDMMDGAIAQALATQRAFGIADFVLAR
FT                   IMPGGDPTGAAAR"
FT   gene            221405..222763
FT                   /gene="flgK"
FT                   /locus_tag="BURPS668_A0246"
FT   CDS_pept        221405..222763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="BURPS668_A0246"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="identified by match to protein family HMM PF06429;
FT                   match to protein family HMM TIGR02492"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88154"
FT                   /db_xref="GOA:A3NFY1"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFY1"
FT                   /protein_id="ABN88154.1"
FT                   /translation="MNIIYIGMSGIRAANQSLLAASQNTANIATGGYSRRGVLLSTGLT
FT                   GGVDASGLLRLNESYKTQQLWQAAGQYGRYDAAQTYFDQLEALFGGNPVDGKTQANDLG
FT                   FGKFIGALEAASGDPGDSVLRNGVIDAANSMTKQFNNMRSVLTNQLRSIEQQRVTTVEQ
FT                   VNGLAKTVAELNGKIAAGQASGADVSALMDQRDAAVDDLSRFAGVRVVQQANGSVDVSM
FT                   ANGQPLVVGAQAGKIELGRDAAGQQTLSLAFGSQVMPLRAASLGGELLGLAEFEEEVLR
FT                   PQMEALRTLAVRTAELINDQLTQGFDMNGNPGKPLLTYDAATGLLGVDPSVKPEELGFS
FT                   GDPANPGDNSNLLALVEIGSTSVDLPGIGDVSLGNAIATMMGKVGAASQQNRQAKGAAE
FT                   AVRGQAELDWYSVSGVDRDEEVMNMLRFKDMYNANMKVIAVASELFETTLNSL"
FT   gene            222781..223695
FT                   /gene="flgL"
FT                   /locus_tag="BURPS668_A0247"
FT   CDS_pept        222781..223695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="BURPS668_A0247"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="identified by match to protein family HMM TIGR02550"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87061"
FT                   /db_xref="GOA:A3NFY2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFY2"
FT                   /protein_id="ABN87061.1"
FT                   /translation="MRITSNQYHSIMAQVNRQATAGLMDTQIRMATEKRILRPSDDPTG
FT                   AMRLAMLVQADAMLDQYRATGAMLNSRLQHSERVMSGVVDQLQNEAVKHLGFAMDGSRS
FT                   PEDLSAYAQVLASVRDTLLQSANTRDSSGNYLFSGTAITTAPIRFDPAAPVGSRYTFEG
FT                   NLEKQTAVVGDGVTEVANESLAEMADGLNALDEAIAKMSEPNANPNDPAYRDVLGRATD
FT                   TIESVLASVNAKIGRMGSTQARLQMLDELHESAQIVGNQAALDVGKISPEEVFTDYQSY
FT                   MVALQASQKLYAEVTQLTLLNVL"
FT   gene            223711..224778
FT                   /locus_tag="BURPS668_A0248"
FT   CDS_pept        223711..224778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86788"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFY3"
FT                   /protein_id="ABN86788.1"
FT                   /translation="MELKTTMPAGGARAAAEAGLRGGIRTPAAMQPDIRDGRVRDASHA
FT                   VVQMPPAGRGAADRRDAFAVHQRVNEQASGMQLVLDYLEQFGDRMKALKQALSARLAGG
FT                   GSDLDVRAKIDSATAAWNRRAAATGGRLSETLELGGVDSARRAFVLRGLDAQDARRAEG
FT                   EVITFHLGGTGARPATLYLAPDLTAREMAYRLKVGLAPLGIDCETHARERITLSVEESR
FT                   WPVVARGLHVKGGGVRFPAGAPQRAAMEAVAGRIDASDWEAGDAGAMRAALTRTVQTVK
FT                   RLDQVSILAEHALKRARQTLASMPSGLNAQWARDACERIAADASARGGYGQVVALTAVT
FT                   AGLDRARVRALLSMR"
FT   gene            224784..225116
FT                   /locus_tag="BURPS668_A0249"
FT   CDS_pept        224784..225116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0249"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86120"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFY4"
FT                   /protein_id="ABN86120.1"
FT                   /translation="MPRSPAACRARTGARAAAVDGARSRFAAPVCSRVGEGFEGRTKCR
FT                   RPVRRRTERGAVSPRPSRGRAAGVARVSSAVHGPKIACALHGRSAEGTPAHAGLRSPCS
FT                   RYVEAL"
FT   gene            225157..225294
FT                   /locus_tag="BURPS668_A0250"
FT   CDS_pept        225157..225294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88251"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFY5"
FT                   /protein_id="ABN88251.1"
FT                   /translation="MLESICSPDTAKPAGAEVDDPVALANALMGIRRRRVRELLALRLP
FT                   "
FT   gene            complement(225337..226104)
FT                   /locus_tag="BURPS668_A0251"
FT   CDS_pept        complement(225337..226104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0251"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87368"
FT                   /db_xref="GOA:A3NFY6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFY6"
FT                   /protein_id="ABN87368.1"
FT                   /translation="MKKYLIEDLVTFDAHLMTLAHLDQTTELTTNESELLQMVLDGIAT
FT                   KAAVIERVWGSKGFVVTDSSYHQLVRSVRNRLEEHGISGALIKTLPRQGLRFLGSAQAL
FT                   TDAATPVAQPGLADQGEPADEAALALLTQHEPQSAPPVGRARNWRRRLRFVERALLAGL
FT                   VVWVGLVTWKMISINDRFPWLTGHFGVHTHAHVTPRSAGLKLLASIGVRPGPGERVYEI
FT                   SRNGDRWLAICAGTRHSSDERCTTYSTRDLTTS"
FT   gene            complement(226373..226693)
FT                   /locus_tag="BURPS668_A0253"
FT   CDS_pept        complement(226373..226693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0253"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86088"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFY8"
FT                   /protein_id="ABN86088.1"
FT                   /translation="MPSRSDQRDSRAGDVEAARRMMPGVRFSIIRSPTRRLRDTPPEPH
FT                   SGSIAQPPHTPEAQPGPAGAPAITRNDAHERAIPRSRPASALKCSASSLAGAMRENSKR
FT                   EP"
FT   gene            226975..227145
FT                   /locus_tag="BURPS668_A0254"
FT   CDS_pept        226975..227145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0254"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86187"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFY9"
FT                   /protein_id="ABN86187.1"
FT                   /translation="MVNDYSNLTGEEQGIFMAALSDYVRASPARRTEMVAMWRRATQEG
FT                   SSQALPAGRSE"
FT   gene            227374..227607
FT                   /locus_tag="BURPS668_A0255"
FT   CDS_pept        227374..227607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0255"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88134"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFZ0"
FT                   /protein_id="ABN88134.1"
FT                   /translation="MTPLHIGARRYFRFLLRPVIESGGNAASMRAFEANSPPASCRTRR
FT                   FVKDRQICALSIKRMLIHCVNLPQERLLLSLG"
FT   gene            227604..227765
FT                   /locus_tag="BURPS668_A0256"
FT   CDS_pept        227604..227765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0256"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85559"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFZ1"
FT                   /protein_id="ABN85559.1"
FT                   /translation="MIALEGPRIPFPVLCLRSTSRISDCAECIALSRKFNKFDLDLRNK
FT                   PELLNIVC"
FT   gene            complement(227969..228103)
FT                   /locus_tag="BURPS668_A0257"
FT   CDS_pept        complement(227969..228103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87575"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFZ2"
FT                   /protein_id="ABN87575.1"
FT                   /translation="MLYSRHQCGMVVGDNQIDFHFTPNLHEYNIDLAFNSIRHKVKPD"
FT   gene            228044..228736
FT                   /gene="rcsB"
FT                   /locus_tag="BURPS668_A0258"
FT   CDS_pept        228044..228736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsB"
FT                   /locus_tag="BURPS668_A0258"
FT                   /product="regulatory protein, LuxR:Response regulator
FT                   receiver"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196; match to protein
FT                   family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88296"
FT                   /db_xref="GOA:A3NFZ3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFZ3"
FT                   /protein_id="ABN88296.1"
FT                   /translation="MKIDLIVADDHPALVAGIEHALSRSNAIRVVGTASNSTELVDLLT
FT                   CERCDILITDYAMPGGSHGDGLGLLSFLRRHHPDLKIIVFTAIDNPALIASMARLGARA
FT                   IVNKMDHIDNLIATVQAVYAGASCLPAGIGAFASSRLAVDGEAPEIERQLSARELEIVR
FT                   LYVSGLSVNEIAAYLHRSKQAVSTQKMNAMRKLGIERDAGLFRYAYETGLMAAGVPSAS
FT                   PVSAQAVH"
FT   gene            228819..228974
FT                   /locus_tag="BURPS668_A0259"
FT   CDS_pept        228819..228974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0259"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88400"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFZ4"
FT                   /protein_id="ABN88400.1"
FT                   /translation="MKPAIAMPGLRFGRARRYLTTHRLTRVRLPDPAHRAFFAARRART
FT                   RARAAA"
FT   gene            complement(229206..229592)
FT                   /locus_tag="BURPS668_A0260"
FT   CDS_pept        complement(229206..229592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0260"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85993"
FT                   /db_xref="GOA:A3NFZ5"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFZ5"
FT                   /protein_id="ABN85993.1"
FT                   /translation="MGSLNYASAISNPFNDIPGQSNIALDRPISGMNSYQEYKQHVKTL
FT                   QATLDRERKAISAKVLQEIRECIAEFGFTPQEVFSSKKKREPKYYDPVSGSTWTGLGRE
FT                   PEWIRGKDRKAFELSSHQRDDHCR"
FT   gene            229991..231316
FT                   /locus_tag="BURPS668_A0261"
FT   CDS_pept        229991..231316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0261"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85868"
FT                   /db_xref="GOA:A3NFZ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFZ6"
FT                   /protein_id="ABN85868.1"
FT                   /translation="MTPPSSVAARPASDPLNDGYRKVTFRLIPLIFVCYLFNYLDRVNV
FT                   GFAKLQMLSDLNMSETVYGLGAGIFFIGYVLAGVPSNLVLRRVGARAWIAIIMVVWGAL
FT                   SSALLCVKTPASFYTLRFFTGIAEAGFFPGMVLYLTQWFSAEHRGRAIALFMSAIPISG
FT                   VIGGPLSGWMLDHFSAGQGGLAGWQWLFLLQGAPTIVLGVAVFALLEDRIDDARWLSAD
FT                   EKAALARAVATTAADAAIASAGRPNTLRDILLNGAVWKFGIVYFSIQMGVYAINFWLPS
FT                   IIRSLGVGGSGAIGWLSAIPYLFASVAMIAVGKSADARQERRWHLSMPMAVGVAGLLMA
FT                   AQSGNAIVPAMIGLVLATAGALTALAMFWPLPTLVLTGSAAAGGVALINSLGQIAGFVS
FT                   PYIVGWIKDATQRTDLALYILSSTMVVGIVLVMRTHARGAGR"
FT   gene            231390..232556
FT                   /gene="glxK"
FT                   /locus_tag="BURPS668_A0262"
FT   CDS_pept        231390..232556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="BURPS668_A0262"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="identified by similarity to SP:P77364; match to
FT                   protein family HMM PF02595; match to protein family HMM
FT                   TIGR00045"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86622"
FT                   /db_xref="GOA:A3NFZ7"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFZ7"
FT                   /protein_id="ABN86622.1"
FT                   /translation="MKIVIAPDSFKESLTAVETARQIEAGFREVFADADYRCLPIADGG
FT                   EGTVDALVAAAGGERRGASVADPLGRPTRAAFGILPDGTAVIEMAEASGLHLVAPDARD
FT                   PRVTSSRGTGELIRAALDAGARRFIVGLGGSATNDGGAGMLQALGVHLSDADGRPLGPG
FT                   GAALARLARIDAAGLDGRLAECAFEVACDVDNPLVGPNGASAVFGPQKGATPEMVADLD
FT                   RHLAHFAAIVARDVGPDVAQLPGGGAAGGLGAAMSAFLGATLRPGVEIVTDALRLRDAI
FT                   RGASLVVTGEGCIDGQTLRGKAPIGVARIAAECGVPVVAIGGAVTHQAGALYAHGFDAV
FT                   FASVGRACTIDEALRDAAANVRFAARNVAAAIRVGLKLGRHASSRRLA"
FT   gene            232739..234193
FT                   /gene="pyk"
FT                   /locus_tag="BURPS668_A0263"
FT   CDS_pept        232739..234193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="BURPS668_A0263"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="identified by match to protein family HMM PF00224;
FT                   match to protein family HMM PF02887; match to protein
FT                   family HMM TIGR01064"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87762"
FT                   /db_xref="GOA:A3NFZ8"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFZ8"
FT                   /protein_id="ABN87762.1"
FT                   /translation="MRNESHTARERRRSTKIVATLGPSSSTETAIEALARAGADVFRLN
FT                   FSHGTHADHALRHAAVRAIEARIGHPIGVLLDLQGPKLRVGQFASGRAQIAKGRPFVFN
FT                   RDPAPGDARRVSLPHPEIFDAARPGHLLLVDDGKLRFRVDAVSSARIETTALLDGIVSD
FT                   RKGVSVPDATLAIPALSAKDRDDLEFGLSLGVDWVALSFVQTAQDVRDARALIGARAAI
FT                   VAKIEKPQAVANIAEIVDAADAVMVARGDLGVEMSLEDVPSVQKQIIRLARAAGKPVIV
FT                   ATQMLESMTLAPTPTRAEASDVAAAVYDGADAVMLSAESASGQYPVEAVDFMRKIISTT
FT                   EADPIQPQLMKAIVTAHAPNATDAIGAAIEVVSDTLRLGVAVTYTASGATAIRLSRLRP
FT                   STAILSLTPRAEIARRLTLAWGVRSRVAAEATGIENIVEIAIEAAHAEGFATDECPIVV
FT                   AAGVPFGHPGSTNLMRIVWPTEMTRQ"
FT   gene            234206..235657
FT                   /locus_tag="BURPS668_A0265"
FT   CDS_pept        234206..235657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0265"
FT                   /product="putative carbohydrate diacid regulator"
FT                   /note="identified by match to protein family HMM PF02954;
FT                   match to protein family HMM PF05651"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85329"
FT                   /db_xref="GOA:A3NFZ9"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A3NFZ9"
FT                   /protein_id="ABN85329.1"
FT                   /translation="MPARFAGRLADRFAGGFAPALQIASQAVSRAISRTISQAAPLACF
FT                   VICRGPRRSRFHGPPAARVRTRSPPFSPFDPTAMMIDARLATEIVVRTVEVMPFDVNVM
FT                   DAHGVILASSDAARVGEIHAGAQLALARARAVEIDAAMAANLSGARPGINLPLSVRGKV
FT                   CGVIGVTGEPDAVRGFGELLRVTAELILEREQLTVELRRNARHREEFVLQLLRRTAAAA
FT                   ELEAWADRLGIDMRLAHAAIVCRLSGVDTEPEAGVGQIEAMQSQLAQEWPQLLSAKTSY
FT                   RELVMFDAVDARAGRDGVLATHAGKRLAALEGTLRKVATQPFSLALGIALDGIDGFERS
FT                   YQCALATLRVGAARTPQRAAYSYYDFVLPVLLSALSQGWQARQLRLPLTRLLARERRSG
FT                   ALLDTLKAWYAHDGHPSATAQALGIHRNTLDYRLQQIRDATGLDLGAIDDRLWLYIALQ
FT                   TMAGSDDGDNGLDGDAGLGDERPAS"
FT   gene            complement(235613..235753)
FT                   /locus_tag="BURPS668_A0264"
FT   CDS_pept        complement(235613..235753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0264"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87150"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG00"
FT                   /protein_id="ABN87150.1"
FT                   /translation="MGPRGGHAPLRKRGVRRVRRVRLAASGSCCQASARRALVAETGVA
FT                   V"
FT   gene            complement(235790..236104)
FT                   /locus_tag="BURPS668_A0266"
FT   CDS_pept        complement(235790..236104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0266"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86484"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG01"
FT                   /protein_id="ABN86484.1"
FT                   /translation="MYLYKSVEFLRKAIFPISIRPFIQIDEIIRFEPAIYIPLQIPASD
FT                   IHAEEYFIFNIRIFYGYFENRIDRGREKILRREARAARAAARASLKTGEDRRRTRRSHA
FT                   "
FT   gene            236382..236510
FT                   /locus_tag="BURPS668_A0268"
FT   CDS_pept        236382..236510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0268"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88307"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG03"
FT                   /protein_id="ABN88307.1"
FT                   /translation="MDKTIESSGIFCRWIQWIVSESRSPSCVIPDEIGHAGAQRRA"
FT   gene            236719..239526
FT                   /locus_tag="BURPS668_A0269"
FT   CDS_pept        236719..239526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0269"
FT                   /product="putative non-ribosomal peptide synthase"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00975"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85937"
FT                   /db_xref="GOA:A3NG04"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG04"
FT                   /protein_id="ABN85937.1"
FT                   /translation="MTASALDLPRDCEHALRAASPPNIVDLLLRAARLHPHTGVRFIAA
FT                   ESEHKGAFVTYPELLDEARRILGGLRARGYRSGMKVALLLEHASDFIPAFWACALGGFV
FT                   PCPLVPIRNDPERWAKHLAHVDTLLDHPLLVTTEALNNDLPGGASAVNLNALRASLPDA
FT                   STHVAQPSDPAVFVLTSGSTGNSKAVVLTHGNLLASMAGKNDRQQLAGADVTLNWISFD
FT                   HVAALLEAHLLPLYVGAVQLHVEAAAVLTDPLRFLRLVSRYRVTMTFSPNFLFGQLNAA
FT                   LEAMGDEALAAWRGAVDLSSLRHVVSGGEAIVVATGQRFLDLLAPCGLARDALWPAFGM
FT                   TETCAGSVYSREFPEGDAGREFASLGLPVAGLQMRIADDRNNVLPEGEAGEFQVRGPMI
FT                   FQRYHNNAEATRAAFTSDGWFRTGDLGRIERGRLWLVGRSKDSIIVNGVNYFSHELETT
FT                   LEALDGVKPSFVAAFPTRGAGDESEQLVVTFTPSFPLDDEDALYRLVIAIRNSTILLWG
FT                   FRPALILPLPEDEFPKTSLGKTQRAIMRKRLEAGSYDGYKARVADLANRQMGGYVAPDG
FT                   QTEAAVAAIFARMFQVAPEAISATASFFDLGGTSLDILKLKRHVEQRLGVIDLPIVTIL
FT                   QNPSVRALAARLAPGERVAAGEYDPVVPLQLTGGKTPLFCVHPGVGEVLVFVNLAKYFV
FT                   NERPFYALRARGFNEGETYFSSFDEMVNTYVDAIRKRQPHGPYAVAGYSYGGAVAFEIA
FT                   KVLEAQGERVDFVGSFNLPPHIKYRMDELDEVEGAVNLAFFLSLIDKQQSLTLPPQLRA
FT                   AMPEQDPLAYLIDHAPPGRLVELDLDLPKFRAWAGLAQSLLTLGRSYAPSGSVRAMSIF
FT                   YAIPLRGTKDDWLNKELRRWDEFTRAPNRYIDVAGEHYTLMGPAHVATFQAVLRAELDR
FT                   ALGGK"
FT   gene            239572..240546
FT                   /locus_tag="BURPS668_A0270"
FT   CDS_pept        239572..240546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0270"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF04321; match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86879"
FT                   /db_xref="GOA:A3NG05"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG05"
FT                   /protein_id="ABN86879.1"
FT                   /translation="MARNDGRGDARQRERAKRKVLITGATGQVARPVAEALAAQDEVWA
FT                   IGRFGDAGVEHALRAKGVKTWRWDMERDTLDSLPDDFTHVLHAAVRRGEDGDFDRAIEI
FT                   NTVATGRLMTHCRHAESFIYVSSGSLYARQALDHPYAETDPLNGVAHWLPAYPIVKISC
FT                   EGVVRALSATLGLPTVIARLNVAYGPYGHGGVPVLLYRQLLAGKPVPVPREGQNWASLI
FT                   HTDDLVRQVPLLWEAASSPALVLNWGGDDAVGIRDCLQYVADLTGVDARFERSDVTRET
FT                   YAFDNTKRRALIGDCTVHWKDGVRRTIETHFPGAVKTQPAAQR"
FT   gene            240570..240965
FT                   /locus_tag="BURPS668_A0272"
FT   CDS_pept        240570..240965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0272"
FT                   /product="putative limonene-1,2-epoxide hydrolase"
FT                   /note="identified by match to protein family HMM PF07366;
FT                   match to protein family HMM PF07858"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87334"
FT                   /db_xref="GOA:A3NG06"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG06"
FT                   /protein_id="ABN87334.1"
FT                   /translation="MSNNMQTVRESYEAFHRRDLPGVLAALAPDVRWTHPDGMSPYGLG
FT                   GTKHGHDEVIAFIRHVPTHIAEMRLAPDEFIESGERIVVLGTRRVTAVNGRSATLKFVH
FT                   VWRFENGRAVTFEDHFDTAEMIRLITA"
FT   gene            complement(240955..241197)
FT                   /locus_tag="BURPS668_A0271"
FT   CDS_pept        complement(240955..241197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88081"
FT                   /db_xref="GOA:A3NG07"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG07"
FT                   /protein_id="ABN88081.1"
FT                   /translation="MRPNPSPTRPAVDGPRGDAARCDAARCNSARFSTNQRDSTQPDAI
FT                   ARGMRRRSERRVIAAPTAIAALIAVSAARAAALRP"
FT   gene            241228..242253
FT                   /locus_tag="BURPS668_A0273"
FT   CDS_pept        241228..242253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0273"
FT                   /product="O-methyltransferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by match to protein family HMM PF00891;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87770"
FT                   /db_xref="GOA:A3NG08"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG08"
FT                   /protein_id="ABN87770.1"
FT                   /translation="MTEVDAGQTPHAAILQMVTGKWHAQALYVAAELGIADLLAQRERT
FT                   ADELAAETQTHPEALYRVLRALGSLGVFVEEDGRRFRNSPLGDTLRRDAPGSMRGFVRF
FT                   AGMDAGWRAWGQLMYSVRTGRSAFEHVVGGPGFAYIDSHPEIAAIVNDAMTSMSELEAP
FT                   AVARAYDFSQARTIVDVGGGHGFLLATLLRANPHANGVLFELPHACEGARQLFAKHGLT
FT                   ERVKVIAGDASHSIDAHGDVFVMKHVICDWDDERATRIMTNCAEAMRPGGKLLLVEAVL
FT                   TPPGEPHFAKLHDLEMLIMSSGGHGRTADGYGRLYAAAGLTMTAVRPTQGMNSVIEGVK
FT                   P"
FT   gene            complement(242294..243295)
FT                   /locus_tag="BURPS668_A0274"
FT   CDS_pept        complement(242294..243295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0274"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86621"
FT                   /db_xref="GOA:A3NG09"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG09"
FT                   /protein_id="ABN86621.1"
FT                   /translation="MRATRGASRRNGSSQDSGAQMSEQSKNSQAGHAPLAYPLAALTRA
FT                   LPTLAALQSFVAAAQLGSLSKAAAHLCRTQGAVSRQIQQLEAHYRCALFVRQPTGLTLT
FT                   ADGDALFAVAADVLARLVRHARERDEAAAAVTVRVPSTFAIRWLLPRLPAIRRALGATQ
FT                   LCLSTSANDTPDFSEPDIDAIVARGDGRWPGVEAIPLFAETLAPMCGPALAASLKSVDD
FT                   LAHVTLLHPGRGRAEWRCWLDAVGAAHIDATRGPVFDTLELTLSAAAEGHGVAIGDPRM
FT                   AGDRLRAGTLTMPLRETAANGLSYYLVYPAQRATQPKIRALANVLVKLAQAR"
FT   gene            243314..243721
FT                   /locus_tag="BURPS668_A0275"
FT   CDS_pept        243314..243721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87912"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG10"
FT                   /protein_id="ABN87912.1"
FT                   /translation="MKIVDSSSNALYTRQIHAYVKALERGDVEAICALFTPDAQIVSPF
FT                   LGRMQPAPFFAKVAAASGESAIALTDVCVSASGARRAMGYLVYDWGLKDGSSVRFECVD
FT                   VFEFDANGFIERMVIVYDTHPIRDVVGDKYA"
FT   gene            complement(243759..245147)
FT                   /locus_tag="BURPS668_A0276"
FT   CDS_pept        complement(243759..245147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0276"
FT                   /product="diguanylate cyclase"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87740"
FT                   /db_xref="GOA:A3NG11"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033424"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG11"
FT                   /protein_id="ABN87740.1"
FT                   /translation="MDGFLIQRPSRLQTLGAGTFALLTLGALVATAPHADLRLPPIEPF
FT                   LPMCALTVFSTSLIAAFLLGAQFIVMRRPILGTLAGAYAFAAITVALQLLAFPGVFAPT
FT                   GLLGARHDSAAWLWTFWHGGFPLFVVLAMLTRYRLAKRLSNTRHVGRWLATLAGVPIAV
FT                   AIALGLVALRADLPAPFGPSLDNALRAADPVAIVIWTINLGAIAAALFVGRMRTMLDIW
FT                   LVVVLLAGFTDTSLNLLSTARFTAGWYVARLFSMIAPGILVCVLVWEVTVLYRRLFDAH
FT                   ASLMRTASHDALTMVYNRSYFNEQFERAFHYARRHNAPLALVMVDVDHFKQYNDTFGHL
FT                   QGDTCLAAVAAALSGVAGRANDFVARYGGEEFAVVLPGADERGAATIAERARQAVERLR
FT                   IAADTAPGYVTVSAGYAASSGNPFETPGALIAAADAALYRAKMLGRNVSAAPHHDMQDT
FT                   AMRD"
FT   gene            245146..245703
FT                   /locus_tag="BURPS668_A0277"
FT   CDS_pept        245146..245703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0277"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86440"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG12"
FT                   /protein_id="ABN86440.1"
FT                   /translation="MGSPERESRRRHPMGGECRVESGPGTRAHRVKSTTWSAATLIYFS
FT                   SFRDASPSAGVGAMAAKRDDARRDDGVGCGAGRHVGGASARRAGGFTILRFDSRPGVPA
FT                   LTDERIGGAAAHSKRVFADVCVSMSIVLPIRSTDSFGVVAGMGGRPPRGARAVTMSGRP
FT                   SWHGGVAASMRALRALRASRSA"
FT   gene            complement(245898..246248)
FT                   /locus_tag="BURPS668_A0278"
FT   CDS_pept        complement(245898..246248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85322"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG13"
FT                   /protein_id="ABN85322.1"
FT                   /translation="MRRRGIHESSDHQRREKERTGRYVISQTGRPAILAKGAYASAFRI
FT                   VQNRIRKDAVESGGKWFHRRRQPVLSLFLIHSFKFHQSVFITIFQRRAENNDLIPIQRI
FT                   RSRSPIRIPGRY"
FT   gene            246457..246720
FT                   /locus_tag="BURPS668_A0279"
FT   CDS_pept        246457..246720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0279"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87335"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG14"
FT                   /protein_id="ABN87335.1"
FT                   /translation="MAPLLVTCLMLATVAHAQTPPPLQDVNPNRHMNIAVAQASIRQAY
FT                   DAISAAQAANHDRLGGHGDRAKRLLDEASVELKAAALTANGE"
FT   gene            247019..247201
FT                   /locus_tag="BURPS668_A0280"
FT   CDS_pept        247019..247201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86435"
FT                   /db_xref="GOA:A3NG15"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG15"
FT                   /protein_id="ABN86435.1"
FT                   /translation="MGERRVDTGGGSHGQSQSRRGWRQNMKKILVAMLALGVLIGVVAI
FT                   VSICVAWTLADRLCY"
FT   gene            247248..247451
FT                   /locus_tag="BURPS668_A0281"
FT   CDS_pept        247248..247451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86062"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG16"
FT                   /protein_id="ABN86062.1"
FT                   /translation="MNRRRTNVKRRSTNMSIRLARLIALSMLATLVAGVSGCVVEPVQP
FT                   AAHWHPAHYDVYGYWHPGHWGP"
FT   gene            247518..249290
FT                   /locus_tag="BURPS668_A0283"
FT   CDS_pept        247518..249290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0283"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87480"
FT                   /db_xref="GOA:A3NG17"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG17"
FT                   /protein_id="ABN87480.1"
FT                   /translation="MPPPHRRRRVRCAALGAPREAPRALRSAVRADRRAAGARRRARGV
FT                   MRSVTPPCMPPGGPANEARRAWRAVCTFSTSRLAMRASRGAHIAIFIAIAGRRAYHSRA
FT                   VIPRTRNRGTRIARRIRSMLQPTKECAMTRRFDAIIIGTGQSGPPLAARLSAAGMKVAV
FT                   VERGRFGGTCVNTGCIPTKTLIASAYAAHLARRADEYGVTLGGPVAVDMKKVKARKDQV
FT                   AARSNRGVEQWVRGLENGTVYHGHARFESARTVRVGEALLEAERIFIDVGGRALIPPIP
FT                   GLDQVPYFTNSTMMDVDFLPEHLIVLGGSYVGLEFGQMYRRFGARVTIVEKGPRLIARE
FT                   DEDVSHAVREILEGEGIDVRLDADCLSVRRDGGGIAVGLDCAAGAREVRGSHLLLAVGR
FT                   VPNTDDLGLEHAGVETDARGYIRVDEQLRTNVAGIWAMGDCNGRGAFTHTSYNDYEIVA
FT                   ANLLDGDPRKVSDRIPAYAMFIDPPLARVGLTQAEAARSGRRLLVGTRPMTRVGRAVEK
FT                   GESLGFMKVIVDADSHAILGASILGVTGDEVVHSLLDAMYAKAPYTTISRAMHIHPTVS
FT                   ELVPTLLQDLHPPA"
FT   gene            complement(249266..249424)
FT                   /locus_tag="BURPS668_A0282"
FT   CDS_pept        complement(249266..249424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0282"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86999"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG18"
FT                   /protein_id="ABN86999.1"
FT                   /translation="MPPPSGRRHGTRYTAHGTARRRTTRCGARPDGAPPMRGLAHRRLR
FT                   YAGGCRS"
FT   gene            complement(249430..250374)
FT                   /locus_tag="BURPS668_A0284"
FT   CDS_pept        complement(249430..250374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0284"
FT                   /product="ABC transporter, carbohydrate uptake
FT                   transporter-2 (CUT2) family, periplasmic sugar-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86783"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG19"
FT                   /protein_id="ABN86783.1"
FT                   /translation="MEIKHKLVQTAAACALAFAACAAHAADKPLKSIGITVGSLGNPYF
FT                   VTVVKGAQAQAKEINPSAKVTAVSADYDLNKQFTQIDNFISAHVDMILLNAADPKAIEP
FT                   AVRKAQAAGIAVIAVDVAASGADATVQTNNVKAGELACDYLAKKLNGKGNVIIENGPQV
FT                   SAVVDRVNGCKAVLAKNPGLRLLSSDQDGKGSREGGMNAMQGYLTRFPKVDGLFAINDP
FT                   QAIGSDLAAKQLRRTGIVITSVDGAPDIETALTSDTQVQASSSQDPFAMAKKAVSVGYG
FT                   IMNGHKPANAMILLEPTLITRENVKRYKGWSAH"
FT   gene            complement(250454..251488)
FT                   /locus_tag="BURPS668_A0285"
FT   CDS_pept        complement(250454..251488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0285"
FT                   /product="ABC transporter, carbohydrate uptake
FT                   transporter-2 (CUT2) family, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86642"
FT                   /db_xref="GOA:A3NG20"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG20"
FT                   /protein_id="ABN86642.1"
FT                   /translation="MNQQIKQSETAAAPPGAAQPRAPRRAADHRARMQALMRTAGMLPV
FT                   LVLLCVGFGFMTDGFFTLQNLSIVTQQASINIVLAAGMTFVILTGGIDLSVGSVLAAAA
FT                   VASLLASNLPGWGWLGIPAALAVGLAFGVVNGGLISFLRLPPFIVTLGALTAVRGIARL
FT                   MGNDTTIFNPQLPFAFIGNGSILGVPWLVVIALAVVAISWFILRRTVLGMRIYAVGGNP
FT                   EAARLSGINVRGIELFVYASSGLLAGLGALMSAARLYAANGLQLGQSYELDAIAAVILG
FT                   GTSFVGGVGSIVGTLIGALIIAVLSNGLVLLGVSDIWQYIIKGLVIIGAVALDRYRQHG
FT                   SART"
FT   gene            complement(251531..253084)
FT                   /locus_tag="BURPS668_A0286"
FT   CDS_pept        complement(251531..253084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0286"
FT                   /product="ABC transporter, carbohydrate uptake
FT                   transporter-2 (CUT2) family, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88300"
FT                   /db_xref="GOA:A3NG21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG21"
FT                   /protein_id="ABN88300.1"
FT                   /translation="MQRSDPPRPLLEMRGISKTFPAVRALAGVSLTVHPGEVHSLMGEN
FT                   GAGKSTLMKILSGAYQADPGGEILIDGRPISIDGPLAAREAGVAVIYQELCLAPNLSVA
FT                   ENIHVGRELRRGNGRRGTIDRAAMARGCQDVLERLGADFGPNTLVGTLSIAEQQLVEIA
FT                   RAVHTRARILVMDEPTTPLSSRETDNLFRLIRQLRAEGLAIIYISHRMAEIYELSDRVS
FT                   VLRDGAYVGTLERDALSAERLVGMMVGRDISGFYKKAHAPYDPGNLLLSVRDIADGARV
FT                   RGCSLDLHAGEVLGIAGLVGAGRTELARLIFGAEPRVRGEVTLAGKAFAAHSPREAIDA
FT                   GLVYLTEDRKRQGLFLDMSVRENINISVCGRDARLGALDLARGAQRARDAIAALSIRVP
FT                   HANVNVGALSGGNQQKVLLSRLLETKPRVLILDEPTRGVDIGAKSEIYRIINELARAGV
FT                   GVIVISSELPEIIGVADRVLVMREGRIAGELGGRTDAPITQEAIIALATGSRTEASAAH
FT                   "
FT   gene            complement(253071..254321)
FT                   /locus_tag="BURPS668_A0287"
FT   CDS_pept        complement(253071..254321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0287"
FT                   /product="transcription regulator ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87109"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG22"
FT                   /protein_id="ABN87109.1"
FT                   /translation="MRSPHLGQGSNSANVRRYNERLLLKTLRRAGSASKADLARLANLT
FT                   GTAVGSIIASLAEAKLIEFAGRRAEGQRGQPASLIRLDPRGAFGIGVRLDRMRIETALV
FT                   NFAGDVIGRRSHDTLLPQPAAVLEIVREDVAAMQQLLCAHERARLTGVGVAQPYNLGSW
FT                   LREIDLPADAFGAWAEVDFARELDRAIELPVFSENDGNAAAIAELFYGCGRQRDDFVYL
FT                   FLGPAIGGGIAVDGDCLRGVTGNAGDFAMMPVPPSRLPSVPKPSGAWDLLITRASLNGL
FT                   ARHLRHRGETLESHADLEACIARGGQAVDEWIDDCVDALAPALRAVLAVLESPVVVLDA
FT                   DTDAGLIDTLIARLHTALAALAPEARGTPVLVRGTFGPDAGAIGAATLPMFFNFSPRAG
FT                   ILRGAGVDSQEARYAAF"
FT   gene            complement(254863..255231)
FT                   /locus_tag="BURPS668_A0288"
FT   CDS_pept        complement(254863..255231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86389"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG23"
FT                   /protein_id="ABN86389.1"
FT                   /translation="MMTPRMRWIALAAATLLGAAAAGWRVRPPAARDAAPAAAPALAPA
FT                   APASDRARAAPPALTPAPAYAPPSRPLAKALPPMKVKPGGTSWNPDPATKPAPVEAQRG
FT                   GPDIAGAQPLRPPPSASP"
FT   gene            complement(255228..257876)
FT                   /locus_tag="BURPS668_A0289"
FT   CDS_pept        complement(255228..257876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0289"
FT                   /product="glycosyl hydrolase, family 15"
FT                   /note="identified by match to protein family HMM PF00686;
FT                   match to protein family HMM PF00723; match to protein
FT                   family HMM PF09137"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85404"
FT                   /db_xref="GOA:A3NG24"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015220"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG24"
FT                   /protein_id="ABN85404.1"
FT                   /translation="MSARHFGFRQAVLVGSLAALAGAAALPANTSAAAEAFGSPGAAPV
FT                   RGPAAKSFLGTAVNGASRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEE
FT                   KQQAYSAAQTDTRTMSWQVTTGNSSHNWQIRKIVFADPNHNAIVQRVTFTALNGRKVGD
FT                   FNLYMLSKPYLDNAGANNTAQTVSGSGGTALVANHNSRYSALVASRPWKVVNGVGMTSN
FT                   GFVGQSDGWTDLLGGTADKTMDWTFSSATNGNAAQMGWLDLGDPSATSVSFDVVLGFGG
FT                   TQDQALGDANTVLGSDLAGEQQQYDTGWHNYAAGLSSQNGAADDGYYLAAMTLKTMQDK
FT                   SNGAMIAGIGTPWGETQGDANAGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNT
FT                   LQQTTDCGTAEYNAPGCAQGYSRVGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGP
FT                   SVFNPLWPKIKLTADYIVNTGPWTYQERWEENAGYSPSTIAAEIAGLVTAADIATQNGD
FT                   TASAARYLAAADYWQENVAAWTYTSSGAFGNGSYYIRINPAGRAGTGTDRASFAPTAGP
FT                   DTPQTLSVKNGGGSHDARRVVDGGFFELVRMGVKRATDPTIANTISVYDSVLGQTLNVA
FT                   NAPALSPNAWFRYNFDGYGEHNDGGDFDGTGAGRLWPIFTAERGMVEIARQGSGGAGSA
FT                   YFSTLKQLTTPEGFVPEQVWSNSTTLPDGWAVTTPAGYTPGQPTKSMAPLNWAMGEYIS
FT                   LLASIQAGRIVDVPSVVCARYNNCAAPPQSGQVPVAVNVNASTQLGQQMYVTGNVAALG
FT                   NWNTDLGIPVDPASYPVWRNTVNLPAAQAIQYKYYRKNADGSVTWENRSGNRQLQTPAS
FT                   GTLALNDQVSW"
FT   gene            complement(257942..258742)
FT                   /locus_tag="BURPS668_A0290"
FT   CDS_pept        complement(257942..258742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87772"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG25"
FT                   /protein_id="ABN87772.1"
FT                   /translation="MTRGGALHGRRIGVTPRRAGPAGRPTSPNTIQYRRAPPDTAASPR
FT                   SPPPIAARSGPEPRPAPPHPADDTPRSRPTHRPRAPRSALRAPSSELLASSSELRTPNS
FT                   ELRTPSPELRAPNSELRTPNSEPRTPSPEPRTPNSELRTPNSELRAPSPEPRAPSPELR
FT                   TPHSRPAAWTQTRNPRRRHRHGQHVARLVRDAHRLSHALARDRESSLAAGPRRANGSSA
FT                   SAPPAPADSPIPCAAPPSLPRRTDVVSIHSRLQIIENIDSFDFA"
FT   gene            complement(258739..260136)
FT                   /locus_tag="BURPS668_A0291"
FT   CDS_pept        complement(258739..260136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0291"
FT                   /product="DEAD/DEAH box helicase/dbpA RNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF03880"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87516"
FT                   /db_xref="GOA:A3NG26"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG26"
FT                   /protein_id="ABN87516.1"
FT                   /translation="MTYPPTATPFSALALTPATLANLAQLGYTDMTPIQAASLPIALAG
FT                   HDLIAQAKTGSGKTAAFSLALLARIDARRFDVQALVLCPTRELADQVAQEIRRLARAEE
FT                   NVKVLTLCGGTPMRPQTQSLEHGAHIIVGTPGRIMDHLDRGHLTLDALNTLVLDEADRM
FT                   LDMGFFDDIAKVARQCPPTRQTLLFSATYPDGIAKLSQQFLRHPKRVKLEERHDDSKIR
FT                   QRFYEVTEDERLHAVGLLLNHYRPVSTIAFCNTKQQCRDLLDVLHAQGFHALALHGELE
FT                   QRERDQVLIRFANRSCSVLVATDVAARGLDIAQLEAVINVDVTPDPEVYVHRIGRTGRA
FT                   DQDGWALSLASMNEMGRVGGIEQALAREVEWHPLAELKAGGDAPLLPPMETLQILGGRK
FT                   DKIRPGDVLGALTGDAGFSGAQIGKINVTEFSTYVAVERGIARDALRKLNAGKIKGKRV
FT                   KVRLMDE"
FT   gene            complement(260133..260285)
FT                   /locus_tag="BURPS668_A0292"
FT   CDS_pept        complement(260133..260285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0292"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88217"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG27"
FT                   /protein_id="ABN88217.1"
FT                   /translation="MRAYRSHAAAPSRVRGAGAACRASDLHGRFVKGMYDTLLCHPSTD
FT                   PSSTP"
FT   gene            complement(260330..260959)
FT                   /locus_tag="BURPS668_A0293"
FT   CDS_pept        complement(260330..260959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0293"
FT                   /product="outer membrane porin OpcP"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86048"
FT                   /db_xref="GOA:A3NG28"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG28"
FT                   /protein_id="ABN86048.1"
FT                   /translation="MAGGFANDRLYGAALQYQRGGLTVGASYPTMNRARSADAAGAVTG
FT                   DNTFDASSQQNLGIGATYAFSKALIGFAYSHVDVYDPTSNAYFTGTTRPAGGHWQSWKF
FT                   DHFEINGRYRVTPAFYAGAAYTYTQARVDSTADAFHPKWRPLSTKLDYDLSKRSSGFAE
FT                   GVYQHAQHAMNARTGTGFDHAYIPGAANIASGPNQYVVRLALLHPF"
FT   gene            complement(260994..262307)
FT                   /locus_tag="BURPS668_A0294"
FT   CDS_pept        complement(260994..262307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0294"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86817"
FT                   /db_xref="GOA:A3NG29"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG29"
FT                   /protein_id="ABN86817.1"
FT                   /translation="METSALNFAGAPADARAAAKKRRLIAAAAVGNALEFYDFTVYSFF
FT                   AILIGKLFFPVHSPFGQLMLAVASFGVGFVTRPLGGLVIGVYADRAGRKRAMIATLLIM
FT                   ALGTATIAVAPTYAQIGIAAPLLLVAARLLQGFASGGEVGASTTLLIEQAPQARRGFYA
FT                   SFQFSSQGLAALAGALTGVLLTSTLSAAQLESWGWRVPFVIGTLFAPLGYWLRRTVDEA
FT                   PAPASAPRGDAAPMPLADVLRHHGKAVFAGLGITIGGTSIHYIIVFYMAIYGVQVLHLP
FT                   SWLSMSAGCIAGAILAVVTPIGGHLSDRYGRNRIVWWTRVALMLAIYPAFVALNRWPGA
FT                   ASLLSIIAALASVHAINIGATGAMLGELFPRPVRATGGALVYSVGVAIFGGFAQFFVTW
FT                   LIAATGNANAPAWYAIGCGALTLAALGSMDDKAGKPLD"
FT   gene            complement(262348..263538)
FT                   /locus_tag="BURPS668_A0295"
FT   CDS_pept        complement(262348..263538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0295"
FT                   /product="metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85975"
FT                   /db_xref="GOA:A3NG30"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG30"
FT                   /protein_id="ABN85975.1"
FT                   /translation="MHSAPSEHPVIPGIAAIAPELIDVRRRIHAHPELAFEETLTSDLV
FT                   AGLLAGWGYDVHRGLGKTGLVGVLREGQGARTLGLRADMDALPIAEATGLPYASRRANK
FT                   MHACGHDGHTAMLLCAARHLAATRRFSGTLNLIFQPAEENFGGAKAMMDDGLFERFPCD
FT                   AIFAIHNMPGRAAGDMAFRTGAAMASSDRVTITLRGVGGHGAMPHFARDPMSAAGSIIV
FT                   ALQTIVAREIDAQQSAVITVGSVQAGETFNVIPETVVMKLSVRALNADVRALLAQRIEA
FT                   LAKGQAQSFGIEADVQYDYGYPVLVNHDEPTAFAIDVARRMLGEARVEAQTAPLMGSED
FT                   FAYMLEARPGCYAFIGNGVGSKGGCMVHNPGYDFNDDILAIGASYWVRLAEAWLAA"
FT   gene            263718..264620
FT                   /locus_tag="BURPS668_A0296"
FT   CDS_pept        263718..264620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0296"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86899"
FT                   /db_xref="GOA:A3NG31"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG31"
FT                   /protein_id="ABN86899.1"
FT                   /translation="MKYHQLKAFVAVADEGSIRAAARRLNVSPAALTKAVKELELALGV
FT                   SLVVRTARGVQLTRFGQQLQVRASLIVAEMQRARDDIEQAQGATTGAVAAAITPAAAVT
FT                   ILPDAFRAFRRRFPLARVSIVEGFPGVALPKLHDGSLDFAVSVVVPELLAAEFEHAQLY
FT                   ASRHVIVARNAHPLAAATSLADLVDADWLMNPSPESSTQLMFNCFAEHGLPAPTRVVEC
FT                   PSYAIAHSLIQGSDLIASMPEQLLGVEWSRDRIAVLPIREALPAASVQVVTRRDSPLTP
FT                   AAAMLVDCMRDAARRHGLR"
FT   gene            complement(264948..265757)
FT                   /locus_tag="BURPS668_A0297"
FT   CDS_pept        complement(264948..265757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0297"
FT                   /product="ABC-type phosphate/phosphonate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87817"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG32"
FT                   /protein_id="ABN87817.1"
FT                   /translation="MYNVTPRHAALWRSLLRDALHAFARAGGPADVTLLGEPSGEPDGE
FT                   LLPLWRRGDLLLSQTCGYPYRMLGVGDAVHLIATPVFDAAGCDGPRYCSMLAVSAGAHA
FT                   RGATTLAACRGLRAACNGDDSHSGMNALRHAIAPHARGGRFFSAVTRTGSHLSALRALD
FT                   AGAADLAAIDCVTLAYVRDALPARLRRVRIIGATAAAPGLPFIASRALAGEHVGALRDA
FT                   LDAAVAIDAERARALRLRGFARLAPDAYAEIERFEREAVALGYPALA"
FT   gene            complement(265781..265981)
FT                   /locus_tag="BURPS668_A0298"
FT   CDS_pept        complement(265781..265981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0298"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85449"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG33"
FT                   /protein_id="ABN85449.1"
FT                   /translation="MHRNQSRRPDQPMDSHLLMRRGERSMWRNRKRRGAAVPPGAAGRR
FT                   GVRGVRQAARARCPEIRRMAA"
FT   gene            266021..267100
FT                   /locus_tag="BURPS668_A0299"
FT   CDS_pept        266021..267100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0299"
FT                   /product="fatty acid desaturase domain protein"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86362"
FT                   /db_xref="GOA:A3NG34"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG34"
FT                   /protein_id="ABN86362.1"
FT                   /translation="MCLSTFGFHPHRNMAEYFDVDHAREIAALGERFAARTEWPTWLLI
FT                   FVVYGGWLGVLLGVRAGQLPLAAATPLLIALCAWHMSLQHELLHGHPTRSARVNKLLGY
FT                   PPLAVWYPYTLYRDTHLEHHRDEDLTAPGIDPESNYVPLAQWMRLPRWRRALWRARKCF
FT                   VGRLVVGPPASVAAMGAATLRAWHGGDWRDAPMWAAHAVSVVALLTWLHGSIGVPWWYY
FT                   LLAITWPAQSLAMIRSLYEHRAAEHPKARIAINEAGLAMRMLYLNNNYHLVHHDLPKLP
FT                   WYQLPRAYRMRRDAYARKCGGFVIRGGYWELLKRHAWRVTDSPVHPFAGRGASDRVSGG
FT                   GATPGARVAVIEDCVQIGG"
FT   gene            267592..268032
FT                   /locus_tag="BURPS668_A0303"
FT   CDS_pept        267592..268032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0303"
FT                   /product="putative surface antigen"
FT                   /note="identified by match to protein family HMM PF05433"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88502"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG37"
FT                   /protein_id="ABN88502.1"
FT                   /translation="MSKKLIQIMAVAALSAAASLPAFAGDMNNALGGALGGVAGAAVGG
FT                   AVGGSTGAVIGGAVGGGAGGAVTSNRRERTGAIIGGALGGGAGTAAGNAMGGRGGGLIG
FT                   AAVGGGAGAALGGNISRSNSYNDDYDRGYRRGKHHGKHHHRH"
FT   gene            complement(268020..268484)
FT                   /locus_tag="BURPS668_A0302"
FT   CDS_pept        complement(268020..268484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86499"
FT                   /db_xref="GOA:A3NG38"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG38"
FT                   /protein_id="ABN86499.1"
FT                   /translation="MRLAACGLRLAASACGLRLRLAACGFGFGFGFGFGFGFGFGGKSS
FT                   VKRVRYRRSAARRHASGNWPSRRRPVHSPSIPAHSPRIGGTRRASRGPCFHGAAPGTTG
FT                   IVRDARGPTPVARRAAETGPARAETGIMRSVAREPEPDEAGRARRADQWR"
FT   gene            complement(268692..269591)
FT                   /locus_tag="BURPS668_A0304"
FT   CDS_pept        complement(268692..269591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0304"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 3"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87819"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG39"
FT                   /protein_id="ABN87819.1"
FT                   /translation="MMKPLRPLLSIAVGCALAAAAHADDAGPTLKKIRDTGVVTLGVRE
FT                   SSVPFSYYDQQQRTIGYSQEIALKIVDEIKKTLNRPNLTVREIPITSQNRIPLVQNGTV
FT                   DLECGSTTHTKERANQVSFSNSIFQYGMRLIVKKSSGVKDFPDLAGKTVATTAGTTEER
FT                   LLRQWNAEKGMAMQIISAKDHADAFLNVKSGRAVAFFMDEPLLYGAKAKEANPGDYVIT
FT                   GNSPVSEAYGCMLRKDDPGFKQLADRVIARMQRSGEAEALYVKWFNRPIPPKGVNLDYP
FT                   LSADMKQLFANPNDKALD"
FT   gene            complement(269754..271001)
FT                   /locus_tag="BURPS668_A0305"
FT   CDS_pept        complement(269754..271001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0305"
FT                   /product="putative D-amino acid dehydrogenase 2, small
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86560"
FT                   /db_xref="GOA:A3NG40"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG40"
FT                   /protein_id="ABN86560.1"
FT                   /translation="MRICVLGAGVVGLTSAYCLAREGHDVTVLEARPDAVLDASFANGG
FT                   QLSYSYVAPLADPAVLGKLPAWLARRDSALRFVPRLDVDQWLWCAAFLAACRTARARRT
FT                   AAEMLELGALSRIALHALVERETLDFDYARNGKLVVYRDRREFDRARRAMDHLIAAGAR
FT                   QQALDTAACVALEPALAPASGLLAGGIHTPSEEVGDCRRFGIELARVLRERLRVAIHYE
FT                   TPVDTLRTEGATIVAARTPRGEIAADAFVLSAGNGSAPMLRRLGMRLPIYPLTGYSLTL
FT                   PARHDATPRVSVTDLHRKIVYAPLGARLRIAGMVEIAGLRSSGAARRLALLAQQAQEIF
FT                   PHAGDYAHGETWCGHRPATPDGKPLIGATPFRNLWLNTGHGALGFTLACGSARVLADLI
FT                   AGRPPALDTRAYALHR"
FT   gene            271017..271133
FT                   /locus_tag="BURPS668_A0306"
FT   CDS_pept        271017..271133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0306"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87621"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG41"
FT                   /protein_id="ABN87621.1"
FT                   /translation="MKKLSRGPGGRCELERPLVLPTETTAASEQMYRPITLG"
FT   gene            complement(271154..272086)
FT                   /locus_tag="BURPS668_A0307"
FT   CDS_pept        complement(271154..272086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0307"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88002"
FT                   /db_xref="GOA:A3NG42"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG42"
FT                   /protein_id="ABN88002.1"
FT                   /translation="MRLRHIEVFHAIMRTGSLSKAAQLLCVSQPAVSKVLAHAEQNLGI
FT                   RLFSRAHGRLLPTREAELLFGETQKLQSSLERIRALARNLALQPEGQLRVGCLPSLGLS
FT                   LIPQAVKAFRDDYPRVALKIQTLHTDALLNALLTRDLDVAVAIDPPARPGITSAELGRT
FT                   AVVSVGPPDDDAPDAPLSLHAFMEGESIGIGTEDPLGDAIGNALEAFGEDRVTMVEAHT
FT                   WYVARALAARGVGRVLLDELTARAPGEPVTIRPIEPALSVGVFALWRDGGLDSHAGATF
FT                   VDALRAPFGEPSGKPPSMRAPGAPKRRAR"
FT   gene            complement(272126..272497)
FT                   /locus_tag="BURPS668_A0308"
FT   CDS_pept        complement(272126..272497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85606"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG43"
FT                   /protein_id="ABN85606.1"
FT                   /translation="MRAGRRSVGDRSAIAGRYSTCRAVRVESVAPIPADRIVHAPHRRD
FT                   AFPVHFSRSLLRHASSIRSFDTLLQDASSARFVEALARSAPRAPIPSRGPPPNGAPAAP
FT                   AASQPPSGPDRIAIGRDTR"
FT   gene            complement(272625..273365)
FT                   /locus_tag="BURPS668_A0309"
FT   CDS_pept        complement(272625..273365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0309"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87797"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG44"
FT                   /protein_id="ABN87797.1"
FT                   /translation="MPAVRAIVTGHTRGLGEALAEQLLRRDIAVLGLSRGRHPSLASHA
FT                   PERLVEAELDLSEPARVQAWLGGDTLGAFVAGASRVLLFNNAGTVEPIGPLDTQDTAAI
FT                   ARAVGLNVATPLMLASALAKLAPDALERRIAHISSGAARNAYAGWSVYCATKAALDHHA
FT                   RAVALDANRALRICSVAPGVVDTGMQATIRATSDERLPSRERFAQLKSSGALSTPDDAA
FT                   RQLIDYVLSDDFGSTPTADIRHLG"
FT   gene            273379..273669
FT                   /locus_tag="BURPS668_A0311"
FT   CDS_pept        273379..273669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88484"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG45"
FT                   /protein_id="ABN88484.1"
FT                   /translation="MVMSMRKVMETGCVTRAARHPAKPGGRFARRAAGRRGQADDRRAC
FT                   GARCDERASRYPNVDAGLAQTAIHGIFFRARLSSIKSRAIFDEFLHDMIAC"
FT   gene            complement(273666..273785)
FT                   /locus_tag="BURPS668_A0310"
FT   CDS_pept        complement(273666..273785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0310"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86876"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG46"
FT                   /protein_id="ABN86876.1"
FT                   /translation="MRKSGRGAAPFGGLPHRPTDAPNRFLFVFGISSTVRNQG"
FT   gene            273809..274174
FT                   /locus_tag="BURPS668_A0312"
FT   CDS_pept        273809..274174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87376"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG47"
FT                   /protein_id="ABN87376.1"
FT                   /translation="MEPITQAFAQQFSREWIDAWNAHDLDRVLSHYADAFEMSSPMIVQ
FT                   IAGEPSGRLCGKDQVGAYWLTALRMIPALHFEWIATLAGVDSVAIHYRGANGRLALEVF
FT                   HFGPDRRVVKAFAHYAE"
FT   gene            274263..274385
FT                   /locus_tag="BURPS668_A0313"
FT   CDS_pept        274263..274385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86425"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG48"
FT                   /protein_id="ABN86425.1"
FT                   /translation="MRHRSKFINTFNGMPNGMLNAPAVAFRMNGVVRRIVSHRR"
FT   gene            274616..276532
FT                   /locus_tag="BURPS668_A0314"
FT   CDS_pept        274616..276532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85882"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG49"
FT                   /protein_id="ABN85882.1"
FT                   /translation="MVRKRIRAVFAAALVGLAAHAAHAQYTTDWIANTYGTIASHVGNN
FT                   ARSMWVSPEGVIYTASFWDENAGGVAIYQNGKTLGSIGTHAEFQGGAITGNATSIFAAM
FT                   QYSTPQGSGTVGRYNRATLQRDLTIPVSVWNAVSRADVITGLATAGTLLYASDYFGNRV
FT                   RVFTTEGVWQRDIGIANPGALALDDAGNLWVAQKNAAKIVEFSPTGALMNTIQMASASR
FT                   PASLYFDASKRQLMIGDQGPDMNVKLYAIAGMPKQVGTFGVQGGYLDTTTGIRGQVGDR
FT                   RFTRVVGIGKDAAGTLYVLNNPWGGGWDLGRNGATDIHAYDALGNALWKLQALNFEAIA
FT                   APDPTTDGALFYSGMNVYSGTAGGTFVANTVDPFTYPSDPRLDMNDYQRGQHFGQLVSV
FT                   GGHKILVASGQNPGNFNFYHFNAASGYIAIPDASLPGKGFNTSLQVTAGFSIDNKGDVW
FT                   AGLNGTNAISHYPLAGIDASGKPSWGAPTSIPTPASVQPTTRILYLSDSDTMILAQGIA
FT                   GSWDWTAMNGRIEVYHGWSAGNVTQPNPVIALTSPNPKSIASAGNYLFVGYVHTVPNID
FT                   VFDLNTGQLVATLTNSNTGMMDVGNDVDSMYGLRAYLRSTGEYVITKDNYNGSSIVVYR
FT                   WRP"
FT   gene            276744..279704
FT                   /locus_tag="BURPS668_A0315"
FT   CDS_pept        276744..279704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0315"
FT                   /product="putative alpha-1,2-mannosidase"
FT                   /note="identified by match to protein family HMM PF07971;
FT                   match to protein family HMM TIGR01180"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86992"
FT                   /db_xref="GOA:A3NG50"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG50"
FT                   /protein_id="ABN86992.1"
FT                   /translation="MAVDAPSTVPLACEAQEPETIMNRFVRLGAAMAVACALAACGGDD
FT                   GGPAVAASSFAAAGASGAAAGVADTAQADGAPRTGSLTQYVDPLIGTLASNSPNPVPAG
FT                   QAGSVVPAAGLPSGMIQWAPDTNTTPAPADSKEPGSPAGYYYDLNAIQGFSVTHMSGAG
FT                   CAGNNGEFPVMPTTDATKLAPTFSHANETAKPGYYSVLLDSQIKVELTATLRTGFGRFA
FT                   YPAGKPALLVIDATRTNTKTSTSGAITRVSANAISGSTVGGGFCGNSVPVPVYFYAAFD
FT                   RPFAPASSISRGVAKLAFDSGATVQMKIGISYVSVDNAKANLDAENRAWDFDGVRALAD
FT                   AAWNDRLGAIRVSSSDADALKKFYTAFYHALWAPSVFSDVNGQYIGFDKQVHTVAKGQA
FT                   AQYSSFSGWDVYRSLIQLKAVLFPRETSDMIQSLVNDADQCGAIPHWVNDNVEDGVMPG
FT                   DAGSLMVSSAYAFGAREFDARGALAHMIRMANIPGTACAGVTTNGGRASYLQTGYITSG
FT                   EWGIASSTLEYTSSDFAISRFALALGDTATQKMLLGRSAYWQNLLNASLNPPLIAARQS
FT                   NGAWIAETPGSTDNYVEGNAEQYTWMVPYDPAGLFAQLGGNQAVVPRLDKFFTVLNAGM
FT                   SLPNFYMGNEPTFEVPWLYNWAGSPSGTQRVVRQIMQTAFSTKPDGLPGNDDLGAVSGW
FT                   YVWAALGLYPQVPGVAGFAIGSPQFDAIDVRLGSGRMLKIRAPGAPASGYVQSVAVNGR
FT                   AQASPWIALDALVGGAVMHFKMGGAPSQWGAGEAPPSFGVPVARDVADSFNNRGISADG
FT                   ATNADGQGADFDGSLFSYSANALAQAGVRPGAPFTYGGASFVLGGASSLDNAVAVGQTV
FT                   MLPPGSVGTSVVVLGASNNGPSAGVARVSFADGTSAQVTLSFDDWTLNGGSTGATSAIA
FT                   VTSAYRNAGNGQKDNVKTYIFAQKIPVPAGKVVTSVTLPRQVSAGKMHVFGIGVAA"
FT   gene            complement(279770..280048)
FT                   /locus_tag="BURPS668_A0316"
FT   CDS_pept        complement(279770..280048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0316"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86472"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG51"
FT                   /protein_id="ABN86472.1"
FT                   /translation="MRAASWQANRETRLFYFCLLSRDSITNSKFRNKIENSRRIKSFSG
FT                   RLKYPGARRNEKRRGGLPRAPPLHARAWRARMSGRRRETMRGGAPRL"
FT   gene            complement(280167..280304)
FT                   /locus_tag="BURPS668_A0317"
FT   CDS_pept        complement(280167..280304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0317"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85703"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG52"
FT                   /protein_id="ABN85703.1"
FT                   /translation="MNFDLAYQGLMARLDSIFPVNPEKYELIEITVRRIHLHGELKNRF
FT                   "
FT   gene            280303..281361
FT                   /gene="pvcA"
FT                   /locus_tag="BURPS668_A0318"
FT   CDS_pept        280303..281361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pvcA"
FT                   /locus_tag="BURPS668_A0318"
FT                   /product="pyoverdine chromophore biosynthetic protein PvcA"
FT                   /note="identified by match to protein family HMM PF05141"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87870"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="InterPro:IPR017133"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG53"
FT                   /protein_id="ABN87870.1"
FT                   /translation="MKCDRNDEIALAILGEILGIHRRYPEYTTDSDIRHEIEQIHAVQL
FT                   PRIRAFVDAARPVEFVLPAFPSKSPNPNKVLGRLPDMAEQLSLTFLNDLCERISGFYAP
FT                   GAKLTICSDGRVFGDLIRVDDRDITAYQHALGQLIAALRADRLSTYNLENFEAFAQRAA
FT                   NFDDMRRRLVDEFADPIEAIRHRLMADEEGTLLYRAMTRFMFEDGFTPDYRGSKAALQK
FT                   DSKTRALGVIQRSWAWGALLATRFPDAIRLSIHPQPAASLKIGVHMMPTRDNWLTPWHG
FT                   VAVDLGDQFALMKRRDVELLGGRVVMRGGRPSHYAIERWRVAGDALAPLAGGGARPRAD
FT                   AGGALVISGEAV"
FT   gene            281358..282272
FT                   /gene="pvcB"
FT                   /locus_tag="BURPS668_A0319"
FT   CDS_pept        281358..282272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pvcB"
FT                   /locus_tag="BURPS668_A0319"
FT                   /product="pyoverdine biosynthesis protein PvcB"
FT                   /note="identified by match to protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85844"
FT                   /db_xref="GOA:A3NG54"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG54"
FT                   /protein_id="ABN85844.1"
FT                   /translation="MNDLFLQRAVSLEPLTSDAGAPCSFGVLVKPRRARTHVGELSIEW
FT                   LRALVRSQQLVVLRGFDSFADAPGMTRYCAAFGEIMMWPFGAVLELREQANPVDHVFAS
FT                   SYVPLHWDGMYLETVPEFQVFQCVQAIGDAHGGRTTFSSTTEALRVATPETRALWHRAH
FT                   GRYRRTVELYSNTVEAPIVERHPRREFPILRFCEPPIADDPTFINPSSYTFGGIADSER
FT                   DALLGSLTRALYDPRAHYAHRWRTGDVVLTDNFTLLHGRERFTSRSGRHLRRVHIHGDP
FT                   PLRNPHLSKHPHDAAAADAAASA"
FT   gene            282298..283782
FT                   /gene="pvcC"
FT                   /locus_tag="BURPS668_A0320"
FT   CDS_pept        282298..283782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pvcC"
FT                   /locus_tag="BURPS668_A0320"
FT                   /product="chromophore biosynthetic protein PvcC"
FT                   /EC_number="1.14.14.-"
FT                   /note="identified by match to protein family HMM PF03241"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88431"
FT                   /db_xref="GOA:A3NG55"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024677"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG55"
FT                   /protein_id="ABN88431.1"
FT                   /translation="MTLMTGNDYLDSLRDGRNVYVGGERIADVASHRAFRNAARSIASL
FT                   YDALHGEHRERLTAPDRHGQITHRFFKPSESPDDLLAAQDAIELWSRMTYGFMGRTPDY
FT                   KAAFMSGLEAGAGYYGDFRQNAAGWYKRFAGSGLYLNHAIINPPLDRGKAIHDMRDVFV
FT                   RVVGETDRGIVVSGVKMLATAGALTNATFVAPVASALLEPGKADDFAIVFFARMDNPGL
FT                   SLMCRPSYEAAATSPFDAPLSSRFDENDSVLIFDRALIPWEDVLVYRDVKRATGFYAAS
FT                   GFANLYNFQSGIRLAVKLELMIGLLSLGTQANGTQSFRGIQAALGELISLQHLLKTITA
FT                   AMARDPERTPSGVVVPKLQYASALRIQVPQIWKRVRELMETALGGSPLVTVSGAADLLD
FT                   PRVKGLIDAYYRGAALEPQQRIKLFKLIWDATGSEFGSRHSVYETHYSGNFDQIRLDSL
FT                   TWATRSGQLADCEAFARQCMGDYDASGWLRGPWLHG"
FT   gene            283828..285696
FT                   /gene="asnB"
FT                   /locus_tag="BURPS668_A0321"
FT   CDS_pept        283828..285696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="BURPS668_A0321"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF00733; match to protein
FT                   family HMM TIGR01536"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86944"
FT                   /db_xref="GOA:A3NG56"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG56"
FT                   /protein_id="ABN86944.1"
FT                   /translation="MCGITGWIDFARDLRNEAPIVDTMTDTLARRGPDARGVWLDTHAA
FT                   LGHRRLSIIDPERGAQPMLTPERGPRGLPRAVISYAGETYNFRELRAELGALGHRFDTH
FT                   CDTEVVLRAYLEWGAAFVDRLNGMYSIAIWDTARDELLLVRDRLGVKPLFYYPTADGVI
FT                   FGSEPKAILAHPDVRARTSSEGLCDALLFLRTPGQVPFSGMREVKPGHVLRVRRGGLAE
FT                   QRYWALEARPHTDDLPTTIATIRALLDDIVSRQMISDVPLCALLSGGVDSSTIAALAQK
FT                   RRRASGGGALSTFCVDFTGHMRNFRADPIRPTADAPFALEVARHIGSDHHTIELDQAGL
FT                   LDPQVREAVLRAWDLPFNFADLDVSLHRLFAEVRKHATVALSGEAADEIFGGYLWFSDP
FT                   AARRAHTFPWLKLGAHRGLDPRALFHRSFIDALRLGEYEAQLYRAALAEVPRLDGENAE
FT                   DRRTRELHYLTLTRWLPVLLDKKDRMGMASGLEGRVPFCDHRLVEYVFNIPWAMKTFSG
FT                   QEKALLRAAAADLLPESVLNRKKAAYPSIQAPGYDRGLIERLNRAIAAGRAPLEPFIDA
FT                   GALRGLTEKTAAGSLSEFERILLESSSRLNDWLDLYRVELDGVPAG"
FT   gene            285701..286696
FT                   /locus_tag="BURPS668_A0322"
FT   CDS_pept        285701..286696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0322"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85928"
FT                   /db_xref="GOA:A3NG57"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG57"
FT                   /protein_id="ABN85928.1"
FT                   /translation="MTNIWSELMQAIEIRETGGPDVLDYVTRAAREPGRGELLVELAAA
FT                   GVNFIDLYRREGRYPMPLPGTPGEEGAGRVLAVGPDVTRFKPGDRVAWTTVMGSYATRV
FT                   VVPEDKAIAVPDGIDLRTAAAALVQGMTAHYLVNDSYRAREGDVVLVHAAAGGVGLLLT
FT                   QWLKRRGVRVIGTVSTAGKAALARSNGADDVVLHGAFDDLAAEVRRLTDGRGVHAVYDG
FT                   IGAATFDASLASLRTRGTLVIFGGASGPVPPVDVMRLLWGGSLTLTRPYLEHFRASVDE
FT                   FLWRAGAVFDGILDGSLKIRIGGAYPLADARRAHADLAARRTTGKLLLVP"
FT   gene            286751..287677
FT                   /locus_tag="BURPS668_A0323"
FT   CDS_pept        286751..287677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0323"
FT                   /product="aromatic ring-opening dioxygenase"
FT                   /note="identified by match to protein family HMM PF02900"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85501"
FT                   /db_xref="GOA:A3NG58"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011984"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG58"
FT                   /protein_id="ABN85501.1"
FT                   /translation="MGKIVGAGLISHAPVVMMPQAVRLRENGGRDFTLATGLARLRRDV
FT                   FDAHDYDTVLVFDSHWLTTTEAVVTAHARRAGRFTSDEMPNAIRQLPYDLAGDPALAHA
FT                   IAEQARRRASWIDAVDDPCLPLHYATLNPWTYLGRPDKRWLSVSVCQTATTEDFLRMGE
FT                   TVAQAIAQLERKVLLVASGGLSHAFWPLAELRGRMAGAASNIVTPAARAADERRIAWLE
FT                   QGRHDRVIDAMPEFLRFAPEANFGHYLMMAGALGARACAARARRFSEYENGIGTGHVHL
FT                   WFSPADGGWARAETHNERRTETDAASA"
FT   gene            complement(287920..288882)
FT                   /locus_tag="BURPS668_A0324"
FT   CDS_pept        complement(287920..288882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0324"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87838"
FT                   /db_xref="GOA:A3NG59"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG59"
FT                   /protein_id="ABN87838.1"
FT                   /translation="MTVLEVGNMSEVGIRNLNHLRVFMAIVEKGSFTAAAECLSMSKSL
FT                   VSEYLSRLEAEIDTQLVMRSTRRIAPTDAGNKLYCASQAFVSGLYDVIGSIRCLRHEST
FT                   GLLRVAAPSGFSTTHLSSIAATFIHQHPQIELEIVCNDDEIDLVGERVDLAFETGWPKK
FT                   KGFRMKMLGAFDQVLVASPEYSRRHAVPRHPDDLPGSHWIGHGGLANLSYSVFGNEGRS
FT                   VRIQTPGRLKVKSVLLAHQMALAGAGISAFPDYLVAEDLREGRLHRLLPTWTMPKGGIY
FT                   AFRTAPRQASVRERLFLAAVQAYLAGLCGERARAGAVPT"
FT   gene            288930..289268
FT                   /locus_tag="BURPS668_A0325"
FT   CDS_pept        288930..289268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0325"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88103"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG60"
FT                   /protein_id="ABN88103.1"
FT                   /translation="MSRGRCIAIRRHEPGAGYGSGRWLLRRMREGRRSVSWAGATSGGR
FT                   ERARRGSLPPARGLGVRRRRCGGRRLRFASHARAAQAGPGGPVRVAAPVLHARQPVHRQ
FT                   RNAMRRQS"
FT   gene            289885..290031
FT                   /locus_tag="BURPS668_A0326"
FT   CDS_pept        289885..290031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0326"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87408"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG61"
FT                   /protein_id="ABN87408.1"
FT                   /translation="MRPARRRRRRVRAQGMRMPPGRSKSSGVMVWGKAACITIDGAAVA
FT                   RAP"
FT   gene            complement(290104..294180)
FT                   /locus_tag="BURPS668_A0327"
FT   CDS_pept        complement(290104..294180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0327"
FT                   /product="ImcF/SciS family protein"
FT                   /note="identified by match to protein family HMM PF06744;
FT                   match to protein family HMM PF06761; match to protein
FT                   family HMM TIGR03348"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86648"
FT                   /db_xref="GOA:A3NG62"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG62"
FT                   /protein_id="ABN86648.1"
FT                   /translation="MNKVLSFLVSRSFIAFVALLAVALVIWFVGPFVAFGGLTPLAGAG
FT                   MRVLAIALLLAGVLLWLAGRPTSIVFVALLCVLIWHASPLLAFGGATPFAPEAVRAIAI
FT                   ALVLAAFALHLAFRLLQKARTDPDFLKSLLEFGGKQPESPAAGRLVAVNAAIAGAIARL
FT                   KGMRSGARGLRRLLRGKRYLYELPWYVTLGSRACGKTSALLNAGLSFPVAAQMPRAAAG
FT                   LPDHGGSVDWWLTNDAVLIDTAGHYTRHGTSAHAAPLPPAGPAPHAQPADAAADARRAN
FT                   GQPAGERHAVAMAAAAPSSAAFVDERQAQWRQTVDQAEWLGFLRTLRKHRPREPINGAL
FT                   LAVDVATLTSADDNARHAEAAALRARLADLRAQLGVRFPVYLIVTKTDQLPGFAEYFSA
FT                   LTTEGRAQTWGFTLPYDKETIADEGVHARCADELRALAARLAAGVNTRLQEEHDTQRRR
FT                   RLAALPEEFLVLTRPLGELIDRVFADSRYDDTQHHATLRGVYFTSAAQTGGEAAAETRT
FT                   VARRLAAATGRAPAAAARAAQQETSQSFFLHDLLTKIVIPDARLVQPNLRWEYRSRTLS
FT                   LAAHALALLLFAWVAIGLRVSMGNNDAYLDALARKTAALASRVDQLYKAPKPEAVPDVL
FT                   TQARSLSAYPGLDLSAPGSGWRFGLYTPPGIVAESSRTYDALEDTLLLPRIVTRIEAVL
FT                   SQAIADRDPKAAYDALRVYLMLYDRARFDAAQVEAWVLDDWARTDSAAVFGGRASMIAH
FT                   VEQLFRGERIVQSPLIRNDALIRQARAFLDGSNATERLYERAKAAMNKEAPDEFTLLRA
FT                   VGPQAGTVFTRASGAPLARGVPGLFTFDGYRRVFDKRLAEFVRTAREDDAWVMGRAYLG
FT                   DAQKKTAEIANALAGADDPLTDAIRRQYLIEYAQQWDAFLGDIRTIGGTSLAFDLVVLR
FT                   SFAAPDSPLERLARAAVHETTLAQPEASADRSFLQKASAQLSQQADKALGVRAQERVER
FT                   ELVDNRFAGLREMVTGRADTQTDARPGAPAGKSGLDAVANLLNDYYTALTVSDDALANN
FT                   SMPPANDTAAKLKMAAQTMPAPFRSVLTGLAAQGSREVNRGIGQLLSRQLQATVGDVCR
FT                   LAIEGNYPFAPDSKRDVGIEDFTRVFAQGGVIDDFFAKTLAPFVDTSTRPWRYKTLPGA
FT                   TEPVEGPDLEPFQHAKAIREVFFGAPGQKQMAWKADIRIPELDPTITSLAIDVDGQTAL
FT                   YQHGPVAPFAVSWPGPRGGVHAEITASPRIRPDTSAVSTDGPWALLRLLQKGRVSGTAT
FT                   PGRTRVTLDFDGRKAVLDLASTGSVANPLTSDVLKTFRCPGSMPMFSLADTGAPPGLPP
FT                   GSPAAPTSRVARDGR"
FT   gene            complement(294209..295474)
FT                   /locus_tag="BURPS668_A0328"
FT   CDS_pept        complement(294209..295474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0328"
FT                   /product="OmpA domain protein"
FT                   /note="identified by match to protein family HMM PF00691;
FT                   match to protein family HMM TIGR03349; match to protein
FT                   family HMM TIGR03350"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86124"
FT                   /db_xref="GOA:A3NG63"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG63"
FT                   /protein_id="ABN86124.1"
FT                   /translation="MHHPDISAPAPTFDSVAATFARREPAPAPAGEPPAARLAAIRLAR
FT                   NPLLEAARVLLRALADMPERLDRDDIPQLRLLLEQEVRLFQRLCEQANIRRDHMLGARY
FT                   CLCTALDEAAMQTSWAQSASGNLGTWISEGLATSFHEDRQGGDKVYLLIGRLMNSPHEH
FT                   IDLLEVIYRILSLGFEGRYRYEADGQRKHETVRQRLYNEIASQRGPVSVALSPHWQPGP
FT                   RSRSAPFRDFPAWVTAAVLSLIALGLFGCFKYALSTRSADVQQRIAAIARMAPPAAPAE
FT                   LRLATLLAGEIAAGTLSVEENARRSSVTFRGDAMFAPGAAGVNPAMGPLIRKIAAEIAK
FT                   VPGKVTVRGYTDNQPIKSRQFASNEALSEERATQVMQMLQSAGVPASRLEALGKGGAEP
FT                   IGDNRTPQGRALNRRVEITVAR"
FT   gene            complement(295563..296909)
FT                   /locus_tag="BURPS668_A0329"
FT   CDS_pept        complement(295563..296909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05936;
FT                   match to protein family HMM TIGR03353"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87595"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG64"
FT                   /protein_id="ABN87595.1"
FT                   /translation="MSWHNKVVWSEGLFMRPQLFQQQERYLEHYAHKRAAPLSPFFFGF
FT                   SHFSLDSEAPALGKIIVKSASGVFADGTPFDAPGSTPPPAPLTIRPEHLDQVIYLAVPI
FT                   RVPNGEETAFDRAAESLARYAVFETDLRDTNSIGQGPKTVQLSNLRLRLLPEKELTDAW
FT                   IGLALTRVKTIRADASIELDDMLIPPVVGYGASDTLASWLAKIHDLTRLRANALAERLT
FT                   GSDGRAGTTAEVSDYLLLQTLNRYEPLLKHLQRVPTTSPAELYALLIGMAGELSTYVRT
FT                   DTRRPLDTHPPYQHVAPHLCLKPVVDDTHRLLNAVLVRSAQRLALADLGHGMLNAVVDP
FT                   VDMQGFTAVVLAVHAQMPPDLLQQQFAAQAKAGPSERLPDLVRSHLSGIALQALPVPPR
FT                   QIPFNAGYVYYELARGGPLWDEVARHGGLALHIAGEFPSLKLELWGIRG"
FT   gene            complement(296931..297434)
FT                   /gene="sciN"
FT                   /locus_tag="BURPS668_A0330"
FT   CDS_pept        complement(296931..297434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sciN"
FT                   /locus_tag="BURPS668_A0330"
FT                   /product="SciN protein"
FT                   /note="identified by match to protein family HMM TIGR03352"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86849"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG65"
FT                   /protein_id="ABN86849.1"
FT                   /translation="MHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPD
FT                   DRSRPAPIVVSVYELKTDGAFNAADFFTLQGPDKTVLADDLLARERFQLRPGERRVIRR
FT                   DADPAAGALGVVAAYRDLPNSVWRAAYPLPPARDAAWYRFSSPKLKLTIELDTHAIRIT
FT                   EPGK"
FT   gene            complement(297541..298026)
FT                   /gene="sciM"
FT                   /locus_tag="BURPS668_A0331"
FT   CDS_pept        complement(297541..298026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sciM"
FT                   /locus_tag="BURPS668_A0331"
FT                   /product="SciM protein"
FT                   /note="identified by match to protein family HMM PF05638;
FT                   match to protein family HMM TIGR03344"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87156"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG67"
FT                   /protein_id="ABN87156.1"
FT                   /translation="MAQDIFLKIDGINGESLDDSHKDEIEVLNWNWEIQQESTMHTGSG
FT                   GGAGKASVKDLTFEHAIDRASPNLMKYALTGKHVDQAVLVMRKAGGNPLEYLKLTMSDV
FT                   IITRVRPSGSRDDTERSRETVSLSFAKVKQEYVVQNAQGGSGGAVTTSFDIKGNKEA"
FT   gene            complement(298143..299642)
FT                   /locus_tag="BURPS668_A0333"
FT   CDS_pept        complement(298143..299642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05943;
FT                   match to protein family HMM TIGR03355"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88445"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG68"
FT                   /protein_id="ABN88445.1"
FT                   /translation="MKKQQVQTAAAGVQPQADSDFAQLLAQEFKPKTEQAREAVEYAVR
FT                   TLAEQALAQSATISDDAYKSIAAIIAQIDHKLSEQINLILHHADFQKLESAWRGLHHLV
FT                   SNTETDERLKIRFMDISKEELRRTMRRYKGQSWDQSPLFKQIYEEEYGQLGGEPYGCLV
FT                   ADYYFDHTPPDVDLLGSISKVAASAHTPFISGASPSVLQMESWQELANPRDLTKIFTQN
FT                   LEYASWNALRNMDDARYIGLAMPRFLSRLPYGVLTNPVDEFDFEEDTNGADHRRYAWTN
FT                   AAYAMGVNINRSFRLYGWCSLIRGVESGGTVENLPCHTFPTDDGGIDIKCPTEIAISDR
FT                   REAELSKNGFIPLVHRKNTDHATFIGAQSLHKPAEYDDSDATANANLSARLPYLFACSR
FT                   FAHYLKCIVRDKVGAFKEREDMQRWLNEWIMNYVDADPANSSQDTKARRPLAAAEVVVE
FT                   QAQGNPGYYQAKFFLRPHFQLEGLTVSLRLVAKLPSIKEAA"
FT   gene            complement(299677..300258)
FT                   /locus_tag="BURPS668_A0334"
FT   CDS_pept        complement(299677..300258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05591;
FT                   match to protein family HMM TIGR03358"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85857"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG69"
FT                   /protein_id="ABN85857.1"
FT                   /translation="MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLAD
FT                   LSGKPVAPLPAVADRRFLDIDIDNFDERMKAIKPRVAFAVDNTLSGDGQLMVDMTFESI
FT                   EDFSPAAIARMVGPLRQLLEARTQLANLQTYMDGKSGAETLVNQLLQDPALLRSLAAAP
FT                   KPQLAGGPDAGNARGAKDAPDTANHDSDAA"
FT   gene            complement(300294..303221)
FT                   /locus_tag="BURPS668_A0335"
FT   CDS_pept        complement(300294..303221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0335"
FT                   /product="putative Clp-type ATP-dependent chaperone
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02861; match to protein
FT                   family HMM PF07724; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR03345"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85695"
FT                   /db_xref="GOA:A3NG70"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG70"
FT                   /protein_id="ABN85695.1"
FT                   /translation="MAISRQALFGKLGATLFRAIESATVFCKLRGNPYVELVHWLQQLL
FT                   QQSDSDLHRIVRHAGIERDALDRDIARALAALPAGAGSISDFSHHVETAIERAWVLATL
FT                   RFGDRRIRGAWLVAALVDTPELRRVLLSISPAFARIPHDDALDDVLPAWTAGSPEAADA
FT                   PYDHADSAPASPGEPSGATRAAPNGSPLERYCTDLTARARDGDIDPVIGRELEIRTMTD
FT                   VLLRRRQNNPLLTGEAGVGKTAVVEGLALAIANGDVPPKLADVRLMSVDVGALLAGAGM
FT                   KGEFEARLKGVLEAAAKSVAPVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGTIRT
FT                   IGATTWAEYKRHIEKDPALTRRFQVLQVPEPEEPAAVHMVRGVARAFARHHRVTVRDEA
FT                   IRAAVALSHRYIPSRHLPDKAISLLDTACARVALSQHAAPGELQHVRQRLLAARAERDL
FT                   LEQEARIGLDAGQSLAAVRERIEALAAEEAAVDARWKAQADAARALLAAREAALAECHR
FT                   ESCAETRAGSLSESRTESRARSHIDSSAYAHSDVPAEMHAGSHAGSRAATRPDTHAEAH
FT                   AAPASPPPAADTPHAGAAPGLRELERALAAAQGDAPLVFPEVDETIVAQIVADWTGIPV
FT                   GRMMTDEVAAVRALPATLEARVIGQPDALRQIGERVQTARAGLADPKKPLGVFLLAGPS
FT                   GVGKTETALALAEALYGGEQSLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAV
FT                   RRRPYSVVLLDEIEKAHRDVHELFFQVFDKGYMEDGDGRYIDFRNTTILLTSNVGAELS
FT                   ASLCADASLAPDAAALRDALMPELLKAFPAAFLGRVSVVPYRPLEARALARIVRLHLDR
FT                   VVARMAERHRIALAYDDAVVDYVVGRCLVQETGARLLIGFIEQHVLPRLSALWLDAFPS
FT                   KAALARIDIGVADAAAPAARALVFRPGQASRAGPPNAPLTAVQAG"
FT   gene            303727..304473
FT                   /locus_tag="BURPS668_A0336"
FT   CDS_pept        303727..304473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0336"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86350"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG71"
FT                   /protein_id="ABN86350.1"
FT                   /translation="MIFFRIELIMRAFKLFRRGPPDIERAETAARRDFEPSCAGVDMEG
FT                   NAGDETGACLAGAQPPRAPQAGPQGATDGGDAVFGVIGAAFAADTPGERQGGMAAGASA
FT                   VCGTVAAQDLLHTLYEQYCRVLDDPRASLASDDAACLAIERTRDAGPQIDPQRSADGAD
FT                   SIDALLSRARVLDDAFGTFAPGEAPDPADAEPVPEVLRLFAPAEYHAASARRPAGLPPA
FT                   LARREHQTLAIDSPLPAPVATSEHGA"
FT   gene            304470..305435
FT                   /locus_tag="BURPS668_A0337"
FT   CDS_pept        304470..305435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0337"
FT                   /product="ImpE/SciE family protein"
FT                   /note="identified by match to protein family HMM PF07024"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87063"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG72"
FT                   /protein_id="ABN87063.1"
FT                   /translation="MTTPAFPAPPGARTSARPHDTPLDARLAAAQAAVRARPVDAASRW
FT                   ALFQLLCVTGQWERAVGQLQAYARFAAQHAHIAHAYRDLIRAERFRACVMAGHARPGFV
FT                   FDAPPWIDDLREALRAQTAGARDEADRARSRALDRAPFVAGRGPDAPFDWIADSDSRFG
FT                   PVCEVVTAGHDRWLPFSDLAGWRLARPGVLLDLVWAPCVLTLADGSVAHGFMPARYPGS
FT                   ELADGGGAPGALAAAHEADAHESAAREADALRLGSRTAWRDVGRTGVFALGRKTWSTSA
FT                   GDAGLFELHACEFGARARAGAVLGGAAREARGGEAADGCA"
FT   gene            305422..306003
FT                   /locus_tag="BURPS668_A0338"
FT   CDS_pept        305422..306003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04965;
FT                   match to protein family HMM TIGR03357"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87798"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG73"
FT                   /protein_id="ABN87798.1"
FT                   /translation="MDAHETRADAPRNGDEACVRGEGLATPRRANTQLLPTLIDRLRDD
FT                   APQRQTEAPGEYALTRMQMRGIVQRDLAFLLNTTSIDEHIDRERHPAAAASTLNFGVPP
FT                   LAGAFLASCQWAEVERIIRRVILDFEPRLIAETLVVAPSRAAGAVARPNVLAFEVRGMI
FT                   RMDSYPIEFMVQSALDLETNQVNITGMRAS"
FT   gene            306034..307923
FT                   /locus_tag="BURPS668_A0339"
FT   CDS_pept        306034..307923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05947;
FT                   match to protein family HMM TIGR03359"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85448"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG74"
FT                   /protein_id="ABN85448.1"
FT                   /translation="MDPQLLDYYNQELIYMRELGAEFARAHPKIARRLGMQAGEVADPY
FT                   VERLIESFCFMAARMQIKLDAEFPRFTGRLLEVLYPNYVAPTPSMAVARLYPSRTEGNL
FT                   AQGFRVARGTAFAARVPAGEKTACRFRSGQDVTLYPLEIADARLTGIPPDIPALDRYVP
FT                   AGAQVRGALRLRLRTTGNMRIADLRGLDRLPLYLAGDAQVASHLFELLHVAGVATLTAA
FT                   PGEFAAPGRPPAAVTVDALAHEGLGADEGLLPLTWAKFHGHNLLHEYFACPERFYFVAL
FT                   TGLEEGLRRIAGSEVEIVVLLEQSPERLADVVDASRFALFCTPVINLFPRHMDRIELSS
FT                   GQTECHLVPARLAPLDYEVFSVEAMYGQVAATSAELEFRPLYQTLNDDESNYGRYFSTR
FT                   RERRLVSDFARRYGTRTPYVGTEMFVSLVDQNEAPYSEDIRYLSVDALVTNRDLPSLVP
FT                   RDGVRDLTAIESAPIDSVGLIRAPSAPKAPYAEREIAWRLIRQLNFNYLPLDELDHRAG
FT                   GQGLRGLLRLFLAGDEADSRRQVESLVGVKTRPVTRKLPGAGPLVFGRGVECALSVDET
FT                   GFSGVSPYLFGLVLEHYLARHVSINVFTQTELNSIQRGRIARWPVRMGARGGA"
FT   gene            307923..309008
FT                   /locus_tag="BURPS668_A0340"
FT   CDS_pept        307923..309008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06996;
FT                   match to protein family HMM TIGR03347"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86376"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG75"
FT                   /protein_id="ABN86376.1"
FT                   /translation="MARDMTQAAVADTALSPQALARLRAEPWRYGFLALLRRIGADARI
FT                   DPIGKARRPQAEPFRLGQQPSLAFAPREIASVGDANGRLKVRLFGLGMLGPNGPLPIHV
FT                   TEIARDREESRRDPTLGNFLDIFHHRYLTLLYRAWASAQAAAGLDRPDDERFSFYVASL
FT                   AGQDLDEVGARPLPAHARLSASPHLVREARNADGLRMTLERYFGVPVTLEENVFHWIAV
FT                   DPLEHSRLGRPGDASTMAAGALLGELVPDRQHKFRLVFGPLDIDAYLRFTPRGEDLPRL
FT                   VEWVRAFVGYEFEWELELRIKPNGAPPAVMGGPHQLGWSGWLGRSPSGEPVTGMRFEPE
FT                   HYAHGFARGTARDTRGMRGER"
FT   gene            309005..310108
FT                   /locus_tag="BURPS668_A0341"
FT   CDS_pept        309005..310108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0341"
FT                   /product="type VI secretion-associated protein, ImpA
FT                   family"
FT                   /note="identified by match to protein family HMM PF06812"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87732"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG76"
FT                   /protein_id="ABN87732.2"
FT                   /translation="MTPSRKPAGRAAAARTPKPDGWMAPVDAVAPCGADLEYDPEFVVL
FT                   AAKVAPRAEAQYGDFVGSPEPVNWSDVERDCRRLMMRSKDMRLAVLFARSRTRLAGATG
FT                   LAEGIGLLAAWLAAFPDAIHPQADVDADRDAALEIRRNALQALTDADGLLADVREIALT
FT                   RSSATRLQVRDVERAFAQPRPGDALAPESVVRQLDDLHAQQPETLAGFGDALAGLAAIG
FT                   AWSGEHLGDYAPDLSALDALLRRIAGANARGDRAEAEPIAPAEADAPPASEAAAVHAHA
FT                   SPPRRREPAAQALAAAIAGEPAAQPVDRYAARELIRQARQWFEQHEPSSPIPILLRRAE
FT                   HFVGKRYADVVQAIPAELLALWSADET"
FT   gene            310180..312507
FT                   /locus_tag="BURPS668_A0342"
FT   CDS_pept        310180..312507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0342"
FT                   /product="Rhs element Vgr protein"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM TIGR01646; match to protein
FT                   family HMM TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88450"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG77"
FT                   /protein_id="ABN88450.1"
FT                   /translation="MPNFSAARTVTVSGPAVPTTPVGEPALELSAIRGDETLSEIYSYT
FT                   LDCLTPPDPLLAHERAANLDLKAMIGKALTVTVQLEGMGSFVPGMPGMAGAANIGAGAR
FT                   EISGIVTGARFEGQLNRQCRYRLTMRPWIYLADLRSDYRIFQNRSVDEIVDEVLNAYSY
FT                   SYDKRLSGRYPKLGYQVQYGETDFAFIQRLMQEHGIYWFFEHTNQVHRMVLVDHLGAHK
FT                   PVESAAYRTLRYYPPGHKIDAEYIDRFSTEEHIRPGRWATGDFDFEKPNADLGVENALP
FT                   RDTAHNGLERYEWPGDYTAREHGEHFARVRMEQTRARGERASGGGNVRDIVCGTTFALA
FT                   GHPHASANREYLVIGATFEATETGGASGPGAYRIDTSFVAQPATTAFRPPRTVRKPRTR
FT                   GPQTAIVTGPRGQDIWTDQYGRVKLKFHWDRSLVDDQNSSCWVRVSYAWSGNNYGGVNI
FT                   PRVGSEVVVDFEHGDPDRPLVTGQVYNALHMPPWPLPENATQSGFMTRSPAGGGENANM
FT                   LRFEDKAGEEQVKLHAERNYDVSVERDATTAVGRKHLTLVGVDLMPVMSTRSPLERLID
FT                   LLRTGGAASPAASGQPAAASRQPSGQQQQHQQQHQQHQRQRQPYQQLKQQRQMQRAGGW
FT                   QALAANVAKTLQEIVAVLTDPFVTASVSTVQGASTSVVFGDAKGVHVGDTVKITSGDAH
FT                   SEVNGTASSKDVNSVSLKGTSTSLTGVSTSETGTNIVTTGLTVSTTGASVSTTGFSATE
FT                   TLVQVAKKTQECEFIKGIKISM"
FT   gene            312539..315016
FT                   /locus_tag="BURPS668_A0343"
FT   CDS_pept        312539..315016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0343"
FT                   /product="pentapeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85489"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG78"
FT                   /protein_id="ABN85489.1"
FT                   /translation="MKIVKPLAISPLTRVYRMHGREYLGVAALLIATLGDEPKLLAESA
FT                   LWRLAGDELRGYPLDMALPKACPEFLVSGYAYGKYASDPHACACEVGVRIAGLEKRLRV
FT                   CGDRQWAGARITAPRPFERLPIDWDLAYGGAGCADNPRGRGAHAREGAPRDLPNVEYAH
FT                   SPMRLAHEQPAPAGFCPVDAAWPARAGLYGALDRQWQEEDCPGFPRTLDPRYFNIAPAD
FT                   QQLPELRAFPDGARYELTHMHPDHATLAGNLPALRARSFVVRRGSDAPEEMPMRLTTAW
FT                   FVPHRERVILIYHGVTPVRAFDASDVQTVLFGAEASGHARPADWYRQVIEWRTRDDRAA
FT                   LYALRDRDLLPEHALAPEAAATPEPTQQSAKQRQLRERLSVFPDAPRAQTPAPDRLAEF
FT                   VEQQQALADEKRAALEAMRRELATSEVFSVGRRRGPPGRIASADEEPARHAGASAESPD
FT                   IRALERDADERLRGLYQQCAQHQDAPARLHGAAARARRECVASAAAAGQSLQGADLTGA
FT                   DLSGMDLRGARLAGAMLENADLSDADLTGADLSRTVLVRADLTRAKLVDARLTAANLSL
FT                   AHCERTDFSGSDLSDGIFEQVHLRDCRFNGSVLASTRFDACRFDAVDFGRATLRELIFI
FT                   EQSFSGVSFSDATIRKMLLMRCAFADVRFSAASIDGFGIVDTQASGQLRFDRASVNKAC
FT                   FVGRCDIGRADFSFATLTEVNFRETQLVEANFGGARIGNCDFTDACLRAADLRGAKAEG
FT                   SPFVRADLTRADLRDTDLIAAYLRGAKLDGADLRRANLFRANLSQILTDADTRWQGAYL
FT                   NRAVRFPLAEART"
FT   gene            315013..316095
FT                   /locus_tag="BURPS668_A0344"
FT   CDS_pept        315013..316095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0344"
FT                   /product="pentapeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86239"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG79"
FT                   /protein_id="ABN86239.1"
FT                   /translation="MSTRADRLRDAIRHGRAIRDTAIDAGDFDGHDWSGGVFERVRFIG
FT                   VSMKRVRLDEAVFIDCLFCDVDMRQAGCARCTFDRCRLERVDLSASELRDCMMNGTHAA
FT                   GVYFSGARASGLHCVKSDLGDCGFDDARIESAVFSDTRLARAAFTRAAVRKAVFYRLDL
FT                   TSAVFADAAFDDTVFAEANLAGQRLQGQRMHRCQFVGADLRHADFTGARLAGCNFQRAK
FT                   LTGARLDGVDAPNTVFFEADAPDAACRDAALRGSIWVQADARRIDFTGSELDGAVFQRA
FT                   TCTGARFSRAKLEGADFSYADLTGAVFDEAGFARTAFHGATAPAIAWRDHPGAVACDAE
FT                   LSDAQAWSRQRDEQARHEEC"
FT   gene            316092..316280
FT                   /locus_tag="BURPS668_A0345"
FT   CDS_pept        316092..316280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0345"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88489"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG80"
FT                   /protein_id="ABN88489.1"
FT                   /translation="MSATAAERRRSRIAHAPLRLRFAAGSEPVRCRRVADVSRDAAGAS
FT                   FRRYSAIRNNRKRGERT"
FT   gene            316277..316936
FT                   /locus_tag="BURPS668_A0346"
FT   CDS_pept        316277..316936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85859"
FT                   /db_xref="InterPro:IPR021927"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG81"
FT                   /protein_id="ABN85859.1"
FT                   /translation="MSEIEAKPDIRGRSSVPDKAGSVVGALPDGVYVVECGGAKLRCRR
FT                   AFSCLVEPRIGDRVVVCGADSRCVYVIAILARPNAHGVQLRVEGDLVLEATRRVCVTSG
FT                   DALRLASREQLSIEAQRLTMSARQAALTSEKTTLTSAAFDGRLGKIRLIGRLLETVMEH
FT                   VAQSCRSSFRTVETVEHLRASHIDHAAAESMRMHAKHTLLTAETLTKIDAAQIHLG"
FT   gene            316977..317357
FT                   /locus_tag="BURPS668_A0347"
FT   CDS_pept        316977..317357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86494"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG82"
FT                   /protein_id="ABN86494.1"
FT                   /translation="MVMVNSSAGGMNAATSINLTPPGMPMPYPNNAPRANAVPNVGHIF
FT                   VGGGPVHNLATVIPASNGDSGGSMGGVASQTVSGSSRNAQGASKTLVAGMPITRMTDPT
FT                   QQNNNNTIGSGSSPSQTIVLNL"
FT   gene            317424..317600
FT                   /locus_tag="BURPS668_A0348"
FT   CDS_pept        317424..317600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86609"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG83"
FT                   /protein_id="ABN86609.1"
FT                   /translation="MRAGNTDDAACKQRGGTPGPRKSLPPRRAKRHARRAALVNPPEHS
FT                   LGLKEFRRRYDQN"
FT   gene            complement(317630..318085)
FT                   /locus_tag="BURPS668_A0349"
FT   CDS_pept        complement(317630..318085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0349"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86814"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG84"
FT                   /protein_id="ABN86814.1"
FT                   /translation="MTPRRLSPARAEPASAHAHRHRHRHRHRHRHRHRRDRPARRIRVK
FT                   GSRVTNGRRSMNVWEVRQGEWRAVPCYSACRPRESGDRIRRLIPAAYCGGPIGRKRPAA
FT                   AIRPEKSTRRPAPFMTQCDRSINNTTWADCCVFLRSEKAGRRIAFPT"
FT   gene            complement(318082..319998)
FT                   /locus_tag="BURPS668_A0350"
FT   CDS_pept        complement(318082..319998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86991"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG85"
FT                   /protein_id="ABN86991.1"
FT                   /translation="MTKRIHAALLAALLIAALAPPCQARSSTDWLANTFATDATHVGNA
FT                   ARSMWVAPEGVIYTASMWDENEGGVALYQNGRSIGSIGAHNEFQGGAITGNAASIFAAL
FT                   QFNRNGGSGMVGRYDRTTRRRDLLIPVSATTTERWADVVTGLATSGSTLYASDFPGNRV
FT                   RIYTVAGVWRRDIDISEPGALAADSAGNVWVAQKRAGAIAEFDSGGRLLNTIRMAAASR
FT                   PSALYFDAATQRLMVGDEGPDMNIKIYDVSRTPALVGTFGVRGGYLDSASGIKGQVGDK
FT                   RFTRVAGLGKDAAGNLYVLNNPWGGTWDLGRDGATDIHAYSPSGTLQWKLQSVNFEGIA
FT                   APDPGTDGAFFYSGTNVYAGTAGGTFVANTVDPIDYPTDPRIDVRDPARGEHFGQLAAI
FT                   GSNRILAAGSQNPDVFHFFHFNAAHGYIAIPDGSIPGAAFGTTARIRAGFCLDSRGGVW
FT                   AGLDKTNAIWHYPLTGFDANGKPAWGPATVTPIPNSIKPLTRIVYLPESDTMILARGRP
FT                   VGTDWTAIGTRIEVYHGWLAGNTAAPNPVIGLSSANPKSITAAGNYLFVGYVHTQPNID
FT                   AFNLSTGALAATLINSSPEQIYVGNDVDSMYGLRSYLRSNGEYVITKDNYNAAGIVVYR
FT                   WTP"
FT   gene            complement(320048..320302)
FT                   /locus_tag="BURPS668_A0351"
FT   CDS_pept        complement(320048..320302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87603"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG86"
FT                   /protein_id="ABN87603.1"
FT                   /translation="MRAHAFARRSKRPDRSETYFSSPDLPHASRFARVRPGAPFDGTPS
FT                   VRRRPERIRGRFSSLFSIPPIDAQSRRCLSQWRRVTQLC"
FT   gene            complement(320339..321232)
FT                   /locus_tag="BURPS668_A0352"
FT   CDS_pept        complement(320339..321232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0352"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87708"
FT                   /db_xref="GOA:A3NG87"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG87"
FT                   /protein_id="ABN87708.1"
FT                   /translation="MDNLRRLDLNLLITLDALLSEHNVTRAAARLNLSQPSVSIHLAKL
FT                   RDIFGDPLLLPGPRGMRPTARADELREPLRRALETLGRAVSPGAPFDPAASAHTWRVAA
FT                   SDYSESTVVLPALNGLRAAAPGTRLAVVETVPSRIAKQAEQGDIDLAFHITECAPGNLR
FT                   HRALFTERYVLVGRAGHPRLKRRPTLAQFCKLDHVIVSPDGGGFQGGTDHALAKLGFAR
FT                   RVVLSVPHFLFMMSAVANSDLVAMMPSRLVRDSRALQVVEPPVDVPGFRMAMLWHERSH
FT                   RDPAHQWLREHIAALV"
FT   gene            321328..322104
FT                   /locus_tag="BURPS668_A0353"
FT   CDS_pept        321328..322104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0353"
FT                   /product="NAD(P)H dehydrogenase (quinone) family"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88435"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG88"
FT                   /protein_id="ABN88435.1"
FT                   /translation="MNVLLVYAHPEPKSLNGSLKNFALRHLEEAGHAVQVSDLYAMQWK
FT                   AALDADDNTARRPDTRFDPSLDSKHAFENGTQAADIAREQDKLRWADALVLQFPLWWFS
FT                   MPAILKGWVERVYAFGFAYGVGEHSDTHWGDRYGEGSMKGKRAMLIVTTGGWASHYGPR
FT                   GINGPIDDLLYPIHHGILYYPGFDVLPPFLVHRANRIDETRFATIRDALGQRLDTLWTT
FT                   APIAFRAQNAGDDEIPQLTLRADIAPGRSGFAAHIA"
FT   gene            complement(322377..324425)
FT                   /locus_tag="BURPS668_A0354"
FT   CDS_pept        complement(322377..324425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0354"
FT                   /product="O-acetylhomoserine
FT                   aminocarboxypropyltransferase/cysteine synthase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM TIGR01326"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88082"
FT                   /db_xref="GOA:A3NG89"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG89"
FT                   /protein_id="ABN88082.1"
FT                   /translation="MTEPASADWRLETLAVHGGYRPDPTTRAAAVPIYQTVAFAFDDTQ
FT                   HGADLFDLKVQGNIYSRIMNPTNDVLEQRVAALEGGIGALALASGQAAVTYSILTIAEA
FT                   GDNIVSSSTLYGGTYNLFAHTLPQYGISTRFADPREPAAFDALIDARTKAIFAESVGNP
FT                   LGNITDIAALAEIAHRHGLPLIVDNTVPTPYLLRPFEHGADIVVHSLTKYLGGHGTSLG
FT                   GAIVDSGKFPWAKHAERFRRLNEPDVSYHGVVYTDAFGAAAYIGRARVVPLRNTGAALS
FT                   PFNAFQILQGIETLALRIERIGENALKIAQHLARHEKVEWVDYSGLPNHRDHALVERYL
FT                   SGRAPGILTFGVKGGRAAGAAFQDAEALHAPRQHRRREVARDASRFDDASPALARRARE
FT                   SGREGRDGAAVDRHRAHRRSARRSRSGAREGLKGGAIGRARDRALVRSCARPIDRTVRR
FT                   DAARCNAYVAPHCRAMRLGASAALHRREAAASRRAAMRASRGVQSTASTASPGMRRALR
FT                   IMWRAAARSPTTRTSGWRHASQSKPSRRGPPSRPASAFRRGAPSRAPRRAPPWISSSAW
FT                   PSGPASSHAMVGYSPSLSSSLASSPPPPCHPPSHHRQPACSLNACRYRFGVVPTIRTKR
FT                   SRNALAKPNPASVAIRSTDSAVVCGNGCARRTRAGRSHCNGKVPVRS"
FT   gene            complement(324697..325089)
FT                   /locus_tag="BURPS668_A0355"
FT   CDS_pept        complement(324697..325089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0355"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86575"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG90"
FT                   /protein_id="ABN86575.1"
FT                   /translation="MSVIGLDHYNLRAPRPLLDTLRDFYIDVVGLRLGARPPFRSHGYW
FT                   LYAGAQAVLHLSQAGPDETRRANVVNTFDHVAFSCDDLPGTLARLQRFGIRYSSADVPL
FT                   TRQHQLFFDDPAGNGVELNFAVRDDG"
FT   gene            complement(325129..325437)
FT                   /locus_tag="BURPS668_A0356"
FT   CDS_pept        complement(325129..325437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0356"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87358"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG91"
FT                   /protein_id="ABN87358.1"
FT                   /translation="MGGSAGGAGGVVGVVGVVGVVGVVGVGSVVGAVGTVGEVGASDEI
FT                   GEIHATGKSSGFSMQPGTGKRRVHHAMPSNAAPRARTATAGDARRPARAARPTRPAR"
FT   gene            complement(325452..326297)
FT                   /locus_tag="BURPS668_A0357"
FT   CDS_pept        complement(325452..326297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88083"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG92"
FT                   /protein_id="ABN88083.1"
FT                   /translation="MSNAPAPRTLTVPPLPPLTEAESADVTRRALALRAAFAQDVARRL
FT                   NVPDAEQRAYGERLQQTLDANGLGELAREYVVLVDRAPNVQAVFLYFRTTRSNAWQMIG
FT                   ASPVATGLPGQYDHFVTPLGVFEHTPENMDFRAEGTTNDNGIRGYGQRDMRIYDFGWTD
FT                   AERGWGKGGVSQMRFQMHATDPEYLEPLLGIRHSKGCVRIPASLNVFLDQHGILDAEYE
FT                   ARAAGGDPPWVLRAHRQVTPWAGRYLVVIDSQRKARPAWSPAPGKKAQAKLPKGGDTAD
FT                   "
FT   gene            326628..326948
FT                   /locus_tag="BURPS668_A0359"
FT   CDS_pept        326628..326948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86206"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG94"
FT                   /protein_id="ABN86206.1"
FT                   /translation="MVRQSCPRPIRYADRCQRGARRRDAPRHFNASVPWGALARLKFRS
FT                   FFDPADARIVFADCFVRVSAFVPVRADRANARPFPATVRISRRRRAVCRRRIVRSSSGR
FT                   VI"
FT   gene            complement(327103..328458)
FT                   /locus_tag="BURPS668_A0360"
FT   CDS_pept        complement(327103..328458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0360"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85556"
FT                   /db_xref="GOA:A3NG95"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG95"
FT                   /protein_id="ABN85556.1"
FT                   /translation="MANMTQAAADGELDLSTLALPQAARMPAFSLTMAWWAVCSAVFYI
FT                   VVGATLALDYGARNALIGMVLSVVSYGLVNAAISRYAIRTGLSVALFSRVLFGSAGAAL
FT                   ATLIFFATAIYYAVFEGSVIAVAAHGLMPALDYKWAALIVVCYSVPLVFGSVQHWLDKF
FT                   NGVLLPFYLLGLLAAVALATHRYGYHAAWLDFGPKGGVPAHGWWHCFVYYMGVWVLMMF
FT                   TFDYARFGREADAGYHGRWNFGMPFYLVTFVVNGAAGIYLVSTIPGLGALSEVSVVTAL
FT                   LKLMGVWGLLFVWVTQSRINTANYYLATVNMQAFFQKAAGLRAPKYVWALVVGAVVYAL
FT                   MMADIFSKLLQALAWQGVFIVAWVGVALAHILSTRYEELLGGGIECRDTHVPAFNPGGL
FT                   SAWFAGVFAGMMLTTATGFAQSLSAPVTFVVSWAVYRGMLASAKRTWFVRER"
FT   gene            328471..328665
FT                   /locus_tag="BURPS668_A0362"
FT   CDS_pept        328471..328665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0362"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87290"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG96"
FT                   /protein_id="ABN87290.1"
FT                   /translation="MAIAFGKCAACAARRAMNGGGATRGASQRQGIRNKGRRPSHAARC
FT                   AARFVIVIGRKRASAAVRP"
FT   gene            complement(328645..329649)
FT                   /locus_tag="BURPS668_A0361"
FT   CDS_pept        complement(328645..329649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0361"
FT                   /product="biotin-dependent carboxylase domain protein"
FT                   /note="identified by match to protein family HMM PF02626;
FT                   match to protein family HMM TIGR00724"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86802"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG97"
FT                   /protein_id="ABN86802.1"
FT                   /translation="MPTDTLNAIEVVKPGLATSVQDAGRHGYYHVGIPPSGALDQFSLR
FT                   AANLLVGNDEDAAVLECTLLGPQLLFRRDALIAVTGAEMAPRIDGAAQPCNVALRIRAG
FT                   GTLTFDYVKQGARAYLAVAGGIDVPVVLGSRSTYTLGAIGGHEGRRLQKGDALPIGAAK
FT                   RAAREGATLPDALRTPLAREAELRVLPGLYHHRLTDESARTFFEDTWVVAPEADRIGYR
FT                   YRQGRALRFREREQPFGAGADPSNIVDACYPIGSIQVPAGVEPIILHRDAVSGGGYATI
FT                   GTVISADLDLIGQMQPNHQARFVAVTMADALAARRDAQRRLARLRDALWPHGG"
FT   gene            complement(329639..330514)
FT                   /locus_tag="BURPS668_A0363"
FT   CDS_pept        complement(329639..330514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0363"
FT                   /product="allophanate hydrolase, subunit 1"
FT                   /EC_number="6.3.4.6"
FT                   /note="identified by match to protein family HMM PF02682"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88021"
FT                   /db_xref="GOA:A3NG98"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG98"
FT                   /protein_id="ABN88021.1"
FT                   /translation="MTIRYTFGGDEFIFVEISESMSLDAFFKGTAITRELRRRNVPGVT
FT                   EICPANASYQVRYDPDVIEPDTLLALLKTIEAEVGEAALNIDTRIVEVPVLYNDPWTHE
FT                   TLMRFRERHQAPESTDLEYAARVNGKRDIDEFIAAHAGSPWFVSMVGFVAGLPFMYQMV
FT                   ERERQLQVPKYLRPRTDTPKLTVGHGGCFGCIYSVRGAGGYQMFGVTPAPIFDPAQRLD
FT                   YLRDFMVFFRPGDIVKFKPIDRAEYDAAVAAVEAGTFTLRVKPVRFALEAFLRDPHAYN
FT                   RSLVEVLDAN"
FT   gene            complement(330511..331956)
FT                   /gene="accC_2"
FT                   /locus_tag="BURPS668_A0364"
FT   CDS_pept        complement(330511..331956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC_2"
FT                   /locus_tag="BURPS668_A0364"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF02222; match to protein
FT                   family HMM PF02785; match to protein family HMM PF02786;
FT                   match to protein family HMM TIGR00514"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88262"
FT                   /db_xref="GOA:A3NG99"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A3NG99"
FT                   /protein_id="ABN88262.1"
FT                   /translation="MNDLDSTHASFYRPSRIGTVLVANRGEIAVRVIRAAHELGMRAVA
FT                   AVSDADRDSLAARMADEAVHIGPSHAAKSYLDPAAMLAAARQCGADAIHPGYGFLSENA
FT                   DFAAQVEAAGLIFVGPPARVIATMGDKARARETARRAGVPTVPGSEGVVASLDGAREVA
FT                   ARIGYPVMIKAAAGGGGRGIRVAHDAAQLAAQLPLAQREAQAAFGDGGVYLERFIARAR
FT                   HIEVQILGDGENVIHLFERECSLQRRRQKILEEAPSPSLTPALRDALCASATRLARQVG
FT                   YRGAGTLEYLFDDARGEFYFIEMNTRIQVEHPVTEAITGVDLVREMLRIADGEPLRFAQ
FT                   GDIALHGAALECRINAEDPLQDFRPNPGRIDALVWPAGPGVRIDSLLYPGYTVPPFYDS
FT                   LLAKLIVHDESRPAALARAARALRELRIDGVKTTAPLHRALLDDADVRAGRYHTNYLEA
FT                   WMRDWLARLDARASAPRGLGEAA"
FT   gene            complement(331962..332204)
FT                   /locus_tag="BURPS668_A0365"
FT   CDS_pept        complement(331962..332204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0365"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00364"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86110"
FT                   /db_xref="GOA:A3NGA0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGA0"
FT                   /protein_id="ABN86110.1"
FT                   /translation="MAQHEIVSPLPGTFYRRPSPDAAPFVDVGSTLAPGAVVGIVEVMK
FT                   QFTEIETAAAGRVVEILVDDGEPVDAGQVLMRTEE"
FT   gene            complement(332218..333018)
FT                   /locus_tag="BURPS668_A0366"
FT   CDS_pept        complement(332218..333018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0366"
FT                   /product="LamB/YcsF"
FT                   /note="identified by match to protein family HMM PF03746"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87753"
FT                   /db_xref="GOA:A3NGA1"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGA1"
FT                   /protein_id="ABN87753.1"
FT                   /translation="MRKHSVDLNSDMGEGFGPWKIGDGVDEEIMPLISSANIATGFHAG
FT                   DPNIIARTVQLAKNAGVGVGAHPGFRDLVGFGRRDIGETPQALVNDIVYQLGALREFAR
FT                   FHGVSVQHVKPHGALYMRAARDEALSRLLVETLQQLDPALRLYCMEASVTYRIARELGQ
FT                   PVVREFYADRDYGRNGSIVFTRRAGRLDPRQVADKVLRACVDGRVATVDGEDIDIDFDS
FT                   ICLHSDTPGALALARATRDALTAHGIRIAAPATAEANGIRIDEA"
FT   gene            333181..334200
FT                   /locus_tag="BURPS668_A0367"
FT   CDS_pept        333181..334200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0367"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88448"
FT                   /db_xref="GOA:A3NGA2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGA2"
FT                   /protein_id="ABN88448.1"
FT                   /translation="MRTGRGRRAACPPAHSRSGNEILRAALSIFQAGGGMALTLRQLKY
FT                   FVATAELGQISQAAIQLTISQSAVTSAIRELEDSLGTQLFVRTASGVALTNTGRRFLNQ
FT                   AYTILSSVDEAMRIPNLESTLTGTLALAASYTVLGYFLPHHLMRLHTQYPRLTIQLHEL
FT                   NRESIEEGLIAGRYDMAVLLTSNVSNPELVLEPVIHSARRLWVGAHHPLLRRESVTFAD
FT                   VAPEPFVMLTVDEAAYTALRYWNETPYRPNVILRTSSVEAVRSMVANGSGVAILSDMVY
FT                   RPWSLEGRRIETVLLRDPVPPMSVGLAWRRNAEFSPAMHAVREYFRHTFMEPRMGGGA"
FT   gene            334260..334424
FT                   /locus_tag="BURPS668_A0369"
FT   CDS_pept        334260..334424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86144"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGA3"
FT                   /protein_id="ABN86144.1"
FT                   /translation="MPASRHRPSPIAHRPSHIAHRTSHIAHRTSHIAHRTSHIAHRTSH
FT                   IAHAGSPSG"
FT   gene            complement(334421..334687)
FT                   /locus_tag="BURPS668_A0368"
FT   CDS_pept        complement(334421..334687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0368"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85480"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGA4"
FT                   /protein_id="ABN85480.1"
FT                   /translation="MRAPERNHPRAANADAPTVGIASAQTTAARCAISIAARPPRARRY
FT                   YVISRRRAPPHMHAHRAQRLEPGQRRARRNNAVKSLFRSGMMS"
FT   gene            334772..334915
FT                   /locus_tag="BURPS668_A0370"
FT   CDS_pept        334772..334915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85756"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGA5"
FT                   /protein_id="ABN85756.1"
FT                   /translation="MIVPQTQTQTQTHMHMHMHMRAHRRRGRAPRPVSNGGERHVDSPR
FT                   DA"
FT   gene            334890..337403
FT                   /locus_tag="BURPS668_A0371"
FT   CDS_pept        334890..337403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0371"
FT                   /product="putative penicillin amidase"
FT                   /note="identified by match to protein family HMM PF01804"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86381"
FT                   /db_xref="GOA:A3NGA6"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGA6"
FT                   /protein_id="ABN86381.1"
FT                   /translation="MSIRHATRSVALCSMLALASTLGCTSGAHDAPAAHAPRTAQTAHA
FT                   TAVAAGIAGLREPVRIVRDSVGVSHIYARNTHDLFFAQGYNAARDRLWQLDLWRRQGEG
FT                   KMAEQFGPRFAAQDRAARLFLYRGDLEAEYASYHPEAKQILQAFADGINAYVREAKADP
FT                   AKMPPEFRLTGAEPGEWRPESSLIRIYGITRNVTGEVALARQVAAVGLSKALSLNAFEP
FT                   PVRQTAIPAGVDVGLIDKRILADYLLARNGLPFRAEDFPRSPLGAAQRDALAARLNAAR
FT                   LTLADDSANPLAPRYESNNWVVAGARTASGKPLLANDPHRRIGMPSLRYMVHLHAPGWN
FT                   VIGAGEPALPGVSVGHNDRVAFGLTIFAFGDEEDLYVYDTRPGHPDEYRYRGRWEKMRI
FT                   VEETVAVRGQADRVERLAFTRHGPVLYEDAAHRKAYALRAAYLEFPGTAAYLASLRLDQ
FT                   ARDWPSFVAGMRRHYVPGENMVYADVDGNIGWFGGALAPIRREADWSGALPVPGDGRYE
FT                   WAGLTEGEALPHVLNPAAGYIATANAYDLPDGYRYVDRSAHVWAEPFRQRRLDEVLRGA
FT                   SGLTVADMQRLQYDDRSLPAQAMLGFASQLKADEPGTRDALARLARWSGDMAIDSVPAT
FT                   IYEFWMREVMRRVRDVEVPAAARDAFPKLEVRQVLRYLRQPDGAFGADPAAGRDALLLA
FT                   ALRDGLANARAKLGENVDAWRWGRLHHAQFDHQLAGVLPAFGAFGTERYAVGGNDDTVH
FT                   RGTYRPSDFRQTSGASYRQVIDVADWDRSMIQNTPGQSGDPRSPFHANLLKGWASGEYW
FT                   PMAFSDRAVDALAHDTLILEPAPAR"
FT   gene            337787..338725
FT                   /gene="pip"
FT                   /locus_tag="BURPS668_A0373"
FT   CDS_pept        337787..338725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="BURPS668_A0373"
FT                   /product="prolyl aminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="identified by similarity to SP:P52279; match to
FT                   protein family HMM PF00561; match to protein family HMM
FT                   TIGR01249"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85444"
FT                   /db_xref="GOA:A3NGA8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGA8"
FT                   /protein_id="ABN85444.2"
FT                   /translation="MYPPIEPYAHGFLDTGDGHRVYWELCGNPNGKPAVFLHGGPGSGC
FT                   SADHRRLFDPARYNVLLFDQRGCGRSTPHASLENNTTWHLVDDIERLRAMLGVERWLVF
FT                   GGSWGSALALAYAQTHPARVAELVVRGIFTVRRSELLWYYQEGASWLFPDLWEDFIAPI
FT                   PRAERADLIAAYRRRLTGDDEAAKREAARAWSVWEGRTIALLPNAAHETYFGDAHFALA
FT                   FARIENHYFVHQGFMEDGQLLRDAHRLADIPGVIVQGRYDVATPARTAWELAKAWPRAS
FT                   LEIVPDAGHAYDEPGILRALIAATDRFARER"
FT   gene            338949..339773
FT                   /locus_tag="BURPS668_A0374"
FT   CDS_pept        338949..339773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0374"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88553"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGA9"
FT                   /protein_id="ABN88553.1"
FT                   /translation="MNAGFVQDRINQAVWRSRGALRGYGRASGWTDPGEAAAIAWIAER
FT                   VRDEPILDVGVGGGRTVPLLKTISADYTAVDYTPELVEICRRNHPGTRVHRMDARDMSA
FT                   FADESFSLVVFSYNGIDAVDHDGRMAILKEFARVLRPGGFTLFSTHNLAGPSYREGPSR
FT                   LARLPRRSANPLAIALDAARIAYSLPVGAFNYFRNSRFNRVFDGYAMRVCAAHKFGILI
FT                   MYTDFATQQRQLADVGLKLRAAFGGSSGEPVRRDQDLGGEAWLHFVASKPCG"
FT   gene            complement(339884..341896)
FT                   /locus_tag="BURPS668_A0375"
FT   CDS_pept        complement(339884..341896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0375"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87672"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGB0"
FT                   /protein_id="ABN87672.1"
FT                   /translation="MNLHRSIVVPLVFSAMFLAGCGSSVDGRFTSGMVAMGAVAGSTVA
FT                   AYPIGADGTIGAQPLAVTTSDASGAFSLPALDRWPALIRATHGAYVEEATGAAATLEGD
FT                   GLEAVYASAPSTIVVSPYSSAVVATARAAGGLTQANIAAAIATISAFVGDFDPQQTRPA
FT                   TMAAGAAAPAIEPGHQMALALGAESQSRTDAAADIATSIAAIVAQAAAGDTLDTCHAGA
FT                   GDPRADGTLAAPVSSGCAITRGAARYAANARNTSGVTSLASLSAIRTSRASPDQTAAAT
FT                   PDACADRAALLAQNLALFDGRRDDVQANLVGGVTRDNWRTVTTRSTWGPTAAFYGTLAT
FT                   PAACADADTFARELVIAAENYWIDQGINYCHHHIPGWTPPDDSAAAAPRYRNSSAGSTS
FT                   GASSNGMTCTAQRSGTGAQIVPGTAPSAGFSASEIQWNGVDCSDFTSWIYNFVGLTGVR
FT                   LPTAIGSQACAANEGADALPTPGVLLDIDSGNIDAMLPALKPGDLLYITQVDPLASGSD
FT                   AGGYQLAHVVTWTGKRWSDLQAGPDAARYALARLGQPGSRLGGDLAKYLPLADLATQNP
FT                   WMIIDSHYAGPAYRPFVGWYRRSLSNVRRIVGADAARRDPALAPYVIAPIASDARGDTL
FT                   TLASPHANASAQQGWRMIYRQSGGTPSCVRAGIAQ"
FT   gene            complement(342105..342386)
FT                   /locus_tag="BURPS668_A0377"
FT   CDS_pept        complement(342105..342386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88388"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGB2"
FT                   /protein_id="ABN88388.1"
FT                   /translation="MICAATDRRTPQHQFPFPCAPLPSHSAIARPARDRFAARTIRPGE
FT                   RTCTGDRLSIRRNHRIRFGFLLDRPIDSRPRARLVPLRSAGRGESSSP"
FT   gene            complement(342483..342761)
FT                   /locus_tag="BURPS668_A0378"
FT   CDS_pept        complement(342483..342761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0378"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87467"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGB3"
FT                   /protein_id="ABN87467.1"
FT                   /translation="MSDRARGKRAPESPSCRVHAIARDIATAPARFARRARPGAETRRE
FT                   LDASARIAKRETGNGKRETGNGKRETGNGKRETGNGKRETRNADHGS"
FT   gene            complement(342785..344413)
FT                   /locus_tag="BURPS668_A0379"
FT   CDS_pept        complement(342785..344413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0379"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87162"
FT                   /db_xref="GOA:A3NGB4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGB4"
FT                   /protein_id="ABN87162.1"
FT                   /translation="MKLRRKIPLAFATALVLTSASAFYGIHALNRSLDTYGTTVRQNVA
FT                   NERMVSATLVAFKLQVQEWKDTLLRGKDPAKLDKYWRAFQQREQTVDALAAELKAKLPD
FT                   GESRGLIEQFASAHAEMGQGYRKGFEAFRASGFDPSAGDQAVAGVDRAPAVLLEKAARD
FT                   IAADSARVSADAASDAAHATAISIAATLALFALSLAGGVWFGGTVTRPLERALACVRRV
FT                   ATGDLSTPIDARGRDEIAELLAALKDMQASLSHVVRDVRHNADGVATASAQIASGNLDL
FT                   SSRTEEQAASLEETAASMDELTSTVRRNAEHAQHACAVAAGASTKAARGGDVMRQVVDT
FT                   MRGIADSSGKVAEIIAVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRTLAQR
FT                   SATAAREIKTLIEQSTERVGAGSALVDDAGRIIGEIVDSVRQVTGIVSEIAAASNEQSV
FT                   GIEQVNRAVAQMDNVTQQNAALVEEASAAAHALAEQAHALHGAVAVFSLHGERGGERGC
FT                   ARAGQPAVEAAHDSPRTPLAVVAPA"
FT   gene            complement(344491..344766)
FT                   /locus_tag="BURPS668_A0380"
FT   CDS_pept        complement(344491..344766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86646"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGB5"
FT                   /protein_id="ABN86646.1"
FT                   /translation="MTSRGKVAVPDSRFPFADCRRASIRASCGLRFARAAAFTHFAPVT
FT                   ARMPPPVFRRAAAHRLRRAPRACGSRGVGMQRASALDVDAAAIRLF"
FT   gene            complement(344763..346874)
FT                   /gene="prpR"
FT                   /locus_tag="BURPS668_A0381"
FT   CDS_pept        complement(344763..346874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="BURPS668_A0381"
FT                   /product="propionate catabolism operon regulatory protein
FT                   PrpR"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM PF06506; match to protein family HMM PF07728;
FT                   match to protein family HMM PF08448; match to protein
FT                   family HMM TIGR02329"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86101"
FT                   /db_xref="GOA:A3NGB6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGB6"
FT                   /protein_id="ABN86101.1"
FT                   /translation="MSTLPETGVRPRVWAVGISRLRALFRDIADEYEERADLRIVARGY
FT                   EEAITALATAGAERPDAIVAAGSNGTYLKARVRVPVVLVNPTGFDVMHALARARRDAGR
FT                   IALVSYGETPPEVRSFAAAYGLDVVFASYQSAQEADTRVLEMRERGIETVVGPGLVTDL
FT                   AANAGMGAVFVYSHASVRAAVNTALEVAHATHAEALRRERLDNLLQHLRDGVVALDREG
FT                   RIEAINERLALALGVSPSAAVGRALDDLTPELRTLRAADGDTLATVRGVRYVVHRGPLA
FT                   SSGGAPGSVLTFQESRAVERLDRTLRSHQHAQQFTARYRLDDIVGTTPAIAYARDLARR
FT                   YAKSDATVLILGESGTGKEMIAQSLHALSARRKYPFVAVNCGAFPESLLESELFGYEEG
FT                   AFTGARRGGKAGLFEAAHRGTLFLDEIGEMPPSLQSRLLRVLQEREVVRVGSTEPVPVD
FT                   IRVVAATHRPLFAAVEAGTFRADLYYRLNILNIGLPPLRERAADIPALAATLLAQAARR
FT                   EPRLAERLRDANDAARALDAANAALARYRWPGNVRELQNVIERIAVELADAGERGDAAV
FT                   SADTLRAIAPEVFALDTLGGFGSFGSFGSFGSAAGGGHGDASGGDIDADADARRPTLVQ
FT                   RRRRAEADEIRAALDACGGDRDRACARLGISKTTLWRKLAASEGKARGNKRGERGGGHG
FT                   GDNDEGAGA"
FT   gene            347091..347984
FT                   /gene="prpB"
FT                   /locus_tag="BURPS668_A0382"
FT   CDS_pept        347091..347984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="BURPS668_A0382"
FT                   /product="methylisocitrate lyase"
FT                   /EC_number="4.1.3.30"
FT                   /note="identified by match to protein family HMM TIGR02317"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85906"
FT                   /db_xref="GOA:A3NGB7"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGB7"
FT                   /protein_id="ABN85906.1"
FT                   /translation="MGNPQLISAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAV
FT                   YLSGGGVAANSLGIPDLGISTMDDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIR
FT                   SFIKAGVGAVHLEDQVGQKRCGHRPGKECVPAGEMVDRIKAAVDARTDETFVIMARTDA
FT                   AAAEGIDAAIERAIAYVEAGADMIFPEAMKTLDDYRRFKEAVKVPILANLTEFGSTPLF
FT                   TLDELKGANVDIALYCCGAYRAMNKAALNFYETVRRDGTQKAAVPTMQTRAQLYDYLGY
FT                   YAYEEKLDQLFNQGRN"
FT   gene            348033..349205
FT                   /gene="prpC"
FT                   /locus_tag="BURPS668_A0383"
FT   CDS_pept        348033..349205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="BURPS668_A0383"
FT                   /product="2-methylcitrate synthase"
FT                   /EC_number="2.3.3.5"
FT                   /note="identified by match to protein family HMM PF00285;
FT                   match to protein family HMM TIGR01800"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86734"
FT                   /db_xref="GOA:A3NGB8"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGB8"
FT                   /protein_id="ABN86734.1"
FT                   /translation="MSETKEAAATGAAGGFKPKKSVALSGVAAGNTALCTVGKTGNDLH
FT                   YRGYDILDIAGSSEFEEIAHLLVHETLPNVTELAAYKAKLRAMRGLPANVKAALEWIPA
FT                   SAHPMDVMRTGVSVLGTVLPEKDDHNLPGARDIADRLMASLGSMLLYWYHYSHNGRRIE
FT                   TETDDDSIGGHFLHLLHGKTPSKSWIDAMHTSLILYAEHEFNASTFTARVIAGTGSDMY
FT                   SSITGAIGALRGPKHGGANEVAYEIQNRYRTPDEAQADIRRRVENKEVVIGFGHPVYTI
FT                   SDPRNKVIKEVARKLSKEAGDLKLFNIAERLESVMWEIKKMFPNLDWFSAVSYHMMGVP
FT                   TAMFTPLFVIARTAGWSAHIIEQRVDNKIIRPSANYTGPEDLKFVPIEKR"
FT   gene            349279..351873
FT                   /gene="acnD"
FT                   /locus_tag="BURPS668_A0384"
FT   CDS_pept        349279..351873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnD"
FT                   /locus_tag="BURPS668_A0384"
FT                   /product="2-methylisocitrate dehydratase, Fe/S-dependent"
FT                   /EC_number="4.2.1.99"
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM PF00694; match to protein
FT                   family HMM TIGR02333"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87405"
FT                   /db_xref="GOA:A3NGB9"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR012708"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGB9"
FT                   /protein_id="ABN87405.1"
FT                   /translation="MNTANRKPLPGTSLDYFDARAAVDAIRPGAYDALPYTSRVLAENL
FT                   VRRCDPAILADSLTQLVERKRERDFPWFPARVVCHDILGQTALVDLAGLRDAIAERGGD
FT                   PAKVNPVVPVQLIVDHSLAVECGGFDPDAFAKNRAIEDRRNEDRFHFIEWTKKAFENVD
FT                   VIPPGNGIMHQINLEKMSPVIQAQDGVAYPDTCVGTDSHTPHVDALGVIAIGVGGLEAE
FT                   NVMLGRASWMRLPDIVGVELTGKRQPGITATDVVLALTEFLRREKVVGAYLEFRGEGAK
FT                   SLTLGDRATISNMAPEYGATAAMFFIDEQTIDYLRLTGRSDEQVKLVETYAKAAGLWAD
FT                   SLAHAQYERTLTFDLSSVVRNMAGPSNPHKRLPTSDLAARGIAGKWEEKPGEMPDGAVI
FT                   IAAITSCTNTSNPRNVIAAALLARNANARGLARKPWVKSSLAPGSKAVELYLKAANLLP
FT                   ELEKLGFGIVAFACTTCNGMSGALDPKIQQEIVDRDLYATAVLSGNRNFDGRIHPYAKQ
FT                   AFLASPPLVVAYAIAGTIRFDIEKDALGHDKDGKPVTLKDIWPTDEEIDAIVASSVKPE
FT                   QFRTVYEPMFARAADAGERAAPLYDWRPRSTYIRRPPYWEGALAGERTLKGMRALAVLG
FT                   DNITTDHLSPSNAILPTSAAGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPTLVN
FT                   EMAIVDGEVKKGSLARVEPDGKVMRMWEAIETYMSRKQPLVVIAGADYGQGSSRDWAAK
FT                   GVRLAGVEAIVAEGFERIHRTNLIGMGVLPLEFKPGTNRATLAIDGTETFDVIGERTPR
FT                   ADLTLVIHRSSGERVAVPVTCRLDTAEEVSIYDAGGVLQRFAQDFLESSRAA"
FT   gene            352031..353221
FT                   /gene="prpF"
FT                   /locus_tag="BURPS668_A0385"
FT   CDS_pept        352031..353221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpF"
FT                   /locus_tag="BURPS668_A0385"
FT                   /product="putative AcnD-accessory protein PrpF"
FT                   /note="identified by match to protein family HMM PF04303;
FT                   match to protein family HMM TIGR02334"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85649"
FT                   /db_xref="GOA:A3NGC0"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="InterPro:IPR012709"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGC0"
FT                   /protein_id="ABN85649.1"
FT                   /translation="MAHVPQIKIPATYLRGGTSKGVFFRLQDLPEAARTPGAARDALLS
FT                   RVIGSPDPYGKQIDGMGGASSSTSKTVIVSKSARPDHDVDYLFGQVSIDKPFVDWSGNC
FT                   GNLSAAVGPFAIAGGLIDPARVPENGVATVRIWQANIGKTIVAHVPITNGAVQETGDFE
FT                   LDGVTFPAAEVQLEFMDPAADEDGAGGAMFPTGNLVDDLDVPGVGTLKATMINAGIPTI
FT                   FVDAAAIGYTGTELQDAINSDAKALAMFETIRAHGALRMGLIASLDEIATRQHTPKVAF
FT                   VAKPADYVASSGKRVAAADVDLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAA
FT                   GGGARHAVRFGHPSGTLRVGAEAKQDGGEWVVTKAIMSRSARVLMEGWVRVPGDAF"
FT   gene            complement(353274..354398)
FT                   /locus_tag="BURPS668_A0386"
FT   CDS_pept        complement(353274..354398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00369"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85659"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGC1"
FT                   /protein_id="ABN85659.1"
FT                   /translation="MRRRQPARARRRGSGARPPEGTDDDDRCPIGAWRLALGAWRLALG
FT                   AWRLALGAWRLALGAWRLALGAWRLALGAWRSALGARRSALGARRLANGARGVALGEWR
FT                   VIDASGRRRLVGMRRAAHRHGARAARTPRTAGDRRRTGAGGRTRAASPARADVSAHKRA
FT                   RAGTSGRRRASPAAPPLVRRHDEFPCVSPAPFLEWSAKSRIASAARAPRRIVQHIHSID
FT                   SEGTSMTDIVDHARGALRAQPFSMLLGTELVHIGGEEASLRLPIRDELRQQYGFVHGGV
FT                   ISYLADNALTFAGALALGPRVVTGEYKINYLRPAVVGTLIARAKLIYAGRNQATCQCHV
FT                   FVIDGDHERLVAVAQGTINRVGDGREPGAAEEKA"
FT   gene            354807..354998
FT                   /locus_tag="BURPS668_A0387"
FT   CDS_pept        354807..354998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08898"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86379"
FT                   /db_xref="InterPro:IPR014994"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGC2"
FT                   /protein_id="ABN86379.1"
FT                   /translation="MSQAQGHPVTPYGVAIHQAIADGDLAQMKSLRTQAQALLAQQGNL
FT                   ATALELLEVEIAKLERRK"
FT   gene            355091..355729
FT                   /locus_tag="BURPS668_A0388"
FT   CDS_pept        355091..355729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08896;
FT                   match to protein family HMM PF08898"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87157"
FT                   /db_xref="InterPro:IPR014992"
FT                   /db_xref="InterPro:IPR014994"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGC3"
FT                   /protein_id="ABN87157.1"
FT                   /translation="MSEDLRVGLFPVRYLVGTGLPGAPQLVLDLMVDTVDHSVVGRAAV
FT                   SQAVSPPLNFHADVWGSYVFRLGPPPRRDGSGAIVQISLQGNQGGPQSNSMITFYGELL
FT                   LKGDGKTGVASYRYYSNGSWHEVENVPVKADPELVPIEPGPVIGQSSMSAIGSAAMYGV
FT                   AIQSAAASGDLAHMRTLSAYARQQLESRDEIAAALSELKAEIAKLESRQ"
FT   gene            355782..356372
FT                   /locus_tag="BURPS668_A0389"
FT   CDS_pept        355782..356372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08896;
FT                   match to protein family HMM PF08898"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87882"
FT                   /db_xref="InterPro:IPR014992"
FT                   /db_xref="InterPro:IPR014994"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGC4"
FT                   /protein_id="ABN87882.1"
FT                   /translation="MATTGLFPVQLRVATPNLGAPVLWLNLLVNTVEKTASGFARITQT
FT                   VYPPMHFRARVVGPFHQMRIDPHAPQSITLTLSGSPTGPVAPQVVILELNALLNEGWQS
FT                   GTANYRYFYESRWHSIEHAIVSKDNSRIPLDPPSEHVMPMYGVGLQEARASGDLSRMKA
FT                   LARQAEQQLADHDVIAAELQKLEAEIARLEARR"
FT   gene            356451..357926
FT                   /locus_tag="BURPS668_A0390"
FT   CDS_pept        356451..357926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0390"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88284"
FT                   /db_xref="GOA:A3NGC5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023820"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGC5"
FT                   /protein_id="ABN88284.1"
FT                   /translation="MSTTDARPARYLFDSDYQRFVPVHAVWEITLACDLKCLHCGSRAG
FT                   HRRTNELSTAECLEVIDALARLGTREVSLIGGEAYLRKDWTQLIRAIRSHGMYCAIQTG
FT                   GRNLTPKRLAQAVDAGLNGVGVSLDGLAPLHDKVRNVPGAFERALDTLRRARDAGIAVS
FT                   VNTQIGAQTMEDLPALMDTIIELGATHWQIQLTVAMGNAVDNDELLLQPYRLAELMPLL
FT                   AKLYKDGVSRGLLMTVGNNIGYYGPYEHLWRGFGDERVHWSGCAAGQNVIALEADGTVK
FT                   GCPSLATVGFSGGNVRDMSLEDIWRTSEGIHFGRLRSVDDLWGFCRTCYYADVCRGGCT
FT                   WTSHSLLGKPGNNPYCHYRVLELQKQGLRERIAKVQDAGPASFAVGRFDLVTERIADGE
FT                   PVASVVRSGQVIELAWKNRGKRSPEVGRVPPKLKMCRNCDGYVHAGEQTCPHCGGDIDA
FT                   AARAHELDAQRRHALMNDLERLLGLPASTFGGG"
FT   gene            357935..358099
FT                   /locus_tag="BURPS668_A0391"
FT   CDS_pept        357935..358099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0391"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87122"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGC6"
FT                   /protein_id="ABN87122.1"
FT                   /translation="MHPRTHARAHWGARRRPRCRAAAPPRRTPNAERRTAAEPLRRVRD
FT                   RSSPPLKCR"
FT   gene            358139..359734
FT                   /locus_tag="BURPS668_A0392"
FT   CDS_pept        358139..359734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0392"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02203"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85845"
FT                   /db_xref="GOA:A3NGC7"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGC7"
FT                   /protein_id="ABN85845.1"
FT                   /translation="MFSKIKLASGLLGVLVTFCLFLIAVEGLGFWSLSASRSNVDDLSN
FT                   VAIKQTDATTVATQHMLDARTNLSRASTRMVKGDPMPTETLQHVRDQLALADRAFAAFT
FT                   AAPTISAENTERAAALTDRYRKYHAALVDLVQFLESNNMQAFLDQPTQQIQDAYLGELR
FT                   TFSEFSGRTSEHALGMIDTGMHWFETVGAVLLVLMLACIAGIYAVARRAVVAPLAQALV
FT                   HFERIAQGRLDETVAPRGVYEIERLLRGLADMQASVAGTVRVVRNASNAIHLGAAEIAS
FT                   GNADLSARTSSQAASLEQTAASMEELTATVRQNSDSARAASALADDALRTTQNGGAIVD
FT                   DVIDKMHGIARSSGRIAEIIAVIDGIAFQTNILALNAAVEAARAGEEGRGFAVVAGEVR
FT                   ALAQRSAQSAKEIKLLIEESVAQIDGGSELVERAGEAMRSVSASIERVAQTMTEITAAS
FT                   VEQSAGIEQVNQAVTQMEQLTQQNAALVEEVAAAAGSLNEQTEQLQQSVSVFELGDARA
FT                   RRLAGGAALAGAGA"
FT   gene            complement(359935..361596)
FT                   /locus_tag="BURPS668_A0393"
FT   CDS_pept        complement(359935..361596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0393"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88432"
FT                   /db_xref="GOA:A3NGC8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGC8"
FT                   /protein_id="ABN88432.2"
FT                   /translation="MNFCGNDLQQPLSLTCRSPLRITVSGMHDAPSRPAPIEPPRHACG
FT                   SPAASAPARARALATASATCSLIVLDTNVVAVSLPSIARTFHASFADIEWVVSAYMTAF
FT                   AACLLPAGGLADRAGRKRVLLAGLAVFFVASLGCGLAPSAALLNVARAVKGIGAAMLLT
FT                   SALAVIANRFSEGRERARAWAIWGMCMGVATAIAPLVGGAIAQWIGWRWIFLLNLPVCI
FT                   ALAAAVRATIDESRDPHAKRIDAPGSVLFGAALALGIWALIDAPSHGWTAPGTLARFAA
FT                   SAALGAAFVAAERWQRRPMIDLALFRTPRFVGALLAMFGYAACAQVMMTFLPLYLQIGF
FT                   GMSAIDAGLGMLPFALAMIVGPSLGAALSARAPAATVLGCGLALIGIGNFATAALAGAS
FT                   HYGLVALGMMITGCGAGILNGDTQKAIMACVPPERTGMASGISTTTRFSAIVTSVGVLG
FT                   AVLAEQTHAALAARVAHAPALLGALDPRFMSSLLAGDLAQAIRGLPPRTGATLAHIAPG
FT                   GFASGFSLALCASGAFALAAAVAVRLLVGAQPGRAA"
FT   gene            361632..362513
FT                   /locus_tag="BURPS668_A0394"
FT   CDS_pept        361632..362513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0394"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87357"
FT                   /db_xref="GOA:A3NGC9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGC9"
FT                   /protein_id="ABN87357.1"
FT                   /translation="MDRLELRHVRAFLCVARHLHFARAADELDIAPPALTRLVQDAERL
FT                   LGVRLFHRTRRSVALSAAGAAYLGEAQAALAHLARGRERAALAERGEIGRIELGYVSSA
FT                   AYAGVLQRTVGAFRDAHPRIRVDVREVPMSEVAARLDAGTLDAAYVRPPLPLPDGVSTH
FT                   TVHRDVFVVAVHGQSPLAARASIRPAALAGERFVVPEQALGTLEVARRGRFEPIVDARP
FT                   GALVAVLAHVSVSGGVAIVPQALVGCVSLPGVAYRPIEGKPIASEVAVAYRRHEKAPAV
FT                   RAFVRFVRQAAL"
FT   gene            complement(362596..363699)
FT                   /locus_tag="BURPS668_A0395"
FT   CDS_pept        complement(362596..363699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0395"
FT                   /product="N-acylglucosamine 2-epimerase family protein"
FT                   /note="This functional annotation is a direct result of
FT                   community participation in a Pathema-Burkholderia
FT                   annotation jamboree: http://pathema.jcvi.org.; identified
FT                   by match to protein family HMM PF07221"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86675"
FT                   /db_xref="GOA:A3NGD0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGD0"
FT                   /protein_id="ABN86675.1"
FT                   /translation="MSAPVSVSDQAARLRRHFAQIVLPIWRGPGFNPALQLPFEAVAPD
FT                   THAPLPVTRYRAMACARQLFVFSQAGDAQHAHALFAALCRHFRDPRHDGWFYSVDAQGA
FT                   PLDRTKDLYTHAFVVFACAEYFAAFGNRDARELAQRTAALIVDRFAPRPGSALLDSARG
FT                   EDFAAAAGGPLQNPLMHLTEGWLAAGRAFGDTAFDDALLRTAQAVERTFVDPHTGCVAE
FT                   LPIGCADNRFEPGHQFEWFYLVASAGARLAATGLPDALARAYAFAQRHGVDPDTGGVSA
FT                   ATDERGACVDGTQRIWAQTEYLRALATHGGEPDALARQIARFAERFLHPRGWYECKTAQ
FT                   GEVSRADMPSTTPYHLATAYASLPAGT"
FT   gene            363774..364505
FT                   /locus_tag="BURPS668_A0397"
FT   CDS_pept        363774..364505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0397"
FT                   /product="MgtC family membrane protein"
FT                   /note="identified by match to protein family HMM PF02308"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87613"
FT                   /db_xref="GOA:A3NGD1"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGD1"
FT                   /protein_id="ABN87613.1"
FT                   /translation="MRAAAVEHGRARMLNNVELIMRLMLAAALGSVIGIERERLSWAAG
FT                   LRTHMLVCVGSALIMIVSAFGFADVLGQAHVDLDPSRMAAQVVSGIGFLGAGSILLRGE
FT                   IVRGLTTAASLWSVAAVGLAVGGGLYAAAVAATIIILVILAGIKPLERRYLSVRQRRHL
FT                   MLLVERGTLTFDSLHAALGLDSARVKRFIVQQSEDSADSDEVTIALGRVSDVEYESICA
FT                   RLRQLPGVKGFSERKGGLPDD"
FT   gene            complement(364471..364761)
FT                   /locus_tag="BURPS668_A0396"
FT   CDS_pept        complement(364471..364761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88514"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGD2"
FT                   /protein_id="ABN88514.1"
FT                   /translation="MLVARRVAHGGVAAGPGRRARLPGAARRRGARPLPGWGRTGRTGT
FT                   WGCCEIGHGSFSGAPHARRIRLRTISGRRHCLMPAARGPRVSHPASRPCAR"
FT   gene            364735..366078
FT                   /locus_tag="BURPS668_A0398"
FT   CDS_pept        364735..366078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87062"
FT                   /db_xref="GOA:A3NGD3"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGD3"
FT                   /protein_id="ABN87062.1"
FT                   /translation="MGDASRDEHTLDLFGTAFEENARTDEAAAGVAADETAHDAARVQA
FT                   RGFGGLDRPGRGADAGADAGAGASASASASADARGARAAAHAPEPAGEQADLLSGFGEL
FT                   PAADRQDAQRNADGRVDAEAADGERSRAVKADERLNEGVNQGVNAEASAGEHAAAGSAG
FT                   PAIIRRGASAPDASEPAAAKSGVDEATAARPPRARRASARRADGGKQAAERGARRSRTA
FT                   EDAISKSAGADGGALGGEAAGGQAAGNRAVPADTVRDSSPAPVARRDAAVRGRPAEARA
FT                   LPAAADRAPVNAAQPHPRSANPSPALLPAAAAQAATSAASADSDAQLRPLADRIRALQS
FT                   ETIDLRRAADAQMRRVNRLLLALAVVLLAAIVAWIGLAVQLSRQRDQFAAMQQRIDRLV
FT                   AAQATQGATIATLSQRQDEVGAQVDRLTSRLSSATAPAKRAHRTRHMR"
FT   gene            366275..366430
FT                   /locus_tag="BURPS668_A0399"
FT   CDS_pept        366275..366430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86182"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGD4"
FT                   /protein_id="ABN86182.1"
FT                   /translation="MSLIFALLQKIEDLFTSPHLPLDADYSYKARHAEVERVRKSHVSQ
FT                   VGLIRR"
FT   gene            complement(366692..367108)
FT                   /locus_tag="BURPS668_A0400"
FT   CDS_pept        complement(366692..367108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86946"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGD5"
FT                   /protein_id="ABN86946.1"
FT                   /translation="MRDGACMDAMEYLFAALARRDSARRRHDCGSRSASTAGCRCRTRR
FT                   RDKLRIAMSLPTKFAGSVAQFVDISATLTLGAGRGIAAPAFLARHAIPRSRPRPASIAA
FT                   RRQRRQRSGRRRFTVDAARAAARSRAAGRSTDVG"
FT   gene            367430..367909
FT                   /locus_tag="BURPS668_A0401"
FT   CDS_pept        367430..367909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0401"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86958"
FT                   /db_xref="GOA:A3NGD6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGD6"
FT                   /protein_id="ABN86958.1"
FT                   /translation="MLQMRPMTQTEFREYRERAARGYARDLIESGQSAPDEADARALAC
FT                   IDTLLPDGLLTDDQVLLTLSESADGSVLGHLWYGVVAEGPHRSLFIYDLEIEPAFRRQG
FT                   WATRVLQALEDDARELRVSEIGLSVFNHNAAALALYRELGFAAVTTTFVKSIESP"
FT   gene            complement(367993..368115)
FT                   /locus_tag="BURPS668_A0402"
FT   CDS_pept        complement(367993..368115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0402"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87913"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGD7"
FT                   /protein_id="ABN87913.1"
FT                   /translation="MIGSTHRKPHARRHASARGIAHGARQPRCRRPRRITLQAA"
FT   gene            complement(368112..368555)
FT                   /locus_tag="BURPS668_A0403"
FT   CDS_pept        complement(368112..368555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85945"
FT                   /db_xref="InterPro:IPR025145"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGD8"
FT                   /protein_id="ABN85945.1"
FT                   /translation="MIAFLARRAARRTPTPTTASHSPISRSRGAGRHLFAALAVALIGL
FT                   PHAHAEIRCGWLQNPTPGNWWLDDRTGSWTLGTMGGPETEGMDVIPDMAGKQYVETNGS
FT                   HGYACACLTVVTDKQERRIVKVLKAKQLPLSRCRRDKRLKEPT"
FT   gene            complement(368590..368733)
FT                   /locus_tag="BURPS668_A0404"
FT   CDS_pept        complement(368590..368733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0404"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86867"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGD9"
FT                   /protein_id="ABN86867.1"
FT                   /translation="MSRPACRMLENGHTRASPHQAALAKAAGDKLRHGRERNCDRLHTS
FT                   TA"
FT   gene            complement(368980..372165)
FT                   /locus_tag="BURPS668_A0405"
FT   CDS_pept        complement(368980..372165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0405"
FT                   /product="cation-transporting ATPase membrane protein"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR00003;
FT                   match to protein family HMM TIGR01494; match to protein
FT                   family HMM TIGR01511; match to protein family HMM
FT                   TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87461"
FT                   /db_xref="GOA:A3NGE0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGE0"
FT                   /protein_id="ABN87461.1"
FT                   /translation="MTKLFAPAAPITTTLLVEGMHCGGCTSRVEQALAQVPGVTGAVAD
FT                   LAAGTATVAAASAIDTARLVAALDAAGYRATVATAPAATGNADARHGRARDEDDDAAAA
FT                   PHTAAVTLTIGGMTCGGCARRVEQALAAVRGVADAKVDLATMSAKASVARDVDSQTLVA
FT                   AVEQAGYRANVVRDARAEAAPKPAACPFEDAARSAAPAAAFAVDESSAASPERVATQSF
FT                   EFDIAGMTCASCVGRVEKALAQVPGVVRATVNLATEKAAVDADADAHVDTARLIDAVKR
FT                   AGYRASPVSDPASALAPSPEIAAARTAIELDIAGMTCASCVGRVEKALAQVPGVARATV
FT                   NLATEKATVDADADAHVDTARLIDAVKRAGYRASPAIAACAPASRATATADAAAARPAS
FT                   PSADDRKLAEARRERALVIASAVLTTPLALPMFAAPFGVDAALPAWLQLALASIVQFGF
FT                   GARFYRAAWHALKARAGNMDLLVALGTSAAYGLSIWLMLRDPGHAAHLYFEASAVIVTL
FT                   VRFGKWLEARAKRQTTDAIRALNALRPDRARIVEHGVERDVPLAQVRVGTVVRVLPGER
FT                   VPVDGRIEAGVTHVDESLITGESLPVPKEPGERVTAGSINGEGALTVATTAIGAETTLA
FT                   RIIRLVESAQAEKAPIQRLVDRVSAVFVPAIVAIAFATFAGWLVAGAGVETAILNAVAV
FT                   LVIACPCALGLATPAAIMAGTGVAARHGVLIKDAQALELAQRARIVAFDKTGTLTQGRP
FT                   TVTAFDAIGIPRGDALALAAAVQRASAHPLARAVVAAFDADADARRSSLAAAHADTPRA
FT                   VAGRGVEARVDARLLALGSTRWRDELGIAVPDGVARRAAALEAAGNTISWLMRADAPRE
FT                   ALALVAFGDTVKPNARRAIERLAARGIRSALVTGDNRGSATAVAASLGIDEVHAQVLPD
FT                   DKARVVAQLKATAGDGVVAMVGDGINDAPALAAADVGIAMATGTDVAMHTAGITLMRGD
FT                   PALVADAVDISRRTYRKIQQNLFWAFVYNLVGIPLAALGWLNPMIAGAAMAFSSVSVVT
FT                   NALLLRRWKGDAR"
FT   gene            complement(372162..372311)
FT                   /locus_tag="BURPS668_A0406"
FT   CDS_pept        complement(372162..372311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0406"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85619"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGE1"
FT                   /protein_id="ABN85619.1"
FT                   /translation="MEPPPRPPRAAHSRQPATILDLALDLPIMGKLILRTVGGTARLIE
FT                   SDCR"
FT   gene            372485..373705
FT                   /locus_tag="BURPS668_A0407"
FT   CDS_pept        372485..373705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0407"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86333"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGE2"
FT                   /protein_id="ABN86333.1"
FT                   /translation="MFPVSLWPLPRSPWLPPRRAAPRRAAPRYAKPSQAKPSRQCRRCY
FT                   RYCHRHGIDIDIDSGNGNGNGNGNSNSNGNSNGNSNSNSNSNSNSNSNGNGNSNSNSSR
FT                   HRYHPHLRRTPYERSSNYPLEVPQGGSMSTNMKRLMTAALGAALAFGALSARAASFDCA
FT                   HAANAAERAICGTPALGELDVRMAAYYEILQNARPADEGMAYREFRDALRDEQQRWRQR
FT                   TRDACGARIDCLTNAYTARIAALRGVAAERLVLRMTGGSAASAGAADATYAIEGESITL
FT                   ANGESVRPAAPGSAMKRVTTLVARSAVATIAGRPVEAVLLSDDPGGSGRFLYVATAQPG
FT                   GGAPAVLLGDRVKPVSVSIERAATGGAVVVVEYLDRPEGAPFAQAPTIKIVRRFALEQG
FT                   RLVEQRG"
FT   gene            complement(373950..374309)
FT                   /locus_tag="BURPS668_A0408"
FT   CDS_pept        complement(373950..374309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87093"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGE3"
FT                   /protein_id="ABN87093.1"
FT                   /translation="MINIWDRVEGGEGEGGEAAACPPRGAASGERSRRATLRRRHRAAS
FT                   ATRRGTIARMLEPPNTARPMLRRADVRRDSRFGGLAVWRRGFAVSPYRRIAVSPYRRIA
FT                   DSPRRRFDTSRPTRM"
FT   gene            374531..375952
FT                   /locus_tag="BURPS668_A0409"
FT   CDS_pept        374531..375952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0409"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF06742;
FT                   match to protein family HMM PF06863"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87810"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGE4"
FT                   /protein_id="ABN87810.1"
FT                   /translation="MTTNQRESTVSLRRACASLAALALLAACTSTPEAIQRKTGWMRSE
FT                   VADSYIYAYPLVLMDVAKEAATADGAPVNTLRHAQALPAPGAANPPLASVDMLDSTAWL
FT                   DVADEPVIVALPDGRGRYLDARALDMWTNVLWSTGPSANPRSGASRARTLAFVGAGWEG
FT                   TLPEGVTRVDVPARNVWLDVRIQTSGGRDLAAARKLQRAIRVEPLSVYTGDARGARADA
FT                   GAASAEPASGAAASPVAQVAALDPPAFFSRVARALQDNPPPAADAHAQEILADIGVTAG
FT                   APVQWKGDKLIGAENGAAEARERLTALPPNALAANGWSWLGDSVGNYGQDYALRAYAAS
FT                   TQFGAGTRDDETVAVVKTDSAGRPLNGAHRYVIRFAPNALPPARAFWSLAPYTPDGAVP
FT                   ELGRARRSIGERDRLRRNRDGSLEIVVSAAPPGKGYASNWLPAPRADFELALRLYAPKR
FT                   QAADGTWQPPAVVRK"
FT   gene            376108..380073
FT                   /locus_tag="BURPS668_A0410"
FT   CDS_pept        376108..380073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05359"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85633"
FT                   /db_xref="GOA:A3NGE5"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGE5"
FT                   /protein_id="ABN85633.1"
FT                   /translation="MAFNKETVQSNLQKLGVAARSRRAKRAGVGALIVLVAFGLLGFFA
FT                   APPLIRHIAEQQLSQQLERPATIARIAFNPYTLRLEADGVRVGERGGQGAFVDIGKLVV
FT                   RASWTSLARFAPIIDEVRLDQPRFRIVRYDAQRFNFTDLVDKFSKPSPQPSAKPARFSV
FT                   SNIQVNDGRIEFDDRLLNAKHVVDQWTVGIPFIATLPSKTDIFVEPKLRARLDGSPIAI
FT                   DGKTKPFAQSRESSINLKFDGLDVPRLLSYAPTKLPVDVRSGRLSSNLDVNFAMAGDTP
FT                   SLRVSGTLDLNDAQVTSRANEPLFAAHAVHVAAAQFEPLRNVLHFDDIRIDRPVVSLAR
FT                   DKAGVLNVMKLAGGEKAGAPPAARAAAPTSAGASAAAAAGAAGSSVSAVSPGSPAAARP
FT                   ASGAASQPAAAASSAAAAHAAAEKAPPLDLTIKRFAINDGALNLNDASLVTPAAISLQH
FT                   VATTLADFTLAGKTPARYTLAADVASGGSLKAEGAFSLAARQADTKLAIDALALPAVQP
FT                   YLAGASSARVLDGVLSTSVNAKADWSKTPLDAQVSDSELGLKSLKIVLPNAKTPAVALP
FT                   DARVKVTKIDLAARTAEIASVDATGLALDVARLQDGRIDLASLAGDGGRAAGAKPAASN
FT                   ASAARGARPAAPAWRYRIDELNVKDAKANFTDRSTPRPVKLAIAPLALNVRQISEDLSK
FT                   PLPVRLTATLNRKGSLELSGNVTAQPLKVGLKLNGNRLDAAAFEPYFGSMLNATVASAL
FT                   LNAKGELSVEQAKQSTKASYRGDAALVDVRMLDKATSDPFAGWRSLALANLKASYDDAR
FT                   GTDVDASRVTFSNFYGRVLLDAQGKLNLREVVAKESGPAQSLTRDASGKEPIPLTPQAA
FT                   SQAKAAIAASAVEPASAPVLASAAAASAAAGASAVAASPASGAAVVRAAAPPQHPVRLH
FT                   FGQLLLQRGRVTYTDNFIKPNYTANLVAINGTVGAFGTDSTAPAPVDVGANLAGNGPIT
FT                   IKGTVNPLIEKPSLDLTATAHDIELTNLTPYSAKYAGYPITKGKLNVDLHYKLDNDLLS
FT                   ANNHIFIDQLTFGEHVENDTATKLPVRLAIALLKNSRGEIDVNVPVSGSLSNPEFSIGG
FT                   LIWRAVLNLIAKAVTSPFTLLAHAFGGDGEALGYVEFEPGRSKLSDASQKKLDTISKML
FT                   AEKPSIRLDLIGRVDPDKDLPGLRDAYVERLVRQQKLKDVVGQGESVDPMTVKVDPAEY
FT                   TKYLTKAYKAADFKKPRNMIGFTKTLPDDDMRKALADHASVDDSSLRALAQARAQAVRQ
FT                   YLEGKVDSSRMFIVAPKLDAKGIEDKGATTRVDFGLK"
FT   gene            complement(380199..380420)
FT                   /locus_tag="BURPS668_A0411"
FT   CDS_pept        complement(380199..380420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87426"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGE6"
FT                   /protein_id="ABN87426.1"
FT                   /translation="MATLEAFRCVLDDARTPEIIRHHIIDALQYALRNYGQVFTAKEVE
FT                   WLAAWDDPRIPLAARKELDRREPAAAAR"
FT   gene            complement(380788..382449)
FT                   /locus_tag="BURPS668_A0412"
FT   CDS_pept        complement(380788..382449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0412"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="identified by match to protein family HMM PF01663"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85336"
FT                   /db_xref="GOA:A3NGE7"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGE7"
FT                   /protein_id="ABN85336.1"
FT                   /translation="MKRNSKQFEIGAWLGACALAFAGAASAAAVQDRDHDSRPVDAKRV
FT                   LLVSIDGLHEQDLTRCIGANTCPNLALLAKSGVTYTNARTPGLSDSFPGLAALVTGGSP
FT                   KSAGLFYDVSYDRTLYAPSDATCSGKQGWNVVFDETTGIDAMNGGALTHLDGGGAFNPQ
FT                   AIPHARVNGQCVSVYPHDYVKTNTVFEVVKEHLRGSHTAWADKHAWGYDWVNGPSGKGV
FT                   DDLARTEINSIDPATGTPYTDIYTHTEKFDDYHVQAIVNQIDGKNSTGTAAAPVPTLFG
FT                   TNFQTLSVAQKATVASGGGYLDASFTPGPEVANAIAYVDGALGRIVAELRQRGLYDSTV
FT                   VIVTAKHGQSPTDHTKLVKHGDTLTALLEANGFVDPNGNFGQNNTASGNPNDGTGLVGT
FT                   GFVQTDDVGLVWLRDPRQLSAAVATLKANLGCNAPGICADGPQAYILYGPSVAERFGDP
FT                   ALGRTPDIVVQPNPGVIYTSSKKKDEEHGGNAPDDSHLGLLVSYAGLRQGRTIDAPVLT
FT                   TQVAPTILRSLGLEPRLLHAVALEGTRVLPGLGLER"
FT   gene            complement(382513..382902)
FT                   /locus_tag="BURPS668_A0413"
FT   CDS_pept        complement(382513..382902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0413"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86325"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGE8"
FT                   /protein_id="ABN86325.1"
FT                   /translation="MPRGAVGCTRNHHERRRGARRSRRAPLRRDAAHARSSAALPRCRA
FT                   DERDTGNGPPPTRHLHSRAPPHTARTHAWRFPRSATPPSPSPRTSPRTAARPPAETHSH
FT                   NFAAPLVAQAPRAPTDKRKRRVTTR"
FT   gene            complement(383030..383419)
FT                   /locus_tag="BURPS668_A0414"
FT   CDS_pept        complement(383030..383419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0414"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87233"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGF0"
FT                   /protein_id="ABN87233.1"
FT                   /translation="MNPPVLRVARPTNDIDTLVRFYTKALGFDVVARFENHEGFDGAIV
FT                   GRAGYPWQIEFTHRHGVTVARAPTAEHLLVFYLPDRGAWTEAVARMRAYGATPCRSENP
FT                   YWDREGVTFEDPDGYRIVLQNAQPD"
FT   gene            complement(383547..383840)
FT                   /locus_tag="BURPS668_A0416"
FT   CDS_pept        complement(383547..383840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85764"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGF1"
FT                   /protein_id="ABN85764.1"
FT                   /translation="MTAMAMKKTDLEKNKALKLTHAMKQTTSARFGKGAEDAAADRRER
FT                   RRLEQAQGLVPFACKLNIELVARLNERAAAHPDGMTGLLTELLQRGLDETAK"
FT   gene            complement(383837..383983)
FT                   /locus_tag="BURPS668_A0417"
FT   CDS_pept        complement(383837..383983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0417"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86748"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGF2"
FT                   /protein_id="ABN86748.1"
FT                   /translation="MYRQMRAGRRRFAHGRPRRVRPGAPHGARRPISAPRGNAYNRILS
FT                   CKR"
FT   gene            384021..385070
FT                   /locus_tag="BURPS668_A0418"
FT   CDS_pept        384021..385070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0418"
FT                   /product="squalene/phytoene synthase family protein"
FT                   /note="identified by match to protein family HMM PF00494"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87690"
FT                   /db_xref="GOA:A3NGF3"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGF3"
FT                   /protein_id="ABN87690.1"
FT                   /translation="MGNSTRAFLLGPLLKGVSRSFYLTLRVLPQGMRDPIGLAYLLARA
FT                   ADTIADTSLIPPAQRLELLLSLRAQINGAPDPHALARIAGEVAGQQAQTDEKTLLESLG
FT                   PALAVLSQLSPPDRAAVRGVVTTLTEGMEFDLRTFPDESSGRIVALREWPALDRYTYLV
FT                   AGCVGEFWTKMTCAHLPGLLTEREDTMSERGIRFGKALQMTNVLRDCGRDLRIGRCYLP
FT                   QAMLDEYGLRAEDLLGPDASLRARPLMHALVRTTLAHFRAGIDYTFAIPRRAPRLRLAC
FT                   FWPIAIGLRTLALLASNDAWLDPARASKVRRGDVYRILAYSLPLAMSNGALRAWLDRLI
FT                   ADVEARLIA"
FT   gene            385070..385489
FT                   /locus_tag="BURPS668_A0419"
FT   CDS_pept        385070..385489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0419"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86990"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGF4"
FT                   /protein_id="ABN86990.1"
FT                   /translation="MRGAPGRARRRAARGRAEEGARRGGTGCRCPRRSRLPRLPRLPRR
FT                   SGGRDGDRRAVSHTRPSRAVRRRADGRHRAVPAMPGSRVPPMRTAHGARFPRFISPSRF
FT                   HSFAPFRECIDEPRRQPRRRPLRVRDGGRPARVAQ"
FT   gene            complement(385532..386563)
FT                   /locus_tag="BURPS668_A0420"
FT   CDS_pept        complement(385532..386563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0420"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88043"
FT                   /db_xref="GOA:A3NGF5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGF5"
FT                   /protein_id="ABN88043.1"
FT                   /translation="MMGIHESGNDAAQCARFTFAQKVAYKRNYFDFKSTMKVTLDELQA
FT                   FAAVVDTGSITAAAQQLGLTVSATSRTLARLEGKLKTTLLRRTTRRLELTEEGRTFLNS
FT                   ARAIIDSVESAEEQMLARREKPSGRLRVDAASPFMLHVIVPLVRGYRERFPRVELELNS
FT                   NEGVIDLLERRTDVAIRIGRLKDSTLHSRLIGNSRLRILASPAYLDAHGQPRKAGDLGK
FT                   HALLGFNQPESLNVWPILGADGEPCRIEPAVWSSSGETLRQLALDGAGIVCLSDFMTAQ
FT                   DREAGRLVQILARHTQDVRQPIHAVYYRNTAISSRIASFVDYLVDALGGGNAAQKAAAW
FT                   TRP"
FT   gene            386562..387764
FT                   /locus_tag="BURPS668_A0421"
FT   CDS_pept        386562..387764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0421"
FT                   /product="arabinose efflux permease"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87011"
FT                   /db_xref="GOA:A3NGF6"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGF6"
FT                   /protein_id="ABN87011.1"
FT                   /translation="MPLALLALTISAFAIGTTEFVIVGLIPTIASDLGVSLPSAGLLVS
FT                   LYALSVAIGAPLITALTGRVPRKTLLAALMALFTLGNLVAWRAPGYESLIVARILTGLA
FT                   HGVFFSVGSIIAMTLVPKDKAASAIATMFSGMTVAFVAGIPLGTFVGQHFGWRATFLIV
FT                   ALFGLVAFVGAAAFVPRDLAQTPPAPLARQLRVLAEPRLLLVFAMTAIGYGGSLIAFTY
FT                   MAPLLERLAGFTPPQVSLVLVGYGVSVAFGNVWGGKLADRIGPVGALKRIFLLLALVLL
FT                   ALTFTVHHAALAVPTMLAWGAVAFGNVPGLQVYVVKQARHFAPHAADVASGLNIAAFNL
FT                   GVAGGSSLGGLIVAHAGLGHTPWIAAVVTLGAFALSALSGALDRRDGLPARTAEPVGLA
FT                   H"
FT   gene            387791..388597
FT                   /locus_tag="BURPS668_A0422"
FT   CDS_pept        387791..388597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0422"
FT                   /product="2,5-diketo-D-gluconic acid reductase B"
FT                   /EC_number="1.1.1.274"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86917"
FT                   /db_xref="GOA:A3NGF7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGF7"
FT                   /protein_id="ABN86917.1"
FT                   /translation="MSGIPPFGLGTFRLQGQTVIDSVRHGLELGYRAIDTAQIYGNEAQ
FT                   VGEALAASGVRRDELFVTTKIWVDHHARDRLVPSLEESLAKLRTDYVDLTLIHWPAPGN
FT                   GVPLEECLGALADAKASGLTRRIGVSNFNIALTKRAIAALGKDAIATNQIELSPYLQNR
FT                   KLAAFLQDEGIHVTSYMTLAYGKVLGDPVIGAIARRHRATPAQVALAWALRLGYSVIPS
FT                   STKREHLASNLLAQTLRLTDDDLARVAALERNGREVSPDGLAPQWD"
FT   gene            388673..389788
FT                   /locus_tag="BURPS668_A0423"
FT   CDS_pept        388673..389788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0423"
FT                   /product="N-ethylmaleimide reductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by similarity to SP:P77258; match to
FT                   protein family HMM PF00724"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85430"
FT                   /db_xref="GOA:A3NGF8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGF8"
FT                   /protein_id="ABN85430.1"
FT                   /translation="MTQDPLFEPLRLGALTLPNRIVMPPMTRSRASRPGDEANELMAVY
FT                   YAQRASAGLIVSEGTYIAPLGKGYAWTPGIHTPAQIAGWRKVTRAVHAADGRMFAQLWH
FT                   VGRLSHASLLGGRQPVSSSPIQAKGVNVFVAGEDDSTPGFVQASEPRALGIDEIREIVG
FT                   QYRAAARHALDAGFDGVELHGANGYLVNQFIDSRANTRTDEYGGSLVNRLRFLREVAQA
FT                   LIEGTGDASRVGIRLAPLTTLNGCVDDDPQTTYLAAAELLGELGVGYLHIAEADWDDAP
FT                   LMPVEFKRKLREAFPGVLIYAGKYTAERAREALAAGWADLIAFGRPFVANPDLPERLRA
FT                   GAPLAPHDRGTLFGGGAHGLTDYPALAQGAV"
FT   gene            complement(389829..390149)
FT                   /locus_tag="BURPS668_A0424"
FT   CDS_pept        complement(389829..390149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87943"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGF9"
FT                   /protein_id="ABN87943.1"
FT                   /translation="MVGSPTIDMDRRVDGGAAPTFKFRAAGPCVRPRSLSPPAGLRPEP
FT                   SRDRYSRSGIKPGLKPRDAGRRKDVRDERARPAMNAPVASGAGARFGHRLRAAASRSFD
FT                   MR"
FT   gene            390162..390356
FT                   /locus_tag="BURPS668_A0425"
FT   CDS_pept        390162..390356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0425"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87316"
FT                   /db_xref="GOA:A3NGG0"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGG0"
FT                   /protein_id="ABN87316.1"
FT                   /translation="MRLLLALLLPWLQFFTIGRPFAGIICLILQITLIGWLPAAIWSVY
FT                   ALSQYKTDRKIEEALGRRS"
FT   gene            complement(390697..390867)
FT                   /locus_tag="BURPS668_A0426"
FT   CDS_pept        complement(390697..390867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0426"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86402"
FT                   /db_xref="GOA:A3NGG1"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGG1"
FT                   /protein_id="ABN86402.1"
FT                   /translation="MKTSITTTTEPRAVARGARLPGWMWFALLWMGGVAGAVTLGYAFK
FT                   LFMYATLFAVK"
FT   gene            complement(390839..391846)
FT                   /gene="cioB"
FT                   /locus_tag="BURPS668_A0427"
FT   CDS_pept        complement(390839..391846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cioB"
FT                   /locus_tag="BURPS668_A0427"
FT                   /product="cyanide-insensitive terminal oxidase CioB"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by similarity to GB:CAA71556.1; match to
FT                   protein family HMM PF02322; match to protein family HMM
FT                   TIGR00203"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88399"
FT                   /db_xref="GOA:A3NGG2"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGG2"
FT                   /protein_id="ABN88399.1"
FT                   /translation="MDVTVIWAAIIALGLFMYVVLDGFDLGIGIVFPFFPAEQERDLMM
FT                   NTVAPVWDGNETWLVLGGAGLFAVFPIVYSTVLSALYLPLVFMLVCLIFRGVSFEIRAK
FT                   ARRTKHLWDLAFIGGSTGATFFQGVALGAFLQGIPVDGGRFAGDAFGWLTPFSLLTGLG
FT                   LIATYALLGCCWLVAKTEGDLQRRLHRVVWPLTVVLLGFIAVVSLWTPLQDTNIAQRWF
FT                   ATGLFWRLLPVPFLVAGCAVLMRRAVRERHDTTPFALALALVFLGYVGLLASLWPYAIP
FT                   QSVTLWEAAAPRSSQTFTLIGAAVIIPVILAYTTMGYWVFRGKVRHEDQHYYHH"
FT   gene            complement(391882..393294)
FT                   /gene="cioA"
FT                   /locus_tag="BURPS668_A0428"
FT   CDS_pept        complement(391882..393294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cioA"
FT                   /locus_tag="BURPS668_A0428"
FT                   /product="cyanide-insensitive terminal oxidase CioA"
FT                   /note="identified by match to protein family HMM PF01654"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87422"
FT                   /db_xref="GOA:A3NGG3"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGG3"
FT                   /protein_id="ABN87422.1"
FT                   /translation="METAFSALDLARVQFAFTVSFHIVFPALSIGLASFIAVLEYRWLK
FT                   TGKAYYKSLCLFWSKIFAVAFGMGVVSGVVMAYQFGTNWSGFSSFAGSVTGPLLMYEVM
FT                   TAFFLEAGFLGIMLFGWNRVSPRAHFGATLMVAIGTLISTFWILASNSWMQTPQGFEIV
FT                   DGQVVPTDWFAIIFNPSFPYRLAHMAIAAFVVAALVVAATAAWHLLKGRRDKAVKKMFS
FT                   MSLWLLLVLAPLQAVIGDQHGINTLRHQPAKLAAIEGLWETEPGGTALNLFGIPDMKAQ
FT                   TTRYAVSIPHLGSLILTHSWDGEIRGLKSFPPQDRPNSTVVFWSFRIMVGLGLAMIGLA
FT                   ALAWLLRRRGRLYEAKWFHRFALAMGPTGFVSLLAGWVTTEVGRQPWVVYGVMRTSHAV
FT                   SPLSTQQVSVSLMTFVVVYFLVFGTGVYYMLKLMRKGPALPGDTPDDAHDARPERTARR
FT                   PLSAANQLIDAA"
FT   gene            393890..394903
FT                   /gene="ltaE"
FT                   /locus_tag="BURPS668_A0430"
FT   CDS_pept        393890..394903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ltaE"
FT                   /locus_tag="BURPS668_A0430"
FT                   /product="low-specificity L-threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="identified by match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85989"
FT                   /db_xref="GOA:A3NGG4"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGG4"
FT                   /protein_id="ABN85989.1"
FT                   /translation="MIDLRSDTVTRPSAPMLAAMTAAEVGDDVWGDDPTVARLQAVVAE
FT                   RAGKEAALFFPSGTQSNLAALMSHCERGDEYIVGQAAHTYKYEGGGAAVLGSIQPQPIE
FT                   NAADGTLPLEKIAAAIKPIDDHFARSRLFTLENTIGGKVLPAGYVDEAVALARSRGLAA
FT                   HLDGARVCNAAVASGRAIAELCAPFDSVSICFSKGLGAPVGSVLVGSGALIERAHRWRK
FT                   VLGGGMRQAGVLAAACLYALEHNVERLADDHANAERLAQGLARIEPVKVLSQATNMVFA
FT                   QFPEADCAPLEAWLKERGILTQMLYASRFVTHCDVSRDDIDTAVAAISAYFARSRA"
FT   gene            complement(394872..395849)
FT                   /gene="iciA"
FT                   /locus_tag="BURPS668_A0429"
FT   CDS_pept        complement(394872..395849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iciA"
FT                   /locus_tag="BURPS668_A0429"
FT                   /product="chromosome initiation inhibitor"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM TIGR03298"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86914"
FT                   /db_xref="GOA:A3NGG5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGG5"
FT                   /protein_id="ABN86914.1"
FT                   /translation="MTIDPKQAAALVAVADTGSFEQAAARLHVTASAVTQRVRALETSL
FT                   GAPLLLRTRPCRPTAAGQRVLQHLRRMALLQVDLQAELEAERGSTIAVAIALNSDSLGS
FT                   WFLPALTSVLAGERMLFELIVEDQDHTFALLESGMAIGCVTTQSKPMRGCFATPLGTMR
FT                   YRLIAAEEFAARWFAQGLTRESAREAPVVAHGRRDTLQSSFLRDKLGLPDGAFPCHYVP
FT                   GTHAHFAAVRHGLGYAMVPELLLGTTPLAEQRLVDLAPAHSTDVSLYWHAWTVQSPKME
FT                   SLSSRVVEAAQQLLAPPPRGAAAAGGRAAAAPAPVKRANARNTR"
FT   gene            complement(395846..396037)
FT                   /locus_tag="BURPS668_A0431"
FT   CDS_pept        complement(395846..396037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87543"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGG6"
FT                   /protein_id="ABN87543.1"
FT                   /translation="MIGHVEILRWQMRRTPSRGCCSARCARAHCPGRIPIPIQYLAQVD
FT                   YAKFYLGGRCARRHASDR"
FT   gene            396026..398167
FT                   /locus_tag="BURPS668_A0432"
FT   CDS_pept        396026..398167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0432"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912; match to protein
FT                   family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86838"
FT                   /db_xref="GOA:A3NGG7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGG7"
FT                   /protein_id="ABN86838.1"
FT                   /translation="MTDHTPHSSPPASPTPPQGPAPKRRRYFRTLAGLVLGAAIAGGAV
FT                   GTWTLHRIWTALPSVEPLAVYRPALPLRIFSREGELLAEYGVERREFVPLDRIPPLVRH
FT                   ALLAAEDAQFYTHGAVDIGGLARATVANVVTGQPGQGGSTITMQVARNFFLTREKVLSR
FT                   KLAEILMSYKLERAYSKDKLLELYMNEIYLGERAYGFAAAASVYFGKPLDALTPGEAAV
FT                   LAGLPKAPSAFNPVVNPARATMRRNYVLGRMRALGYLDEAAYRQAADAPIALATTPPPG
FT                   ILAAPYVAERARRMMVERFHDDAYTLGLDVTTTIAMREQRAADAALARGLAQVGRRDAK
FT                   DALEGALVSIDAATGDILALVGGADFSHNVFDHALQAYRQPGSSFKPFVYSAALEKGMF
FT                   PGVLIDDTQRTLSRDETGANPWRPRNFGNHYEGFIPVRRGLMRSKNLVAVSLMQVARPD
FT                   FVQQHAARFGFEPLRNPASLPLALGAGSATPLEVASAYGVFANGGVRMEPRLIESVRQR
FT                   HGGALFDAQPAPGVRVISARNAFVMDSMLRDVVAHGTARRAVALKRADAAGKTGTSNGS
FT                   KDVWFAGYSSGVVSVVWMGYDAPRSLGRATGSSAALPVWVDYMKTAVDGRGAIERTPPA
FT                   DVALVDGDFVYAEYANGDKCAPSLPPFVRSPFACGAARGAPADGGAPASAAGAAGAPTP
FT                   AAVDAAERARVLELFRTED"
FT   gene            398180..398788
FT                   /locus_tag="BURPS668_A0433"
FT   CDS_pept        398180..398788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0433"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03458"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86069"
FT                   /db_xref="GOA:A3NGG8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGG8"
FT                   /protein_id="ABN86069.1"
FT                   /translation="MHTLYLIAIVAEAMSGALMGMQRGMDRFGLALVGAVTALGGGTVR
FT                   DVLLGRYPLTWVAHPEYLLLTLAAATFASMTATHVARLKSLFTAVDALGLAAFSIIGCD
FT                   VAAAVNGSPVVIVLAGAITGVCGGMLRDLLCNEMPLVLRKELYASIALLTGGLYVGMKA
FT                   IGAAQGFATVAALAVGFALRMLAVRRGWRLKAFQAADAG"
FT   gene            complement(398837..399655)
FT                   /gene="hmuV"
FT                   /locus_tag="BURPS668_A0434"
FT   CDS_pept        complement(398837..399655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuV"
FT                   /locus_tag="BURPS668_A0434"
FT                   /product="hemin ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88287"
FT                   /db_xref="GOA:A3NGG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGG9"
FT                   /protein_id="ABN88287.1"
FT                   /translation="MLNADHLHVARDGRAILNDLSIRIAPGCVTALLGRNGAGKSTLLG
FT                   VLAGDLPAGGLARGATVRGGVALNGEPLHAIDAPRLARLRAVLPQASRPAFAFSAREIV
FT                   LLGRYPHARRAGALTYADGEIASQALALAGATALDARDVTTLSGGELARVQFARVLAQL
FT                   WPPPGAAQPPRYLLLDEPTAALDLAHQHQLLDTVRRLSRDWNLGVLTIVHDPNLAARHA
FT                   DRIAMLADGAIVAQGAPADVLRPEPIARCYGFRVRLVDAGDGVAPVIVPA"
FT   gene            complement(399649..400053)
FT                   /locus_tag="BURPS668_A0435"
FT   CDS_pept        complement(399649..400053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0435"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87514"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGH0"
FT                   /protein_id="ABN87514.1"
FT                   /translation="MRTRLRRRPAGQADDVRARRACRRIGTLAAPMPNASVGAASRAAW
FT                   SIRVEFVEFVESIESFESIESIESFGSFGSFGSFGSFGSFGSFGSFESQVHRTHLTHRV
FT                   HRVHRTRTRTHREPHRKPIDSPPIAHRTPC"
FT   gene            complement(400056..401177)
FT                   /locus_tag="BURPS668_A0436"
FT   CDS_pept        complement(400056..401177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0436"
FT                   /product="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85570"
FT                   /db_xref="GOA:A3NGH1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGH1"
FT                   /protein_id="ABN85570.1"
FT                   /translation="MSLAARRHSARPISAERGSTCASRALAALRRRRARWTLAALIAAL
FT                   AAASIAALCIGAYRLSPAQLLGALTATDAQLAGDAALRQARAVLVDIRAPRVVLALFVG
FT                   AGFGAAGAAMQALFRNPLADPGLIGVSSGAALGASALIVLGPLFAARLALGLLPVAAFA
FT                   GALAVAALVYRLAVARGRLALPLLLLAGIAINALAGAGIGLLTYLADDAQLRSLTFWSL
FT                   GSVGGAQWRTIAAVAPFALAGCVLLARERHALNALQLGEAEAMHLGVPVPRVKRRVLVG
FT                   TAMCVGALVSCTGAIGFIGLVAPHCVRLAAGADQRIVMPGAALFGALLAVAADLAARTL
FT                   AAPAEIPLGILTALIGAPFFLALLWKRRGALGG"
FT   gene            complement(401174..401566)
FT                   /locus_tag="BURPS668_A0437"
FT   CDS_pept        complement(401174..401566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0437"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88237"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGH2"
FT                   /protein_id="ABN88237.1"
FT                   /translation="MNGRLRRRLAGRAPGRTARLRVAPRACAIVRTPERMATRARLACL
FT                   ACLACLACLACLACLARLARLARLARLARLARLARLACAAYAAYAAREACRFARGAATV
FT                   AAARAPQAGRRAYASSAPPLPFDFTR"
FT   gene            complement(401563..402489)
FT                   /gene="hmuT"
FT                   /locus_tag="BURPS668_A0438"
FT   CDS_pept        complement(401563..402489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuT"
FT                   /locus_tag="BURPS668_A0438"
FT                   /product="hemin ABC transporter, periplasmic hemin-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87030"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGH3"
FT                   /protein_id="ABN87030.1"
FT                   /translation="MSKPPRIDARRRAWLAGTGALVFAAAHPGAFARAPASAPPKRVVA
FT                   IGGALAETIYALGGARTARYELVGTDTTCTYPEAARRLPKVGYQRALSTEGLLSLRPDV
FT                   VLASAEAGPAAALSQLARAGVAVTTFDEAHDVESVRRKIRGIANALSLQATGDMLLARF
FT                   DRDWLAARAAADAAPPRGRERTPARVLFVLNHSGNQALVAGQQTAADAMIRYAGAHNAM
FT                   QGFDRYKPLTAEALVAAAPDVVLITDEGLQAAGGRDALLAAPGFGATPAGRARRVVSLD
FT                   ALFLLGFGPRLPQAVTALQRRLNSVLA"
FT   gene            complement(402486..403637)
FT                   /gene="hmuS"
FT                   /locus_tag="BURPS668_A0439"
FT   CDS_pept        complement(402486..403637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuS"
FT                   /locus_tag="BURPS668_A0439"
FT                   /product="hemin transport protein HmuS"
FT                   /note="identified by match to protein family HMM PF05171"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86327"
FT                   /db_xref="GOA:A3NGH4"
FT                   /db_xref="InterPro:IPR007845"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGH4"
FT                   /protein_id="ABN86327.1"
FT                   /translation="MMNTAAPAASPARALAPDELRDAFLHLKETRKLRNRDVAQLLGVS
FT                   EGEALAAFAGERVVRLESSFVELFEEMPRLGGVMALTRNAAAVHEKDGAFEQMSHDGPV
FT                   GLALGAIDLRIFYRNWAAGFAVYEPTAHGVMKSLQFFDAQGDAVHKVYLRKHSDHAAFD
FT                   AFVSRWRMPVQSPAFAVEPAPPAHVERPDGEIDAAGLRAAWDAMTDTHQFHGVVRRHGV
FT                   SRTQALRLAGASRAHRVATDAARRVLERAAQTRLPIMVFVGNRGMIQIHTGAVTNIRRM
FT                   GTWINVLDEDFNLHLREDLVASAWVVRKPTSDGAVTSVELFDAAGDNIAMLFGARKPGQ
FT                   PELAGWRELAGALPRLDTADAADAATVAHAADVPVATDAGAAR"
FT   gene            complement(403694..405988)
FT                   /locus_tag="BURPS668_A0440"
FT   CDS_pept        complement(403694..405988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0440"
FT                   /product="TonB-dependent hemoglobin/transferrin/lactoferrin
FT                   receptor family protein"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01785; match to protein family HMM
FT                   TIGR01786"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87859"
FT                   /db_xref="GOA:A3NGH5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGH5"
FT                   /protein_id="ABN87859.1"
FT                   /translation="MARQPLRAALFGAFGLYAAAARAAGPASEPAAAAPPAAASAASTS
FT                   QVRHAAIAAARKDAPALDPITVTATRTASAASRTAASVSVITDSDLEEQQADNIKDALR
FT                   YEPGVTVRRTAYRPANAALGGGRDGDSSINIRGLEGNRVLLMEDGIRLPSAFSFGPLEA
FT                   GRGDYADLDTLARIEILRGPASALYGSDGLTGAVNFITKDPSDLLSIHRKKTYFSFRPS
FT                   YDSVDRSIGATVTAAGGNDRVQAMLIASGRRGHELDTHGDDNSASTRRTRANPQDVYTE
FT                   SLLGKLTITPTARDTIKLAAETVRRRIDTNVLSAINPPTTLGLTANDRLERNRFSIDYD
FT                   LRDAAARGFQTAHVQFYYQESTQDQDAFETRGGRLQSRSRSNHYSERALGGSAFAESGF
FT                   ATGPLAHKLLYGVDGSIDRIKSLREGTVASPGESFPNKAFPDTDYSLFGAFVQDQIGFG
FT                   KLLVTPGLRFDAYRLSPSSGDPLFTGKTVSSSDHELSPRVAMLYEVSPALIPYAQYAHG
FT                   FRTPTPDQVNNSFSNPIYGYTSIGNPNLKPETSDTLEAGLRGTLGTGYGPLRYSVAAFA
FT                   GRYRNFISQRTVGGSGRPNDPLVFQYVNFANARIHGFEGRAEWVMPNGFTLKTAMAFTK
FT                   GTTQDNGAASEPLDTVNPFSAVFGVRYEPSERWFAQADLLWQAGKRGRDVSSAACQKKT
FT                   CFTPPSSFVVDLRGGYRFNKHVSAYLGIHNLFDRKYWNWSDVRGIAADSNVLDAYTAPG
FT                   RSVAVSMKVDF"
FT   gene            complement(406351..406467)
FT                   /locus_tag="BURPS668_A0441"
FT   CDS_pept        complement(406351..406467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0441"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86750"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGH6"
FT                   /protein_id="ABN86750.1"
FT                   /translation="MTHARAGDSRRRRCNMAGGDIRRDGAPLRAPVPIMPDR"
FT   gene            complement(406464..406691)
FT                   /locus_tag="BURPS668_A0442"
FT   CDS_pept        complement(406464..406691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0442"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85505"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGH7"
FT                   /protein_id="ABN85505.1"
FT                   /translation="MNVQTLSGVLHAQELLFVSLIRVLPLETRQALADEFDRQIQLAET
FT                   SRLEAPHDREAHDAFLAHVRKLLIRLESMA"
FT   gene            complement(406755..406880)
FT                   /locus_tag="BURPS668_A0443"
FT   CDS_pept        complement(406755..406880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0443"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86215"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGH8"
FT                   /protein_id="ABN86215.1"
FT                   /translation="MDARRVRMRMTRIAPPCPRRRTCALVTRRNRAPLGFCARRT"
FT   gene            complement(406850..407746)
FT                   /locus_tag="BURPS668_A0444"
FT   CDS_pept        complement(406850..407746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0444"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87715"
FT                   /db_xref="GOA:A3NGH9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGH9"
FT                   /protein_id="ABN87715.1"
FT                   /translation="MKHLYPNVAELHAFASSAKHLNFSYAARELGLTPSAVSRQIASLE
FT                   ALLGVKLFVREGRNLALTRAGQVYQARVAGPLREIGNASLELLSAREDSNLLTIASVPT
FT                   FTTKWLVPRLPRFLETAPDITLSFRRHLAPGDLFPLGLDAAIRYGDGRWEGVQCDYLDG
FT                   RTFVPVCAPGFAERYALREPADIAAAPRLVHEQAECAWLAWADRHRATQMNALAGPRFE
FT                   QYSVLIQAAQAGLGIALIPAFLIRAPLAAGTLVQPLDAPVDVDEQSHYLCYAPERLQAS
FT                   ASLRLLREWMLGECACA"
FT   gene            complement(407798..407914)
FT                   /locus_tag="BURPS668_A0445"
FT   CDS_pept        complement(407798..407914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88465"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGI0"
FT                   /protein_id="ABN88465.1"
FT                   /translation="MAALTGDEGKRHAKRPPQQALRESRRRPPVWARDMASS"
FT   gene            407913..408761
FT                   /locus_tag="BURPS668_A0446"
FT   CDS_pept        407913..408761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0446"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85881"
FT                   /db_xref="GOA:A3NGI1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGI1"
FT                   /protein_id="ABN85881.1"
FT                   /translation="MRSSTTAGFAGGIPFRRGKRRPSFGAIVVNGVVALFALYLLMPIV
FT                   LLLIGSIGQSWTNTLLPAGFTWRWFAELAADPSLRRAFSVSFVVALACCALDTLAGVPL
FT                   AYALHHRALRGCGVAARVVMLTPIGVPALTLGFGYIVVFGGDALPWLGTLPLMIAAHAV
FT                   LTLPYLLQTLLSDLRHLDLAKLEACAATLGAPPLRQFFTIVLPNLRQSLFSGLVMVAAL
FT                   SIGEFQVSNLIAGFRYRNFPVVLLQAFYGASGIACAASVVLLLLAVLATLASTHTVQRL
FT                   K"
FT   gene            408766..409809
FT                   /locus_tag="BURPS668_A0447"
FT   CDS_pept        408766..409809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0447"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86611"
FT                   /db_xref="GOA:A3NGI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGI2"
FT                   /protein_id="ABN86611.1"
FT                   /translation="MSLEFDNVSFRYPGGAHGVDAVTLHAQPGELLAVIGRSGSGKSTL
FT                   LRLSAGLLDGYAGRIAIGGADMAGVPVWRREVGMVFQQYALFPHLSVADNVAYGLRMRG
FT                   VAAAERRRRALEMLERVGLAAHAARSTTQLSGGQQQRVALARALVIEPALLLLDEPLAA
FT                   LDAGIRHQLRDEIRALQRACRATTLFVTHDQDEALSMADRVAIVDGGRVLQVGTPRSLY
FT                   ERPVSAQVARFIGHSTILRGRVQAGGTIDVRFATLCADTGAHRPGAEVDVLVRPEHVEP
FT                   DPPAQCVNRIEGALGEVRYFGATHRYDFLPHGAAHPLLCEGRVLAARGVAIEPRHLLVL
FT                   PASGGAR"
FT   gene            409836..410924
FT                   /locus_tag="BURPS668_A0448"
FT   CDS_pept        409836..410924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0448"
FT                   /product="putative ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86158"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGI3"
FT                   /protein_id="ABN86158.1"
FT                   /translation="MSENRPLLTALRRAALAFGMCATLVANGASAEPLYAGEDALYAKA
FT                   ADEGLVVSFDTGPEWANWKALFAAFRKRYPKVELTYNDIGSAATVVALDKSRRRPQADT
FT                   AYYFAASALDAAGKDVVAPFKPVNFDKLPPVFREADGRWFTVHSLNVAFLVNRKLVKNV
FT                   PRRWSDLLKPEYRNAVVYLDPRSTGQGQVVVFAAASALGGGVDDPKPGAEFFGKLKHAG
FT                   NVLRIEGTTPYAKFVKGEIPILIGYENDGLKAKYADGLGDAVDVVIPQDGSVCAPYAMS
FT                   LVKNGPNPAAAQLWLNFVMSDAGQALFAHGYVRPAVPGVALAPDVAAKMPNAPQVRALD
FT                   VAKAAARKAEVDRLWSQAALGQ"
FT   gene            410935..411762
FT                   /locus_tag="BURPS668_A0449"
FT   CDS_pept        410935..411762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0449"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87295"
FT                   /db_xref="GOA:A3NGI4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGI4"
FT                   /protein_id="ABN87295.1"
FT                   /translation="MQRSFLERGLLRRFGAAPAGGLLALFFVLPLAALVSAAFAEGGRA
FT                   FAAVLHDPLVGDAIGRSLALAVGTGTLSTCVGVPLALSFAEQPPARRRWLLALLGVPLA
FT                   FSGLVIAYGFILTFGRAGFVTTLLAGLGADAAKVGGVIYTTFGLVIAYAYYLIPRVALM
FT                   LFPAFANLERRPLEAAMSLGAKPWRAWLDVAWRELWPSVMAAWCLVTAIALGTYGTALA
FT                   LAGTQINILPLLMYLKLSDGQTDFSQAAVLSIVLTALCTCVLAMGEYVGRRHR"
FT   gene            411743..412288
FT                   /locus_tag="BURPS668_A0450"
FT   CDS_pept        411743..412288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0450"
FT                   /product="conserved hypothetical protein TIGR00725"
FT                   /note="identified by match to protein family HMM TIGR00725"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88531"
FT                   /db_xref="InterPro:IPR005268"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGI5"
FT                   /protein_id="ABN88531.1"
FT                   /translation="MGDDIAEYKPDVADALARVALRQQGPRRHLMPVGLIGPRDATGEQ
FT                   LRIAEGVARALAATGLVIVGGGKGGVMEAAARGARRANGLVIGLLPEDDAGGANPHLSV
FT                   ALPTGLGITRNALIARASLCLVAVGGGLGTLSEIALGLQWGKPVFTICDAPQVTGVENF
FT                   DAPDRLLARVAQWLADSA"
FT   gene            412355..412642
FT                   /gene="opcP"
FT                   /locus_tag="BURPS668_A0451"
FT   CDS_pept        412355..412642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opcP"
FT                   /locus_tag="BURPS668_A0451"
FT                   /product="porin, Gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88299"
FT                   /db_xref="GOA:A3NGI6"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGI6"
FT                   /protein_id="ABN88299.1"
FT                   /translation="MKKAAAAWLVAGSMCAGAHAQGTVTLYGIVDAGLGYTSDQRVAQT
FT                   KGALGSPVGYRNESSYGFASGTWSGSRWGAEGQGGAGRRSCSRVPARERL"
FT   gene            412677..413555
FT                   /gene="opcP"
FT                   /locus_tag="BURPS668_A0452"
FT   CDS_pept        412677..413555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opcP"
FT                   /locus_tag="BURPS668_A0452"
FT                   /product="porin, Gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85675"
FT                   /db_xref="GOA:A3NGI7"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGI7"
FT                   /protein_id="ABN85675.1"
FT                   /translation="MFGRQAWMGLSSERYGTLTMGRQYDPIVDFVGTIGAGAFLTGMGA
FT                   HPGDLDNIDNQARENNSIKYVSPKFGGLALGALYGFGNQAGSVKNQNTWSVGGQYVNGP
FT                   FSLGAAYLYATNAYGANGGAWTGSYDGTFASSINEGFASAKSMQIVAAASTYQIGAVTL
FT                   GLSYSNTRYKSGAFSTFNGTATYNSIGGTVSWQATPELRVAAGYDFTRGSSIDGQSAPK
FT                   YHQVNFASYYYLSKRTALYGLVGYQKASGKTLDAYGNVVAATASVGDVGNGISSAGDTQ
FT                   TLVRIGVRHTF"
FT   gene            complement(413611..414630)
FT                   /locus_tag="BURPS668_A0453"
FT   CDS_pept        complement(413611..414630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0453"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF04198"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88379"
FT                   /db_xref="GOA:A3NGI8"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGI8"
FT                   /protein_id="ABN88379.1"
FT                   /translation="MTRTAVHDAAQRAAPLDHDMTNEELTQLAKCYYVDGLTQEELAQK
FT                   FAISRPKVGRLLKRAIEEGIVEIRVRHHPRAVQDLEQELVTRFGIQRAIISVDHKDQDS
FT                   QRELLAGLVASYLDRVLADGAIVAVGMGRNVSAVSRHAVSTTQRNCSFVSAIGGSYRGG
FT                   ETMNADHICRRLAARFGGESETLYAPALVNDPQLFTALLENDVVRQSLDKARRASIALV
FT                   GIGDILEDSNMVRMGWFTPEEMAEAKRAGAVGDIMGYDFIDIHGRPATTMLRGRVIGLT
FT                   LEDLKRIPNVIATASEPTKATGILGALRAGVINTLATTQSIAQTVLSLAQATETASAA"
FT   gene            complement(414608..415102)
FT                   /gene="rpiB"
FT                   /locus_tag="BURPS668_A0454"
FT   CDS_pept        complement(414608..415102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB"
FT                   /locus_tag="BURPS668_A0454"
FT                   /product="ribose-5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by match to protein family HMM PF02502;
FT                   match to protein family HMM TIGR00689; match to protein
FT                   family HMM TIGR01120"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85531"
FT                   /db_xref="GOA:A3NGI9"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGI9"
FT                   /protein_id="ABN85531.1"
FT                   /translation="MKVAIGCDEAAYALKESIKRHLRATHPELELVDFGTHSADEAVLY
FT                   PDIAIEVAQRVAAGEFPRAILLCGTGIGVAISANKVPGIRAAQCHDTYSAERARRSNDA
FT                   QIVTMGARVIGTELANSIVDAWLRAEFDGGRSQPKVQRIADYERRAGLTQAGPNDAHRG
FT                   S"
FT   gene            415376..416857
FT                   /locus_tag="BURPS668_A0455"
FT   CDS_pept        415376..416857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0455"
FT                   /product="ABC-type sugar transport system, ATPase
FT                   component"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86938"
FT                   /db_xref="GOA:A3NGJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGJ0"
FT                   /protein_id="ABN86938.1"
FT                   /translation="MTPVLLEASQVAKRFNGVSALRDGRLSLAAGRVHALCGGNGTGKS
FT                   TFLNILMGLLRRDEGTIRLNGRDVDFASPAEALASRMAIITQELSPVPGMTVAENLYLG
FT                   REPTRAGVVVDFRALKRRAQALLDRLGFAIDAGAPMHRLSLAQTQLVEIAKAFSHDCQV
FT                   MIMDEPTSAIGERETETLFAAIRNVTAHGAGIIYVSHRLSELFDIADDYTVFRDGAYVE
FT                   SGRLADIDRAHLVRAIVGREMPVVDKARRPAHGAPCLKVEGLTRANEFEDVSLDVRRGE
FT                   ILGIYGLMGSGRSEFLNCVYGLTRPDAGAATLGGKPLPRGEPARSIRAGIALVTEDRKD
FT                   SGLVLCGSVQENIAMAAYRRLSRGGVIRRSLVRRLAQAMVERLRIKAASLRMPVSAMSG
FT                   GNQQKVVLAKCLSTEPVLLLCDEPTRGIDEGAKQEIYRLLDAFARDGGAVIVVSSEAPE
FT                   LLYLSDRIAVFKGGRVAAVRPGDGATQESLLHLAS"
FT   gene            416911..417843
FT                   /locus_tag="BURPS668_A0456"
FT   CDS_pept        416911..417843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0456"
FT                   /product="ribose/xylose/arabinose/galactoside ABC
FT                   transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87410"
FT                   /db_xref="GOA:A3NGJ1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGJ1"
FT                   /protein_id="ABN87410.1"
FT                   /translation="MNVAELASRFGIPIVFVALCVVLAFASPYFLTWRNWSDILRQTSI
FT                   NGILAIGMTYVILTKGIDLSVGSVLALAGIVSGLAGAAGHGLAVSLAAGVACGAALGAI
FT                   NGVAIARLNVPPFVATLGMLSVARGVTYIANDGSPVANLPDDYLSLGIGRLGPLGMPVL
FT                   IFAGVALACWWVLRYTTYGRYLYAVGGNEKSARTSGIGVRKVVFSVYVISGALAGLAGM
FT                   ILAARTTSALPQAGMSYELDAIAAVVIGGTSLSGGQGGVVGTLFGALLIGVINNGLNLL
FT                   GVSSYYQQIAKGLIIVLAVLIDVARKQQR"
FT   gene            417875..418903
FT                   /locus_tag="BURPS668_A0457"
FT   CDS_pept        417875..418903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0457"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87118"
FT                   /db_xref="GOA:A3NGJ2"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGJ2"
FT                   /protein_id="ABN87118.1"
FT                   /translation="MQTRKTWFGRFAAAAALGATLAIAAAGSAAHAASGPYRIGAAVYG
FT                   MKGQFMQNWVREIKAHPAVKSGAVQLTVFDGNYDALTQNNQIETMLTQQYSGILFVPID
FT                   TKAGIGVAARAGASDTPLVASNTMLATPKVPYIGNDDVEGGRLQAEALARRIGGKGNVV
FT                   IIQGPIGQSAQIDREKGEMGVLAKYPGIKVIEKKTANWSRAEAMNLMEDWLNAHPKQIN
FT                   GVIAQNDDMALGALQAIKNRGLTPKDIPITSIDGMPDAIQAAKRGEITTFLQDAQAQSQ
FT                   GALDLVLRQLVGAGYKPQSVIWQRYAKDLKWDGGTAKRYILPWVPVTPANADQLYKQVT
FT                   GG"
FT   gene            418915..419685
FT                   /gene="kduD"
FT                   /locus_tag="BURPS668_A0458"
FT   CDS_pept        418915..419685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kduD"
FT                   /locus_tag="BURPS668_A0458"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.125"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87892"
FT                   /db_xref="GOA:A3NGJ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGJ3"
FT                   /protein_id="ABN87892.1"
FT                   /translation="MTNLWDRAFDLTGRVALVTGGAAGIGHACARLLAQRGASVALVDR
FT                   HPETAGIAATLEGGAARHSGMSLDLRDCSAAQAGVALAASRFGGVDMLVNSAGVALLDK
FT                   ALDVGEAAWDATMAINVKASFFVAQAAARQMIAGARGGRIVNLASQASVVGLERHAAYC
FT                   ASKTAIVGMTKALALEWAPHGITVNAVSPTIVETALGKQAWAGEAGERAKREIPAGRFA
FT                   QPDEIAALVLYLLSDAAAMMTGENVVIDGGYTVR"
FT   gene            419751..420887
FT                   /locus_tag="BURPS668_A0459"
FT   CDS_pept        419751..420887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0459"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85687"
FT                   /db_xref="GOA:A3NGJ4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGJ4"
FT                   /protein_id="ABN85687.1"
FT                   /translation="MPQTAEAPPQRAAERGETPALPATMRAVVCHGPRDYRLEQVPVPK
FT                   PGPDEILTQVERVGICMGDIKTFRGAPSFWGDAVQPRYVKPPMIPGHEFVCRVVALGPG
FT                   AERRGVKAGDRVISEQIVPCWSCRFCGHGQYWMCQKHDLYGFQNNVHGAMAEYMIFTKE
FT                   AIVHRVPDSIPTDEAILIEPLSCSLHAADRANVGFDDVVVVAGAGTLGLGIIGAVRLRH
FT                   PKQLIVLDMKPERAALARRMGADDVWNPAEENVIEKIRAITGGYGCDIYIEATGHHRAV
FT                   GQGLAMLRKLGRFVEFSVFNDEASVDWSIIGDRKELDVLGSHLGPYMYPRAIEFIASRR
FT                   IDVRGIVTHTFPLSRFADAFAVMERGEQSLKVVLDPRG"
FT   gene            420892..421896
FT                   /locus_tag="BURPS668_A0460"
FT   CDS_pept        420892..421896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0460"
FT                   /product="glycerone kinase"
FT                   /note="identified by match to protein family HMM PF02733"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86396"
FT                   /db_xref="GOA:A3NGJ5"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGJ5"
FT                   /protein_id="ABN86396.1"
FT                   /translation="MNRVINHPDYVVEDMLRGIVAAHPALALDADNPRVIGVAHPVPGK
FT                   VGVVTGGGSGHEPAFVGYTGPGLVDAVAIGEIFSSPTAKSFLDAFRRADRGAGVACLYG
FT                   NYAGDNMNVKMAIKMAAAQGIDVKTVVANDDVASAPREERAKRRGVAGEILMWKAGGAR
FT                   AAAGGDLDAVIASAKKAIDNTRSVGIGLSACTIPANGKANFHIADGEMEVGIGHHGEHG
FT                   VRVMRTVSAKDMAAMMLDIVLPDFPLERGEEVAVLVSGLGATPLMEQYILYAEVSQRLA
FT                   AAGLKIGFRLVGNLFTSLEMMGVTLTVTRLDDELKQLFAAPCSSIGLTVGERA"
FT   gene            421893..422552
FT                   /locus_tag="BURPS668_A0461"
FT   CDS_pept        421893..422552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0461"
FT                   /product="dihydroxyacetone kinase, L subunit"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF02734;
FT                   match to protein family HMM TIGR02365"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87307"
FT                   /db_xref="GOA:A3NGJ6"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGJ6"
FT                   /protein_id="ABN87307.1"
FT                   /translation="MNTAAIQCLPLADAGFVVRELVDVIRRNRDHLSEIDAAIGDGDHG
FT                   INMSKGFGQCGARLDARGATSLPDALDVLSTALMDGIGGSMGPLYGSFFMDFAAPLKGR
FT                   DTLDAALFGEALAAGFAGVQAISDAKIGDKTLIDTLAPAAAAFHEALRAGDDFRHALAA
FT                   MSAAAERGKESTRWLQARVGRASRLGERSVGTLDAGAASCCLILCSLASSIGARLN"
FT   gene            complement(422586..422789)
FT                   /locus_tag="BURPS668_A0462"
FT   CDS_pept        complement(422586..422789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0462"
FT                   /product="aminoglycoside acetyltransferase (6) type I"
FT                   /EC_number="2.3.1.82"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86136"
FT                   /db_xref="GOA:A3NGJ7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGJ7"
FT                   /protein_id="ABN86136.1"
FT                   /translation="MFVEPAARRRGVARALCAAAAAWGTARGCAAFASDAPLENAASHA
FT                   LHCALGFDETERVVFFRKPLAR"
FT   gene            complement(422793..423059)
FT                   /locus_tag="BURPS668_A0463"
FT   CDS_pept        complement(422793..423059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87006"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGJ8"
FT                   /protein_id="ABN87006.1"
FT                   /translation="MTHPAALFKIRAAQASDAAAWRQLRRALWPHADDIEHARDIARQL
FT                   DAPARHACFIASPPGILAPVGFAEVAVRHDDVNGCGASPVLFL"
FT   gene            complement(423056..423439)
FT                   /locus_tag="BURPS668_A0464"
FT   CDS_pept        complement(423056..423439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86474"
FT                   /db_xref="GOA:A3NGJ9"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGJ9"
FT                   /protein_id="ABN86474.1"
FT                   /translation="MENAFNERGVMVTRNGLSAAGQIFALREIRGVEVRTVRKNKLVPC
FT                   AISLTGAAAAIAGGALGSSALLVAGVMLVVVGYLAWTTQDVTHRLIVDMPDGKREAIMS
FT                   VDREFVERVAHAVDAARAAGAST"
FT   gene            complement(423929..424189)
FT                   /locus_tag="BURPS668_A0465"
FT   CDS_pept        complement(423929..424189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0465"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85573"
FT                   /db_xref="InterPro:IPR021294"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGK0"
FT                   /protein_id="ABN85573.1"
FT                   /translation="MVEDTVFSGLRTLLTHEHAFPVQSCRVSIEMQRPWGRPYRLVEWT
FT                   MHLDAPARRRIVPAESTEAEIAEAVASHVPGRLYEGGAALY"
FT   gene            complement(424398..425546)
FT                   /locus_tag="BURPS668_A0466"
FT   CDS_pept        complement(424398..425546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0466"
FT                   /product="outer membrane porin"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88354"
FT                   /db_xref="GOA:A3NGK1"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGK1"
FT                   /protein_id="ABN88354.1"
FT                   /translation="MNKKLLTTAILAATASAAHAQSSVTLYGLIDAGVSYVNHSKSASG
FT                   SDKLFKYDDGIAQGSRWGLRGAEDLGGGLKAIFVLENGFNSGNGTIGQGGAIFGRQAYV
FT                   GLSHKDAGTLTFGRQYSFTTDILGANYSTGGNTVAGNYAYHVNDIDQLTSSRINNAVKF
FT                   QSANYAGFTFGALYGFSNSTSFAGAPATTTGTTTTPGSSRAYSFGLNYANGPIGLGAAY
FT                   TDIRYPSQATPAFTTNIANLTISNVRDLRSFGVGGRYIWGPATLWALWTNTRLEPVTGG
FT                   STTYNAYEAGGKYAFTTALSAGVGYTYSRVSGANSGHWNQVNGALDYALSKRTDVYLLA
FT                   IYQEASGKNLQAQIGSSTSYFNTSGTGSKNQFAARVGIRHKF"
FT   gene            complement(425641..425805)
FT                   /locus_tag="BURPS668_A0467"
FT   CDS_pept        complement(425641..425805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0467"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87407"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGK2"
FT                   /protein_id="ABN87407.1"
FT                   /translation="MWRRTDKPSNFHTYIPAPGQSTGQIDITRAAQVAIIACGVGATHS
FT                   EHDGNCHIH"
FT   gene            425880..426659
FT                   /locus_tag="BURPS668_A0468"
FT   CDS_pept        425880..426659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0468"
FT                   /product="lipoprotein, YaeC family"
FT                   /note="identified by match to protein family HMM PF03180;
FT                   match to protein family HMM TIGR00363"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86860"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGK3"
FT                   /protein_id="ABN86860.1"
FT                   /translation="MAGGAVWALAATLAHAGGPALKIGTMSGPDAQIWAEVTKVAARDG
FT                   LAIKVIEFNDYVQPNAALDAGDLDANGFQHQPFLDSQIRQRGYRIVNVGLTYTSPMGFY
FT                   SKRLKSLKDLPVGAKVGIQNDPSNGNRALLLLQKYGIVKLKPGAGVNGVNATPLDVAEN
FT                   PRKIRLVELDAAQLPRALPDLDAASINTDYAVKAGLSPVKDAIAIEDLKGPYANLIAVR
FT                   AQDKDKPWVKKLVAAYESNDVRKFIETKFNGAIIPAF"
FT   gene            426695..426892
FT                   /locus_tag="BURPS668_A0469"
FT   CDS_pept        426695..426892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0469"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87792"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGK4"
FT                   /protein_id="ABN87792.1"
FT                   /translation="MSEGGASRAARFAAARAHQRIHSNGHSPASRGQFVSRGSVCLSMK
FT                   AACARGPAGDAAKARPRREA"
FT   gene            426889..427011
FT                   /locus_tag="BURPS668_A0470"
FT   CDS_pept        426889..427011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0470"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87067"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGK5"
FT                   /protein_id="ABN87067.1"
FT                   /translation="MSLGGVQARAAREWWASGRGLAAACGNDPSPAFMSGRQPS"
FT   gene            complement(427132..428412)
FT                   /locus_tag="BURPS668_A0471"
FT   CDS_pept        complement(427132..428412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04952"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88370"
FT                   /db_xref="GOA:A3NGK6"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGK6"
FT                   /protein_id="ABN88370.1"
FT                   /translation="MILTRRARRFRRKSLIGRENDYRTAQVWCVSRRSTYNRSFTDIER
FT                   RAAAAPPPPIMQTQTHPLISPAVGTARHITSFHYGPRGGKKVYIQASLHADELPGMLVA
FT                   TLLRRKLAALEAAGRLRDEIVVVPVANPIGLAQHVFGDHLGRFELGSMQNFNRNFHDLA
FT                   ALVIPRIEGRLTHDAAANLAAVRGAMREALAEQKPRTELESQRLALQRLSYDADIVLDL
FT                   HCDCDAVMHIYTNPDLWDDVEPLSRYLGAKASLLALNSVGNPFDEIHSFCWSELRGRFG
FT                   ERHPIPNGTISVTVELRSERDVSYELAEHDAQALVEYLTLRGAIDGTPAPQPPLEFAAT
FT                   PLAGTDPLVAPVSGVIVFHTPVGVWIEAGQDVADIVDPLTDRVVTLKSSVSGVLYARQI
FT                   ARFATAGMEVARIAGATPIRTGSLLSA"
FT   gene            428524..430632
FT                   /locus_tag="BURPS668_A0472"
FT   CDS_pept        428524..430632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0472"
FT                   /product="putative acyltransferase"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87678"
FT                   /db_xref="GOA:A3NGK7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGK7"
FT                   /protein_id="ABN87678.1"
FT                   /translation="MSELQWAGSQAGGPAAHGKTAYLPYIDGLRAWAVLSVMLYHLDAR
FT                   WLPGGFAGVDIFFVISGFVVSVSVANRGPMSLGPFLLFFYARRMRRILPALVAALLATA
FT                   LVSTLFIPASYLSDRNRTTGLLAFFGLSNVILGAPGGDYFSPKAEFNPYTHTWSLGVEE
FT                   QFYLLFPLLFHAWRAGGKRRYASTALFAAGLCASLAWSVWARPAMHAQTFYLIFGRFWE
FT                   LAAGVLLYQCVARAGRPAGRPAAAFGIEAGVWASAVAVLAGFVASKPALYPFPGALVPV
FT                   AGALGLLGLLHGRARASPVRAALEQPALRFVGRISYSLYLWHWPVFVVFRWTLGLDSAG
FT                   GKASALLVACALATASYRFIETPLRRGGAAARRAPRVAALAGGAGVLAAGAALSSMLAA
FT                   AQPQLSLSTVARHRLDWYPYGVETNAAYPGCVADVGARDVRGGKLWIYARQGCGRPPES
FT                   RQRVFVIGDSHAMAYAGMFKQFVVRTGIAVYSYNNAGCPFVSLQPWRERGEPGCRRYGD
FT                   AALDDMLSKLAPGDIVFLPSLRLPRFVTQWAFVGDDDARRLSSGREAAQVRERAIADAV
FT                   AVLRAIERRGARIVLEAPPPVFRTVPYRCSDWFNRRNAICARGPLVGRGEIDALRAPVL
FT                   TAYARIAAQVPDVHTWDPLPLLCDEKTCSAYDGARPLFFDGDHLSGYGNLRVLPGFEAF
FT                   VRELIEAA"
FT   gene            430657..430800
FT                   /locus_tag="BURPS668_A0473"
FT   CDS_pept        430657..430800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0473"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87374"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGK8"
FT                   /protein_id="ABN87374.1"
FT                   /translation="MEATEAIEAIEATTVRLPGEGGRSAGKPNRAMPAGGAGMSGERMK
FT                   SA"
FT   gene            complement(430894..431676)
FT                   /locus_tag="BURPS668_A0474"
FT   CDS_pept        complement(430894..431676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0474"
FT                   /product="putative lysine-arginine-ornithine-binding
FT                   periplasmic protein"
FT                   /note="identified by match to protein family HMM PF00497;
FT                   match to protein family HMM TIGR01096"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88535"
FT                   /db_xref="GOA:A3NGK9"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGK9"
FT                   /protein_id="ABN88535.1"
FT                   /translation="MKKILAALTVALLAVSAGGVQAKDWSTIRFGVDASYPPFESKGPD
FT                   GKVVGFDVDLGNEICKRVKAKCVWIENDFDGMIPALKARKFDGVLSSMSMTPQREEQIA
FT                   FSSKLFNTPTRLVTKKGANLMPTAESLKGKTVGVEQGTIQETYAKVHWAPMGVKVQPYQ
FT                   NQDQVYADLIAGRLDAALQDAVQADIGFLKTPRGKDYAFAGTDLNDPKTLGEGAGIGLR
FT                   KEDTDLKAKIDKAIADMHKDGTYDKIAKKYFDFDVYGK"
FT   gene            complement(431910..432809)
FT                   /locus_tag="BURPS668_A0475"
FT   CDS_pept        complement(431910..432809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0475"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86060"
FT                   /db_xref="GOA:A3NGL0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGL0"
FT                   /protein_id="ABN86060.1"
FT                   /translation="MKLQQLQAFVCAAHHKSLRAAARALGVTQPAITHTIRELEAALNA
FT                   ELLVRSVRGVELTACGHALLPRAEQLLGDMRRTVEAVEQVRGELSGRVAIGTMPSIALT
FT                   ALPRAVMKFRATMPHVSLSLEEVTVPNALARLRNGELDIAAIHHIPALERDFAQLPLCS
FT                   TEFVVAMREGHPLAGARRLAELLDAEWIVTVGADHFPHSVMMSMFNAHGLPLPQRLLRA
FT                   PSSFAVTLGLVARSDVIGCFTKPLAAMVAPLGIRPARLDDRLPSYDLSILSRRDLLPTP
FT                   AVTQFIACLRQAADETLT"
FT   gene            432945..434132
FT                   /locus_tag="BURPS668_A0476"
FT   CDS_pept        432945..434132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0476"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86963"
FT                   /db_xref="GOA:A3NGL1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGL1"
FT                   /protein_id="ABN86963.1"
FT                   /translation="MNDARFTEVDDLAPLAEALREIRHRIHRHPELAYEEVETAALVAD
FT                   KLEAWGWRVTRGVGGTGVVGTLRVGDGARSVGVRADMDALPIAEATGLPYASAVPGKMH
FT                   ACGHDGHTAMLLGAAWRLAQARHFSGTVHLYFQPAEEHGVDSGAKRMIDDGLFERFPCD
FT                   AVFGMHNHPGVEPGVFLTRRGAFMSAGDKAVIDIHGVGGHAARPHLAVDPVVVAASVVM
FT                   ALQTIVARNVDPAQPAVVTVGSLHAGTANNVIPSRARLELSVRSFDPEVRALLRRRITE
FT                   LAQAQAASYGASANVEYIEGYPVVVNSDAETDFAAQVAKELVGERNVVEQADILMGSED
FT                   FAFMLQRRPGSFVRLGNGAGEEGCMVHNPKYDFNDRNLVTGAAFWARLVERYLPR"
FT   gene            434195..434374
FT                   /locus_tag="BURPS668_A0477"
FT   CDS_pept        434195..434374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0477"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86964"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGL2"
FT                   /protein_id="ABN86964.1"
FT                   /translation="MTSAEQQATSDERPTPVGCSRIRCDRSLHRLTHCGRFMPPDANRS
FT                   PASRAGVGRGCASG"
FT   gene            434399..435736
FT                   /locus_tag="BURPS668_A0478"
FT   CDS_pept        434399..435736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0478"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88068"
FT                   /db_xref="GOA:A3NGL3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGL3"
FT                   /protein_id="ABN88068.1"
FT                   /translation="MHEDNLTMPADGAGVAPADAVSAAGLRTARGGAIAAAVIGNWLEF
FT                   FDFTVYGFFAVIIGKLYFPSHDATTSLLLSVATFAAGFFTRPLGSIVLGVYADRRGRKA
FT                   ALNLTILLMALGTGMIALAPTYAQIGVLAPVIVVCARLMQGFSQGGEFGAATSTLVEHG
FT                   GAARRGFRASWQLATQGGAALMGSGFAALLSNTLAKDALESWGWRVPFALGVLIAPVGM
FT                   YLRRRLADDAPGAGHHGIDGGVLRELFARHGRTVLLLTLTVMGGTVSTYILTFYMPTYA
FT                   IHTLGLPMKLSMFVGVASGCVMLVTCPLFGWLSDRIGSRRLPIFVGRGVLVVLLFPAFV
FT                   LMNRYPSLAVVMPLTGLMLLFYSMGSASEFALMCESFPRRVRATGISIAYALAVTLFGG
FT                   TAQLVATWLVRVTGSTLAPAAYVAACVIVSLVAVGMLCETATETAD"
FT   gene            complement(436288..437007)
FT                   /locus_tag="BURPS668_A0479"
FT   CDS_pept        complement(436288..437007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0479"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM PF08362"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85710"
FT                   /db_xref="GOA:A3NGL4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGL4"
FT                   /protein_id="ABN85710.1"
FT                   /translation="MPHDDPTTTPPDAPAPRARTKAAHAPSRARKAHIRELNEAHLLAC
FT                   AEAVFAERGFEGASTALIAERAGLPKANLHYYFPTKLALYRRVLDDLLEDWHAAADSFD
FT                   VGDDPVAALGGYVRAKMALSRERPLGSKVWANEIISGATHMQDLLLERVKPWMDTRIAL
FT                   IERWIARGLVEPVEPKTLLYMIWATTQHYADFDAQIVALSGKRALSAKAFDATTDEVVR
FT                   LILRACGARSPHAREPA"
FT   gene            complement(437368..438153)
FT                   /locus_tag="BURPS668_A0480"
FT   CDS_pept        complement(437368..438153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0480"
FT                   /product="beta-ketoadipate pathway transcriptional
FT                   regulator, PcaR/PcaU/PobR family"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF09339; match to protein
FT                   family HMM TIGR02431"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86387"
FT                   /db_xref="GOA:A3NGL5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGL5"
FT                   /protein_id="ABN86387.1"
FT                   /translation="MSTEFQAKPGDSYVQSFARGLAVIRAFDAEHPEQTLTEVASATGL
FT                   TRAGARRILLTLQTLGYVEADGRLFRLTPKILDLGFAYLTSMPFWNLAEPVMEQLSARI
FT                   HESCSAAVLDRTEIVYVLRVPTHKIMTINLSIGSRLPAYCTSMGRVLLSSLDAAALDDT
FT                   LAQSTLRAYTPRTLTDPAALKDEIATVRSQGWAIVDQELEAGLISLSAPIRNRRGQVIA
FT                   AMNISGNAQRHTAKQMVKAFLDPLLEASQTVSQLVARRG"
FT   gene            complement(438150..438350)
FT                   /locus_tag="BURPS668_A0481"
FT   CDS_pept        complement(438150..438350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0481"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85679"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGL6"
FT                   /protein_id="ABN85679.1"
FT                   /translation="MPPLPLASNAYGKCSLYEHKIVNRTLPCDHRQRAAARQAPGPCGA
FT                   RVGATRPHALIFSAAHHFHPP"
FT   gene            438390..439592
FT                   /gene="pcaF"
FT                   /locus_tag="BURPS668_A0482"
FT   CDS_pept        438390..439592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaF"
FT                   /locus_tag="BURPS668_A0482"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930; match to protein family HMM
FT                   TIGR02430"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86194"
FT                   /db_xref="GOA:A3NGL7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGL7"
FT                   /protein_id="ABN86194.1"
FT                   /translation="MTEAFLCDAIRTPIGRYGGALAPVRADDLGAVPLKALVERNRDVD
FT                   WAAVDDVIYGCANQAGEDNRNVARMSLLLAGLPHAVPGATINRLCGSGMDAIGLAARAI
FT                   KAGEASLMIAGGVESMSRAPFVTGKATSAFSRQAEIFDTTIGWRFVNPLMKQRYGVDSM
FT                   PETAENVATDYRVSRADQDAFALRSQQKAARAQADGTLAQEIAPVTIAQKKGEPLVVAR
FT                   DEHPRETTLEALAKLKGVVRPDGTVTAGNASGVNDGACALLVASEAAARRHGLVPRARV
FT                   LGIATAGVEPRVMGIGPAPATQKLLARLGMTLDQFDVIELNEAFASQGLAVLRLLGVAD
FT                   DDARVNPNGGAIALGHPLGASGARLVTTATYQLHRTGGRFALCTMCIGVGQGIAIAIER
FT                   V"
FT   gene            complement(439695..439877)
FT                   /locus_tag="BURPS668_A0483"
FT   CDS_pept        complement(439695..439877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86077"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGL8"
FT                   /protein_id="ABN86077.1"
FT                   /translation="MSRGEALGRLESATARASQPLVVTARRDRIGADRIGMRARSVNDR
FT                   RGIETRHAFDARKSQ"
FT   gene            complement(440013..440363)
FT                   /locus_tag="BURPS668_A0484"
FT   CDS_pept        complement(440013..440363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86595"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGL9"
FT                   /protein_id="ABN86595.1"
FT                   /translation="MGSASFSCFHRPNESIEWLSMGLYPLFRQAFEKIDLAPRKSDTAT
FT                   LVLTWVNPRARKHRLRPGGPPERHRATSMIVPGDSSPSDRNQTFSPELFRDSYRANIQE
FT                   LKTIFAGENTVS"
FT   gene            440377..441921
FT                   /locus_tag="BURPS668_A0485"
FT   CDS_pept        440377..441921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0485"
FT                   /product="aerotaxis receptor"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF08447; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86314"
FT                   /db_xref="GOA:A3NGM0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGM0"
FT                   /protein_id="ABN86314.1"
FT                   /translation="MRNNQPVTQHEFELPDDATLMSTTDPHGRITYANATFVHVSGFSS
FT                   DEIVGAPHNVVRHPDMPRDAFADMWATLKRGEPWTALVKNRRKNGDHYWVRANAVPVIR
FT                   GGQTQGYMSVRTKPARAETAAADALYRDFREGRAGSRRFHKGLIVRTGLLRACSLLQTM
FT                   SVRARIHLPIVALTPAIVGAAWAAGVAGAPLAQLAGATLGGAALAAWWLDAQIARPLRT
FT                   LRRQALDVATGASRRGVNMNRVDEIGMSLRTINQLGLMFRWLIDDVSEQVLTVQRAVNE
FT                   IAQGNHDLSARTEQAATSVQQTAASMAQMTATVSSNAQTATQANRLSESASHAAERGGQ
FT                   AVREVVSTMGEITESSRRISEIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAG
FT                   EVRALAQRSANAAKEIKALIGASVERVESGAQTVDYAGRTMGEIVSQVKRVSDLIAEIS
FT                   ASTSEQRAGVTQVDDAVVHLDSITQQNAALVEQSAAASESLRQQATLLVDAVGVFR"
FT   gene            complement(442019..443440)
FT                   /locus_tag="BURPS668_A0486"
FT   CDS_pept        complement(442019..443440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0486"
FT                   /product="O-methyltransferase"
FT                   /note="identified by match to protein family HMM PF00891"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88463"
FT                   /db_xref="GOA:A3NGM1"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGM1"
FT                   /protein_id="ABN88463.1"
FT                   /translation="MRASGRPSHETASATHAGLFRVGRDMGGQRRGPRIALIAFGRSRH
FT                   GARPFAAIPVDTRWPMQTLSKRVTRAPPPRPAAPSSARAHRPAQAGWPARDTAFGARHA
FT                   SPMKPLIPSIDRGGRHRARRRHDLDLARYPAMTLTSPHHDDVAVYDLTLGLFACPAMLI
FT                   AHRAGLFRRLGESPSTLKELGAALGLARRPTEALANTAAALGFVRRDADRYALTALGAD
FT                   LLVERSPTYFGAFLDLMYEASETFSLKSLEAAIRDDAAHAYGSPDVFQSHEQQLALAQR
FT                   FTRAMESVSAAHAPVWPTQLDLSRHRVMLDIGAGSGAHTRGALSAWPALRAIVFDLPGV
FT                   CELSRPYFETSPVRERVTLHPADMRHDPFPDADLHFYSNVFHACPREKNALLARKSSDA
FT                   LPPGGRIVLHEVLYRDDKSGPLAAAASSLMMISWTEGEQYSSRELTEILANAGFSSIET
FT                   IPSAGYYSLVTGVKH"
FT   gene            complement(443452..444489)
FT                   /locus_tag="BURPS668_A0487"
FT   CDS_pept        complement(443452..444489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0487"
FT                   /product="putative oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88174"
FT                   /db_xref="GOA:A3NGM2"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGM2"
FT                   /protein_id="ABN88174.1"
FT                   /translation="MLSVGNEDLDLTNRHNAEDWLPDRIRLRNVWLPLAHTFEIGERAS
FT                   RWYVHSEPCYLWRAAGRIHACPWHPGLPAAKRPTPRPRDADAACYPVVERFGYVWVWYG
FT                   EPEAASDAFVPDVPFLPRDGGLPKYMQGNIRVDCCAPLLIENLLDLTHSDFLHAKVFGD
FT                   QHADEDRVDVSYTSETVTMIRRCKNKSILPIMRWFGGVRAKYQDIHAVVHVHVRSSIAL
FT                   AYGRHTPGSDLPLFHPCVPESRNYCRLNFALNATQAPWPLRLLLPFVPYVVGLQDNSMV
FT                   RRQSGRYLDAGERRDLYSRFDRAGLRYRILLQQLAKRQSEGDFSYADDALPSRDARGIL
FT                   GMPNE"
FT   gene            complement(444489..445481)
FT                   /locus_tag="BURPS668_A0488"
FT   CDS_pept        complement(444489..445481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0488"
FT                   /product="iron-sulfur cluster-binding protein, Rieske
FT                   family"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85406"
FT                   /db_xref="GOA:A3NGM3"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGM3"
FT                   /protein_id="ABN85406.1"
FT                   /translation="MNTVAQIRFDSIARWMPVALSEQVSGRAALAVICMEQPLVLFRDA
FT                   SGAVCAMEDRCAHRRAPLSLGRVTPDGRLQCAYHGWTYDGATGACVAIPNLSASERVPA
FT                   HYAAHAYKTLERDGFIWACARDAPPPAEAIARDARSARRFAGSVTVAVARDEYVAALAD
FT                   GPHLTMRIAGLYITDYVIADATPHDGDIATERGVTWLAHIVDRHFGVRHPWTLRVTSPR
FT                   DGALASIELASRDGATALWASIAITPAARGATNVLWRGGVAADASGFGAKLFRTWARLH
FT                   AAPFAMLAHVDGRALSTLDALYSRAWRGPIPEGIAHTRPMPADYRTRSR"
FT   gene            complement(445478..445594)
FT                   /locus_tag="BURPS668_A0489"
FT   CDS_pept        complement(445478..445594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86657"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGM4"
FT                   /protein_id="ABN86657.1"
FT                   /translation="MPRCAGGHSADRDETQAGPPRRARHACRRHRARRDEHG"
FT   gene            445602..445730
FT                   /locus_tag="BURPS668_A0490"
FT   CDS_pept        445602..445730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0490"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87242"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGM5"
FT                   /protein_id="ABN87242.1"
FT                   /translation="MAYMACIARHARRPAARVFERAATMRAVLGPCAAERRRSTRC"
FT   gene            445766..446158
FT                   /locus_tag="BURPS668_A0491"
FT   CDS_pept        445766..446158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0491"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88016"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGM6"
FT                   /protein_id="ABN88016.1"
FT                   /translation="MRRQSARASLSAAYGLPRRAQTPWKWPPAVDMAAVAVRWGAAGRR
FT                   SAAQRVFGAARSAGAERGVSRRRSQRRRARDAIEAGNGRAGPPASLRIASIARSPFTAI
FT                   ARSRAAGAALPGAEPRRRPVSASTSA"
FT   gene            446554..447204
FT                   /locus_tag="BURPS668_A0493"
FT   CDS_pept        446554..447204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85694"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGM7"
FT                   /protein_id="ABN85694.1"
FT                   /translation="MKEGGEFDRRSIVLMKMIFKYRNFNRCFFGNDSDGIENKMGMIFA
FT                   IFIRRRLGSAGFLWGMDEALAVQFRAAGKEKRATGARMATIRAEEGRAAVTRVAAPCVP
FT                   GGAAHVARLAKRAFVARCAPRGGREAAAISGDARSGSTDVRRRRSARARVTAGRRGRRA
FT                   VRKPVPLPVDVQRRADACSGRFGRGLPFRAMRATRAARIVHHTSRITPRRTCT"
FT   gene            complement(447179..448648)
FT                   /locus_tag="BURPS668_A0492"
FT   CDS_pept        complement(447179..448648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0492"
FT                   /product="succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /EC_number="1.2.1.16"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01780"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85483"
FT                   /db_xref="GOA:A3NGM8"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGM8"
FT                   /protein_id="ABN85483.1"
FT                   /translation="MTTAHETLALKDPALLRERAFVAGEWQAADGGATLEVRNPATGAL
FT                   IGTVPAMGAAETRRAIDAANAAWPAWRKKTAKERAAILRKWHDLMIAHADDLALILTTE
FT                   QGKPLAEAKGEIGYAASFLEWFAEEGKRVYGDTIPTPAADKRIVVTKEPVGVCAAITPW
FT                   NFPAAMITRKVGPALAAGCPIVVKPAEATPFSALAMAVLAERAGVPAGVFSVVTGEPKA
FT                   IGGELTSNPIVRKLSFTGSTPVGRLLMAQCAATVKKVSLELGGNAPFIVFDDADLDAAV
FT                   EGAIASKYRNSGQTCVCTNRFYVHEKVYDAFAEKLTAAVAKLKVGPGTEAGVVQGPLIN
FT                   GAAVRKVEAHIADALDKGARVTTGGQRHPLGHGFFEPTVLTGVTPDMKVAKEETFGPLA
FT                   PLFRFSTEEEAIRYANDTEFGLAAYFYSRDIGRVWRVAEALEYGMVGINAGIISNEVAP
FT                   FGGVKQSGLGREGSHYGIDDYVVIKYMCVAV"
FT   gene            complement(448706..449989)
FT                   /gene="gabT"
FT                   /locus_tag="BURPS668_A0494"
FT   CDS_pept        complement(448706..449989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BURPS668_A0494"
FT                   /product="4-aminobutyrate transaminase"
FT                   /EC_number="2.6.1.19"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00700"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87443"
FT                   /db_xref="GOA:A3NGM9"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGM9"
FT                   /protein_id="ABN87443.1"
FT                   /translation="MNNADLHARKNAATPRGVGVMCDFYASRAENAELWDVEGRRFIDF
FT                   AAGIAVLNTGHRHPRIVKAIADQLGQFTHTAYQIVPYASYVELAEKINARAPIAQPKKT
FT                   AFFTTGAEAVENAVKIARAYTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKIGFGPFPG
FT                   DVFHAPYPNALHGVTSADSIAAVETLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVR
FT                   ALRKLCDAHGILLIADEVQTGFARTGKLFAMEHYDVSADLMTIAKSLAGGMPLSGVVGR
FT                   ADVMDAAAPGGLGGTYAGNPLAVAAAHAVLDVIDEEKLAERATVLGDKLKAKLAALRAE
FT                   LPQIVDVRGPGAMVAAEFVDPHTRASDAAFTKRVQTLALERGLLLLICGVDANVIRFLF
FT                   PLTIEDAVFDEALGILESVLREAVGVPA"
FT   gene            450131..451816
FT                   /locus_tag="BURPS668_A0495"
FT   CDS_pept        450131..451816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0495"
FT                   /product="transcriptional regulator, GntR
FT                   family/aminotransferase"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88373"
FT                   /db_xref="GOA:A3NGN0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGN0"
FT                   /protein_id="ABN88373.1"
FT                   /translation="MRVSVLSDWLAQRIVRGGGAQPIYRQLHRLLQQAILTRELPAGAR
FT                   VPSSRLLAAELGIARNTVTQVYEQLALEGYVSSATGRGTFVADSAPDEIVGAPADSPPG
FT                   LPGPGLPGTRGAAAGAEAAAGIGFDPTLEPGAARRSLSARGARLVGGAGVSKRQGGAFM
FT                   PGVPDVSRFPARVWTRLHNKYWRRLRPELLTYAPGGGLAPLREALADYLRTSRSVRCAP
FT                   EQIIVTTGIHQSIDLAVRLLTDPGDVIWTEDPCYWGVRSVMHVSGLTTRPIPVDEEGIA
FT                   PAAADFAAPPKLMLVTPSHQYPLGMVMSLARRRMLLEYARQHGAWIIEDDYDSEFRYGS
FT                   RPLASLQGLDTAGQVIYVGSFSKTLFPGLRVGYLVAPEPLAESFATASAELYREGQLLQ
FT                   QAVLAEFIAEGHFVSHIRKMRTLYGQRRQTLLDALARRYGDALPAVGGDAGLHLVMRLP
FT                   DGVDDRALARAALERDIVVRALSGYYAQATRAASGLLLGYACVPEDEIGCAFDALSRAI
FT                   DDVAFGRAAAASAAPASTSAAAASSASAASTTSAAARMPAAVAR"
FT   gene            complement(451833..453347)
FT                   /locus_tag="BURPS668_A0496"
FT   CDS_pept        complement(451833..453347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0496"
FT                   /product="C4-dicarboxylate anaerobic carrier family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03600;
FT                   match to protein family HMM PF03606"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85977"
FT                   /db_xref="GOA:A3NGN1"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGN1"
FT                   /protein_id="ABN85977.1"
FT                   /translation="MLAAPAHCADTPRTPDMPDMPDMPDTRGTPAHDASPRPEHKPHGK
FT                   MLHPVVMMIWVLAAAVALTWLVDSGRYARNGKLVVPGTYQVVPKATSLATLVAPAVSKS
FT                   TPQFAMPASLVSAFVAVPGGLVKNAPLIVMVMFVGGMFGVMRRTGVVDAGIDRLLQLTG
FT                   NDVYLLTPLLMILIGLGSTLLGFISEYLVIIPMVMVIAKRLGLSNLFAVALVALAAKIG
FT                   YIASVTNPLALAVAQPLVGVPLFSGVALRAAVFAVYLALGILYLLHHVKRSGYRRERAK
FT                   ALAHAHGVARLSVRHQATLALLAAAVAMLVFGTRELKWGNVELAAFYAFVAIAAAAIGG
FT                   LDSRSAADAFVDGMKSMMLAALLMGLAASVELLLQNSLVLDTLIHLFTRLANGQSPVWV
FT                   ANGLMAVQMVLDVFIPSVSGKAAVSMPIIGPIAQLSGVSGQTSVLAFVLGGGLTNLVTP
FT                   TSGMLLAYLATARVDFGAWLRFVLPLFAVLLALSCGVLAFAVQIGY"
FT   gene            complement(453365..454132)
FT                   /locus_tag="BURPS668_A0497"
FT   CDS_pept        complement(453365..454132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0497"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85949"
FT                   /db_xref="GOA:A3NGN2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGN2"
FT                   /protein_id="ABN85949.1"
FT                   /translation="MNYIVDAVDSALKLLSFVAEHPHLGVTELASKLGINKSRTYRMLC
FT                   TLELHRFVVQDARTSTYALGPQAFVIGVAAAQQNALVRAAQRHMLALSQAINETVVLRV
FT                   REGLETVCVARCETTHEIRTIGSVGNRRPVGLGASGKVLLAFAPDAVRNEYFARVRKAA
FT                   QGDPLRLVEELDAISRKGYAVSVGEVTAGAVAIAVPVRDLTGETLASVSVAGPEMRISR
FT                   VEIPDYLERLQACSHAISAELGYVPARAAPQPA"
FT   gene            complement(454129..455037)
FT                   /locus_tag="BURPS668_A0498"
FT   CDS_pept        complement(454129..455037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0498"
FT                   /product="putative N-formylglutamate amidohydrolase"
FT                   /note="identified by match to protein family HMM PF05013"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86882"
FT                   /db_xref="GOA:A3NGN3"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGN3"
FT                   /protein_id="ABN86882.1"
FT                   /translation="MLTFNRHTVALDERFACFVAQPLDAALPIVVDSPHSGIAYPPDFG
FT                   AVAPRHAILTSWDAFVDELWAGAPERGCALVGARFPRAYIDPNRAVTDIDAALLAEPWP
FT                   EPLAPQSYTRRGMGLIRRYALPGVPLYDRKLSLDEVRHRIDTYYLPYRRALADAAEPLY
FT                   AKHGALWHVDCHSMKSRGNAMNLDAGAARPDVVVSDRLGTSADPAFTRWTADWFAHAGY
FT                   RVRINAPYQGGDLLNALAAPARRRHSIQIEFNRALYMNETAFDKHAGFAALKRTVDAYL
FT                   DALAAHVRAQLPPPRGEGVSR"
FT   gene            455401..455808
FT                   /locus_tag="BURPS668_A0499"
FT   CDS_pept        455401..455808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0499"
FT                   /product="outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87107"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGN4"
FT                   /protein_id="ABN87107.1"
FT                   /translation="MAGIGIGAAVPPALAQSSVALYGIVDSGITCSRNQKGRSAWPATS
FT                   GNEQGARLGARRARGSRRRHERAVQPADGRRRALRPFRGQRADRVTRAAPVALGGTYTQ
FT                   VLASHAAAHDAHYLQTSAGPGISCRSVPMSI"
FT   gene            complement(455816..455959)
FT                   /locus_tag="BURPS668_A0500"
FT   CDS_pept        complement(455816..455959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88051"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGN5"
FT                   /protein_id="ABN88051.1"
FT                   /translation="MTRRGGARAARRNSCRMPVSATICVRVLDGFAMPTIDDATAFDDA
FT                   RC"
FT   gene            complement(455956..456789)
FT                   /locus_tag="BURPS668_A0501"
FT   CDS_pept        complement(455956..456789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0501"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88347"
FT                   /db_xref="GOA:A3NGN6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGN6"
FT                   /protein_id="ABN88347.1"
FT                   /translation="MEQRFVLLVLLCALLHAVWNALLHASEDRVAQLGTMSVPYLLAGA
FT                   AGALALPPPPAPAWPYVAASALLELGYCAALLRAYRSGDFSRIYPIARGLSPLAVCALA
FT                   LIALGERPTPFALAGIALVSLGIASLALRRGLRWSGESVPYALVTGLFIAAYSVVDGRG
FT                   VRLAGDPLAYVAWVYLLWNAPQFALICRLRGWRALARSRAAVSRGLAAGVLSLAAYAIA
FT                   IAAYRHLPVATVSALRETSSIFAIAIGWFALRERPSARRLAACALVVAGAMLIRM"
FT   gene            456819..456977
FT                   /locus_tag="BURPS668_A0502"
FT   CDS_pept        456819..456977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0502"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85554"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGN7"
FT                   /protein_id="ABN85554.1"
FT                   /translation="MRAAAGRDREASACRAVFRMSCVGARRLARAARVPLPKRARRLAR
FT                   NRAPDCR"
FT   gene            457003..458073
FT                   /gene="selD"
FT                   /locus_tag="BURPS668_A0503"
FT   CDS_pept        457003..458073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selD"
FT                   /locus_tag="BURPS668_A0503"
FT                   /product="selenide, water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00476"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85539"
FT                   /db_xref="GOA:A3NGN8"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGN8"
FT                   /protein_id="ABN85539.1"
FT                   /translation="MAMTETKQTDAAAPRLTSLSHGGGCGCKIAPGVLSELLRRTAPPA
FT                   LFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIVDDPFDFGRIAATNALSDVYAMG
FT                   GKPILALALVGMPINVLPHETIAAVLRGGEAVCADAGIPVAGGHSIDSVEPIYGLAALG
FT                   VVHPARVKRNAAARAGDVLVLGKPLGVGVLSAALKKDRLDAQGYAQMIATTTKLNRPGT
FT                   ALAALPGVHALTDVTGFGLLGHTLELARGAGLTARVRYGALPWLAGVEALVADGVLTGA
FT                   SGRNWAAYGHDVRLGDGLPAVAQALLTDPQTSGGLLVACAPEAVDDVLACFRDDGFERA
FT                   AAIGEMVDGAARVDVS"
FT   gene            458518..458721
FT                   /locus_tag="BURPS668_A0505"
FT   CDS_pept        458518..458721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0505"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87433"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGP0"
FT                   /protein_id="ABN87433.1"
FT                   /translation="MPGGEPARRDVFVRERRAGCRRSRRRPGMARRASDRAGNARRSHA
FT                   RAALKRARCAVPFGSMIALSLG"
FT   gene            458751..459452
FT                   /locus_tag="BURPS668_A0506"
FT   CDS_pept        458751..459452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0506"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88557"
FT                   /db_xref="GOA:A3NGP1"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGP1"
FT                   /protein_id="ABN88557.1"
FT                   /translation="MVRACVVVVVARADARPTRASARHRVRMRPFAPYALPAHGAPMHA
FT                   FDARRSQTPCICSAGADEAAARKRARPESHARAFASIRFITPANPWTNPILSRPTHTPT
FT                   RASPAVAFVRMHRPPRARGVRRLLRRLLRRQLVVALDGRARGVACVRRAGSRRRCLPPR
FT                   LHVFVLAYGAAVLAHVRILASFILLAQSRMSFSSNLFLIRNANADSLYIFRSRIFACRL
FT                   RDGAVRRAEQR"
FT   gene            459421..460428
FT                   /locus_tag="BURPS668_A0507"
FT   CDS_pept        459421..460428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0507"
FT                   /product="purine nucleoside permease family protein"
FT                   /note="identified by match to protein family HMM PF06516"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86785"
FT                   /db_xref="GOA:A3NGP2"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGP2"
FT                   /protein_id="ABN86785.1"
FT                   /translation="MAPSVAQNNGEAFAEAGAQGRPAKVMIISMFGPEGQAWLDRLGPW
FT                   KDVAVPGLSPDYPNVHCNKQDVCVVTTGMGYANAASTIMALTFSRRFDLRRTYFLISGI
FT                   AGVDPARGTLGTAAWAKYLVDFGLQWELDAREIPAGWNGGYLGINTKSPSDKPPLDYRT
FT                   EVFELNGKLADTAYALSRNVQLADSAQAQAARAKFNYAPANQPPVVTRCDTSSGNTWFS
FT                   GTLLGERARQWTKLLTDNKGTYCMTAQEDNATFEALKRAASVNRVDLSRVAVLRTGSDF
FT                   DRPYQGQTSVDNLLNYADQGGFPLATENLYRAGNPLVQDIATHWGEWKDGVPRR"
FT   gene            460442..460576
FT                   /locus_tag="BURPS668_A0508"
FT   CDS_pept        460442..460576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86221"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGP3"
FT                   /protein_id="ABN86221.1"
FT                   /translation="MRYMRDVRYVRCAPLSAKARSSGTVSRRARCRPSDRAAMESGCS"
FT   gene            complement(460659..460952)
FT                   /locus_tag="BURPS668_A0509"
FT   CDS_pept        complement(460659..460952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0509"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87031"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGP4"
FT                   /protein_id="ABN87031.1"
FT                   /translation="MKRSSLLAFAAIALAVAAPAFADGGIGPAGGYGDASGHGHGARTR
FT                   AEVRAELEQAQRDGTLAALRKSMSYAPPGAELGAPRPYRPDPDTNQLAGAGR"
FT   gene            461207..461371
FT                   /locus_tag="BURPS668_A0510"
FT   CDS_pept        461207..461371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0510"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88194"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGP5"
FT                   /protein_id="ABN88194.1"
FT                   /translation="MRRVDSRARFAFRSDERAAIRSRHRIGGQVSRTHGATSQTVEAVR
FT                   AKSIAFDGR"
FT   gene            complement(461869..462873)
FT                   /locus_tag="BURPS668_A0511"
FT   CDS_pept        complement(461869..462873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0511"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88244"
FT                   /db_xref="GOA:A3NGP6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGP6"
FT                   /protein_id="ABN88244.1"
FT                   /translation="MDRLQAMQVFTRVVDTNSFTKAAETLGLPRASVTTIIQNLEAFLG
FT                   VRLMHRTTRRLSLTPDGAAYYERCVRILADVEETEASFQVNNRKPHGKLRVDMPGSIGR
FT                   LILIPSLCEFHSRYPDIDLQLGLSDRPVDLLQEGVDCVIRVGALQDSSLVARRVGLFEG
FT                   TTVASPAYLEKYGEPQTIEELAQHKAVNYFSSRTGRTIDWAFLIDGKEVEVKMNGLVSV
FT                   NDADAYVTCGLEGFGLIQPPLFMVLPHLRNGTLKEVLPGHKPLPMPISVVYPHSRHLSP
FT                   KVRVFVDWVAEIFERCPLLSGRKGLDATCSKRTFEEAERAPSLDTPVLNEWVA"
FT   gene            463032..463916
FT                   /locus_tag="BURPS668_A0512"
FT   CDS_pept        463032..463916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0512"
FT                   /product="putative carboxylesterase"
FT                   /note="identified by match to protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88132"
FT                   /db_xref="GOA:A3NGP7"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGP7"
FT                   /protein_id="ABN88132.1"
FT                   /translation="MDARRRATQVMDAFDFRRQISSTSAESARVRPALAVSDVVIGGYA
FT                   QDIALRLYRRPDKSSLPVVLYFHGGGFVRGSLDDAERAARHLAEHVPALVVSVDYSLAP
FT                   RHPFPAAPEDAYCAARWAEARARAFGGNPRKIGVAGHDAGGQLANCLAFIARDRGEIRI
FT                   AAQALIGPMLDPSLTRLADATRLVSSDTSAQECAACYRAYLPQPSQRMHPYAAPLESVR
FT                   LAGLPPTLVATAQNDVLHVEAEKYASCLIDAGVPTQVVRYRDVSHAALADHASALEEVA
FT                   RFFQFRFSAGAPG"
FT   gene            463967..465196
FT                   /gene="bpeE"
FT                   /locus_tag="BURPS668_A0513"
FT   CDS_pept        463967..465196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bpeE"
FT                   /locus_tag="BURPS668_A0513"
FT                   /product="multidrug efflux pump BpeE"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87547"
FT                   /db_xref="GOA:A3NGP8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGP8"
FT                   /protein_id="ABN87547.1"
FT                   /translation="MAILRTSRSRIAAAAFAVVFIAGLGTFGAIRVNAGAPEKSAAPLP
FT                   EVDVATVLSKMITDWQSYSGRLEAVEKVDVRPLVSGTIVSVNFKDGALVKKGDVLFVID
FT                   PRPYQAEVDRAAAQLAGAQARNGYAQSDWQRAQRLIGDNAIARRDYDEKQNAAREASAN
FT                   LKAAEAALETARINLGYTRITAPVSGRVSRAEITLGNVVSAGASAAPLTTLVSVSPIYA
FT                   SFDADEQTYLQYIGGAKDGRKVPVELGLANESGYSRQGVIDSVDNRLDTSSGTIRVRAR
FT                   FDNADGALVPGLYARVKVGGSAPHPALLIDDAAINTDQDKKFVFVVDQQGRVSYREVQL
FT                   GAQHGNQRVIVGGLAASERIVVNGTQRVRPGEQVKPHLVPMTGGDDAAAATPVAGGVQR
FT                   PRAAQGNARA"
FT   gene            465258..468443
FT                   /gene="bpeF"
FT                   /locus_tag="BURPS668_A0514"
FT   CDS_pept        465258..468443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bpeF"
FT                   /locus_tag="BURPS668_A0514"
FT                   /product="multidrug efflux pump BpeF"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00915"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86857"
FT                   /db_xref="GOA:A3NGP9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGP9"
FT                   /protein_id="ABN86857.1"
FT                   /translation="MNISKFFIDRPIFAGVLSVIILLAGMIAMFLLPISEYPEVVPPSV
FT                   IVKAQYPGANPKVIAETVASPLEEQINGVEDMLYMQSQANSDGNMTITVTFKLGTDPDK
FT                   ATQLVQNRVNQALPRLPEDVQRLGITTVKSSPTLTMVVHLISPNDSYDMTYLRNYALIN
FT                   VKDRLSRIQGVGQVQLWGAGDYAMRVWLDPQKVAQRNLTADDVVRAIREQNVQVAAGVI
FT                   GASPTLPGTPLQLSVNARGRLQNEDEFGDIVVKTAPDGGVTHLRDIARIELDASEYGLR
FT                   SLLDNKPAVAMAINQSPGANSLAISDEVRKTMAELKQDFPAGVDYRIVYDPTQFVRSSI
FT                   KAVVHTLLEAIALVVIVVIVFLQTWRASIIPLIAVPVSIVGTFSLLLLFGYSINALSLF
FT                   GMVLAIGIVVDDAIVVVENVERNIENGLTARAATYKAMQEVSGPIIAIALTLVAVFVPL
FT                   AFMSGLTGQFYKQFAMTIAISTVISAFNSLTLSPALSAILLKGHGDKEDWLTRVMNRVL
FT                   GGFFRGFNKVFHRGAENYGRGVRGVLSRKAVMLGLYLVLVGATLMVSKIVPGGFVPAQD
FT                   KEYLIAFAQLPNGASLDRTEKVIRDMGAIALKQPGVESAVAFPGLSVNGFTNSSSAGIV
FT                   FVTLKPFDQRHGKALSAGAIAGALNQKYAALKDSFVAVFPPPPVLGLGTLGGFKMQIED
FT                   RGAVGYARLADATNDFIKRAQQAPELGPLFTSYQINVPQLNVDLDRVKAKQLGVNVTDV
FT                   FDTMQIYLGSLYVNDFNRFGRVYQVRVQADAPFRQRADDILQLKTRNAAGEMVPLSSLV
FT                   TVSPTFGPEMVVRYNAYTAADVNGGPAPGYSSGQAQAAVERIAAQTLPRGVKFEWTDLT
FT                   YQQILAGDSAFWVFPISVLLVFLVLAALYESLTLPLAVILIVPMSILSALTGVWLTQGD
FT                   NNIFTQIGLMVLVGLSAKNAILIVEFARELEHDGKTPFEAAVEASRLRLRPILMTSIAF
FT                   IMGVVPLVLSTGAGAEMRHAMGVAVFFGMLGVTLFGLMLTPVFYVVLRTLAGGKIHVAQ
FT                   KDSAGYGVPAPDA"
FT   gene            468454..469986
FT                   /gene="oprC"
FT                   /locus_tag="BURPS668_A0515"
FT   CDS_pept        468454..469986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprC"
FT                   /locus_tag="BURPS668_A0515"
FT                   /product="outer membrane efflux protein OprC"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85313"
FT                   /db_xref="GOA:A3NGQ0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGQ0"
FT                   /protein_id="ABN85313.1"
FT                   /translation="MNKTNINERIARVAKIAAASGLLVALLAACAVGPDYRRPDVATPA
FT                   AFKEAPALAPGEQAGTWKAAEPADAAHRGEWWRVFGDPVLDALETQALAANQNLKAAAA
FT                   RVEQARAATRAARSQWFPQVGVGFGPTREGLSSASQFQPQGSGPTNATLWRAQGTVSYE
FT                   ADLFGRVGRNVEASRADEAQSQALFRSVQLALQADVAQNYFELRRLDSDQDLYRRTVGL
FT                   REEALKLVQRRFAEGDISELDVSRAKNELATAQADAVGVARRRAASEHALAILLGKAPA
FT                   DFSFSETPIAPVAVRVPAGLPSALLERRPDIAAAERAMMAANARIGLAKSAYFPKLDIT
FT                   GAFGYEAATLGNLFLWSSRTFLLGPFAGTALTLPIFDGGRRSAGVAQARAKYDEEVANY
FT                   RQQVLVAFREVEDNLADLRLLDDQIRAQSDAVNASRRAAKLSRTQYQEGAVSYLDVIDS
FT                   ERSVLESQLQSNQLTGTQAVSTVNLIRALGGGWGSDAALGSREPGKQDVAAR"
FT   gene            470420..470563
FT                   /locus_tag="BURPS668_A0517"
FT   CDS_pept        470420..470563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87224"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGQ2"
FT                   /protein_id="ABN87224.1"
FT                   /translation="MTGGIDDEAWKGATAASRRRHTACDARRIGPACMLQREFCFVRSG
FT                   LD"
FT   gene            complement(470984..472225)
FT                   /locus_tag="BURPS668_A0518"
FT   CDS_pept        complement(470984..472225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0518"
FT                   /product="transporter, DAACS family"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86298"
FT                   /db_xref="GOA:A3NGQ3"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGQ3"
FT                   /protein_id="ABN86298.1"
FT                   /translation="MTLANKKISLPLQMILGLALGVVFGLLAPAASRDLAFISTLFGHA
FT                   IKMVVLPLILLSVTLGAFRAGTQRGRLGKTAAFSLVFFVLMTVIAAALGLALNWLFRPG
FT                   IGASHAQTASMPANLASGIDWMKFLTDMIPSNIVGALAAGNSLPVLVFGVLLGCALAAV
FT                   EDRAAPFVAVCESMLAAFFKMTEWVVSLSPIAIFAAIAVLLSSKGLAAMAPLAKLLGIA
FT                   YLGMALLAAWLTLIVKLAGHSPRAVVRKVSEPLILGFTTRSSEITFPVHLKKLTEMGVP
FT                   SSVASTVLPLSYIFNREGAVLYTVLAVCYLADAYQLAWSWPLMITIAVLTIITIDGAAN
FT                   VPSGAVVAITVILAAIGLPADAVLLILGVDAFFDMGRTALNVYASTVATTLASRVSGAA
FT                   PEIAQATTAHASRA"
FT   gene            complement(472209..472868)
FT                   /locus_tag="BURPS668_A0519"
FT   CDS_pept        complement(472209..472868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0519"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86640"
FT                   /db_xref="GOA:A3NGQ4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGQ4"
FT                   /protein_id="ABN86640.1"
FT                   /translation="MEKISSDTGSAYDEIRSRIFDGRLSPGQKISHRGLAHELGVGQMP
FT                   VRSALQLLASEGLVNIVDKSGTFVNEPTRDDLREIYELRLALESTAAYLAARGGVTDGL
FT                   SRSHAQMRRLVDENIADIMTEQKIGWVFHDEIFKAARNDRLFTTYKLLRAQTHALNELP
FT                   RSDFATVRRGTLEHLEIYAAIDARDAETARHRMWNHVIDGTPDRIRLIRAQYDTGQ"
FT   gene            473024..473494
FT                   /locus_tag="BURPS668_A0520"
FT   CDS_pept        473024..473494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0520"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85736"
FT                   /db_xref="GOA:A3NGQ5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGQ5"
FT                   /protein_id="ABN85736.1"
FT                   /translation="MLVHQQSYSIVTVPVASVLPLRARILLDGDENASRFPCDDHDATL
FT                   HLAARTSDGIVAVATICRQPFREFPPDGAWRLRGVAVEPLMQGHGVGTRLMHACIEHAQ
FT                   RQDARVVWCTARDSARGFYAALGFATSGMPLAIAARPDMVFHEMHLLLPGRA"
FT   gene            complement(473675..474574)
FT                   /locus_tag="BURPS668_A0521"
FT   CDS_pept        complement(473675..474574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0521"
FT                   /product="transporter, auxin efflux carrier family"
FT                   /note="identified by match to protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87512"
FT                   /db_xref="GOA:A3NGQ6"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGQ6"
FT                   /protein_id="ABN87512.1"
FT                   /translation="MASLILVLACLVAGAALARSKRLPANFPASLNYFVIQISLPALVL
FT                   QHLHRIAFGADVVWLFATPAIVFAATAALALAAGALLRLDKATVGCLTLVCGTSNTSIV
FT                   GVPVVQALIGSAAVGHALVVDQANFIVMCTAGLVAADLYAGGATRWRGVARQLAGYRPI
FT                   QAMALALLLRPVPFAPVVEDVLALLGATLTPIAMISVGASFSVRHARDAARNFLVGIGL
FT                   KLLVVPAIVLACGLYVFSQQGVPLAVALVQATMPPMIIAGLIAIDKKLDPPLAGALMTL
FT                   GVPVSIAAAWLWRGVLPY"
FT   gene            complement(475010..476875)
FT                   /locus_tag="BURPS668_A0523"
FT   CDS_pept        complement(475010..476875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0523"
FT                   /product="AMP-binding enzyme"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85472"
FT                   /db_xref="GOA:A3NGQ8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGQ8"
FT                   /protein_id="ABN85472.1"
FT                   /translation="MSSIQSALAACRSLTAPPPLAPAANFADVLRYRAETTPDEFAYGY
FT                   LGFGRMPDRVMRYGDIHRRALGIAREIVAHGRPADPVLLIFPSAADFVEAFFGCLYAGR
FT                   MAVPALPPRTEKERRRLISIARDCAPSFAICGNGEMDAVLAELCAAGVVAPPCREVGAI
FT                   ADGGDIGDAPGALPAIAPGSIAFLQYTSGSTSDPKGVMVGHDNLLANERLLRRHWGSDR
FT                   ERWLIVSWLPHYHDMGLIGGILQPIYAGRPAVFMSPQDFLQHPARWLHAVSDYGATCSG
FT                   APNFGYELCRRRASRMDLARLDLSTWEQAFNGAEPVRPRTLREFADAFACAGFRYDAFA
FT                   PCYGLAELTLAATSKQIGESVVIRRADRAALAAGRFEPQQDGGRSVDAVSVGALEHAHQ
FT                   TFCIVDPATGEPQPTGAIGEICVASDSVCHGYFGRPDATEATFHAYRSSAFPDGMLRTG
FT                   DLGFIDEAGHLFVSGRLKDLIILNGVNYYPQDIEGAVLNVSDQIRANRLAAIMVERDEQ
FT                   AGVVVVLEAIGRFDLAALAPEIAREVWDACQLTLSGVIRVKKGEIHTTSSGKIQRATCA
FT                   KMLADGAFTIEDAHLHDTARAWLAPVVERCGRACREPSADTPAVA"
FT   gene            complement(476892..477791)
FT                   /gene="fabD"
FT                   /locus_tag="BURPS668_A0524"
FT   CDS_pept        complement(476892..477791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="BURPS668_A0524"
FT                   /product="[acyl-carrier-protein] S-malonyltransferase"
FT                   /EC_number="2.3.1.39"
FT                   /note="identified by match to protein family HMM PF00698;
FT                   match to protein family HMM TIGR00128"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86046"
FT                   /db_xref="GOA:A3NGQ9"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGQ9"
FT                   /protein_id="ABN86046.1"
FT                   /translation="MKALIFPGQGAQAAGMGAGLFERFPEIVATANDVMGLSIERLCLD
FT                   DPHGQLADTRYAQPAIFVVNALHLAAWRDAHDTGDGAPVWLAGHSLGEYSALLAAGVFD
FT                   FRTGLEIVKRRGELFASAGGGAMAAVVGVTAVELGRRLRAAGFDDIDLANLNSAEQTVI
FT                   AGPAASVDAAASMLDAGGDVTVHPLKVSGAFHSRRMTPLKPAFEAFVSRFALAEPARPV
FT                   VSNVTARPYQPPGTPADYLVEQLDQPVRWRDSVRHMLRAGVDEWIELGPGRRILTRLVD
FT                   AIRLEPPERHAAPQPALP"
FT   gene            complement(477792..478223)
FT                   /locus_tag="BURPS668_A0525"
FT   CDS_pept        complement(477792..478223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0525"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86913"
FT                   /db_xref="GOA:A3NGR0"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGR0"
FT                   /protein_id="ABN86913.1"
FT                   /translation="MKLVLFLHLIFVAAWMSCVIVEGIFEHAIDRSPEQRAFISKLHWT
FT                   TDKYVEIPAFTIVLITGAVLLMHRAPTPLLLTKVAFGTLAIALNAVCVWIVIRRMRYAA
FT                   QADHAAWERIDRLQHKLGGVVAISMLVALGIGGYLFAGG"
FT   gene            complement(478291..480150)
FT                   /locus_tag="BURPS668_A0526"
FT   CDS_pept        complement(478291..480150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0526"
FT                   /product="AMP-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85950"
FT                   /db_xref="GOA:A3NGR1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGR1"
FT                   /protein_id="ABN85950.1"
FT                   /translation="MSSLSQQLSALGSRIFTSAPFGPGVSMQNLAEWSSLAHVQLLGRV
FT                   AAEFGVDIDIEEAYRLDSFERLLHYIERQRGPGDEAPPASAASATAAGDAGEAPATIGA
FT                   LLRARAAALPDEPFLFFPADDRSYTYRAFYGLACAAAETLRAHGLARGDRLCVVLPNGP
FT                   EFLAYYFGAHLLGVVSVPINPALTAAECAYIVRNSGAKLVVFDRRMTNLREAVRTELAD
FT                   DRGARLASADAASGFGLEALAAAADHATLALEPGLAADDDASILYTSGTTGHPKGVVLS
FT                   HRNLLSDARALVDWFAFEPGTRTMCILPLFHNNGQVITLLSPLIAGGSSVILEGKSALP
FT                   SFWKLIDTYRVNWTSVMPAFLSAFLEYGLKRTDDTLRGIVCGGQVLLDEVRSRFETEYR
FT                   VPVFEGFGLTETTSFATMNRHPAERRRFGSIGVALPCNALRIVDANGREAAANETGEIL
FT                   IRGENVAARYHGRAELTAERFRDGWLHTGDYGYRDDDGHFFFATRVDDLIIKGGENIYP
FT                   AEIENVLHGCGDVVECAALGVPDPILGQEVCVYVKLRPASTLGKDDIRRLCEGRIAHYK
FT                   CPRHVVLLNELNDLPELPKGPTRKILRRKLLAHFATLRERAAA"
FT   gene            complement(480180..481439)
FT                   /locus_tag="BURPS668_A0527"
FT   CDS_pept        complement(480180..481439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0527"
FT                   /product="putative diaminopimelate decarboxylase"
FT                   /note="identified by match to protein family HMM PF00278;
FT                   match to protein family HMM PF02784"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87935"
FT                   /db_xref="GOA:A3NGR2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGR2"
FT                   /protein_id="ABN87935.1"
FT                   /translation="MNANLHAFTAADAAPSTEYWWARERLHYRGNALHFCGRDVAELAA
FT                   AFAEPVFLYDPQRALDNVARLQRALGDLQRGDFRLHYAMKANRFRPLLSELRRSPLFGI
FT                   DACSPEELREALACGFAPERISYTAHGMMPDEAALLAALPGVHVNCDTLSAIALLGSRS
FT                   PGREIGIRVNPGVGIGYGDSERLSYAGAAVTKFGIYAEQFGAALELAARHGLAVTWLHC
FT                   HAGCGYLDAQLESFERVLDALDAFAARVPGLRGINLGGGLGLPHRATDRPLDLERWRAA
FT                   VHARFGGRPLAIAIEPGDFIAKDAGMLVLRVAYVELKRNRRFVGLNGGFNLAIEPAFYD
FT                   LPCEPVPCVRRPGPAQSVCVAGNINEALDVWGNDVSLPPVEPGDFIALLNAGGYASSMS
FT                   SNHCLRGQFRELALFDAAPH"
FT   gene            complement(481436..482917)
FT                   /locus_tag="BURPS668_A0528"
FT   CDS_pept        complement(481436..482917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0528"
FT                   /product="FkbH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85587"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGR3"
FT                   /protein_id="ABN85587.1"
FT                   /translation="MSARRLYVGATFTASPLDPLLRARGFGDVAFARYNQLLQALVAPD
FT                   PRHADDATLLLVRLADFVRHEANDRTQSPDALAALLAQRADAWLDALASFAAGRARPPC
FT                   IVVLPSPALDARGAAPADTGRRLERALLGVPGLRALDWADFAASSAIAQPFDPIADKLG
FT                   HVPLSIEGFAAFAQWLAERLRGEAGEAAHAGKHGGDAAPAGANANPPARAEADAARAPA
FT                   GAHANVDPHAAADIAAATGRAAAAHPGAEAAGPADAAAARAAVPPHARAPADAPAPAAS
FT                   PAAPSPSLARFFERLQLRIAGVALDDETALAKSARLSHTAATFHLSGRPYLEADLLDAT
FT                   SRDAAALALTAADRFGQYGCSGFVLVRADAGLPVLAEFVLSCTVLGKQVEHGVLLALAQ
FT                   AAQRAALPAVALDYVRTDGNQPAVDFVDAIAAQAGVALDRSGPRARLRIAPCALAEAVL
FT                   ACAKAPQALAAAAQALDLAPLFSHSNATAHPAAHR"
FT   gene            complement(482914..484005)
FT                   /gene="ilvC"
FT                   /locus_tag="BURPS668_A0529"
FT   CDS_pept        complement(482914..484005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="BURPS668_A0529"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="identified by match to protein family HMM PF01450;
FT                   match to protein family HMM PF07991; match to protein
FT                   family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86512"
FT                   /db_xref="GOA:A3NGR4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGR4"
FT                   /protein_id="ABN86512.1"
FT                   /translation="MRFSPSLPHVILMNDLIYQDEHASLQPLEGLTVTVIGYGIQGRAF
FT                   AANLRDSGVAVRVGNIDDRYFELARAEGHRVTDIAEAVAHADIVLLLIPDEAHGAVFDV
FT                   DIAPNLREGALLCVAHGHSLVQGDVRPLAGRDLAMLAPRMYGDPIRRYYLAGQGAPAYF
FT                   DIVADHTGRARDRVLAIARAVGFTRAGVMALGYRQETFLDLFQEQFLAPALVDLVETGF
FT                   QVLVERGFNPKAALLEVYGSGEMGKMMLDGADIGLDEVVALQGSPTCQVGYHRWRGRTL
FT                   PAAVRELAARVLDQIDSGDFSAYLKEHAANDYAALDEARRAALKRPLNVAHAQVRAAFR
FT                   FPTEAAGGLYQAAPAGAEPELAR"
FT   gene            complement(483975..496343)
FT                   /locus_tag="BURPS668_A0530"
FT   CDS_pept        complement(483975..496343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0530"
FT                   /product="putative polyketide synthase PksM"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF00109; match to protein
FT                   family HMM PF00550; match to protein family HMM PF00668;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02801;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM PF08241; match to protein family HMM PF08242;
FT                   match to protein family HMM PF08659; match to protein
FT                   family HMM TIGR01746"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87434"
FT                   /db_xref="GOA:A3NGR5"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGR5"
FT                   /protein_id="ABN87434.1"
FT                   /translation="MTASPPSSALVTAVEAAVLSLAGDVAGRAFDASAAERPLHALGFD
FT                   SVQYVELSGCLNEYYGLDLAPTLFFDVHVPRRIAEHLVARHPAALARKHGIGAGDDADT
FT                   AARARAAAAENRAPQPDMRAGAAGPAGEPLLDTHASPGEPRGDAHENPCDDTRGAAAAD
FT                   AHESAADIAIVGMAGIFPQSADLDAFWRHLAAGDDLIAEAPASRWDWRAGDGEPASRWG
FT                   GFIPRIEYFDAAFFGISPREAEQMDPQQRLLMQTAWAALEDAAVRPSDLMGSDAAVFVG
FT                   VSTSDYMALLPGADGHLAVGNAHAMLPNRLSHLLGAHGPSEAVDTACSSSLVALHRAVR
FT                   ALRRGESSVAIVGGVNVMLTTRLHRALAAAGMLSPDGRCKTFDAAANGYVRGEGIAALV
FT                   LMPLERARANGHPVCAVIKGSAVNHGGRAAFLTAPDINAQAALIEAAYRDAGVDPATVS
FT                   YVEAHGTGTSLGDPIEVQALRQGLDACARDLAGTASHAPARCGLGSVKTNIGHLEAAAG
FT                   LAGVVKVVLAMDRRMLPPSLHCRELNPYLKLDGSRYHVVTEPTPWPDEATPTPLRAGVS
FT                   SFGFGGSNAHVVLQSAHARPIARASAPPPPHTNEQAGADAPAADGPRAWFIPLSARTDA
FT                   ALHARAAQLAHWLDTEPADDAWLPALAKTLSIGREPMARRFGITCASLDELRAQLAIAL
FT                   GGRATSLARDDARLRPHAPACAAWLAGETDPLPAAWDDATPRLRLPVYPFEGERHWPTE
FT                   AAPAARFALAPDADGAYRIAIAPDAPLVADHRLAGEPVLAAAAQIVIAWRAFEADALAG
FT                   DAGQAGDVGESMESMESNGSSASKPAATSADSGTAADSRDPHDSYHSHDSRHTIDTNAT
FT                   SATTPIALRDIEWLAPIAIGAPTDLCITLARDAHGDIDARRGEAAHRRANGRAARFAIA
FT                   AAPAIDTPLGRGHATRIASAPSNAPELDIEAIRARCTQAVSADACYDAFAAIGIDYGPT
FT                   FRPLRAIAVGRDEALAEFDASALARTTGDARIVALLDGAFQAIAGLTLAHAASLESGLL
FT                   PASLARIEFTGPLADSVRAWIREAPSDTGRRTFDIDLVTASGRSCASLRGLALASGRSA
FT                   TSREAPRITTPGDHLFAPQWLPCATNAAGAATPSPRAGALAIMGGTPAQRAALAATHAA
FT                   APRLIDDIAELDANVSHLVWLPSAPADAHAPLAQCASLDGLRLVKRLLALGAGDRAFDL
FT                   TVLTVRSWTMPGDAPAFPAHADLAGLCGALANEYPHWRVRLIDLPDAAALPADWHARSA
FT                   EGGHPLLLHRHGQWFARRLVPLAALPAPAAQPYRPGGVYVAIGGAGGLGRVWTEHAIRA
FT                   CGAQVVWIGRRPLDAQIDAHCDALAALGPRPSYLSADASDAESLRAARDAVLERFGRLD
FT                   GVVHTAIVLEDGGLAQLDEARFSAALNAQVATTANLARVFGSDPLDFILFFSSLQSAFV
FT                   AAGQSNYAAGCTFRDAFADWLRTQLRCAVKVVNWGYWGQTGVVATEPYRARMAALGIGS
FT                   IEPAPAMAVVDALLASNVDQVGYLKTIASAAVPTLAPALAARIAPRTRALAGTPPRVDA
FT                   TDDSAAWRDALAALERAIARRLFAELGALRVFGGSGAPGGHAFDDGAARNSAAGQRSAD
FT                   DRAPDAAPFDIDTALRTGRIAPAYRRWLAHALTLIARHGPLAWDGRSGRLAEAPPTPDT
FT                   ARAEWARARAELERTALLDAHLALVDATLDALPAILQGSVPATSILFPDGDLSRVEAVY
FT                   QRNEQADRCNRALADAVLHLVGDASSAQPAALAEIGAGTGGTTVPLLAALDARGARLGR
FT                   YDFTDISKAFLLNAEQTFGRGRDMLRYRLFDVERPIAGQALDTGGYDIVIATNVLHATQ
FT                   DIGVTLRNAKALLKAGGHLIINELLGTHGFAHATFGLLPGWWRHRDSARRLPGSPLLSR
FT                   DGWTRALREAGFAVLDGGSAGAAAGQGVIVALSDGVIVQPSHADARAASCAASRAAPGD
FT                   DAGAHASAARPAASARSTASPAHAPAASPIAAAPTGASLRARCVQALAQLVARTLKMPV
FT                   GKLAPDQPLGSYGVDSILVIGLTKTLRETFGVALSNATLFEHATLNALAEFFVAEHRAA
FT                   CERVLGGDAEPAPNAPNGPNAASAAAATRPAMPPARAGAPSPAAASAAPKPRESNVCAP
FT                   PSADDTAVAVIGMSGRYAQADNLREFWANLRAGRHCITEVPAERWDWRTHFDAEKGAPG
FT                   RTYSRWGGFLTQIDRFDAAFFRIAPNDAEQIDPQGRLFLEESWAAIEDAGYTSDTLSAD
FT                   RRVGVFVGVMNGDYPTGAQFWSIANRVSHALDLHGPSLAVDTACSSSLTAIHLALDSLR
FT                   SGTCDCALAGGVNLIQSPKHLVGLASLTMLSAGDACRAFGAGADGFVDGEGVGVLVLKP
FT                   LSRALADGDAIHGIIRGSMINAGGKTHGLTVPNPRAQQAVVGAALARSGVPARAVGYIE
FT                   AHGTGTALGDPIELAGLTRAFAEATDELGFCALGSVKSNIGHCESAAGVAGVTKVLLQM
FT                   KHRELVPTLHAHEPNPDIDFARSPFVLQRTLAPWPQPALDGWPRIAGVSSFGAGGANAH
FT                   VVLEEFVETRAAAGGDDAGPAIVVLSAATDAALRRRARQLHAALAAGEIGDERLHDLAY
FT                   TLQIGRAAMASRFGCVAGSAAELQAQLAAFVEGDASRGWHAHRLAGDRHGLAELDADPE
FT                   LRASLVEQCVAAGKLDRLAALWCQGLGIDWPALHRGRARRRMHLPTYPFDGPRYWLRDD
FT                   AAHAAEPAPADGAAEDASADAPNAANAPTPDVATLVRRTVAQVLGYPDVDMNESFLSLG
FT                   GDSIRAARAHRVLQRALDTRIPLSLMLEASTLAECAQAIDALLSTQPAPASALALETNA
FT                   GAAGAPIADAAALELSAPPSRESASPPHPASPPRDARPRVHPLSSNQQQFFFLDRLNPA
FT                   NPAFNLPGALRVRGEWHAHALEATYQALIDTHDVLRTRFVVRGGEPCAEVAPHRAAAIR
FT                   RHDLTALLPKHQAARVAECLTESSREGFALEQGEPSRLTVLELRDDDHVILLNLHHIVG
FT                   DAVSVVVLLDALARAALTGRAAAPDRARPQYAQWAAHERDALPATIERELPYWLERLRD
FT                   VPPPLPLPCDRARPPVPSYRGRSVPLAFAPALITLLDAYCKAHGLSRFVVMLAAFKLAL
FT                   RVLSGRDDVVVGSPYANRAEDDTADMIGSLAYALVLRTRLGEAQTFADAVALVRRTVHG
FT                   AFDHLGVPYPRLVEALNPARHGGANPLYQIMFNVIPMPALPEGVEPVEVDSGWLDYDLF
FT                   VRLRASSHAIDGVLQFSADLFDRSTAEAIAAYYVELLHTLLAHPSLPLASLAPPAELAL
FT                   ERTIADAMPPLRIEIASTFTDRPLAGTLRYWGTATGQPIEPNFAPYGQLFQTLYDPSTP
FT                   FHANRHGTNVVLVRPCDWLRFDDADADAARADLTGDAGAAAAERIALYADELADALRDA
FT                   APSLAVPVLVLVLPDDAASLAARDEHTGTATEAPAEALADARAGKPSPDTSLAPYRMLR
FT                   AALADLPSITVAHWRDVAAIYPVADVFDPHADAAGHVPFTSEYYAALASYIARTAFQHA
FT                   SVPLDDAWNRLAAQIRDDAEHLLAAPADGARARRAPHAAPTNETQATLLPIFAAALKLD
FT                   DPGIDDNFFDCGGHSILAIGVVHQINEAFGTSLSVADIFMAPTVRRLAERMRDAPDGPE
FT                   YVELASAAALPDDIAPLPGPVADAPRALLLTGATGFVGRHLLRELIDRTSATIYCLVRA
FT                   PDAAQGLARIRATLERWSLWRDGDAARVIAVPGDLGRPRIGLSDAARARLVAEVDAIYH
FT                   NGTSMNHLESFEMARAANVGGVIELLRIATEGRPKTFNYVSTLAVFSMRERTGTHVFDE
FT                   AAPIDGERHPSDQGYTTSKWVGEQLTHLAAARGVPCNVFRLGLVTGDVRHGHYDELQAY
FT                   YRLLKSCILMGAAFDDFRYDLVITPVDYVARALAHLGARHSQGGRVFHLSTMQVTPMRT
FT                   VFEMMNAHLRTPMRMLTHRAWIDELRVRYRRGDVQSIVPVVQWMMNMSDAELVKLARER
FT                   EETTFIYDCTATHRELEQAGIVVPVFDDALLQRYLRGMFNDDADLRALAARLDGGECAS
FT                   PLHSHT"
FT   gene            complement(496402..497946)
FT                   /locus_tag="BURPS668_A0531"
FT   CDS_pept        complement(496402..497946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0531"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86341"
FT                   /db_xref="GOA:A3NGR6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGR6"
FT                   /protein_id="ABN86341.1"
FT                   /translation="MHPVAAPHRDARRHRRNLRDSRGRARARAARARATCPRSRGKRNM
FT                   LINGLCIEGGGEPLSIVDPATGEPLAAPAAASAADLERAVAAAEAAFPAWRATTPATRA
FT                   SLLLALADEIDRQAGALARIESRNTGKPLHLVVQDELPAVADCFRFYAGAARTASGPSA
FT                   GEYVEGHTSMVRRDPVGVVAQIAPWNYPLMMAAWKLAPALAAGNTIVFKPSEWTPLSIV
FT                   ALEAALARIFPAGVVNIVLGDGASVGRALATHPRVRMISLTGSVEAGKSVLAAAAGNLK
FT                   RTHLELGGKAPVLVFDDADLDAAVAGIRYAGFYNAGQDCTAATRIYVQRGIYDTLAQRL
FT                   ADAASTLRVGPPDRADAEMGPLVSAAHRARVERFVREAAALRHARVLTGGAPLPGPGCY
FT                   YAPTVIAGVRHDDAPMRREAFGPVVTLTPFDTESQALRWANDSEYGLASSVWTRDAARG
FT                   MRLAACIDAGVTWVNAHFTYTADMPHGGTKQSGYGSDLSTLGLADYTQPRHVMWRH"
FT   gene            complement(497808..499229)
FT                   /locus_tag="BURPS668_A0532"
FT   CDS_pept        complement(497808..499229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0532"
FT                   /product="aminotransferase, class III family protein"
FT                   /note="identified by match to protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86794"
FT                   /db_xref="GOA:A3NGR7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGR7"
FT                   /protein_id="ABN86794.1"
FT                   /translation="MAYRNDSLLTSAQQDTRHLLHPWADLSALGRETPTVIVDAQGTRV
FT                   TDADGRTYLDAIGGMWCVTLGYGRREIADAIRDQALRMPFYTPFGAMTNEPAAALGARL
FT                   AALAPGDLKRVHLTTCGSTAVESALRFAHYYFGATGRPHKRHIVTRGDAYHGSTYLAAS
FT                   ISGKAWDRTCFHYDSTIVHHLSSPNPYRRPAGMSVDAFCASLVDEFDALIAKLGAEQIA
FT                   CFIAEPILASGGVIVPPPGYLAAMRERCRRHDILYISDEVVTGFGRVGHFFASHAHFGI
FT                   EPDMIVVAKGLTSGYQPLGAVLISERLVDAVSGEHAYGNGVFTNGFTYSGHPVACAAAL
FT                   ANIELMERERICEHVRDVGPYFIRRLDALRRLPIVGDVRGDHLMACIECTSGAGATGAL
FT                   PTPADIAIAQRVDRHCEEMGLLVRPYESMCILSPPLTVTRADIDEICAILAAALERAQR
FT                   ELAQHAPVREENETC"
FT   gene            complement(499238..500317)
FT                   /locus_tag="BURPS668_A0533"
FT   CDS_pept        complement(499238..500317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0533"
FT                   /product="putative peptide synthase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86058"
FT                   /db_xref="GOA:A3NGR8"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGR8"
FT                   /protein_id="ABN86058.1"
FT                   /translation="MRDRAPRRPLHQYKEKRAMDSFIELQENDRRQVPVRGRAYLAGAD
FT                   SPLVPVTIPIANDLALGLAQAAATPAEAAALCRDAIDARLPATGALLFRGLPIADRAGF
FT                   DTFMRALGYAPRSYDGGIAVRARDTGYALVASQEDPRITMAPHNEMAYLPNPPRKVFFF
FT                   CAAAADEGGEVPINDVRLAAAQIPDEVLAQFERKRIGYHRHLPRESTPTQIGWTDTFGV
FT                   RERDAVDALMRDKGYEHRWLDGDGLGYGYVHDAFLDDPAGGAPLWFNQVTELHASYWRS
FT                   HPLFPSDWDDARYPATTTYGDGEPIDPELVTKLRAALWRTSRAVAMRPGDVLVLDNVYV
FT                   QHGRFAFSGPRLHLVSLTD"
FT   gene            500393..500710
FT                   /locus_tag="BURPS668_A0534"
FT   CDS_pept        500393..500710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0534"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88124"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGR9"
FT                   /protein_id="ABN88124.1"
FT                   /translation="MAQAAQTSDAAAEAEAEAEAEAEAEAEAEAEADAEADAEADAEAE
FT                   AIAVALALALAVFDVVDVIDTDASSRRTSGHRAASRRRPARTPPRSPRCGGRPLARRIR
FT                   P"
FT   gene            500707..500868
FT                   /locus_tag="BURPS668_A0535"
FT   CDS_pept        500707..500868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0535"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87205"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGS0"
FT                   /protein_id="ABN87205.1"
FT                   /translation="MRLSANQASACTIGASCRAKTGTVERWDIERGSPCIGKPRDIRRE
FT                   IGGGRCNP"
FT   gene            complement(501303..501821)
FT                   /locus_tag="BURPS668_A0536"
FT   CDS_pept        complement(501303..501821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86313"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGS1"
FT                   /protein_id="ABN86313.1"
FT                   /translation="MTITLIEPVQQRTGIYPSSDLKVEDGYPSSDTFQIIQTQDGRGAG
FT                   VRVLKAFARGRRMARVSGQITAFCRLHTLQINAHTHLYDPHFSGLLLHSCDPNVRLDMA
FT                   GFELWSLRDIAAGEMLTMDYASTEDVLMRQFECHCGAPNCRRWITGAKELPNDSGQTLL
FT                   AGLRAAEIA"
FT   gene            complement(501921..510428)
FT                   /locus_tag="BURPS668_A0537"
FT   CDS_pept        complement(501921..510428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0537"
FT                   /product="polyketide synthase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF00109; match to protein
FT                   family HMM PF00501; match to protein family HMM PF00550;
FT                   match to protein family HMM PF00698; match to protein
FT                   family HMM PF00975; match to protein family HMM PF02801;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85391"
FT                   /db_xref="GOA:A3NGS2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGS2"
FT                   /protein_id="ABN85391.1"
FT                   /translation="MRQIVSTSNGSLDSRARIIAFPFAGGSGASYADIARELGDAFAFT
FT                   TLSLPGRGATQHIPFYDDWPSLVDDLAAEVARLDDGTPFFLFGHSLGALLAYEVARTLE
FT                   QRGGARPAGVFLSGHPAPSRERAAPAWRRQTHALPDAEFVEAVRRWGFFPEGALDDPDV
FT                   ARYVLPPLRADLRLAETYRHARGDALRAPCAIYGGAADPSTSADDLRAWRAHVSPQHAC
FT                   PVESFDGHHFYFLDPSSRAALCASLAGHIEQRLAQRPASIVAAAPDPGSRVAACLRTAG
FT                   DWGDAQAVLAAIREHVARTPDALALQDGERTWTYRQLASHAAELADAFRAAGVGRQDVI
FT                   GVFLPHGAEYVLTIVGAWSIGASVCLLEKSWPDSLVGEFVASCRVAQLATTPALLARAA
FT                   KHLPDARCTLVGARPPLAQRAWTSVAPRPDDIAFVSLTSGSTGKPKAVLTTHVGTSYCF
FT                   HARDALYPYADGEREGLNVFLAWECLRPLMFGRPAVVIGDDVIFDPPRLVALLRRERIT
FT                   RLVVTPSLLESVLDFPGIAGQLRDALAHMSAWFLMGEVVPQRVVDKARAAFPPSVRLVN
FT                   AYSTWESLDVCYADLLPSRASDDGRRVPIGRPLPGCALAVLDEAGRAVPAGETGELYIA
FT                   SPALGPGYLDDAARTAEKFLPSVAALAERGHDAPAYRTGDRARLLPDGQIAILGRIDNT
FT                   VKIRGFKVLLHAIENVLDAVDGVSKTLVVPIDDPHTKQPSALAAYVVGRGGAPSETTLA
FT                   RLRQQARAKLPEYAVPAHFIGLEAFPLRAGTSRKLDRRALPPPEPPAGASPAERGAVPA
FT                   AAGDGLEARLAEVWRDVLGVASVARDDNFFELGGNSLSAAKAVGTLGERLGLSLAVVDL
FT                   YQHSRLRDLADYCRRSREEDAARGRADAARDARAARTASGAGAPKVAIVGMAGRFPGAD
FT                   SIDAFWRNLTQGVDSLSRFTREQLLAKGVDAAQLDHPDWVSAAQVVGDADKFDALFFGI
FT                   GRREAVLMDPQHRLFMEVAWSALEQAGYARAENRYRTRTGVFASCGIDGYLVHHLQGGG
FT                   LLTPLDPGRLMLTEIGNEKDYVATRVAYQLDLGGPAVSVGAACSSALVAVVQAVQAIRA
FT                   GQCEMAIAGASALSFPNFGFCYEDGLVGSADGHVRPFDARASGTLFGDAVGAVVLKRLD
FT                   LAEADGDPILAVISGVGLSNDGRMKAGYTAPNADAQRRCIVDALDMADVRSEQISYVEC
FT                   HATATLIGDAIELKGLSDAFAQTRGADADAAAVAGRCAIGCVKGNIGHANCAAGITGLI
FT                   KTVLQLRHRQRVPTVHFDTLNPKLVPFVEHDASPFVVQRHADDWTVADPATQLPRRAGV
FT                   SSFGIGGTNAHVIVEEAPPPAHAAAPAESVPRAHHLMTVSARTPGALARNLQALAGRLA
FT                   ALEAADLGCAAHTLHVAREAHPLRVALAVPARPADAAAALAEASVDMPDMSDAPAAPVR
FT                   AKPGATVAFCFSGQGSQHPGMARELYRSNAEAGRFRHHFDAACAALERALGAPIAHAIL
FT                   NADDEAMRRPLVTQCGLFALEHALAAVLGEYGVRPVAVAGHSIGQYAAAVAAEALTLEQ
FT                   AAALVAARAGATEALNAFSAGGGAPARGGMLAVTGDDARIEQWAAGRADVWIAVRNAPR
FT                   TLVLAGAQPALADAARALAALGCRCRPVPVSHPFHTPLMQPVADAIIAQRIAGAAPRIP
FT                   MTCNVTGGWLGADAASPGYWARHLLEPVRWSDNVAALLRWQPDVVLEIGPGTVLCSLIG
FT                   KHLAGGANAGAPARPNGHAGANAAALAPRVLPTLPAAGDDAHDAAHFCNTIGQLWCAGV
FT                   PIDWRAYHAHEAAAPGRALARVPLPGYAFERDSYWTRPRASIYVDAAQADAEPDAAPAA
FT                   ADHTDAADADSARAALADASDKTPAARAASTHTCSGECACERACAAEPRPSGGMERVAA
FT                   PPAPSSRGLVRLKPRRRPRMKLYCFPYAGGSSRSFDGWARTAPDWLDIVAIEWAGRNAR
FT                   AEESLARDDAADLAAREAIAAAIVADAGELPVAFCGLSYGGAAATELLGGPLRAWAASG
FT                   RVKGLAIVGRAPLLEQPAIDAPADSFLLVPDALRDDPLWQEIFRPVLEADLDADARCAH
FT                   RIAQRWRDGGRQPLLTVPLQIHGAHDDPAFDWRLAGDWARISSAPLASLHRYPGGHDFM
FT                   IRCEAEIVARVAAWLRPQRAARTAAPAPTFALHWQPRAIAPIAPNTPITPNPLAAADGS
FT                   STGASLADASQADTSGAAMGAAPVAAPLPECAVYAAGGEASAFERLAPLLRESGDEAAL
FT                   LCIGAADDPLGAAQCAGFVKLWQALAARECAGTLTLVLPAGAASGPLVGAARVASAEHA
FT                   ALRVRLVLADDHPDLAPRAADPRWAAGLARDAAHCGDEPWLLRRAGRMFAPRLMPHAAP
FT                   ALPEGTLGAAGGPYLVTGAAGGVGRALVDWLIDEQQVPPQRLIALCRNADLAPRGVRAV
FT                   AADLADARALGAALESIGEVEGIFHLAGVLDDGVIANLDEARLRRVLAPKQSLAALLAH
FT                   APRWRTRWAVAFSSTSALLGVPGQANYAAANAWLDQLACWPARAGEPPVLSIQWGSWAD
FT                   VGMSARSDRAQRRAMQDGERALAPDAAFAALGALLAGMLGGAAAARQFAVCDVDWPRSP
FT                   WRDAPIVEAIARGAPNAGSEAEAAKVTSATNRTKRADEASGANGWIAASSTPVAMSSAT
FT                   PAAHVCGNARADAAAPRAGDESDRARSPRPASEPARFAAPTVEAAAAAQAPAARATRSA
FT                   SAPDPVRAFLEDYVSRWDERLDLATLGLDSLDLAQMRNGFFKKFGVQIPLSTLASPTLK
FT                   IGELARRMRNVAGIADE"
FT   gene            510707..510829
FT                   /locus_tag="BURPS668_A0539"
FT   CDS_pept        510707..510829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88529"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGS3"
FT                   /protein_id="ABN88529.1"
FT                   /translation="MNTYPTPALRKFLSFEMPGAYVQSMATIAKPVQDMRKPQC"
FT   gene            complement(510802..511002)
FT                   /locus_tag="BURPS668_A0538"
FT   CDS_pept        complement(510802..511002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85742"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGS4"
FT                   /protein_id="ABN85742.1"
FT                   /translation="MSQIISYIEIKTAPRARIHPGQEGNPIEFPNLFFGIYIIKFINAT
FT                   YIIFPDDIYNASNQHCGFRIS"
FT   gene            complement(510999..511316)
FT                   /locus_tag="BURPS668_A0540"
FT   CDS_pept        complement(510999..511316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87262"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGS5"
FT                   /protein_id="ABN87262.1"
FT                   /translation="MAGQASRAERPLKTAEGRCGWLSADSTRTTQASADDRAGHARKTV
FT                   RARGTPGLVAERSVLDGRRAHGDGPHAAHRAAAATALRHSGSATAFPTISGRAKFSLLL
FT                   N"
FT   gene            511372..511647
FT                   /locus_tag="BURPS668_A0541"
FT   CDS_pept        511372..511647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0541"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86181"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGS6"
FT                   /protein_id="ABN86181.1"
FT                   /translation="MRAARVPRVRGGSRDAGVAGARGSRAMLERRAPSAGSASAQAADR
FT                   PAAFDETNGVPCFGGAAVKLAGVSPRADRRCPLAPFEHAFFIGSLT"
FT   gene            511674..512390
FT                   /locus_tag="BURPS668_A0542"
FT   CDS_pept        511674..512390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0542"
FT                   /product="autoinducer-binding transcriptional regulator,
FT                   LuxR family"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF03472; match to protein
FT                   family HMM PF04967"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88401"
FT                   /db_xref="GOA:A3NGS7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGS7"
FT                   /protein_id="ABN88401.1"
FT                   /translation="MFEGLSIGSFNEILNATCKKSLFEQTAYHVRQLGFKNFAYRHQIS
FT                   GAASSRCMLDGFPAEWRLRYDAADYLSIDPVVQHCRCRTVPLIWHDDLYTTSRAKLMRD
FT                   EAKSYGLVYGLSCPVHDRSGAISMLSMATDDPFEHDASDILRLLSLSQLLASFVHAAMH
FT                   ELLDCRLRRQGSCDLTARERESLQWAGRGKTAWEISKILGISERTVVFHLSNAARKIGA
FT                   NNRAQAVVIASARGLI"
FT   gene            complement(512563..512688)
FT                   /locus_tag="BURPS668_A0543"
FT   CDS_pept        complement(512563..512688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0543"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85956"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGS8"
FT                   /protein_id="ABN85956.1"
FT                   /translation="MQAKLPAPALLRGGAAASFRNELRSMIGPGGEDGLRSDFAK"
FT   gene            512730..513569
FT                   /locus_tag="BURPS668_A0544"
FT   CDS_pept        512730..513569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0544"
FT                   /product="ABC transporter, methionine uptake transporter
FT                   (MUT) family, periplasmic amino-acid binding protein"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85766"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGS9"
FT                   /protein_id="ABN85766.1"
FT                   /translation="MQSRLFLARILRRASRAAAAAFALAVFAEFAVPLAHADSTPLKVG
FT                   IATSPQIDALKVAAKEAKAQGLDVKIIEFTDWNTPNAALANQDIDVNYFQHIPFLENAK
FT                   KQRGYDFVAIAPGTIMKIGLYSKKIKSFDQLKNGATVAIANDPVNGGRGLLLLQRAGLI
FT                   ALKPGADYRATTRDIVSNPKHLKILQLEASQLARSLDDVDLAQGYPSFIKLAGTADPNG
FT                   ALLFDGLENKLFALQWVVRPERANDPRIRRFIAIYQHSPAVRQALDDAFGRLYAIAW"
FT   gene            513563..514981
FT                   /locus_tag="BURPS668_A0545"
FT   CDS_pept        513563..514981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85546"
FT                   /db_xref="GOA:A3NGT0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGT0"
FT                   /protein_id="ABN85546.1"
FT                   /translation="MVKPQARAMTNKKILLNAFDMNCVGHINHGLWTHPRDRSAQYTDL
FT                   DYWSDLARTLERGKFDAIFLADIVGVYDVYGGGPDLALRESVQVPVNDPLLLVPAMAQV
FT                   TKHLGFGVTANLTYEPPYLFARRMSTLDHLTKGRIGWNIVTGYLDSAARGMGLARQIGH
FT                   DDRYARADDYMEVVYQLWERSWDDDAVIRDRAARVFARPDKVRRVRHDGPYYSVDAIHL
FT                   SEPSPQRTPVLYQAGTSARGVEFAAKHAECVFVNGQSKAAARSAVADIRAAAARIGRDP
FT                   ASIKVFAGITVVTDENERAAREKFDEYRRHANPEAGLAHFASSTGIDFSRFGLDEPIAH
FT                   VKTDSIQSAVDAISKKSASGAWTVRRMLDQMSIGGRYQPVVGSPSQVADELAAWVDETD
FT                   VDGFNVTRTVVPESFDDFVDRVVPALQDRGLYKEDYDRAPTLRAKLFGAGGRLPDWHAG
FT                   ARHRFGRARETART"
FT   gene            514978..516195
FT                   /locus_tag="BURPS668_A0546"
FT   CDS_pept        514978..516195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0546"
FT                   /product="ABC transporter, methionine uptake transporter
FT                   (MUT) family, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF09383"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88366"
FT                   /db_xref="GOA:A3NGT1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGT1"
FT                   /protein_id="ABN88366.1"
FT                   /translation="MIERRGDPMAQLLDSPGFIERSAAVPHKATAAAPAARDAAAPAAV
FT                   PGAAVSFELVGKVFDGPRGPAAALREVTLDIARGGVFGVIGRSGAGKSTLLRLVNGLER
FT                   PTSGAVRVNGVDVGTLDERGLVALRRRIGMVFQHFNLLSAKTVAQNIGLPLKIAGVPKA
FT                   ERARKVDALLDLVGLAAKRDAYPASLSGGQKQRVGIARALVHDPALLLCDEATSALDPE
FT                   TTQSILALLADINRRLGLTIMLITHEMEVIRAVCDTVAVVEQGEVVETGPVWRVFGDPR
FT                   HGATRALLRTLAHDLPADLAARVRPLDGAAPLPCGAQLLLDVRYTGASGGEPDLGALTA
FT                   ALARNVGDAVHFVHGGLDRIQGRVQGRLVIAASLAARGAAGPDRIAAALAAARRHANRV
FT                   EVLGYV"
FT   gene            516188..516844
FT                   /locus_tag="BURPS668_A0547"
FT   CDS_pept        516188..516844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0547"
FT                   /product="ABC transporter, methionine uptake transporter
FT                   (MUT) family, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87413"
FT                   /db_xref="GOA:A3NGT2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGT2"
FT                   /protein_id="ABN87413.1"
FT                   /translation="MSELWLPELADAIRDTLWMVGASALVAALVGVPLALVLVTTAPGG
FT                   LYERRGVNAALGAIVNAFRSTPFVILLVALLPFTRFVIGTTIGVWAAIVPLSIAAIPFF
FT                   ARIAEVSLREVDKGLVEAAQAMGAERRHIVLHVLLPEALPGIVGGFTITVVALIGSTAM
FT                   AGAVGAGGLGDLAIRYGYQRFDTAVMATVIAILIALVTVVQFTGDRVVRRLAKRA"
FT   gene            516841..517401
FT                   /locus_tag="BURPS668_A0548"
FT   CDS_pept        516841..517401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87921"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGT3"
FT                   /protein_id="ABN87921.1"
FT                   /translation="MSRPAHNGAYGLHVDAYGGRGGGMRSAAACAAAHARVTDIAGAAS
FT                   APEKAHCRAGGPAARSGACAALDGGRPIRHGAGGRPIERATPHVPHARRCRAHIGLTCG
FT                   YATITAAYMHATPQPRCGVFAMATSRTIMAPTSTSTSTSPAARFGRARAVRPRRFARCA
FT                   DVGRASGARRQTGIRTNRFSKAM"
FT   gene            complement(517454..517585)
FT                   /locus_tag="BURPS668_A0549"
FT   CDS_pept        complement(517454..517585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0549"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85577"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGT4"
FT                   /protein_id="ABN85577.1"
FT                   /translation="MAGLPVDAAAARDITRAHALRRLVWSIARLAVWCASNTSAGHL"
FT   gene            517628..518803
FT                   /locus_tag="BURPS668_A0550"
FT   CDS_pept        517628..518803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0550"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87694"
FT                   /db_xref="GOA:A3NGT5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGT5"
FT                   /protein_id="ABN87694.1"
FT                   /translation="MTEQAGRPPRTLAELIAALRASAPERDRAGGHAAREKRWIADAGL
FT                   LTLAVPREFGGQEAGWPVIYHTIRALARVDSALAHLLGFQCLQIVSVDVWGSAAQRERY
FT                   LRGTVEHDWWWGNAVNPLDTRLVARATGDGGYRLDGVKGFCSGTRGSQRMTVSAHDSVT
FT                   GKPVFAVVPTQREGIAVRDDWDPIGQRQTDSGSVAFDGVRVAPDEVLHRSEAPPMPRAT
FT                   LRALVSQLVLTNLFVGIAEGALAEARDYVQRAGRPWLHSGVERAADDPYTLQRFGDMRV
FT                   QTVSAEALADRAARALQGAWAKHDALTADARAEVALAISEAKIVAQRAALDVSEALFDA
FT                   CGARATAAPLALDRFWRNARTHTLHDPLDYRLRDVGRYALTGALPDASLYT"
FT   gene            complement(518905..519732)
FT                   /locus_tag="BURPS668_A0551"
FT   CDS_pept        complement(518905..519732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0551"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86076"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGT6"
FT                   /protein_id="ABN86076.1"
FT                   /translation="MISRPASGAGARAPRRPGRTGTDMKARPMLEYALHPLEDRLVHVD
FT                   ELCRADPVPRGWARCPLCLEALYVVQLRDRSHARRFAHLAGEFARCPLVNDALPNPLAV
FT                   HVGPPLDEHGRQARATFFRHWQRHLHTIRQTASAFGIARFMRAIELADVLKLWAWPTLA
FT                   QRDIPYILLVLTEFIAAPRGERKQAAWSRFWFDASVQRVDDLRKPRGVLPRLFRLRYRL
FT                   PRMSKFPNARHLIDCQPVLMNDIGPSDAALGTPRADIAMFEAFAARFARRPAE"
FT   gene            complement(519729..519902)
FT                   /locus_tag="BURPS668_A0552"
FT   CDS_pept        complement(519729..519902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0552"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86071"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGT7"
FT                   /protein_id="ABN86071.1"
FT                   /translation="MASTRAGRAACACPASDCAGGPPVGAKTAGRHAPHIGVSHIACLI
FT                   RGTDFPVDFVLR"
FT   gene            complement(520028..520594)
FT                   /locus_tag="BURPS668_A0553"
FT   CDS_pept        complement(520028..520594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0553"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88252"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGT8"
FT                   /protein_id="ABN88252.1"
FT                   /translation="MSPDHPWNSLEIVKLAAEVLTPVSVAAFGWLVSHRLKQLELVQWT
FT                   NQKLIEKRLALYDTIAPLLNRLLCFYTWVGPWKDISPDDVIRAKRELDQTIHIYRHLFD
FT                   DDVYRAYQAYLDALFDTHSGAGRDARIKSTIASPDGDRIGNGTYRWNPAWAERFTDANV
FT                   ASRDEVRARYQRIMDGLRISLGVAR"
FT   gene            complement(520664..521383)
FT                   /locus_tag="BURPS668_A0554"
FT   CDS_pept        complement(520664..521383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0554"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87542"
FT                   /db_xref="GOA:A3NGT9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGT9"
FT                   /protein_id="ABN87542.1"
FT                   /translation="MTFQPVESYTRVRLSDVVSDQIKSLISAGKLLPGQKLPTERELAA
FT                   QLNVSRPSLREALVRLEADGFIGSVGRGGFVVSDITAPVVSSPLADLLLQNPEASHDVL
FT                   ELRHGLETISTAYAAERATPGDLAKIKEAFDTLAGHSLKHEPGRLAEVDANFHLAIADA
FT                   THNVALIHVMHGIHGLLQESMHKSHRLVNHADAMERALLEQHTEIYEAIAAKDPERARA
FT                   AAERHLRYVRALYEQAA"
FT   gene            521776..522582
FT                   /locus_tag="BURPS668_A0555"
FT   CDS_pept        521776..522582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0555"
FT                   /product="Fe-S oxidoreductase"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85593"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGU0"
FT                   /protein_id="ABN85593.1"
FT                   /translation="MDSSPQTAGAPGGTRETPRVGLFVTCLANLFRPSAALAAVQLLEA
FT                   AGCAVDAPRAQTCCGQPALNSGDFDDARGIARRTIEAFERYDYVVAPSGSCIRTLRHDY
FT                   PDLLANDPAWRPRAERLAARAHELTSFLVDVLGWAGPERAAVPECTLAYHDTCSGLRGL
FT                   GIKAQPRALLARVEGVALTEMKDAEVCCGFGGTFCVKYPEISTKIVSDKTANVAASGAT
FT                   VLAGGDLGCLMNIGGRLKREGSAVRVYHVAEVLAGMNVEPICGEGE"
FT   gene            522594..524027
FT                   /locus_tag="BURPS668_A0556"
FT   CDS_pept        522594..524027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0556"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02589; match to protein
FT                   family HMM TIGR00273"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85525"
FT                   /db_xref="GOA:A3NGU1"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGU1"
FT                   /protein_id="ABN85525.1"
FT                   /translation="MNAPATFKARASAALHDAQLQEALGMLGEGWIEKRRRVVSLLPEF
FT                   EMLRERAKAVKDHVLANLDTYLERYEAAVTRAGGVVHWANDAAQAREIVLRICRDANAK
FT                   TITRGKSMVGEEIGLPAALEGAGMEVVETDLGEYIVQLAHEGPSHIVFPALHKTIGQVT
FT                   ELFAGNHSSAQYDGPRETVADVVGEARQVLREKFFVADVGITGANYLVAETGSNVICTN
FT                   EGNGDLTSTLARVHIVTAGIERVVPTLDDVALFVRLLGRSATGQEITSYTTFSTGPRRG
FT                   DDLDGPQEYHVVLVDNGRTRMLAGEFRDMLRCIRCGACMNHCPVYGAVGGHAYGWVYPG
FT                   PMGAVLTPLLQGIEHDTDLPNACTLNGRCAEVCPVKIPLPTLLKKLRGMQFDARLTAPG
FT                   TRFLLRAFGAIARRPALYHWLTRVGARALRALGGKRGSIARVPFASGWTDSRELPKPPP
FT                   RTFFETWDATRTNQPEVRR"
FT   gene            523985..524749
FT                   /locus_tag="BURPS668_A0557"
FT   CDS_pept        523985..524749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02589"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85826"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGU2"
FT                   /protein_id="ABN85826.1"
FT                   /translation="MGRDAHESTGGASMSARDDILGRIRAALGNERARLAAQFPAPAQA
FT                   KGAGASAAPNANAAFAPDASLSTASSAARGSAISLGDVDLVARFVAKAQQVSATCTHIA
FT                   TAAGAPAAVDAYLRDAGLADAPLVVAAALDALPWRAHRALPGVDLRRDGLVSVTPSFAA
FT                   IAETGSVVCLSSSATPTSLNFVAATHVVLVNRSAIVATMEDAWARVRATIATLPRAVNV
FT                   ITGPSRTADVEQTVQVGVHGPKRVLVLICDDA"
FT   gene            525123..526841
FT                   /locus_tag="BURPS668_A0558"
FT   CDS_pept        525123..526841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0558"
FT                   /product="glycolate permease GlcA"
FT                   /note="identified by match to protein family HMM PF02652;
FT                   match to protein family HMM TIGR00795"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88233"
FT                   /db_xref="GOA:A3NGU3"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGU3"
FT                   /protein_id="ABN88233.1"
FT                   /translation="MQVWNQVYLPLGGVGWSALAAGAPIILFFVSLAVLRLKGHVAGAL
FT                   TLALALVIAIAVYGMPAERALASAGYGFAYGLWPIAWIIVTAVFLYKIVVKSGQFDVIR
FT                   SSIVALTDDQRLQMLLIGFSFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIA
FT                   DTAPVAFGALGIPVIVAGQVSGLDPMAVGAMAGRQLPFLSFFLPFWLVFVMDGVKGVRE
FT                   TWPAALVAGGSFALVQFFTSNYIGPELPDVTSALASLVALASFLKVWRPLRAREAARAQ
FT                   RLVSAGGGALALGGMPGGLGGARATGGREPSPYSFAQIARAWSPFVVLTVMVTIWSMKP
FT                   FKALFAKGGALAFTTLQFHVAHLDKLTQKMAPVVAHPTPVPAVFNWDLLAATGTAILLS
FT                   AIVSMAILNVPARTGVRTFFEVLKDLKRPVLSIGLVLAFAFVENYSGMSTTLALLLAGT
FT                   GAAFPFFSPLLGWIGVFLTGSDTSSNALFCSLQATTAQQIGVPSTLLVAANTTGGVAGK
FT                   MISPQSIAVACAAVGLVGREADLFRFTLRHSLFFALVVGVMTCVQAYWLTGMIVH"
FT   gene            526910..527155
FT                   /locus_tag="BURPS668_A0559"
FT   CDS_pept        526910..527155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0559"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87645"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGU4"
FT                   /protein_id="ABN87645.1"
FT                   /translation="MFESPEAFEAFEAFDPAVHTGGERARTRRTAAFTRVSYGLPCKDL
FT                   LQPFAWNDGRDLLFWRIYEIRRARRGVRRLIRGGHA"
FT   gene            527152..527589
FT                   /locus_tag="BURPS668_A0561"
FT   CDS_pept        527152..527589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0561"
FT                   /product="DoxX family membrane protein"
FT                   /note="identified by match to protein family HMM PF07681"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87027"
FT                   /db_xref="GOA:A3NGU5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGU5"
FT                   /protein_id="ABN87027.1"
FT                   /translation="MTRSVDSGVIFFARLLLAVLFLWGGAMKLMGYGEFVGYLKGLGVP
FT                   FTQVAAPVIVALEAIGGVLLIVGYQVKPLALVLALYTLAAALIGHNFWDATSSALQRDM
FT                   VVHFWKNVAIAGGFLLLYVTGAGGASIDGARRPSSSYGSLR"
FT   gene            complement(527785..529329)
FT                   /locus_tag="BURPS668_A0562"
FT   CDS_pept        complement(527785..529329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0562"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86787"
FT                   /db_xref="GOA:A3NGU7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGU7"
FT                   /protein_id="ABN86787.1"
FT                   /translation="MDTHLPHPTLSRAALVRIVSTVSAGFVITQLDVTIVNVALARIGI
FT                   DLHTSVAGLQWIVDAYTLALAGLMLSAGALGDRFGARRLFAAGLALFAVASFVCGIAAN
FT                   AATLIAARALQGLAAAAMLPNSLALLNHACAHDPRLRARAVGWWTASGAISIAAGPVIG
FT                   GVLIAQFGWRSIFFVNLPLCAAGLAATRLWIDSDDTRAAAASSASSASSASSASSAADG
FT                   AHHSHPAADRRASGPNACAPAPKRAAGAGTRGLDLPGQCLAVVALTLFTGAVIDWRPAL
FT                   VAIALAAGAAFVFVESRSAHPMMPLALFRRRTFSVAVLFGVCMNLSYYGIIFVLSLYLQ
FT                   RVRHDTPLEAGLAFLPLTGGFLLSNVASGWATAHYGPRRPMIAGALIGATGFALLSAVR
FT                   ADTPIAMLVVPFLLIPGGMGLAVPAMTTTVLASVERARAATASAVLNTARQAGGAIGVA
FT                   AFGALASGARPPDIVSGLHASAYVSAALFVFASAMAAFVHGAPQPAAGKPANANAR"
FT   gene            complement(529604..530896)
FT                   /locus_tag="BURPS668_A0564"
FT   CDS_pept        complement(529604..530896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0564"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88275"
FT                   /db_xref="GOA:A3NGU9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGU9"
FT                   /protein_id="ABN88275.1"
FT                   /translation="MPASELSAVSSAPPRALTGRDYKTLGLAALGGALEFYDFIIFVFF
FT                   APAIGQLFFPHDIPDWLRQLQTFGIFAAGYLARPLGGIVMAHFGDLVGRKRMFTLSVLL
FT                   MSVPTLLMGLLPTYDSVGILAPVVLLLLRVLQGAAVGGEVPGAWVFVSEHVPPQRIGYA
FT                   CGTLTAGLTIGILLGSLVATAVNSRFSTAEVAAFAWRIPFLLGGVFGLFSVYLRRWLHE
FT                   TPVFAEMKARKTLAAEIPLKAVIRDHGRAVIVSMLITWMLSAAIVVVILMTPTLLQKQF
FT                   HIAPATALFANSIATLCLTAGCITAGSLADRFGAKAVLSIGGVALAACYYAMYTQIAVD
FT                   AARLVPLYGLAGFTVGTIGAVPFVLVKSFPAVVRFSGISFSYNVAYAVFGGLTPVIVSL
FT                   LMKSHSLAPAHYVAAICVLGAVAMLFSKDAE"
FT   gene            complement(531222..532256)
FT                   /locus_tag="BURPS668_A0565"
FT   CDS_pept        complement(531222..532256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0565"
FT                   /product="malate/L-lactate dehydrogenase family protein"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF02615"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87552"
FT                   /db_xref="GOA:A3NGV0"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGV0"
FT                   /protein_id="ABN87552.1"
FT                   /translation="MHDRPDLARPDVVLSLDDVRALALRVLAHHGLSDAHARAIANVIT
FT                   QGQRDECHSHGVYRLLVCARSLRLGKVDPQAVPTLRRLSPSIVAVDAHRGFSLLAFETG
FT                   LPVLVEMARRHGIAAMAINRCYHFSALWPEVEALAAHGLAGLAMNPSHGWVAPEGGTRP
FT                   VFGTNPLAFAWPRPGGTPFVFDFATSAIARGDLELHAKAGKPIPPHWAIDANGAPTTDP
FT                   QAALQGAMRTFGGHKGSALAAMIELLAGALIGDMTSAESLAFDEGAGATPCHGELVIAL
FT                   DPKTFLGDALDAGLARGERMFEAIVAQGARLPSQRRFDARARSAAHGVRIPARLHDEIV
FT                   ALLD"
FT   gene            complement(532249..533841)
FT                   /locus_tag="BURPS668_A0566"
FT   CDS_pept        complement(532249..533841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0566"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87573"
FT                   /db_xref="GOA:A3NGV1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGV1"
FT                   /protein_id="ABN87573.1"
FT                   /translation="MRLTGELLIGQSATFGQHGAFRAIEAATGAPLEPAFGGASLQDLD
FT                   AACALADDAFDAYRETSLDARAAFLDAIGRHIVALGDALIERCAAESGLPRARIEGERA
FT                   RTVGQLALFAAVVRDGGFIDARIDPARAQRKPLPRVDLRLRNIAIGPVAVFGASNFPLA
FT                   FSVAGGDTASALAAGCPVIVKAHGAHPGTSELVGRAIQAAVRECGLPAGVFSLLFDASR
FT                   EIGQALVADPRIKAVGFTGSRRGGVALMRIAAARPEPVPVYAEMSSINPVVLMPGALAA
FT                   RHDAIAQQFVASLTLGAGQFCTNPGLILAIDGPALRAFEKAAAAAIDAAAAQTMLTPPI
FT                   HASYREGVARLASHRAVERLGEGPAGGPFAARAALFATTADALLSHAELRDEVFGPASL
FT                   VVRCADADALHRVLKSLEGQLTIAAHLGERDAPLFAALRPTLERRAGRILVNGFGTGVE
FT                   VGHAMVHGGPFPATSDPRTTSVGARAIERFLRPVSYQDVPDALLPDALRDANPLRVPQR
FT                   IDGALAPREARDA"
FT   gene            complement(533917..535917)
FT                   /locus_tag="BURPS668_A0567"
FT   CDS_pept        complement(533917..535917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0567"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86427"
FT                   /db_xref="GOA:A3NGV2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGV2"
FT                   /protein_id="ABN86427.1"
FT                   /translation="MRDARRRRSGAGLAFRAETMPRETAATARPRAAASPRRDPAGSAH
FT                   AGGPRAPQHDSAESAGRAAADRRAPRRRTGHPAHRHASAAVTAAAGAPSVPPAAALPCA
FT                   AAPRPPLETIETRPSNQGDKPMPAQGNAQRTAPLARPAPTDAGHGKFKKQLSLTDLTFI
FT                   GLGAIFGSGWLFAASHVSMIAGPAGILSWLLGGFAVLLLGIVYCELGAALPRAGGVVRY
FT                   PVFSHGPLLGYLMGAITLIAFSSLIAIEVVAARQYAAAWFAGLTVEGSGNPTTLGWLVQ
FT                   AALLCFFFYLNYSSVKTFAKANNVISVFKFVVPLAVIVVLFAFFKPANLTLHGFAPFGM
FT                   PGVEMAVSAGGIIFAYLGLTPIVSVASEVRDPQRTIPIALILSIVLSTLIYVLLQLAFL
FT                   GGIPSAMLAGGWHDIGKAFSLPYRDIALALGVGWLAYMVVADAMISPSGCGNIYMNATP
FT                   RVVYGWAKTGTFFKVFARVDEASGIPRAGLWLTFALALFWTLPFPSWEALINTVSAALV
FT                   LSYAVAPVSVAALRRTAPGLPRPFRASAFALTGPASFVIAALIVYWSGWRTVSWLLGLQ
FT                   IAMFAVYLACRRRVPTAHLSLAEQVRSCAWLIAFYALMIVASYFGGFGGTGQLAHPYDT
FT                   FAVAAVALVIYYWGAHTGVPSAKLQLDDDEN"
FT   gene            complement(536053..536973)
FT                   /locus_tag="BURPS668_A0568"
FT   CDS_pept        complement(536053..536973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0568"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="identified by match to protein family HMM PF00701"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85719"
FT                   /db_xref="GOA:A3NGV3"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGV3"
FT                   /protein_id="ABN85719.1"
FT                   /translation="MSRHAIQWSGVFPAVSTQFKPDFSLDVDATHRVVKNLVNDGVSGL
FT                   VVCGTVGENTSLGTAEKLAVIEAARDAAGGKVPVIAGVAEFTTEFARNTVREAQRVGVD
FT                   GVMVMPALVYSAKPHETAAHFRAVASSTDLPVMVYNNPPIYRNDVTPDVLIALQDCENI
FT                   VCFKDSSGDTRRFVDLRNAVGDRFVLFAGLDDVVVESIAVGAQGWVSGMSNAFPKEGET
FT                   LFRLAKQKRFDEALALYRWFMPLLHLDARPDLVQCIKLCEELVGRGSALTRPPRLALQG
FT                   DTLAHVKAIVAKALETRPTLPDVGL"
FT   gene            complement(536984..537166)
FT                   /locus_tag="BURPS668_A0569"
FT   CDS_pept        complement(536984..537166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0569"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87876"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGV4"
FT                   /protein_id="ABN87876.1"
FT                   /translation="MWVFDDARDEIGTARRARRRSRPDCADFIFSRLEKAQASRRADGD
FT                   TGSRTDAPVGHLIRT"
FT   gene            537194..538156
FT                   /locus_tag="BURPS668_A0570"
FT   CDS_pept        537194..538156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0570"
FT                   /product="proline racemase family protein"
FT                   /note="identified by match to protein family HMM PF05544"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87813"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGV5"
FT                   /protein_id="ABN87813.1"
FT                   /translation="MRISTLDRRDMKHIHIIDSHTGGEPTRVVVSGFPALGGGTMAERL
FT                   AVLAREHDRYRAACILEPRGSDVLVGALLCEPVSAGAAAGVIFFNNAGYLGMCGHGTIG
FT                   LVRTLHHMGRIGPGVHRIETPVGDVEATLHDDLSVSVRNVLAYRHAKDVVVDVPGHGAV
FT                   TGDVAWGGNWFFLVSDHGQRVAGENVAALAAYASAVRAALERAGVTGRDGAPIDHIELF
FT                   ADDPEYDSRSFVLCPGHAYDRSPCGTGTSAKLACLAADGKLAAGVTWRQASVIGSVFSA
FT                   SYAAAEGGVVPTIRGSAHLSAEATLVIEDDDPFGWGIAS"
FT   gene            538153..539286
FT                   /locus_tag="BURPS668_A0571"
FT   CDS_pept        538153..539286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0571"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86422"
FT                   /db_xref="GOA:A3NGV6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGV6"
FT                   /protein_id="ABN86422.1"
FT                   /translation="MTDSPTDVIVIGAGIVGAACAHEFALRGLRVVVVDDGGGGATAAG
FT                   MGHLVAMDDNAAELALTHYSIGLWRALRDAMPEGCAYRNCGTLWLAADAHEMDLARAKQ
FT                   AALGARGVAGELIGRAALAALEPMLRTDLGGALKVPGDGILYAPAAAHWLLHRLPGVAL
FT                   RRARAVALDGARVALEGGDVLRANAVVVANGVAARALVPELPLRPKKGHLLITDRYPAR
FT                   VSHQLVELGYAASAHASDGTSVAFNVQPRPTGQLLIGSSRQFDTEDPRVEAPVLARMLR
FT                   RALGYLPALAGLNGIRAWTGFRAASPDGLPLLGEHPSRRGVWLALGHEGLGVTTAPGSA
FT                   RVLAALMFGERAAIDAEPYRPARFLSTSKSAAAGELR"
FT   gene            539283..539516
FT                   /locus_tag="BURPS668_A0572"
FT   CDS_pept        539283..539516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0572"
FT                   /product="2Fe-2S iron-sulfur cluster binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00111"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86319"
FT                   /db_xref="GOA:A3NGV7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGV7"
FT                   /protein_id="ABN86319.1"
FT                   /translation="MIIYLDRRALEVADGTTVAAALALAGDDTARTSCTGAARAPFCGM
FT                   GMCHECRVTIDGRRRLACQTLCREGMQVERTR"
FT   gene            539513..540805
FT                   /locus_tag="BURPS668_A0573"
FT   CDS_pept        539513..540805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0573"
FT                   /product="oxidoreductase"
FT                   /EC_number="1.5.1.19"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF04324; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85318"
FT                   /db_xref="GOA:A3NGV8"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGV8"
FT                   /protein_id="ABN85318.1"
FT                   /translation="MTNEILTVDVAIVGAGPAGLAAARAAARSGCTVAIVDDNPRAGGQ
FT                   VWRHGPHAAPGALARASFGVLRQPNVRHLAAARVVAAPRPGALLVEDEQRALVLGYRKL
FT                   ILCCGARELLLPFAGWTLPGVTGAGGLQALVKGGAPVRGERVVIAGSGPLLIASLATAR
FT                   AAGARVVALVEQAPPGALARFALSLAATPSKLAQAARLTRGFVGARYLTGAVVREAHGD
FT                   ARVRAVTIERDGARETLDCERLACGFGLVPNLTLALALGCAVRERAIAVDDAQRTSVEH
FT                   VYAAGECTGVGGVELARIEGELAGLAAGGAHAAPHGRARMAALLRRRARWRRFAARVAR
FT                   TFALRDAARSLPPDDTLLCRCEDVTIGAVRAHASARDAKLLTRCAMGACQGRVCGAAAH
FT                   AYFGWDDAPPRPPFSPARIDTLLAASDDALL"
FT   gene            540841..541713
FT                   /locus_tag="BURPS668_A0574"
FT   CDS_pept        540841..541713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0574"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF08448"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88581"
FT                   /db_xref="GOA:A3NGV9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGV9"
FT                   /protein_id="ABN88581.1"
FT                   /translation="MMTLLAVPPEKLPAASAASTAAGPTPAAGNGACASPPSSGAALEG
FT                   DDDGFAAMLAHFAQLEPVFDALPDVAFFVKDVRARYALVNRTLAQRCGYKDKRDLYGKA
FT                   ADEVFPRRFGRSYVEQDLTIIAGGRQLTDQLELHLYSGRQPGWCLTCKEPLRNAQGRIV
FT                   GIAGLSRDLRAHESSHPAYSRIADVVRYIHAHYVQPLNLKHLAGMAGMSVAQLERYFHK
FT                   VFHLTPRQMLLKARLDAATALLVTHDKVTDVAALCGYTDHSAFTRQFKATVGVTPTEYR
FT                   LMLQEGRGA"
FT   gene            complement(541910..542116)
FT                   /locus_tag="BURPS668_A0575"
FT   CDS_pept        complement(541910..542116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0575"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87034"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGW0"
FT                   /protein_id="ABN87034.1"
FT                   /translation="MLRRLLSHHEIATLLILLHAPIGANAKPELPALQEAGLVEMIRSD
FT                   MDAAPSFRLTEDGNAVLKGLGYR"
FT   gene            complement(542395..543687)
FT                   /pseudo
FT                   /locus_tag="BURPS668_A0576"
FT                   /note="ISBma3, transposase, truncation; comparison of this
FT                   gene to its homologs suggests this gene has been truncated;
FT                   identified by match to protein family HMM PF01548; match to
FT                   protein family HMM PF02371"
FT   gene            complement(543842..545905)
FT                   /locus_tag="BURPS668_A0577"
FT   CDS_pept        complement(543842..545905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0577"
FT                   /product="putative 4-hydroxyphenylpyruvate dioxygenase
FT                   HppD"
FT                   /EC_number="1.13.11.27"
FT                   /note="identified by match to protein family HMM PF00903;
FT                   match to protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85976"
FT                   /db_xref="GOA:A3NGW1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGW1"
FT                   /protein_id="ABN85976.1"
FT                   /translation="MQRSIATVSLSGTLVEKLRAIRAAGFDGVEIFENDLLYFDGSPAD
FT                   VRAIAADLGLAIVLFQPFRDFEGVPPERLARNLERAKRKFELMHALGANRMLVCSNMSP
FT                   DAIGDDALLVDQLGALARAAQAAGVVAAYEALAWGRNVKTYGHAWRLVDAVNHPSLGLA
FT                   LDSFHTLSLGDSPDGIARIPGERIAFVQIADAPKLAMDVLEWSRHYRSFPGQGDFDLAG
FT                   FTARVIESGYAGPLSLEIFNDGFRAAPTALTAADGYRSLLYLEETTRERLACDARRARR
FT                   AGGAPGTGETRGERERHDAHGAHGERGEHRAHDKDDKPDDKRGGPDERESRAAHPRPAQ
FT                   PLFAPPPAPAHVGFQFIEFAVDAAAAENVAGWLGKLRFRRAGRHRSKDVTLYQHGAASI
FT                   VLNAERDSFADAFFQEHGLSLCASAFRVDDARLAFERAAGYGYAPFSGRVGPNERVLPS
FT                   VRAPDGSLNYFVDEAPGAPTLYESDFVLTDIDGPSEVGPLAGIDHVCLALPADALDTWV
FT                   LFFKTAFGFEAERNWLVPDPYGLVRSRAVRSPDGSVRIALNASVDRHTAVVRSLERYRG
FT                   TGLNHVAFRADDIVAAIAEFAADGVPFLRIPRNYYDDLAARYALPDETIDTLRRHHLLY
FT                   DRDDAGGEFLHAYTELVDGRFSFEIVERRGGYDGYGAANAAVRLAAQAQRRG"
FT   gene            546037..546618
FT                   /locus_tag="BURPS668_A0579"
FT   CDS_pept        546037..546618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0579"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="identified by match to protein family HMM PF01220;
FT                   match to protein family HMM TIGR01088"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87383"
FT                   /db_xref="GOA:A3NGW3"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGW3"
FT                   /protein_id="ABN87383.1"
FT                   /translation="MVQIIENPERHCASASAHWRRILTTHARSSTDTYPFFTGVSYMNK
FT                   PKVLVLNGPNLNLLGKREPRIYGSETLQDVERRCADAAHALGLALEFRQSNAEHQLIDW
FT                   LHDAREHVAGVVINPAAYTHTSVAIADALAALGKPIIEVHISNIHRREAFRHHSFVSAL
FT                   ADGVICGCGTEGYVFALRRLATLIGGEGTR"
FT   gene            546615..547469
FT                   /gene="aroE"
FT                   /locus_tag="BURPS668_A0580"
FT   CDS_pept        546615..547469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="BURPS668_A0580"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="identified by match to protein family HMM PF01488;
FT                   match to protein family HMM PF08501"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86538"
FT                   /db_xref="GOA:A3NGW4"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGW4"
FT                   /protein_id="ABN86538.1"
FT                   /translation="MSERSFLIGLIGAGIGGSLSPAMHEAEGRGQGLNYVYRRIDLDAL
FT                   GLTADALPELLATAERMGFDGLNITHPCKQRVIEHLDELSADAAALGAVNTVCFAHGRR
FT                   IGHNTDWSGFAKAFARGLPGASLERVVQLGAGGAGAAVAHAALTMGAAQLALFDVDPVR
FT                   ARSLADQLQARFPHARLSAGGTLADALANATGLIHATPTGMLGHPGLPLPAHLLRSGLW
FT                   VADIVYFPLETELIRAARALGCRTLPGGGMAVYQAVDAFELFTGRAPDAERMFEHFRAL
FT                   VAR"
FT   gene            547517..548863
FT                   /locus_tag="BURPS668_A0581"
FT   CDS_pept        547517..548863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0581"
FT                   /product="putative glucarate transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86074"
FT                   /db_xref="GOA:A3NGW5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGW5"
FT                   /protein_id="ABN86074.1"
FT                   /translation="MPQPIHTDAAPRAAVAAARAASPARPRSNARYRILALLAFGTMIN
FT                   YLDRTVLGVAAPGLTKELGIGAAAMGVMFSAFSWTYVLAQVPGGLLLDRFGSKLTYYWS
FT                   MTLWSLFTLLQGFVHGVAPLLACRLGLGLSEAPCFPTNSRVVATWFPQKERAMATGTYT
FT                   VGEYIGLAFLSPVLFALMGAFGWRSLFWVVGGVGIVFGFVWWKFYHEPHDHPRANAAEL
FT                   AYIEEGGGLVQATAGGGSRAKFNWRVAGRLLKKRQLAGICLGQFAGNSTLVFFLTWFPT
FT                   YLATERHMGWLKIGFFAVMPFIAASVGVMFGGLFSDWLLRRGRSANVARKLPIIAGLLL
FT                   ASTIVLANYVRSNEAVIAIMSVAFFAQGMAALGWTLVSDIAPEGLLGATGGIFNLAANL
FT                   AGIVTPLVVGFIVAATGSFVGALAFIGVIALIGALSYIFVVGDIKRIEL"
FT   gene            complement(549117..550226)
FT                   /gene="phnW"
FT                   /locus_tag="BURPS668_A0582"
FT   CDS_pept        complement(549117..550226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnW"
FT                   /locus_tag="BURPS668_A0582"
FT                   /product="2-aminoethylphosphonate--pyruvate transaminase"
FT                   /EC_number="2.6.1.37"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM TIGR02326; match to protein
FT                   family HMM TIGR03301"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87994"
FT                   /db_xref="GOA:A3NGW6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3NGW6"
FT                   /protein_id="ABN87994.1"
FT                   /translation="MPERDPILLTPGPLTTSRMTRDAMLRDWGSWDAAFNRLTKSVCAD
FT                   LVRIAGGGDAYVCVPLQGSGTFAVEATLGTLVPRDARVLVPNNGAYCARIAAILRRLGV
FT                   AHVELPFAEDEPASAHAIDAALARDARLTHVALVHLETSAGLLNPLDDIAAVCRARGKA
FT                   LIVDAMSSFGALPIALAASGIDALISASGKCLEGVPGMGFAIVRRSALEAAEGRSPSVA
FT                   LDLHDQYAYMQRTSQWRFTPPTHVLAALRAALDQFFDEGGQPARGARYARNCATLVDGM
FT                   RALGFEPFLDARAQASVIVTFYAPADPAYAFPAFYAAVRDAGYVLYPGKLTTADTFRVG
FT                   CIGALGADEMRGAVAAIGGALESLGIAMR"
FT   gene            550291..550467
FT                   /locus_tag="BURPS668_A0583"
FT   CDS_pept        550291..550467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0583"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87137"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGW7"
FT                   /protein_id="ABN87137.1"
FT                   /translation="MSFFGNEVNRHGAVIERCDASGAAKNRSVRPRRDGGAARAHEAAR
FT                   RSPFAVSPYGEAT"
FT   gene            550464..551546
FT                   /locus_tag="BURPS668_A0584"
FT   CDS_pept        550464..551546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0584"
FT                   /product="ABC-type Fe3+ transport system, periplasmic
FT                   component"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR03227"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86591"
FT                   /db_xref="InterPro:IPR017637"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGW8"
FT                   /protein_id="ABN86591.1"
FT                   /translation="MTYTNFPRGGAWRRFVLAAGAAALLQGAAAQAQAAAVVLYTADGL
FT                   ENLYRDVLPAFEKQEGVKVNIVTAGSGEVVNRANVEKGSPKADVIVTLPPFIQQAGQFG
FT                   LLQPYRSVNYKNVPAIAKAEDGSWATFVNNYFSFAINPSVVKSQPKTFADLLHPDYSGK
FT                   LAYSNPATAGDGMAVIILTSALMGEDKAFDYLAKLERSVKFHTKGTGYLNVLLSRNEIA
FT                   VANGDLQMDLDDAEHGGLSIKPIFVAAKAGEPPTTFQLPYAIGLVKGGPNQDAGRKLID
FT                   YLMSADVQAKVPDMFGIPGRTDVPLSGKNGEAVKRAIAGVKLIPVDWDAVMAKKPVWTE
FT                   RWKKEVIGDSGKQTEVVKPK"
FT   gene            551603..552700
FT                   /locus_tag="BURPS668_A0585"
FT   CDS_pept        551603..552700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0585"
FT                   /product="ABC-type spermidine/putrescine transport systems,
FT                   ATPase component"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402; match to protein
FT                   family HMM TIGR03258"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85676"
FT                   /db_xref="GOA:A3NGW9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017662"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGW9"
FT                   /protein_id="ABN85676.1"
FT                   /translation="MDTASLTHPGAFDAARPHAAPRAGACGGVRIEHLSVRYGARTVLD
FT                   DLSLEIGAGELLAVLGKSGCGKTTLLRFIAGFVKADGLTGTFAVAGRDLTHAPPHKRNL
FT                   GLLFQNYALFPHLTVFENVAFGLRARRMSSADIARRVADALKLVQLGDAGHHLPAQLSG
FT                   GMQQRVALARALVIEPDVLLLDEPLSALDANLRASVRSELKALHERLPNLTVVCVTHDR
FT                   DDALVLADRALLMREGRVAQLGTPQQLYDAPADGFVARYLGAANLLPPNVVFAFGDPRH
FT                   DVRDKVACVRPERLAVRPLGEGRLHGTIASVEWHGAALSLTVMLDAACDEPVLVTMQRG
FT                   RGPAPERGARVSLDCEADDVVLISP"
FT   gene            552678..553625
FT                   /locus_tag="BURPS668_A0586"
FT   CDS_pept        552678..553625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0586"
FT                   /product="ABC-type sulfate transport system, permease
FT                   component"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR03226"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87628"
FT                   /db_xref="GOA:A3NGX0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017636"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGX0"
FT                   /protein_id="ABN87628.1"
FT                   /translation="MSSLSHLEPRAALAADPAAAARIRASAAAHDAAARRRERRASARI
FT                   VALAAVVLGPLVLYPLVRLVLLSAFGAHGPTLAAYRAFFASHDVRDVLGTTLWVLFASA
FT                   GTASIVGVLLAALLFFRPFPGASLVTRFLELYVAFPSFLVAFTLIFLYGSQGSVSIALQ
FT                   RVLGLDAPPLDFLFGPGGVILAQTVFYTPFVVRPALASFATLDARLVEAAASLGANGWT
FT                   LARRVVLPLAWPGIAAGVILCFLLTLNEFGILLVLGSARLVTLPVAIYSSATVDIDLPA
FT                   AAAGAVVMLAMSLTLYALYRRMSRRANEGGRDVR"
FT   gene            553615..554469
FT                   /gene="phnV"
FT                   /locus_tag="BURPS668_A0587"
FT   CDS_pept        553615..554469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnV"
FT                   /locus_tag="BURPS668_A0587"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR03255"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86673"
FT                   /db_xref="GOA:A3NGX1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017661"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGX1"
FT                   /protein_id="ABN86673.1"
FT                   /translation="MSADFPARAAPVPRRELRWTDAASRVASRALVALAAAACCWLFVL
FT                   PVVVVALSSVAGHWSGTILPAGYSLRWFERLGRPEFDALAASLEIGLGVAALGTALGVA
FT                   LALALEGRTRRGVGALVDALVMLPNGVPSVVLGLAVLIAYHAKPVDLSSSPAIVVFVQL
FT                   ALVLPFCYRCAAAALRPELTVLREAAASLGAPPAMVLRRVLLPQLVPAIRASLALGFAL
FT                   SLGELGATLTVYPPGFATVPIVVIGAVERGYYLPASALSLLLLGASLVALIAIAARAPR
FT                   PPR"
FT   gene            554513..555784
FT                   /gene="phnA"
FT                   /locus_tag="BURPS668_A0588"
FT   CDS_pept        554513..555784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="BURPS668_A0588"
FT                   /product="phosphonoacetate hydrolase"
FT                   /EC_number="3.11.1.2"
FT                   /note="identified by similarity to GB:AAC15507.1; match to
FT                   protein family HMM PF01663; match to protein family HMM
FT                   TIGR02335"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86207"
FT                   /db_xref="GOA:A3NGX2"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR012710"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023116"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGX2"
FT                   /protein_id="ABN86207.1"
FT                   /translation="MNEGPEGRNTMNRHIEVNGRVYRMPAEPTVAVCVDGCEYDYLEEA
FT                   ASAGVAPFLARMLREGSAFQADCVIPSFTNPNNLSIVCGAPPSVHGICGNFFWDQNAQG
FT                   GAGAAVMMNDPAYLRAGTLLAAAADAGAKVAVVTAKDKLRRLLGWRMRGVCFSAEKANQ
FT                   ANLGENGIADVLDFVGLPSPDVYSAALSEFVLAAGVRLAQSRRADLMYLSTTDYVQHKC
FT                   APGSEGANAFYAMMDRYLAALDALGWVIGVTADHGMNAKHDPRTGEPNVVYLQDALDAW
FT                   LGPRLARVILPITDPYVVHHGALGSFATIYVEQGVDAGTVIGRLREFDGVELALDNATA
FT                   AERFELPADRIGDVVVVGRRDVVLGTRAREHDLSGLTVPLRSHGGLSEQRVPLLFNRRI
FT                   EHVEPGRRLRNFDLFDLALNRTVQ"
FT   gene            555781..557235
FT                   /locus_tag="BURPS668_A0589"
FT   CDS_pept        555781..557235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0589"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR03250"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88546"
FT                   /db_xref="GOA:A3NGX3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017656"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGX3"
FT                   /protein_id="ABN88546.1"
FT                   /translation="MTTMPLRDHAAYRRETLRWCGQRAARARTLDVFDPYSGLRVGTVP
FT                   LATVDDVRRAFDYAVAYRPALSRYARSQILERAAARLTARAEEASTLISLESGLSKQDS
FT                   RYEIGRVADVFKFASIEALRDDAQSYSCDLTPHGKSRRVFSQRQPLDGVIVAITPFNHP
FT                   MNQVAHKIAPAIATNNRVIVKPSEKVPLSALYLADVLYEAGLPEPMLQVLTGDPREIAD
FT                   ELLTHPSATLITFTGGVAIGKSIAAKAGYRRIVLELGGNDPLIVLDDADLERAAALAAQ
FT                   GSYKNSGQRCTAVKRILVHKRVAPRFTELLVEHTRAWTYGDPFDPANRMGTVIDEAAAA
FT                   LFEARVDEAVAQGARLLTGNARRGALYAPTVLDRVDASMTLVREETFGPVSPIIAFDTI
FT                   DDAIRISNGTAFGLSSGVCTDRADAIVRFVNELNVGTVNVWEVPGYRLELTPFGGIKDS
FT                   GLGYKEGVQEAMKSFTNLKTFSLPWA"
FT   gene            557240..557791
FT                   /locus_tag="BURPS668_A0590"
FT   CDS_pept        557240..557791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03276"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85782"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR017670"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGX4"
FT                   /protein_id="ABN85782.1"
FT                   /translation="MALTLDDIRMLFDRHGDIAYSGEPVTQREHALQSAQLAEQAGAND
FT                   ALIAAALLHDLGHLLNRRGETPTAHGIDDLHQYCVLPFLRPLLPDAVLEPIRLHVDAKR
FT                   CLCAIDASYYARLSADSVRSLHLQGGVFSDAEAEAFLKRPYAPDAVRVRRWDDLAKMAG
FT                   KPTPGLDHYMRAVARAAIAK"
FT   gene            558403..559890
FT                   /gene="rrsA"
FT                   /locus_tag="BURPS668_A0591"
FT   rRNA            558403..559890
FT                   /gene="rrsA"
FT                   /locus_tag="BURPS668_A0591"
FT                   /product="16S ribosomal RNA"
FT   gene            559973..560049
FT                   /locus_tag="BURPS668_A0592"
FT   tRNA            559973..560049
FT                   /locus_tag="BURPS668_A0592"
FT                   /product="tRNA-Ile"
FT   gene            560084..560159
FT                   /locus_tag="BURPS668_A0593"
FT   tRNA            560084..560159
FT                   /locus_tag="BURPS668_A0593"
FT                   /product="tRNA-Ala"
FT   gene            560552..563433
FT                   /gene="rrlA"
FT                   /locus_tag="BURPS668_A0594"
FT   rRNA            560552..563433
FT                   /gene="rrlA"
FT                   /locus_tag="BURPS668_A0594"
FT                   /product="23S ribosomal RNA"
FT   gene            563615..563730
FT                   /gene="rrfA"
FT                   /locus_tag="BURPS668_A0595"
FT   rRNA            563615..563730
FT                   /gene="rrfA"
FT                   /locus_tag="BURPS668_A0595"
FT                   /product="5S ribosomal RNA"
FT   gene            564126..564530
FT                   /gene="cueR"
FT                   /locus_tag="BURPS668_A0596"
FT   CDS_pept        564126..564530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="BURPS668_A0596"
FT                   /product="Cu(I)-responsive transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF09278; match to protein
FT                   family HMM TIGR02044"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86510"
FT                   /db_xref="GOA:A3NGX5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGX5"
FT                   /protein_id="ABN86510.1"
FT                   /translation="MNIGEAAKVSGVSAKMIRYYESVGLLNPAKRTDSGYRVYHDDEIH
FT                   LLRFIRQARRLGFLVDDIRKLLALWQDRSRASAEVKAIALEHVAELDGRIAELTDMRNT
FT                   LVNLAAHCSGDDRPDCPILERLADPCCDPK"
FT   gene            564750..564896
FT                   /locus_tag="BURPS668_A0597"
FT   CDS_pept        564750..564896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0597"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87278"
FT                   /db_xref="InterPro:IPR021946"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGX6"
FT                   /protein_id="ABN87278.1"
FT                   /translation="MFAYIIEKLSNWFEAAERERREAYLASSSDIVQLEQRIRSLETNG
FT                   YSL"
FT   gene            565098..565376
FT                   /locus_tag="BURPS668_A0598"
FT   CDS_pept        565098..565376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87966"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGX7"
FT                   /protein_id="ABN87966.1"
FT                   /translation="MCVIATTAVAGSDSARAPLILDTQSGIHDGKSGIVLQNAPLSRAP
FT                   IVAPAQSAPMTELPSGSTMGSTAPMVVIPYIEVPGSAVPLKAPPPRQ"
FT   gene            complement(565389..566234)
FT                   /locus_tag="BURPS668_A0599"
FT   CDS_pept        complement(565389..566234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0599"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04378"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85987"
FT                   /db_xref="GOA:A3NGX8"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGX8"
FT                   /protein_id="ABN85987.1"
FT                   /translation="MLSYRHGFHAGNHADVLKHTVVVQLLRYLNKKDKSYWYIDTHAGA
FT                   GVYSLFDGYAAKTGEFGTGIEKIWDATDLPEALSDYVDEVRALNRDGELRYYPGSPYLA
FT                   WRLMREQDRMRLFELHSTEIDVLRHNFRDAGRRAMIYAGDGFEGIKALLPPPPRRALVL
FT                   VDPSYEDKRDYAKTIACVEESLKRFATGCYAIWYPQVSRPESQKFPDHLKQLQPNNWLH
FT                   LSLTVSRPPSDGFGLFGSGMFILNPPYTLVDTMKEALPYLVEVLGQDSGAKFAIEHRAN
FT                   "
FT   gene            complement(566383..567354)
FT                   /locus_tag="BURPS668_A0600"
FT   CDS_pept        complement(566383..567354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0600"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86915"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGX9"
FT                   /protein_id="ABN86915.1"
FT                   /translation="MNYRRLGRSGLQVSELSIGSWVTYGNQVDRRAARESLAAARDAGV
FT                   NFFDNAEVYAGGKSEEIMGHALKSLGWPRISYVVSTKFFWGLAEAPNQYHTLNRKYLLN
FT                   AIDASLQRLQLDYVDLVFCHRPDPNTPIEETVWAMSDIIARGKALYWGTSEWSADEIRA
FT                   AYEIADRHHLRKPTMEQPQYNLFHRKRVEQEYRRLYEDFGMGLTTWSPLASGLLTGKYR
FT                   HGVPAGSRAEIHGYDWLRAQLTDPAKNRVVEALGEIANDLGCTVGQLALAWVLKNPRVS
FT                   TVITGASRVEQIIENMRSLDVATQITPDTKQQIEQIVGDAYQ"
FT   gene            567542..568330
FT                   /gene="bdhA"
FT                   /locus_tag="BURPS668_A0602"
FT   CDS_pept        567542..568330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdhA"
FT                   /locus_tag="BURPS668_A0602"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.30"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659; match to protein
FT                   family HMM TIGR01963"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86863"
FT                   /db_xref="GOA:A3NGY0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGY0"
FT                   /protein_id="ABN86863.1"
FT                   /translation="MTSNLNGKAAIVTGAASGIGKEIALELARAGAAVAIADLNQDGAN
FT                   AVAELIEQAGGRAIGVAMDVTNEDAVNAGIDKVAQTFGSVDILVSNAGIQIVNPIENYA
FT                   FADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHG
FT                   LLGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQT
FT                   VDGVFTTVEDVAKTVLFLSAFPSAALTGQSFVVSHGWFMQ"
FT   gene            complement(568320..568487)
FT                   /locus_tag="BURPS668_A0601"
FT   CDS_pept        complement(568320..568487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0601"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85946"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGY1"
FT                   /protein_id="ABN85946.1"
FT                   /translation="MKRAPFGARFMFEARDTRSPVAGEPRRPKRRKTKRSEAAVRQATL
FT                   RHALPMPLTA"
FT   gene            complement(568555..569754)
FT                   /gene="tyrB-2"
FT                   /locus_tag="BURPS668_A0603"
FT   CDS_pept        complement(568555..569754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrB-2"
FT                   /locus_tag="BURPS668_A0603"
FT                   /product="aromatic-amino-acid transaminase"
FT                   /EC_number="2.6.1.57"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87394"
FT                   /db_xref="GOA:A3NGY2"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGY2"
FT                   /protein_id="ABN87394.1"
FT                   /translation="MSLFSAVELAPRDPILGLNEAFNADTRPTKVNLGVGVYTNEDGKI
FT                   PLLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVTAQALG
FT                   GTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDG
FT                   MLAALNGYEPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGES
FT                   IEADAAAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKRVI
FT                   RTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIERDF
FT                   SFINAQRGMFSYSGLTSAQVDRLREEFGIYAVSTGRICVAALNTRNLDVVANAIAAVLK
FT                   "
FT   gene            complement(569876..570040)
FT                   /locus_tag="BURPS668_A0604"
FT   CDS_pept        complement(569876..570040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0604"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88392"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGY3"
FT                   /protein_id="ABN88392.1"
FT                   /translation="MDAEAAGRNGQRIILALRRPAGSASPRSGLADRMRKKRVRGRDIG
FT                   RMKTSNSLQ"
FT   gene            570041..572131
FT                   /gene="uvrB"
FT                   /locus_tag="BURPS668_A0605"
FT   CDS_pept        570041..572131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="BURPS668_A0605"
FT                   /product="excinuclease ABC, B subunit"
FT                   /EC_number="3.1.25.-"
FT                   /note="identified by similarity to SP:P07025; match to
FT                   protein family HMM PF00271; match to protein family HMM
FT                   PF02151; match to protein family HMM TIGR00631"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87343"
FT                   /db_xref="GOA:A3NGY4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGY4"
FT                   /protein_id="ABN87343.1"
FT                   /translation="MSEHHSDTRDDLDESKFVTFEGSPFQLYQPYPPSGDQPTAIATLV
FT                   EGVEDGLSFQTLLGVTGSGKTYTMANTIARLGRPAIVFAPNKTLAAQLYAEFREFFPRN
FT                   AVEYFVSYYDYYQPEAYVPQRDLFIEKDSSINEHIEQMRLSATKSLMERRDVVIVATVS
FT                   AIYGIGNPSEYHQMILTLRTGDKIGQREVIARLIAMQYTRNEQDFQRGTFRVRGDTIDI
FT                   FPAEHAEMAVRVELFDDEVDTLHLFDPLTGRVRQKIPRFTVYPSSHYVTPRETVMRAVE
FT                   TIKDELRERLEFFHRDGKLVEAQRLEQRTRFDLEMLQELGFCKGIENYSRHFSGAAPGE
FT                   PPPTLVDYLPPDALMLLDESHVLIGQLNGMYNGDRARKENLVDYGFRLPSALDNRPLKF
FT                   PEFERKMRQVVFVSATPADYEQRVSGQTAEQVVRPTGLVDPQIEVRPASTQVDDVLSEI
FT                   TERVKANERVLITVLTKRMAEQLTEFLADHGVKVRYLHSDIDTVERVEIIRDLRLGTFD
FT                   VLVGINLLREGLDIPEVSLVAILDADKEGFLRAERSLIQTIGRAARNVNGKALLYADRI
FT                   TDSMRRAIDETERRRAKQIAYNEKMGITPRGVVKRIKDIIDGVYNADEARAELKEAQQR
FT                   AKFEDMSEKQIAKEIKRLEKQMADYAKNLEFEKAAQTRDQLALLRERVFGANVGDHVSG
FT                   GE"
FT   gene            572355..572906
FT                   /locus_tag="BURPS668_A0606"
FT   CDS_pept        572355..572906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88507"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="InterPro:IPR038482"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGY5"
FT                   /protein_id="ABN88507.1"
FT                   /translation="MLRSSFVRSGVALAAACAALSATAAEYPIGKHQIQGGMEIGAVYL
FT                   QPITMDPEGMMRKASDSDIHLEADIHAVKNNPTGFAEGDWMPYLQVTYKLTKQGDAKWA
FT                   AQGDLMGMVASDGPHYGDNVKLNGPGKYHLTLVVKPPMQTGHMAFGRHVDKETGVGAWF
FT                   KPITLEYDFPFAGIGKKGGY"
FT   gene            572963..573292
FT                   /locus_tag="BURPS668_A0607"
FT   CDS_pept        572963..573292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0607"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85704"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGY6"
FT                   /protein_id="ABN85704.1"
FT                   /translation="MTFPRAYAFAAAILVAGAAHAADLPTFRLEMADGKLNPARIEVPA
FT                   GQRIKIQIRNTGKGAVEFESVQLRKEKVLAPGGESFVVIAPLSPGEYKFFDDFHQQAQG
FT                   VIVAK"
FT   gene            573352..574194
FT                   /locus_tag="BURPS668_A0608"
FT   CDS_pept        573352..574194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0608"
FT                   /product="iron transporter, OFeT family"
FT                   /note="identified by match to protein family HMM PF03239"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86637"
FT                   /db_xref="GOA:A3NGY7"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGY7"
FT                   /protein_id="ABN86637.1"
FT                   /translation="MGQILFIVWRESVEALLVVGILYAWLKNGDDEARRGLPYLWAGVG
FT                   AGLLMAVGLGAALVGFTEVLSGDAQDYFQTAMVLIACVLIVQMVLWMKQHGRTLKRDME
FT                   RSLQKSTQDANWWGVAVLVALAIAREGSETAIFLYGLGFGQSGHVDGSQMLAVLIGLGL
FT                   AFLTFYVLQLGGKYFSWRHFFRVTEIMLLFLGAGLFQTGIDKLIDKEILPLGIAQLWDT
FT                   SAILDDSSTFGSLVSTLTGYRAHPSLTNLVAYVAYWAIVYLLLKRAARRPAATAGRPA"
FT   gene            574191..575591
FT                   /locus_tag="BURPS668_A0609"
FT   CDS_pept        574191..575591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0609"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87114"
FT                   /db_xref="GOA:A3NGY8"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGY8"
FT                   /protein_id="ABN87114.1"
FT                   /translation="MSAVAGCRRTSLVAQAGHWMQRHGALIRGIQWGVVLVYAFLILVP
FT                   AFTPLPDDTAHLWSNLTLAAQFVFWGIWWPFVLLSMVMLGRVWCGVLCPEGALSEFASK
FT                   FGRGRAIPRWMRWGGWPFVAFGLTTIYGQMVSVYQYPRAVLLVLGGSTLAAIVIGFLYG
FT                   REKRVWCRYLCPVNGVFSLLARLSPLRYKVDEDAWRRSYRKGEDGHRVIPINCAPLVPL
FT                   RNMKGAAACHMCGRCSGHRGAIELTARSPSEEVVALGDRQASSWDTALILYGLLGIAIG
FT                   AFHWTVSPWFVQIKQTLAGWLIDHDIMWPLDTNAPWFIFTHYPEHNDVFSWLDGSLVIA
FT                   YIVGTGLAYGTALAVLLAGAAAMLGRFERVRLHHLAQALIPLAGAGVFLGLSATTLSLL
FT                   RAEHVPLGWASDVRIAILAGANLWSAWLAWLVTGRYASWPRRLLAMLWFGAALAVVDSA
FT                   WWLMFWGF"
FT   gene            575651..576061
FT                   /gene="glcG"
FT                   /locus_tag="BURPS668_A0610"
FT   CDS_pept        575651..576061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcG"
FT                   /locus_tag="BURPS668_A0610"
FT                   /product="protein GlcG"
FT                   /note="identified by similarity to SP:P0AEQ1; match to
FT                   protein family HMM PF03928"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88111"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGY9"
FT                   /protein_id="ABN88111.1"
FT                   /translation="MRTKPVLTSDDVNKMAAAAEAFAAANQWAVTVAIFDDGAHLLHLH
FT                   RMDGAAPSTVEMAIGKGRTAALGRRESKVYEDIVLQGRISFLSVPLVGLVEGGVPIVVD
FT                   GETVGAIGVSGVKSEQDAAVARAGIAALTDAG"
FT   gene            complement(576364..576594)
FT                   /locus_tag="BURPS668_A0611"
FT   CDS_pept        complement(576364..576594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87078"
FT                   /db_xref="InterPro:IPR019600"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGZ0"
FT                   /protein_id="ABN87078.1"
FT                   /translation="MRRTSDTAPGSRSKAAAVTTPAESAKAAMKPAAASAGQRVVSSDA
FT                   LLQGQSHVSIAHNGETYQLRATRLGKLILTK"
FT   gene            576509..576673
FT                   /locus_tag="BURPS668_A0612"
FT   CDS_pept        576509..576673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0612"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87811"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGZ1"
FT                   /protein_id="ABN87811.1"
FT                   /translation="MAAFADSAGVVTAAALERLPGAVSLVRRNVSVVERIGSVIQAIGE
FT                   WRFDGMNTK"
FT   gene            complement(576772..577257)
FT                   /locus_tag="BURPS668_A0613"
FT   CDS_pept        complement(576772..577257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08982"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88578"
FT                   /db_xref="InterPro:IPR015075"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGZ2"
FT                   /protein_id="ABN88578.1"
FT                   /translation="MNFEHLIQINAADNPAVPTLTRAQLWEGLVLRAEQPQLFVLGLDS
FT                   CIVHERTETTLERELHYGNATVRDHVTFTPNEQVRYDIHAADGEIGGSLTMTIEERDDR
FT                   QLFLRFEYRTTLPVSNDSEDARQTQEIVKEAYRTSDIDTVRLIREYAQGRKDPDPLH"
FT   gene            577287..577409
FT                   /locus_tag="BURPS668_A0615"
FT   CDS_pept        577287..577409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0615"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86635"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGZ3"
FT                   /protein_id="ABN86635.1"
FT                   /translation="MPDANRYCDANPQRRRSFPLRRSANGADGVQAEMRPIRPV"
FT   gene            complement(577376..578248)
FT                   /locus_tag="BURPS668_A0614"
FT   CDS_pept        complement(577376..578248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0614"
FT                   /product="pirin domain protein"
FT                   /note="identified by match to protein family HMM PF02678;
FT                   match to protein family HMM PF05726"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85723"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGZ4"
FT                   /protein_id="ABN85723.1"
FT                   /translation="MTIARSIQRTYPAHRTTEGGGFVVHRPFPTRLLTDFDPFLLLDEM
FT                   GPVDYAPNDAKGAPDHPHRGFETVTYVLEGWFRHRDSAGHAGALGPGDVQWMTAGAGVV
FT                   HSEMPDPEFARRGGRAHAFQLWVNLPRRDKMIAPRYQDIPAARIPSAKSPDGRAKVRVI
FT                   AGEAFGACATIETRTPMLYLHFTLSPGAVVEQPVPAGFRVFAYPFEGGGFYGGDREAVD
FT                   ARHVVVYAEDGDTAVFAAGEAPLDLLLIGGAPLNEPIVRYGPFVMNTEDEIREAVADYQ
FT                   TGRMGRISA"
FT   gene            578350..579342
FT                   /locus_tag="BURPS668_A0616"
FT   CDS_pept        578350..579342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0616"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85515"
FT                   /db_xref="GOA:A3NGZ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGZ5"
FT                   /protein_id="ABN85515.1"
FT                   /translation="MWNWNDEMTIDAHNLNDLMYFSQVVEHGGFSAAERVLGISKSRLS
FT                   RRLTELEATLGVRLLQRSTRKLALTEAGQLFYQHCQAMLSEAQAAMNAVQQLRSAPRGT
FT                   VRVSVPVTVSQTMLSRLLPEFLRRYPEVRVQIRVTNRVIDLFEDSIDVALRVRSEPPQS
FT                   ANIVVRPLWRTEQMLVGAPSLLQQNAPPLAPDDLAGFDTLDTPSGDGRHVFNLIAPDGT
FT                   RHTHEHEPRLVTADLMTIREAVLDGVGIAALPESMYGNALRAGQLSPVMPGWTLPVPQL
FT                   YAVFVSRQGMPPAVRAFVDYLVEKLDNERYEEPGCPERGAKDTQTKISI"
FT   gene            complement(579726..580154)
FT                   /locus_tag="BURPS668_A0617"
FT   CDS_pept        complement(579726..580154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0617"
FT                   /product="transport energizing protein, ExbD/TolR family"
FT                   /note="identified by match to protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86151"
FT                   /db_xref="GOA:A3NGZ6"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGZ6"
FT                   /protein_id="ABN86151.1"
FT                   /translation="MAMNTSFGDDDDDGLMNEINMTPLVDVMLVLLIIFLVTIPAMHHA
FT                   VKIDLPRASSQPVEVKPKTIDVAIESDGTVLWDDHPVSAADLQARIAQAAQTNPQPELH
FT                   LRADRKVAYERVAEVMSAAQAGGLTKLGFVTEPKSNAK"
FT   gene            complement(580168..580896)
FT                   /locus_tag="BURPS668_A0618"
FT   CDS_pept        complement(580168..580896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0618"
FT                   /product="transporter, MotA/TolQ/ExbB proton channel
FT                   family"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85432"
FT                   /db_xref="GOA:A3NGZ7"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGZ7"
FT                   /protein_id="ABN85432.1"
FT                   /translation="MQSYGIAHVWAQGDFVTRFIAIALLVMSILSWMVIVIKGWNVIRL
FT                   KRLSKDAEQSFWHSDDFDEGVDKLGRASSSSQDNPFLALALSGKEAADHHHQTQPHLHD
FT                   RMDVSDWVTRCLKDTMDERIARMQGGLAILASIGSTAPFVGLFGTVWGIYHALLVIGAT
FT                   GQTSIDQVAGPVGESLIMTAFGLFVAIPAVLGYNALTRANKSVVSRLRRFAHGLHAYFV
FT                   TGTRLASSQRDGLRLAARAN"
FT   gene            complement(580933..581679)
FT                   /locus_tag="BURPS668_A0619"
FT   CDS_pept        complement(580933..581679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0619"
FT                   /product="TonB domain protein"
FT                   /note="identified by match to protein family HMM PF03544;
FT                   match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87532"
FT                   /db_xref="GOA:A3NGZ8"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGZ8"
FT                   /protein_id="ABN87532.1"
FT                   /translation="MQVSNSLPGASAPAFSRMNPRIVTAAVTVLAGHALLLTGALLMRN
FT                   DVPHRPLESKTITAQLLSAPVAQPAGIQSAPAPTPPQPVPKAKPKPAPAPVPRPVAKPS
FT                   PTPLPVTHEPAPNAITAPEPAPAAPVAPAETSAKAAPPAGAPTNRPTMEIVAPKEGAHL
FT                   SCQIAKAAYPSMSKRRGETGVVKVRFVVGLTGKIESAQVVQSSGFARLDDAALDAIRSS
FT                   PCQPYLQNGQPMRAAYTQPYDFTLTD"
FT   gene            complement(581915..582154)
FT                   /locus_tag="BURPS668_A0620"
FT   CDS_pept        complement(581915..582154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0620"
FT                   /product="putative bacterioferritin-associated ferredoxin"
FT                   /note="identified by match to protein family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86793"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A3NGZ9"
FT                   /protein_id="ABN86793.1"
FT                   /translation="MIVCVCKSVSDRKIRASLAEGVNTFEELQFELGVATCCGKCEETV
FT                   REIMAEQGVCASRCGAERPAAVPVAVTFYERKAA"
FT   gene            complement(582286..583158)
FT                   /gene="murI"
FT                   /locus_tag="BURPS668_A0621"
FT   CDS_pept        complement(582286..583158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="BURPS668_A0621"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="identified by match to protein family HMM PF01177;
FT                   match to protein family HMM TIGR00067"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85689"
FT                   /db_xref="GOA:A3NH00"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH00"
FT                   /protein_id="ABN85689.1"
FT                   /translation="MTTPYAPDSRAPSARAPIGVFDSGLGGLSVLRAVRERLPDEALVY
FT                   VADSRHAPYGPRDDVFIVERTLAIGEWLVAQGAKALVVACNTATAQSIAIVRERLPIPL
FT                   VGVEPGIKPAALHSKTRVAGVLATQATLRSARFEALLARHAADCRFLCQPGHGLVEAIE
FT                   RGDTGSPALRTLLASYLEPMLEAGADTLVLGCTHYPFLGAAIRDVTRNRLHLIDTGDAI
FT                   ARQLARVLDERGLRAPASPRPAPLPRFCSTSDGRQLQALAATLLGLDAPVESVTISSPS
FT                   TAASAADPA"
FT   gene            complement(583205..583681)
FT                   /gene="bfr"
FT                   /locus_tag="BURPS668_A0622"
FT   CDS_pept        complement(583205..583681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="BURPS668_A0622"
FT                   /product="bacterioferritin"
FT                   /note="identified by match to protein family HMM PF00210;
FT                   match to protein family HMM TIGR00754"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88263"
FT                   /db_xref="GOA:A3NH01"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH01"
FT                   /protein_id="ABN88263.1"
FT                   /translation="MQGDKKVIEYLNAQLKNELTAINQYFLHARMYKHWGLEKLGKHEY
FT                   DESIGEMKHADWLIERVFMLDGLPNLQDLHKLLVGEETEEILKCDLKLEQVSQATCKEA
FT                   IAYCESVRDYVSREIFEKILDDTEEHIDWLETQIDLIGKVGIQNYQQSMMGSPE"
FT   gene            583700..583822
FT                   /locus_tag="BURPS668_A0623"
FT   CDS_pept        583700..583822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0623"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87472"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH02"
FT                   /protein_id="ABN87472.1"
FT                   /translation="MGLEFLNDKRSFLKSQGRIRSISERWNGSAASKRPDRNPA"
FT   gene            complement(583836..585371)
FT                   /locus_tag="BURPS668_A0624"
FT   CDS_pept        complement(583836..585371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0624"
FT                   /product="fumarate hydratase, class I"
FT                   /EC_number="4.2.1.2"
FT                   /note="identified by match to protein family HMM PF05681;
FT                   match to protein family HMM PF05683; match to protein
FT                   family HMM TIGR00722; match to protein family HMM
FT                   TIGR00723"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86579"
FT                   /db_xref="GOA:A3NH03"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH03"
FT                   /protein_id="ABN86579.1"
FT                   /translation="MTVIKQEDLIQSIADSLQYISYYHPLDYIQALGRAYELEQSPAAK
FT                   DAIAQILTNSRMCAEGKRPICQDTGIVTIFVKVGMDVRWASENGAATMSVTDMINEGVR
FT                   RGYTHPDNVLRASIVNPPEGARKNTKDNTPAVIHYEIVPGDKVDVQVAAKGGGSENKSK
FT                   FVMLNPSDSIVDWVLKTVPTMGAGWCPPGMLGIGIGGTAEKAMLMAKESLMEPIDIQEI
FT                   IARGPKDWVEELRVELHEKVNALGIGAQGLGGLATVLDVKILAAPTHAASKPVAMIPNC
FT                   AATRHAHFVLDGSGAAKLEAPSLDAWPKVQWEPNTETSKRVDLNTLTPEEVASWKPGQT
FT                   LLLSGKMLTGRDAAHKRIADMLAKGEPLPVDFKNRVIYYVGPVDPVRDEVVGPAGPTTA
FT                   TRMDKFTETMLAQTGLISMVGKAERGPVAIDAIKKHKAAYLMAVGGAAYLVSKAIRGAK
FT                   VLAFEDLGMEAIYEFDVQDMPVTVAVDSQGTSVHQTGPKEWQAKIGKIPVASA"
FT   gene            complement(585411..586019)
FT                   /locus_tag="BURPS668_A0625"
FT   CDS_pept        complement(585411..586019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0625"
FT                   /product="conserved hypothetical protein TIGR00645"
FT                   /note="identified by match to protein family HMM PF03350;
FT                   match to protein family HMM TIGR00645"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86912"
FT                   /db_xref="GOA:A3NH04"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH04"
FT                   /protein_id="ABN86912.1"
FT                   /translation="MSAAPTDPRAARPARRKMRPLPAVIFMSRWLQVPLYLGLIVAQAI
FT                   YVFLFLKEVWHLLSHATGLDETNIMLAVLGLIDVVMISNLLIMVIVGGYETFVSRLGVE
FT                   GHPDEPEWLDHVNAGVLKVKLSMALISISSIHLLKTFINPDQHTTHAIMWQVLIHVAFL
FT                   VSALVMAWVDRLTTHTHPEHFHEASTPPSAPREPAQQSA"
FT   gene            complement(586252..587151)
FT                   /locus_tag="BURPS668_A0626"
FT   CDS_pept        complement(586252..587151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0626"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87591"
FT                   /db_xref="GOA:A3NH05"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH05"
FT                   /protein_id="ABN87591.1"
FT                   /translation="MNRYAFFLIASMLLVGSNVGIGKSIVAFVPVVILATLRFVIANAV
FT                   LWPLFSPVKMRAVKRGEWLNLFLQAFFGTFMFTLLMLNGVQRTSAVAAGVITSTIPAVV
FT                   ALFAWLFLREKPNGRALVSIALAIVGVVTINVANGTASEGGAHASSLAGNLLMLGAVCC
FT                   ESIYVILSRRLTQTLAPIDICAYTHLFGLLLMLPLGAGALWHFDYASVPAGIWALVVWY
FT                   GVSASIFSFWLWMKGIRHVPGSLAGVFSAVLPIAAAIYGILFLGERPTLAHGFALACVV
FT                   TGIVLASLRVRRAPPVSP"
FT   gene            complement(587176..587328)
FT                   /locus_tag="BURPS668_A0627"
FT   CDS_pept        complement(587176..587328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0627"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88523"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH06"
FT                   /protein_id="ABN88523.1"
FT                   /translation="MRRAMLHRTTPDGRGKAMQTFHDKRRNLPVTYATSAPTLLYARFH
FT                   ATLQC"
FT   gene            587441..589423
FT                   /gene="acsA"
FT                   /locus_tag="BURPS668_A0628"
FT   CDS_pept        587441..589423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsA"
FT                   /locus_tag="BURPS668_A0628"
FT                   /product="acetate--CoA ligase"
FT                   /EC_number="6.2.1.1"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR02188"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87579"
FT                   /db_xref="GOA:A3NH07"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3NH07"
FT                   /protein_id="ABN87579.1"
FT                   /translation="MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAERDYEG
FT                   FWARLARETLEWRKPFGKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGLGERVAVIF
FT                   EADDGTVTRVTYADLLARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQACARIGA
FT                   THSVVFGGFSSKSLHERIVDVGATALVTADEQMRGGKTLPLKSIADEALAMGGCDAVKT
FT                   VVVYRRTGGNVDWHAGRDVWMHEMVANESDACEPEWVGAEHPLFILYTSGSTGKPKGVQ
FT                   HSTAGYLLWVAQTMKWTFDWKPDDVFWCTADIGWVTGHSYITYGPLAVGATQVVFEGVP
FT                   TYPNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAAEADDRVHPRSYDLSSLRIIGTVGEP
FT                   INPEAWIWYHKNVGQARCPIVDTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAV
FT                   VDETGQDVPNGQGGILVVKRPWPAMARTIWGDPERFKKSYFPEELGGRLYLAGDGTVRD
FT                   KETGYFTIMGRIDDVLNVSGHRLGTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFV
FT                   VLKRSRPEGEEAAALAKTLRDWVGKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLA
FT                   KGEAITQDTSTLENPAILEQLAEVR"
FT   gene            589581..589901
FT                   /locus_tag="BURPS668_A0629"
FT   CDS_pept        589581..589901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86599"
FT                   /db_xref="GOA:A3NH08"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH08"
FT                   /protein_id="ABN86599.1"
FT                   /translation="MPAPLARAHARYWRFNVALIAVLMTIGFAVSFLVPLFAPALAHVR
FT                   FAGFSLPFYVGAQGAILVYLGLIGAYIVLMQRADRVLRRDYDAYAAEAKRRAAASTDAD
FT                   AC"
FT   gene            589895..591910
FT                   /locus_tag="BURPS668_A0630"
FT   CDS_pept        589895..591910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0630"
FT                   /product="transporter, SSS family"
FT                   /note="identified by match to protein family HMM PF00474"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88180"
FT                   /db_xref="GOA:A3NH09"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019899"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH09"
FT                   /protein_id="ABN88180.1"
FT                   /translation="MLTNRLVRAYALYTIGFAAFVLLLWRIERATGPGVWIGYVFLFVP
FT                   IAVYAVIGLLSRTSDLVEYYVAGRRVPSAFNGMATAADWLSAASFIGLAGSLYATGYDA
FT                   LAYLMGWTGGFCLVAFLLAPYVRKLARYTIPDFLGTRFSSTLVRALAAIAAILCSFVYL
FT                   VAQIQGIGLIATRFIGVDFSIGIFCGLAGILVCSFLGGMRAVTWTQVAQYIILIIAFLL
FT                   PVSLIAMKNGLGPVPQFNYGRLMSRVETLEGEMRDAPQERQVRETYRRQAGAIQARLDR
FT                   LPASYDEARAKLVDQVAELRRHNGPLREINQRERALAEFPRDPAAARVVWEQARDELLA
FT                   RAAAPVPMHEPFPAASDDDRRPRGRNFLALLLCLSLGTASLPHILTRYNTTTSVAAARR
FT                   SVGWTLFFIALFYLTVPVLAVLIKYEILTNLVGRPFADLPAWITQWHRFEPGLIGVADL
FT                   LRDGIVHWSEIQMQPDIVVLAAPEIAGLPYVVSGLIAAGALAAALSTADGLLLTIANAL
FT                   SHDVYYHMVAPDASSQRRVTISKVLLLGVALFASYVASLNTGKILFLVGAAFSLAASSF
FT                   FPVLVLGVFWKRTTTRGAVAGMMTGLGVCVYYIVSTYPFFTQITGFAGPSWLGIEPISS
FT                   GVFGVPAGFATAIVVSLLDRRPDAYTNALVDYIRHP"
FT   gene            591973..592062
FT                   /locus_tag="BURPS668_A0631"
FT   tRNA            591973..592062
FT                   /locus_tag="BURPS668_A0631"
FT                   /product="tRNA-Ser"
FT   gene            592222..592485
FT                   /locus_tag="BURPS668_A0633"
FT   CDS_pept        592222..592485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0633"
FT                   /product="insertion element IS407 uncharacterized 10.0 kDa
FT                   protein"
FT                   /note="identified by similarity to SP:P24580; match to
FT                   protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86490"
FT                   /db_xref="GOA:A3NE76"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A3NE76"
FT                   /protein_id="ABN86490.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFC
FT                   GMEVSEARRLKDLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            592509..593342
FT                   /locus_tag="BURPS668_A0634"
FT   CDS_pept        592509..593342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0634"
FT                   /product="insertion element IS407"
FT                   /note="This functional annotation is a direct result of
FT                   community participation in a Pathema-Burkholderia
FT                   annotation jamboree: http://pathema.jcvi.org.; identified
FT                   by similarity to SP:P24577; match to protein family HMM
FT                   PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86089"
FT                   /db_xref="GOA:A3NE77"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A3NE77"
FT                   /protein_id="ABN86089.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            593459..593974
FT                   /locus_tag="BURPS668_A0635"
FT   CDS_pept        593459..593974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0635"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87926"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH13"
FT                   /protein_id="ABN87926.1"
FT                   /translation="MTKRRPPRTRRPMTKEMLLPLPAAAARRKSIGHHMAYHTLATGEG
FT                   SGSIVAQLFSAVYGAYFVHEATEGRTNLDLFRVAEAALHDCAVRGKAEGKFTTTTDGMI
FT                   AIRKILILRDEQLLNSPSYVLADAQARRTAFLTNDLLSPIAPNASLRFARHLSVNFCQA
FT                   EPYFSDFS"
FT   gene            594096..596834
FT                   /locus_tag="BURPS668_A0636"
FT   CDS_pept        594096..596834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0636"
FT                   /product="Rhs element Vgr protein"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM TIGR01646; match to protein
FT                   family HMM TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88212"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH14"
FT                   /protein_id="ABN88212.1"
FT                   /translation="MRDLYEAISKGVLQQGRLLTLHTPLGKNALVPLRARGSARIGRDY
FT                   SYTIDVASTRDDTALLSLMHQPVTLRIQQITAPFAVPVYRPVHGFVHRVAYLGGNGGLS
FT                   TYQIEFSSALVFLEKTHNEEGWLEKDAREIISDVFDRYPQLRGQYRFTLSSDPAKRSWC
FT                   RQSESDLHFVNRLAEAEGWYFYWVHENVSEGDAPKTTLVIVDRVSTLPDAKPVEFIRAN
FT                   HSNESDGFAHWAAVQTMQSTRYMARAFDYKRPSSNFQVESGLVATSYVTEERRQKVEHS
FT                   IPDAPMTVYESTAYGYSSSDNGEVRARRRVQVWDAHASRYFGVGGVRWLDAGLRFVLNA
FT                   HPRHGDSDPKKREFLVVEARWFIENNVPIGQQIAEFPQSLRATLAEQQAIHRERFKTPG
FT                   HEADGSAGFFVLEVEAQPTTVEFRSPLDHPKPVMSIEHALVVTPDGAEAWTNDRNQIRV
FT                   HFAWDRKNPPNAFNSSPLLSSLQSDTGNGYGAVHVPRAREWVIVGYWNGDCDKPFVLGR
FT                   INGGATPSPWHSNALLSGFRSEGFGKTGAYNSFVHDDSTNQGGTRLVSYTGKSYAALTQ
FT                   GYLIKHDGNTRGQYLGAGFILHADEFGAVRASKGLSISAHWKSYDDEQMGVDEARSRLQ
FT                   QAGMLVESLSSASTTAQAESLQTGQDALKSLSKDIQHPVSGDTSGGVTAGGGTGSANGF
FT                   AQPNIVVSTPKDIALVADSSTHIVAEKEVNVVSNENTYVATGKSFVVAAAEKVSFFAQK
FT                   LGAFFVTAKGPIKLSANTDDVNVNAGKDVTVKAKRIVLDADEIVLKAGGSYTRWVAAGI
FT                   EDGTQGPRTIKSASLSRQGPSSIAQHMNSLPQAKFNDPYVLRNRVTGEVLKNHPYELIR
FT                   GDGTRLTGVTNELGHIAEQKSEDIEKLAVRALRPKPNGPAA"
FT   gene            596870..598804
FT                   /locus_tag="BURPS668_A0637"
FT   CDS_pept        596870..598804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0637"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88430"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH15"
FT                   /protein_id="ABN88430.1"
FT                   /translation="MSDNTDQTGGSPFSDDAEQEVVRQIGRTDKDGASVGHFTLTPASD
FT                   TRSKELLCDVRPIIPVIFLPGVMGSPLVNMETGDEMFFAPNTDGWLGDAGALPTLLGMW
FT                   FKGASSRETQFDPTVAAVTPFGPIRAGKLKKDDKEDQYVDEAEARRRGWGSVYRSSYQP
FT                   ALAWLEEQLNEVMHMNEVQGLWNKTDPDGKEWTLKTLLDTEPADYGATDAGAQGRGQKL
FT                   TKDSAAFQHFVKYRYRVYAIGYNWLQSNEKSARDVIEGMDFKDKKSGKTARLMGIKEII
FT                   AENDSGKAIILTHSMGGLVARMAIAMHGAADLMHGVFHNVLPATGAPIAAKRFRTGGGS
FT                   EGGLNGFINGALLGSNADEFVAVAANAPGALELLPMPDYHNGEPWWIFARLNGEPVMQL
FT                   PKEGNVYKEIYANSKWYGLVPEQSSSLLDPAGIVKKRLDTLPIKSTVSENFSNVMAEVV
FT                   DNQKNIINTYHDKTYVTYGDGALKPKSSTTSGEGHGKRTIEQGKKLDDLLAWGTVIWKG
FT                   NIPVGVTEEELQGARFMHDSHSGTLRVHLDSRNVTIEFEVQKVAKLLPGSDGPDPQKNG
FT                   IVPGDGTVPVWSAEAPARGANGGAAPGVQIVFDQGGYVHQESYNHPWARWALLYSIVQI
FT                   AQDAPEPKC"
FT   gene            599284..599838
FT                   /locus_tag="BURPS668_A0638"
FT   CDS_pept        599284..599838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0638"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88443"
FT                   /db_xref="InterPro:IPR041290"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH16"
FT                   /protein_id="ABN88443.1"
FT                   /translation="MPVYTDLYRRIKARDNWSVPTESGFCFDGGIATGSSTYPEEVSQS
FT                   FALMPGRPALLVIQMRDSVDVDQKEPLTKTLPALRAQMDRVSSGSYRILRQGKRTVAGM
FT                   DAEEVLFALKEGEITSYRFYLLAPGDPSTLAKPHTAIQLLLGASSPDLKPDEATSPVDE
FT                   AGALQTWDTLLNSLRLRPGAV"
FT   gene            599850..600137
FT                   /locus_tag="BURPS668_A0639"
FT   CDS_pept        599850..600137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87682"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH17"
FT                   /protein_id="ABN87682.1"
FT                   /translation="MRRYDIVKGDTTTVGGIVQGGDGQDMLLGREQAYEHDPVWCPVCK
FT                   TVGVIVCDGPRHSSTGPDGRQSALSDDLCRCACPTPPKLVASQSVSYIEV"
FT   gene            complement(600509..601333)
FT                   /locus_tag="BURPS668_A0640"
FT   CDS_pept        complement(600509..601333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0640"
FT                   /product="insertion element IS407"
FT                   /note="This functional annotation is a direct result of
FT                   community participation in a Pathema-Burkholderia
FT                   annotation jamboree: http://pathema.jcvi.org.; identified
FT                   by similarity to SP:P24577; match to protein family HMM
FT                   PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86704"
FT                   /db_xref="GOA:A3NH18"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH18"
FT                   /protein_id="ABN86704.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(601357..601620)
FT                   /locus_tag="BURPS668_A0641"
FT   CDS_pept        complement(601357..601620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0641"
FT                   /product="transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88086"
FT                   /db_xref="GOA:A3NH19"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH19"
FT                   /protein_id="ABN88086.1"
FT                   /translation="MKKRFTEEQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            complement(601686..601844)
FT                   /locus_tag="BURPS668_A0642"
FT   CDS_pept        complement(601686..601844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0642"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86521"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH20"
FT                   /protein_id="ABN86521.1"
FT                   /translation="MMGARARFHPYSAWRKPENKFRQLCAADAASQNKLARSIHAVHLE
FT                   DILRKID"
FT   gene            601716..602684
FT                   /locus_tag="BURPS668_A0643"
FT   CDS_pept        601716..602684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0643"
FT                   /product="Transposase IS116/IS110/IS902 family"
FT                   /note="identified by match to protein family HMM PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85367"
FT                   /db_xref="GOA:A3NH21"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH21"
FT                   /protein_id="ABN85367.1"
FT                   /translation="MHGVDAAGKLVLRRRVGRAQLTELVLRLAPCTIGMEACSSAHHWA
FT                   RQFLQQGHTVKLISPQFVKPFVKGNKTDGNDAEAICEALQRPSMRFVPIKSVEQQDVQS
FT                   LHRARSRLVSNRTGLVSQMRGILAERGIVFAQSITRARREIPVIVADTSNALTPLAREM
FT                   LADLMDQLRELDRRIAGFDRRIDLVFKASETCQRIAQIEGVGPKTATAIVAAVSDPKDF
FT                   RNGRHFAAWLGLVPRQSSSGDRTHLLGISKRGDRHLRTLLIHGARAVLRTAPTKHDKKH
FT                   AWALALKARRGANRAIVAIANKMARVIWSMLATGQSYQKAG"
FT   gene            complement(602875..603024)
FT                   /locus_tag="BURPS668_A0644"
FT   CDS_pept        complement(602875..603024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0644"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88421"
FT                   /db_xref="GOA:A3NH22"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH22"
FT                   /protein_id="ABN88421.1"
FT                   /translation="MKKRFTEEQIIGILKEAEGGLKPAELCRKYGISEATYYIYGLLPI
FT                   ANGG"
FT   gene            complement(603057..603806)
FT                   /locus_tag="BURPS668_A0645"
FT   CDS_pept        complement(603057..603806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0645"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87700"
FT                   /db_xref="GOA:A3NH23"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH23"
FT                   /protein_id="ABN87700.1"
FT                   /translation="MRFLLEFPTPTHVRALDRESFVAAAWDLVGRKVNKCAKLEEIWET
FT                   AAHTAALPHAPDCLAVETFRITLRRYQELNVLRAAIEARAEAELHDNIDFAHLKTLPGI
FT                   GSVIAMTILAEAGDLRRFGHHRQFLKYCGFDPAKIQSGTQRGREQLSKRGNARLRLAFW
FT                   MAGMAAVRMKENSFRSKYERYVHADPDDADLKRKALTAVAAKMARVAYGMIKKNQPYRQ
FT                   FFELGLPSGSIPLSAAVGVTCSPRLVR"
FT   gene            604424..604630
FT                   /locus_tag="BURPS668_A0646"
FT   CDS_pept        604424..604630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0646"
FT                   /product="integrase, catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87716"
FT                   /db_xref="GOA:A3NH24"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH24"
FT                   /protein_id="ABN87716.1"
FT                   /translation="MYYGSEFTSQVMDLWAYHHKVEIAFSRPGKPTDNAFVESFNGTLR
FT                   DECLNVHWFTSLADARVLMFTRN"
FT   gene            604871..604990
FT                   /locus_tag="BURPS668_A0647"
FT   CDS_pept        604871..604990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0647"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87518"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH25"
FT                   /protein_id="ABN87518.1"
FT                   /translation="MAWYNHHRLMEPPGYIPPADAEANYYRQLRNAAEVPALI"
FT   gene            complement(605092..605799)
FT                   /locus_tag="BURPS668_A0648"
FT   CDS_pept        complement(605092..605799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0648"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85841"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH26"
FT                   /protein_id="ABN85841.1"
FT                   /translation="MCAFVAAPLLWGLLAGVAAAQALAQPAASTVSVCAAVITGSSGTT
FT                   VDVSYAGLPGNQPKLYGDFVALWQSSVVPWSIAPAARLGIPTDAELGTVVMTGVSISAT
FT                   PYTVGYAVGPEVDDVCASALLAADGSTGVVDTVTLQLASVGATSLTFRYHTLSGYLPAT
FT                   AGNWVGLWRGRASPYNAAASVARVKVAADVTDDSVVMEGVTLSPGEIYTAIYFMGEPLT
FT                   TAAVLLNFVAPAR"
FT   gene            complement(605817..618212)
FT                   /locus_tag="BURPS668_A0649"
FT   CDS_pept        complement(605817..618212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0649"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88442"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH27"
FT                   /protein_id="ABN88442.1"
FT                   /translation="MAGLNDVIERLSQGTQNVLTVHLGARITKVRDYLNALDEIRVFTA
FT                   NSQNFGHQSSSVNILRNLIRMGAPGPYTFALSASNSADYADLEEKIRLLIPQFRQVGVT
FT                   FELGAGGQSADVTVVRLDKALAPAQFAISGGFDDLENKTPPYHLLNVTNYVQLQPYAWN
FT                   RGTNMVRIKPPGGTASEYNLDELNPTTLLARRAFYLADPELTQSDREAIAQTPYANKAR
FT                   VIERLLERREAGEITLFPVYGVTTKGSAYTSLYNAVTGALIAQNTHPTVKKTVMVQITT
FT                   LTASEWQEFLFLMRDPAGQMVNKIRTTPDFRGWNEENKVKDRVQDLGSPNSEPTVAELD
FT                   EELSYLEDDQLLVVYIGKIPAPLFDVLYASATLPPVLEGQNTAELMLNLGKPYFKITSN
FT                   NSREADARFSYATLPLSSTGAGTDATNSLDESFNGIYFTRPDNWYRDRPTYPPTQLPAM
FT                   INAYVQPAGNARATYFAAQRTFFHDELNDKLLRGLDLFVNLIGPAALEEHRLALAHAEL
FT                   DDANAPVHEAGATARAPARIAHRKPPTRVAGGDANGASELLEAFYEDLTSHTVDGVLDF
FT                   LLAVTDGILNEFFRQVVIDVVFTITDTVTEINADKTEVTLTGKSKAFGAGNLTLAFSFT
FT                   DSGGTIAGKMSGAFTDTVWAFPGAQWLSVANPSLALAIDSNAAVPVTGTVGATFTAGIA
FT                   AKASLTLPSEPGRLLLQAEFLAPRPSITNIFQMLGGINIQALLPSQIQLFSDIEVQNLA
FT                   LRYSYANGVMEYIGVTLGTPENRSWQLVPGVTVTGLGFSALTDYPGDLQRRSTRYVIGG
FT                   RFDIAGGHAQLEARVPALRVTGGLIDGSPPITLAAIVTEYLGADFAAAIPASVSSTAIE
FT                   QLSFIVDQAQGAYSFSMDVSAQWPVPSAANALFTITGLNFAIDAVSRDINPPKADAGGN
FT                   NGAGGTQTEIEGSFGGSLIVLPNSESPIGLSTTATYKTAAKAWTFDAQQTSGVVSLGAL
FT                   LVYYLGNTWQAPQGQEYAIDGLGLTITSSPTDSTWAFTGKTADNWVVPFLDVSLAAKLR
FT                   MGDAGAKAEVPGKFGRLDLEVIWQNIDLTVWFDYNPKVKQYGITWGLLEGVVDGPDPTT
FT                   QDWTATLGFKQNTTLGSMIETMVSWATGSKFGLESPWSFLNAIPLSNLALKYTFNQTTP
FT                   SRNKVSFAVTIGPINLGFARIDSIDVGYQSTGEDRGVMVTLNGSFFWQSDPSTPLEWDA
FT                   SQPGTAPAPPGNGNKYLDLRLLAMGQHITLPCFATADTVQKAIACMATLPDPKPGQIPA
FT                   VRFDAQSAWLIGTDFGVLKIDSGQTGNNANALRVTNDGSSLAESSGYVLTLQAVFNDPH
FT                   LYGLRIALDGAAAKVFKGLDFQIMYRQVSDTVGVYQAEITLPDLMRHLTVGAYSLTLPV
FT                   FGIAVYTNGDFQVDIGFPWNENFSRSFTIEAIIPPGIPVLGSAGFYFGKLSSASTNRVP
FT                   ASSYGTFNPVLVFGFGMQVGFGKSIEYGILSAGFSVTVVGILEGILAKWNPYQLTHSGR
FT                   EPSTQLQGDYYFWLRGTVGIVGRVYGSVDFAIVKANVDITVKLLLQLTYESYVSITITV
FT                   IASVDVSVSVKINLGLFKISISFSFSMRLKETFTIDNRGAAPWLGDGRNVRGVLRLPVE
FT                   RRLSGFARAQARDSLLVSAPNWGNLRPDGVTDLSGYLVPGLTAARDEWTPQGEPANQLS
FT                   CWVALLLIESVPPAGQDAGASKLKAAGSAPDSSFEALAKMVLRWAIAAVQGPMTPNEVD
FT                   RYPVPATLLDWLADDVLVSTGDDPTPIPLDAVQAFLDTHFRFNLRVPPTDQDASADTAY
FT                   FPAPPQLRVMIPPYGNDYPGVQYTLGSYNALGENTLAELRAWFDQLAVQVEREQAANGA
FT                   AARAFVEEAPLSMAGWMFSDYFLLLARQMVKAAQDALRDFKYALDANETPDDVVSWVNT
FT                   TGQLNGLYTLNDVFGANALHALVAEKTLTIGVTSSITLDKTGQTFTSLAKAFDDALPAS
FT                   AIASANAADAALLQPGATITYPGFDPYTSVAGDTLVSIAAHYQAKLNDLLADSDVLDAA
FT                   GMLRIGASALMPYTAYTALATDTFASVAALPVYAGGFDAAALATANAGRSVLLEGVKIE
FT                   YPDKDAYTVQPRDTLGDVANAFGVTVSDLLATSAVLTQPGLLAPVASLTVPAFRYTTQQ
FT                   GDDLAQVAARFGVAVSVLADQPANGTVAGLFDTGDTLDLPHLPQFPLAELLAEAQRSGM
FT                   LQHLSGIASSYTMHGLRFPTSGPTGTGGQWSIVPNEMGMWVHDVNGTLKLPPQAGLYAL
FT                   TGQQFPLPALGADPFAATFDSVAGAGSSWLRFVDGNGGPTDRLTLSVTPGTPDATRIAQ
FT                   VTAAAKTRLVVPMDRLGAGKMYDTALATYPFTSALQWLSTHTVALPYGQPPAGVQSLRV
FT                   WQLPGALAALPDPAIHAVNPRFALRVARYDDATGATETTGVDSYGWASTIGFTVRRIPP
FT                   VAGSPASVDTYEVVGASGAAIVVLEQLLSQVQADDSAYFGLSVGFAPDSATGGGEGVQT
FT                   GGAASVVFGIAQVNLSTETRPPAGAAFAALRETAGETPQLTLLNSPSEFVRLLWEASIT
FT                   RSGGFFLYYYDRAAGGGLPDRIFNDRNEASLTLIVLYAKPAAVDDQDRVTNYMNAVVTT
FT                   DALDTGNAVLFAEAAPVPATVTSGAGETLASLAAQWYSDEADIAEANANVALRAGALVR
FT                   VSEGVYQAPPGGIALAQVASRFGTTVQALNDANPLWGGLPDPLPFPAAIRVPDLTLTAG
FT                   TSAHTASLADIAGWYGEPVDALASHNARVAQLFAAGVPLVIPGGPRVRSAAVQPGVQAL
FT                   AALRPAPPQVDGTSPDYGTELLLNNFSLLNQQVYGNVDFRPSDPPGLPAGPTTKAPEEN
FT                   GNDKVRTVVPADQVEAWNFSQALPYARFAKHVPQAPRAAVALPPASASPYFGVGGILQI
FT                   SFAWQDYYGNVLSTPLSDPLAGDAAPYNDAPLLTGYTDPLVSLSQWPSIASNWQVLPGS
FT                   GGANPRLNIELSFDPSRYQGLLQASAATQTTITVVFTDALDAASVGELSRWQLVPGTVD
FT                   SASLAADGKTVTLTVPALDDDLRYTVIATDIKAQASDMRYSGQASFDWPDNPVTRSSTV
FT                   QQNASQDLHVYTQLYYQLTDPAGVDLSAQSSLLAGAHGAPGSVAYAPAAVDELMDWLFG
FT                   TAGAASSIYAFVLDRSKFQSVAVPPAAGLPLDVDVPPQQVNTAQIFPLWTSFTMTRAHG
FT                   PVLPGLETVAGIRSASTRVAPLQDALGATGGTLGLVTFATGFEQALSTPGSVRLKVATG
FT                   VDRTAPPATGAASTVWAVRVGLAAGKAISYAIADAGNPAVFAPQPASNRLISRTQVPIY
FT                   DYTTGKGISSTPSRTTDFTDVDLDTWCAQVFAAVDDVLTPQFTAPMQIVGELKSADYLQ
FT                   SILDGKKGLATVAKLWMIPVFAGETSDPSAAREAFYQQLLVRLSAAYTTRAAVEFHANV
FT                   TADVIEPAADQPPRLFGPVTRNGPVFEAATVDGQALTTVFLLFSDPMDPATAGNIENYA
FT                   LSSGAGVLTATVDRGTVTLTLATDVQPGQTTVTVSNLKDATGRAVRPPLTRTITTGSAS
FT                   LPASTLAFSSPKLTLQAGDTRALTYLVNAPDSVRGAGGEIVSYVELDMTYQGSQIEHQI
FT                   GALPGIEDYQASTWLSFVVPDTDGPLAADLGNFAVPLVLRAFPASPAMTEQSGTPTHDL
FT                   DTASLPLLKQWDYAFTYSLPFHYPQDRIYGEVEFNLRTAPTLFASFPDAFAQLAEFITV
FT                   FPKVNADLQTILAGIDATVDPMTDQQKIDDASIALQSFIQLVDELVDAAGGNTQGNGER
FT                   RGGTGLTFQAPARLLTGDPSLTFAFYEEEGSAEVGDTEGALVVTLVGAVPAGMGQPVVE
FT                   IDPALYDAQPWQPPGDTQKAGDVFHYVYKRKAGPGPEGSYLSAANGQNIPGRTVRLPAL
FT                   DILQRQDAWSTVWVERNRELVPGKPSADAFVYTTPEVRFASPLYPTNDANAIIDVAAIP
FT                   SGTPVTRSLQEHFDALFAYLLAGDTLPQIVAQVEVTYGYALNAALDKIVLPVLMQAPLT
FT                   VDVAGTGAGTIAKMTADWTAAIETWFSTYEPTGGGTLWMDLTLMSNLTGQPMPLLRMRR
FT                   LMLSIAQVVPPLPCR"
FT   gene            complement(618196..621774)
FT                   /locus_tag="BURPS668_A0650"
FT   CDS_pept        complement(618196..621774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87729"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH28"
FT                   /protein_id="ABN87729.1"
FT                   /translation="MRGDLMSFFTQFEGSRLYIGPVASGDAGWLAYLLPRPSPSTEEID
FT                   LDFALKQLPGSFLFSFTAPLLSTTPLLDAFIGAVDQVIARSPADRGFLWLMAPTAPTIS
FT                   SAPLMGIAADGSYVSNALQAPIFETLSLNVRAGVTLQLDGDTLRLGTANGIFFSGASAP
FT                   GAPQASQIPAGTLPLSGAARGCIRFPVFLQRQFLHDGWNWGFQFQIPHDDPVRSAIGEW
FT                   LPLAFGHLPNPGDMLGFDASYDPSDPWNAHAIAADRSVLVFTGQNQDGSATVLSSCYAT
FT                   TYGELLTLAPVAGPLDMQPDAARFLFNAGAPDDKGNHDFQIAPEGDFVIHAHGPSDGGT
FT                   YDLICGLQGTEFVAFQPFVDGGYAGDRLRFTARSPAYAPRYPFTEVSPVGAPVDVNAPL
FT                   LDATYTSSWGTVARAPGAPGAAAYVAQPKGAALYGRDALIHSLGEKTLFGPMTPSVTLP
FT                   SSAFPVVPYAGSSAGDGVTALTAEQMADFERQVVSPTRRRRIADGGAGVASSKAHALKL
FT                   ADMATATPYNTTTPSGLLVTVDAAGQWSKILLGQNLSPTLRQMSFCNPGAELQQAFATS
FT                   DLFLVAANAAHLGAFSADGSGACGPSATFANRINVGDWSFEAAVGQNNRYDDYADVMIV
FT                   KGRRGPLWDPQNPAGSLVASPDMWTQKDVFAAPSDLVPNPAPPPDETVAAPNPDELTAL
FT                   SYWLQRYFQDALDQAEPEYFAKFNAIAKDPAWTGILFLRMKISSIPDDLVGIVAGVQAP
FT                   ELFNAHHFGIEISQIANDPAAPDIALTTSSSMFGLIYYVDPAYIAPPPGIDPRPVPPTA
FT                   GTDYQFRVLTLKALFENTAVQRFQSYAQLTLNSLFDMPVVSMGEGGNPYATLVLRGSYQ
FT                   DNGGRAVYSLGTTATSTFYFDNNLFTKIEVDSAQMSTRDSGANGQIVSWFALSGFLDFA
FT                   VVQANDSSGAFDILSFGSHAGEDQLRRGLAYSNLGVRMTFPVADPATIAFAFSASEIRF
FT                   DMQTSTPRPDSLFVNFALGLQGLVQGSAQTSPEADGFLNVVTDATLTGVNGDRWYGLAY
FT                   QLNMGTPGNLAGTIGLTSGLLTAWAPVSADAGRYRASLGIQLPGTGGGANLISLQNVLR
FT                   LSIGQMWLTYDRDKRSFLLMLTEIALKFMGLLKIPPSGSTLFYLFGNPQSEGKASGLGW
FT                   YAMYNNTPASRSKSARLLGKARGWTE"
FT   gene            complement(621892..622584)
FT                   /locus_tag="BURPS668_A0651"
FT   CDS_pept        complement(621892..622584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87072"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH29"
FT                   /protein_id="ABN87072.1"
FT                   /translation="MAKELNAPSQQALVTSFTIQPEDVTGTQITYRYDTMPGNQPNAYG
FT                   NTVFIWQTSQVFIPVSTQPAHSQIVQNNQPNGSSIFQGLSVSSESYLVAFAVGNSVKNI
FT                   VAAVFVPSTDSHQPPYDPVQAPSILVTNKGSTSVSFSYAMPAGMTPQADGDWVGLWQGQ
FT                   TEAVLYNMPPTWFVQLGSNSNAGNFGINLSSGNIQRGVTYTLGYFKGGYAQSNPKQTTL
FT                   AASTTFVG"
FT   gene            complement(622701..623126)
FT                   /locus_tag="BURPS668_A0652"
FT   CDS_pept        complement(622701..623126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0652"
FT                   /product="DNA primase TraC"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85482"
FT                   /db_xref="GOA:A3NH30"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH30"
FT                   /protein_id="ABN85482.1"
FT                   /translation="MRHRAGFKQHVKRGERPTATASDREHYAEFGDKMSADDAQHVETE
FT                   SIEAAVFRKAVCAGFDHKMVALALMKRGGRSAANRRTPTCQSGMAADSRNIGEARCARR
FT                   LCSQSLLLPCPRGAFETETLQGQSIVTNCAGGAYQFR"
FT   gene            623662..624069
FT                   /locus_tag="BURPS668_A0653"
FT   CDS_pept        623662..624069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0653"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88065"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH31"
FT                   /protein_id="ABN88065.1"
FT                   /translation="MYPWIWLWAPNFYFPLSGGVDQTIQPDLFDAINSRAGNGEIERKA
FT                   FQVASYGRQLGLIIEVLLDMAKKQEALSPEAKQSMERLEAIQGEIEQIKREAPTSIAAD
FT                   LAARLLQLKTQNPAEFVRLRAQLLGIVKDGA"
FT   gene            624077..626020
FT                   /locus_tag="BURPS668_A0654"
FT   CDS_pept        624077..626020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0654"
FT                   /product="acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87272"
FT                   /db_xref="GOA:A3NH32"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH32"
FT                   /protein_id="ABN87272.1"
FT                   /translation="MRYASRLPARTGVGRMRDARTARCAGLGVVGRGRRTSLEPSAAAR
FT                   IASTKTFEQPFDRSRGARLRPSFHRSFTGRATMKASNAIARFLAAHDVRHCFELVGGMI
FT                   THLLDSFAESGRFQIVSMHHEQAAAFAAEGVARRYMGRKVAVALGTSGPGATNLITGIG
FT                   SCWLDSVPCVFITGQVNTHELKGERAIRQQGFQELDIVPMVRSITKRAVQVSDANELLP
FT                   ALHGALSAALSGRQGPVLIDIPNDVQRAEIADAAVDRWLGEPLRIRDRCEPGDRDIDAL
FT                   RELCRSSSRPLVCFGGGARWAPSMPAWIAALEDARIPYVSTLMGHERVPAGAHYFNMIG
FT                   AYGNREANWAVQHCDLLIVIGARLDVRQTGADVDDFARHARVVQIDIDPAQLNNRIKVE
FT                   QALCCDAESFFRRFAVRRDTFAGIRPDWADQLATLRTAHARNEYPDWNISPGVVFARLN
FT                   EAMAGKAVHYVCDVGNHQMWAAQGLRLGANQAVHYSGGMGAMGFALPTAIGIACSGDGG
FT                   GKTVVITGDGSLQVNVQELDTLSRLQLDVAIVVMNNYSLGMVKNFQDMYFDGKNISTKQ
FT                   GYSCPSFVALARAYGIESMTVAAPAELQRAIDRVAGSRRPLLVEIAMPEATECRPRLAF
FT                   GRKLDDQYPKLD"
FT   gene            complement(626180..629167)
FT                   /locus_tag="BURPS668_A0655"
FT   CDS_pept        complement(626180..629167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0655"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF06082"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86600"
FT                   /db_xref="InterPro:IPR010344"
FT                   /db_xref="InterPro:IPR010425"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH33"
FT                   /protein_id="ABN86600.1"
FT                   /translation="MPKREATGRKRRGCTWLAVVLACARPFDAAAHVEETIAAPTHLGD
FT                   WLAAHQSTPAVGTPPSGAPSPYLGGLSWRSNREVAAQQASKRRLLAGIDALPALTPAAQ
FT                   AARARLSAMIAARAATGRVIVARSDARWLQANPAHDPYLEAGDVVTIPERPSSVAVVRA
FT                   DGSICTVAHVQDVEALPYVLACDPDAAPDLAWIAQPDGTVSESKVAMWNRDVQDTPAPG
FT                   SWIWAPDRGSRWPPALSRALAEFMATQGVSGLADDGSPLPAPPIAPVHQTAFPSGAPGR
FT                   SAAFPVTGGDWGTAGILQTPTARMNDAGEASLSMSHVSPYTRLNFTLQPLDWLEIGFRY
FT                   TDVSNQPYGPVSLSGTQSYKDKSIDAKLRLWRESAYLPDVAVGFRDIAGSGLFSGEYLV
FT                   ASKRTGPFDWSVGLGWGYVGARGNLRNPLAVVSRRFDDRANSATPNGGELGYSSWFRGR
FT                   VSPFGGVQYQTPHERLILKAEYDGNDYRHEPFGQVLKARSPFNFGAVYRATRNIDLSLG
FT                   FERGARMMFGVSLHGNLKRASMPKLGNPPAPPVTQPASNAGPPPPAADPASGDAQAATA
FT                   PASRIGRASPSPFDRDWSGTVAQLQAQTHWHVRSIRALGMDLVVEFDDVDAFYLQDPLE
FT                   RIATILNRDAPLNVRTFHVVALVHGVPVADYQVQRTQWFASRTRALTPSEAAPDTALGR
FT                   PLTRQSIDMLPSLFEQRPKAFVASVGPGYRQTLGGPNGFLLYQISADAYGEVRLPGGAW
FT                   LGGELNVGLVDNYGKFTYTADSKLPRVRTYLREYLTTSRVTLPLLQLTKMGRLGNDQFY
FT                   SVYGGLLESMFAGVGAEWLYRPADSRLAIGVDVNAVRQRGFRQDFSMRDYRTLTGHVTA
FT                   YWNTGWQGVQINLSVGQYLAKDKGATLDISRRFRNGVVIGAYATKTNISAAQFGEGSFD
FT                   KGIYLTIPFDAMMTRSSGSVANLRWNPVTRDGGAKLDRKYPLYDLTDMGERRSLWYAPP
FT                   DGALSP"
FT   gene            complement(629169..629813)
FT                   /locus_tag="BURPS668_A0656"
FT   CDS_pept        complement(629169..629813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0656"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88259"
FT                   /db_xref="InterPro:IPR021308"
FT                   /db_xref="InterPro:IPR023373"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH34"
FT                   /protein_id="ABN88259.1"
FT                   /translation="MPVRLLVSLWIIVLCGCSTSMQGLADVARVYWDGGNHQVARTALD
FT                   ARYRYLRISVRGRATLMILGYVDRDPLGPIETWYSGHGKETLRLQNGRVVGGTGLPVEW
FT                   TSVQLSAQPAWRSLSGAATIERRRDVMPGYAYGLTDTLTVTPIPMPRGTAYFGQPDPGL
FT                   RWFVESSTGAAPLPPARYATRTVGNATTVVYGEQCLDKTFCLSWQRWPVNS"
FT   gene            629906..630253
FT                   /locus_tag="BURPS668_A0657"
FT   CDS_pept        629906..630253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0657"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85579"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH35"
FT                   /protein_id="ABN85579.1"
FT                   /translation="MPVVPVLPLLPLPPELAATPIPTAAATPAPTAATVPTLTPPNVAA
FT                   PPAPAVPAVPVAPVASPAPVVPVVPAEPGMSVAPGVPGVPGAPEPSFRMAPDARSAGCS
FT                   PAAGVAAAGAA"
FT   gene            630485..630703
FT                   /locus_tag="BURPS668_A0659"
FT   CDS_pept        630485..630703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0659"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87043"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH36"
FT                   /protein_id="ABN87043.1"
FT                   /translation="MACQKFAPLFIDQFKRQALFHSVERKRRLAAWVREFCRVTPHFAP
FT                   VSHRWDASGIMGDTAYCFSAVCAFCIY"
FT   gene            complement(630672..630869)
FT                   /locus_tag="BURPS668_A0658"
FT   CDS_pept        complement(630672..630869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0658"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87626"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH37"
FT                   /protein_id="ABN87626.1"
FT                   /translation="MTDSTQRIRSWGHAGRYRTHILPDKRIHAANYDINWKRTHPMFLA
FT                   MLHRWRISAVVNKYKKRTRH"
FT   gene            631048..633681
FT                   /locus_tag="BURPS668_A0660"
FT   CDS_pept        631048..633681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0660"
FT                   /product="capsular polysaccharide biosynthesis/export
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02563"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85744"
FT                   /db_xref="GOA:A3NH38"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR010425"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH38"
FT                   /protein_id="ABN85744.1"
FT                   /translation="MIRRRRADDVLQKARCSIDRKTRSRMNVKSPILRHPRTWAGFSFR
FT                   DGLPFIRFASLRSLAWLLRCAVCLWPCAFPVFAHAQIVPFVPSASASAGADARSAVPLP
FT                   PIDGLPAVDGLSARQRDALQPPLPGAKLTKDATTKDGLLKDGAALNEPPRPCGPLGCRG
FT                   EAIDCPPSADGRPTSITRRADGTPELPDPCGRPRAASQPALTDFQVFVQQSTGRALPLF
FT                   GYNFFSTTTTYRSLDNVPVPDDYVLGPGDEVLLHAWGGVAGDQRLVVDRNGQVSIPGVG
FT                   VVTVAGARASELDSLLRSGLGRYFTDFNVNAALGRLRSIPVYVVGKAMSPGSYTVPGTS
FT                   TIIGALFASGGPAFNGSMRAVALYRNGRQIAALDVYGFLTRGAVKDDVHLLPGDVIVIP
FT                   PAGPRVALTGALDAPGIYELRKTSETLRELLDDAGGVTALTSLDRVMIERVNPADGAAP
FT                   RSVQEVRLDEAGLATVVKDGDIVTLSMVSQKFSNAVTLRGNVAAALRYPYKPGMTLADL
FT                   LPSPEAVLTPDYFTRKNILVEYAKSGGADRRPFDGIRNLVDEPNWHYAIIQRLDPVTLT
FT                   ENVIAFNLRAVMTKGSAEAGIALQPGDVVTIFGKRDLRNPVDDNKSLVRVDGEVRAPGV
FT                   YQLNAGESLRELLQRAGGLTSNAYVFGLEFTRESTRSQQQQNLNAALDRATLQANSKLA
FT                   AALANLPSGDTQYLQAQMAAAQQAQLARLRELKPTGRVSLELSTRASRIGDLPDLPLND
FT                   GDAIYVPPVPAFVTVYGAVDNQNAVIWKLHRTVADTLRVAGVQRDIADLDAAFVLRADG
FT                   SVASASSAGWFGSFGALELMPGDALVVPEKLDRRTAMTKFLAGLKDWSQVLANFGLGAA
FT                   AIKVLK"
FT   gene            633686..634903
FT                   /locus_tag="BURPS668_A0661"
FT   CDS_pept        633686..634903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0661"
FT                   /product="chain length determinant protein"
FT                   /note="identified by match to protein family HMM PF02706"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86823"
FT                   /db_xref="GOA:A3NH39"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH39"
FT                   /protein_id="ABN86823.1"
FT                   /translation="MAELETGGDGPADVGQSAPVGPALSRADVLIALGHGKGLIARIVA
FT                   ATVLLGIALALVLPPIYQASTVLLPPDESRGLFGHSMSSLDVIAGAAMGIEMKTPGELY
FT                   VALLKSTSIEDGLIRQFDLRKRYRVDTMHAARKALQSRVNITIDKKSGLLTIAADDTDP
FT                   AVAAELANAHVAALAKLLERIAVTQAQQRRAFLEKEVAKARIALANAQDAYVKLQAKSG
FT                   IVSVDADTQLAIRHSAEIRSLLAAKQIELSSLGTYATAENPQVKRIEAEVSTLKAQLEK
FT                   IENGDAASLRGSDAGMATLRSYREMKYQESVVDVLSRQLELARVDEAKSGPLVQQVDVA
FT                   APPERKAKPSRLLILLASVAGGFVLAVTAVIGRAFGRQAVERARRSGDLARLRHAWTIT
FT                   FKRTRS"
FT   gene            634870..635676
FT                   /gene="rfbF"
FT                   /locus_tag="BURPS668_A0662"
FT   CDS_pept        634870..635676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbF"
FT                   /locus_tag="BURPS668_A0662"
FT                   /product="glucose-1-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.33"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR02623"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87160"
FT                   /db_xref="GOA:A3NH40"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR013446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH40"
FT                   /protein_id="ABN87160.1"
FT                   /translation="MDDNFQEDAIVKAVILAGGFGTRFTEETISRPKPMIEIGGKPILW
FT                   HILKLYSHHGINEFIICCGYRGYVIKEYFANYFLHMSDVTFDVQKNSMEVHYRYSEPWR
FT                   VTLVDTGETTMTGGRIRRVRQYVEGDDMFCLTYGDGLCDVDLGRLIAFHREHGGKATLT
FT                   AVHPPARFGVLDIGADRQVVDFTEKPRIDGGMINGGFFVLSPSVIDLIDGDATVWEREP
FT                   LERLARANELKAYPHDGFWQCMDTLRDKLLLDSMWATGTAPWKKWS"
FT   gene            635667..636752
FT                   /gene="rfbG"
FT                   /locus_tag="BURPS668_A0663"
FT   CDS_pept        635667..636752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbG"
FT                   /locus_tag="BURPS668_A0663"
FT                   /product="CDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.45"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF07993;
FT                   match to protein family HMM TIGR02622"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88267"
FT                   /db_xref="GOA:A3NH41"
FT                   /db_xref="InterPro:IPR013445"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH41"
FT                   /protein_id="ABN88267.1"
FT                   /translation="MELTMHAPDARFWQARRVLVTGHTGFKGSWLSLWLQSLGAQVHGL
FT                   ALEPPSRPSLFETARVAQRMSSTIGDIRDYDVVRRTIADCRPEVVIHLAAQPLVRASYA
FT                   DPLSTYGTNVMGTANLLEALRRAGCARAVVNVTTDKCYENRDWLWGYRENDALGGHDPY
FT                   SSSKACSELVSSAYRRSFFAQGATALASARAGNVIGGGDWAAERLVPDVLAAFASGRPA
FT                   VIRHPHAVRPWQHVLDSLSGYLRLAERLHADGQAWAEAWNFGPDDAQARTVEWVVSRMA
FT                   RIWGGDARWHPDSADHPHEAAQLKLDSSKAKARLGWRPRWSLARALECTIAWHRAWLAR
FT                   EDMRAVCIEQIAEFDTSPDPT"
FT   gene            636760..638112
FT                   /gene="rfbH"
FT                   /locus_tag="BURPS668_A0664"
FT   CDS_pept        636760..638112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbH"
FT                   /locus_tag="BURPS668_A0664"
FT                   /product="lipopolysaccharide biosynthesis protein rfbH"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85349"
FT                   /db_xref="GOA:A3NH42"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH42"
FT                   /protein_id="ABN85349.1"
FT                   /translation="MDIIRPTFAPDAARSPDAIRAEIAALVREYANATQARAPFVPGRT
FT                   PVPVSGKVIGAPELQHMVDASLDGWLTTGRFNTAFENRLARYLGVTHVITVNSGSSANL
FT                   VAFSTLTSDRLGERAIRPGDEVIGVAAGFPTTVNPILQFGAVPVFVDIELGTYNVDATK
FT                   LEAAISPRTRAIMLAHCLGNPFNVEAVTSLCRKYGLWLIEDCCDALGARYDGRLVGTFG
FT                   DIATLSFYPAHHITMGEGGAVFTNNDELARIAESFRDWGRDCYCAPGADNTCGKRFCWQ
FT                   LGELPRGYDHKYTYSHCGYNLKITDMQAACALAQMDRVDGFIERRRGNFAYLKERLSSC
FT                   DAFLHLPQATFNSNPSWFGFPLTLREDTGVARVDLLDYLSQGGVGTRLLFAGNLTRQPY
FT                   MRHRRYRVSGELAVTDAVMERTFWIGVFPGLDEAMLDYACTKIETFLGINF"
FT   gene            638138..639898
FT                   /locus_tag="BURPS668_A0666"
FT   CDS_pept        638138..639898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0666"
FT                   /product="aminotransferase, DegT/DnrJ/EryC1/StrS family"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF01041; match to protein
FT                   family HMM PF01053; match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87175"
FT                   /db_xref="GOA:A3NH43"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH43"
FT                   /protein_id="ABN87175.1"
FT                   /translation="MNVYKKALVANFRFLKASRDVRDAYLRAIPVADAGFLVPIGESRL
FT                   DDADLLAKLTRWRNEHVHVYPTQFEATVDSTRAWLKERLLATDDRILFLVEDRHGRAVG
FT                   HIGFNGCLNDERLFEIDNVVRGDAAGAKGLFSLALQALIEWARTTSNVEGFFLRVMDDN
FT                   PRAIAFYARNGFAEERRIPLVGERRGETLSYREARDGEAAHKHFVRMAYRRTHEAGRSM
FT                   ILTAGPSISAREAVYAHDAAAHGWNRNWSKYLTSFEAAFADYVGVKHAIATSSCTGALQ
FT                   ISLMALGIGAGDEVIVPDLTWVATANAVRYVGATPVFADIELDSWNLDARSLDALITPQ
FT                   TKAVIAVHMYGHPARMDAILEVAGRHGLKVIEDAAPAIGAEWRGRRCGSFGDFAAFSFQ
FT                   GAKLLVTGEGGMLATDDDALYEKALKIWDQGRNPSRTFWIDGDGVKFKMSNVQAAVGLG
FT                   QLERADELIEMKRRIFDWYDEGLAGAPGIALNREIPDARSIYWMTSLRLDESAPIGRDD
FT                   LMKALKARNVDTRPVFPAISRYPIWSRRQPPQPTASRVGQQAMNLPSGVCLSKDDVFYV
FT                   CRQVRDLLGA"
FT   gene            complement(639859..640029)
FT                   /locus_tag="BURPS668_A0665"
FT   CDS_pept        complement(639859..640029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0665"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86267"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH44"
FT                   /protein_id="ABN86267.1"
FT                   /translation="MHGASPYTGIAGPATDRARAARGARTRSTCTRARRTSARQCVIDH
FT                   APSRSRTCRHT"
FT   gene            640024..641502
FT                   /locus_tag="BURPS668_A0667"
FT   CDS_pept        640024..641502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0667"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88447"
FT                   /db_xref="GOA:A3NH45"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH45"
FT                   /protein_id="ABN88447.1"
FT                   /translation="MHPRRRPPIVRRGGRDRYDRYDRRSPAAVGPRRRPLRAAPAMKAF
FT                   AAALGRLWHLGGIDLPVAVTLLARTWAIASGLVTVLLIARCLSPELQGYYYTFNSLVAM
FT                   QIFAELGMNTVLVQCISHEMAELRIVGGRIAGERRTKARLKSLLTFGVAWCGGAACVFV
FT                   AILLPGGWLFFGASAPRAPDIALAWGLFVVLTGVMLVLNGLLAFLEGCGQIGQVAAVRL
FT                   AQAIGSSLGIWALLGARAQLLSFAGGLAIGCLIAAAALLARYRRLIVDLLRVNDAAGAV
FT                   RWRTEIWPLQWRIAVSWASGYLIFNLFNPLLFATHGAVAAGRFGMSLQIVTALNSVGMA
FT                   WITTKVPQFCRLIARRQRARLDELFRTTLRQSLFFLAAGGVLAVLVAALARAYAPWLGN
FT                   RLVPVALFAALCVVCLANHVVFAEAAYLRAHKQEPFMIVSVANGLATALAAWALIPRWG
FT                   AQGAVLAYAIGSVGVGFVGGTFVFVRKRAEFSAS"
FT   gene            641517..642560
FT                   /locus_tag="BURPS668_A0668"
FT   CDS_pept        641517..642560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0668"
FT                   /product="glycosyltransferase, group 2 family"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85858"
FT                   /db_xref="GOA:A3NH46"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH46"
FT                   /protein_id="ABN85858.1"
FT                   /translation="MLLTIAIPTHNRVSCLRLLVDSLLAQIAQAERRGDRVAILIADNA
FT                   STDGTGEYLESLAASRFVTIHRHAHNRGAAANVVHCFRHASSRYVWIIGDDDLPLPGAV
FT                   DAVLRHLACAAPDLFLLAARWVPENLEAAARACGKPGRAKRVDRIDLSLKASVMTTFIS
FT                   SWVVNREAYLHHYGDAGIDRFGDTLFPQLAWVFGLMRSGARFLSADGPWLLARAGNSGN
FT                   YAVFDTFSHQYNRIVDQSFAEAGWLRDFHRQNILWNFIPGLVWSVRTERAGRFEPFDAA
FT                   AVEKVLSSAYAGSRFYARIVLPMITRRAGVAKWYWVLARILRRARVCWIFACASTRRRL
FT                   AMKSGVD"
FT   gene            642733..643989
FT                   /locus_tag="BURPS668_A0669"
FT   CDS_pept        642733..643989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0669"
FT                   /product="heptosyltransferase"
FT                   /note="identified by match to protein family HMM PF01075"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86607"
FT                   /db_xref="GOA:A3NH47"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH47"
FT                   /protein_id="ABN86607.1"
FT                   /translation="MADERAAKRWPARGEDMKILFIKLSALGDVLASTPLFASTKAEHP
FT                   DWFVGHVVARPYAAATRNNAHVDAQFIVDSPLSGGAIRKIRVAARIWRYMMRERYDIAV
FT                   VLHRSFVLQLICRLASVRKTIGYESRFSFLLSHSIPFSMQGNRSGLELRLLKSAGIIHD
FT                   EKKKLRFDIDFGNVDRNRLRALPAAFIAVNAGGGNADAQAANKLWPAERYGALIKRLPL
FT                   PVVMLGHGAADEDIRDRVAATGARFVDMVGKTNLDETAVILERSRLYVGNDSALLYLAA
FT                   SLGVTTIGIYGPTDPAAFSPLGANNLWLSGKTSCAPCYSSFDGIGGRMYTCTNNICMQA
FT                   VTVESVSERIHAALHQDQNLQAAGPDVVGSGQGRAASETRARADTDARADHQALGDGGF
FT                   AVPLSHRSATGARVPGGDD"
FT   gene            643853..644950
FT                   /locus_tag="BURPS668_A0670"
FT   CDS_pept        643853..644950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0670"
FT                   /product="ADP-heptose:LPS heptosyltransferase"
FT                   /note="identified by match to protein family HMM PF01075"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88072"
FT                   /db_xref="GOA:A3NH48"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH48"
FT                   /protein_id="ABN88072.1"
FT                   /translation="MPHPKRALGRTPTRVLIIKLSAMGDSLCLFPTVRQLALAFPGATI
FT                   DWLTSNRSNPALFAELPFIRTIFVTPPSLVRALTYLGGWLFRARRYDLTIDYDQYYCIS
FT                   ELIAGMSACSAGFRTSLKGTTFSLSVEYDPLLNEKAMFRKLTERVFATYGVSIPDYRAE
FT                   LPELIERFVPSAQLQTLRARLKAQGKPIVGIYPGSGANATFRRWGVGNYVALIERYKDR
FT                   YAFVLLGGPDERDLQADLKDIDGVFNLIDSMSLKEVAWFLKHTIDLLVGNDGGLLHVAE
FT                   SQAVATVGIFGPALYRKWGSSLERSIGVEKELPCRPCLKNYLGTVPSACCLGTTACLSA
FT                   ISTDDVAQAMHRAVHRIHVVPIAHA"
FT   gene            644943..645512
FT                   /locus_tag="BURPS668_A0671"
FT   CDS_pept        644943..645512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0671"
FT                   /product="putative lipopolysaccharide biosynthesis O-acetyl
FT                   transferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by similarity to SP:P37750; match to
FT                   protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85677"
FT                   /db_xref="GOA:A3NH49"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH49"
FT                   /protein_id="ABN85677.1"
FT                   /translation="MLERLFFLFHRVGRVARARMWRIAGQPAFARRGRASKIFGWRAIR
FT                   VGKRATIGDACWIQAVERYGGQSFRPSISIGDDVHLSDAVHISAVSSIEIGNGCLLGSR
FT                   IYIGDHAHGDSADGAHRAMSPARRPLARVEPIRIGDDCWICDGAVILAGTRLAPGCIVA
FT                   ANAVVRLTADAACVIAGNPATIVKRL"
FT   gene            645524..646570
FT                   /locus_tag="BURPS668_A0672"
FT   CDS_pept        645524..646570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0672"
FT                   /product="glycosyltransferase, group 2 family"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86357"
FT                   /db_xref="GOA:A3NH50"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH50"
FT                   /protein_id="ABN86357.1"
FT                   /translation="MPISITVGVPAYARPDELRELIESVLACDPPPDELLICEDASPQR
FT                   DAIRQIVYAQRLALARSGCRLRYVENERNLGYDGNLRMLIAQASGDYLMLLGDDDQLYS
FT                   NAIAETRRYVGAHPEVRFVSRTYRRFSGHRDRGVLNETWLAKSDAVFDRGNSSPALIFR
FT                   LCGFVGGLVVKTDWARELATSRYDGSLYYQYYLACHAYFGAGIGYIGKAIVAGRAQNPP
FT                   LFGHAAAEAGVHVPGAYRPAARARMWRGVLDISADVERALGVPLVGAVMREMAGRQSFH
FT                   IFEMMPAQGRRATLELFVELRKLGLVRSPLPWLLASFVLTFGAAAASGFRMLRRLQFAV
FT                   ERGLRIKC"
FT   gene            646574..647623
FT                   /locus_tag="BURPS668_A0673"
FT   CDS_pept        646574..647623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0673"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87117"
FT                   /db_xref="GOA:A3NH51"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH51"
FT                   /protein_id="ABN87117.1"
FT                   /translation="MFFCYVLFLIFYWSPAIVLQWGTYGMFDDAVPMWYKALRLIVPAY
FT                   GLVVLARQPCYTPAHLLYFVFGAWCVLVSGDLATSVNVLVFCATLVIMKGVRIDAAALR
FT                   RVILAALPFVYGMGLLEVFGVFVSAHTYGSELRVVSTFGGPNNAGIIFSSWALYFIIEF
FT                   RNARRLRDLGHAAACVSFVVLTGSLSAAVALAVCAFVLNAYLIVPAVLVVVPTFLINDF
FT                   FMLKLSYLMATLNGQGETTGSFSDRVENVATIARVAGDNVVNLIVGSGLHSESDYLSVL
FT                   GQFGVVGLILFICVLLTLPRSLFMLLGLLQSLVTPFFFSFPSFPLIALLAAGEVAAEAR
FT                   KRAPRPAPG"
FT   gene            647620..647751
FT                   /locus_tag="BURPS668_A0674"
FT   CDS_pept        647620..647751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0674"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85668"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH52"
FT                   /protein_id="ABN85668.1"
FT                   /translation="MTRDRPNVAEEAPHASEQGRAGGIACRHGRAWLLAVRGAWRAA"
FT   gene            647819..648001
FT                   /locus_tag="BURPS668_A0675"
FT   CDS_pept        647819..648001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0675"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86338"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH53"
FT                   /protein_id="ABN86338.1"
FT                   /translation="MLAMRGAGRRLAPMRAESARRIPGMNADEPGRVPTSADECRRAPT
FT                   STDERRRAPTSTDER"
FT   gene            complement(648055..648249)
FT                   /locus_tag="BURPS668_A0676"
FT   CDS_pept        complement(648055..648249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0676"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86813"
FT                   /db_xref="InterPro:IPR012550"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH54"
FT                   /protein_id="ABN86813.1"
FT                   /translation="MPRRLANAHVRVVARVERKADESPYGACGDKQHTLGRMIRLDTSS
FT                   PYANAHARLREWKRAGGLA"
FT   gene            complement(648641..649540)
FT                   /locus_tag="BURPS668_A0677"
FT   CDS_pept        complement(648641..649540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0677"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85621"
FT                   /db_xref="GOA:A3NH55"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH55"
FT                   /protein_id="ABN85621.1"
FT                   /translation="MQFDDLRIFVATVEAGSFTGAADKLLLSKQFVSRRVMALEASLGV
FT                   RLLVRNTRKLAVTELGHELHARATRILADIAETEEAMSARRGDLRGTLKISAPMSFGIA
FT                   HLSPLIAEFLVRHPAVRLHVELSDRHVDLIGEGFDLALRIGALPDSTLIARRLGELRMV
FT                   ACCSPAYRRKHGAPATPADLHGRACLLYGQEGRTGWEFMIDGARRTFEVQGALLANNGD
FT                   VVRDAAVAGLGIALLPHFIVAHALDTGRLVAVLEPFAQAPLPINAVYPQHRQDMAACRT
FT                   FLGFIEERLRERFAKPRR"
FT   gene            649670..650395
FT                   /locus_tag="BURPS668_A0678"
FT   CDS_pept        649670..650395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0678"
FT                   /product="cupin domain protein"
FT                   /note="identified by match to protein family HMM PF02678;
FT                   match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87005"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH56"
FT                   /protein_id="ABN87005.1"
FT                   /translation="MIEVRAANQRGRAEHGWLSSRHTFSFAEYYDPAQVGFSDLLVIND
FT                   DRVAPGRGFGMHPHRDMEILSYVLEGALEHRDTMGTGSVIVPGDVQLMSAGKGIAHSEF
FT                   NHAADRPVHFLQIWIGPSVRGVEPRYQQASVSDDDKRGRLRLIVSPQGQDGSLKIRQDA
FT                   RVYAGLFDGDASERFALPPRRFAYLHVARGSVTVNGVELHEGDGARIRDEQALQIANGK
FT                   QAEVLLFDLRPIEVTAEWA"
FT   gene            650730..651410
FT                   /locus_tag="BURPS668_A0679"
FT   CDS_pept        650730..651410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0679"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06912"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86373"
FT                   /db_xref="GOA:A3NH57"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH57"
FT                   /protein_id="ABN86373.1"
FT                   /translation="MKPNLPSLLTFNGGYVDTAGFLALQGLFTAHVTGNFVTLGATLVA
FT                   GSTGAIAKLLALPVFCGVVLAAGVARRLMLRAHAPALKILLGAQWLLLVAGAALAIRLG
FT                   PFANGDAWPAIATGMALVMAMAIQNAVHRLHLPDALPTTLMTGTVTQLMLHLSERIAGD
FT                   AAPVRGSPARLANMAWTVVTFALGCAAAALAYLLGGAWAFALPPVLIAFALFLGDERKL
FT                   EHAL"
FT   gene            complement(651440..652720)
FT                   /locus_tag="BURPS668_A0680"
FT   CDS_pept        complement(651440..652720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0680"
FT                   /product="putative cyclic nucleotide regulated pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00027;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86839"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH58"
FT                   /protein_id="ABN86839.1"
FT                   /translation="MSFLQKRRRRSFLACCHSRVKRASSSHFAPSHTSCGQSSEEPSRP
FT                   PVLEKSVGCAQTPDTATRPPAHRASGRRAHSSMNHLRNLLGHLKHTDDFAAYRLPHDLI
FT                   ERACRYGSLVRVERGATLCASGARSDALYVVLDGATRCLPHARLPLPCGIDHGPGTFTG
FT                   ELDLLNDVGCEVTVVASSACRLARIERATLRHLLRREPALRDVLVRVFLLRRIGALASD
FT                   AADTPLRERGAEPAFDVAIVGSGAAGMITAAHAASLRLNTVVAEGRLPFGIDDEFASAA
FT                   PPASPAPPARRQFGPFLTLRDHTVRLDCDAYPFRLVTHGGERLRAHAVVIASSLRPEYS
FT                   PRRARVTLRANTEWLDGAVDVDDDGFVRTGRAASGTTLAAAFESSQPGVFAIGAVRAGP
FT                   RRSALGELTEGAVVVDAIRRFIRASAV"
FT   gene            652828..653748
FT                   /locus_tag="BURPS668_A0681"
FT   CDS_pept        652828..653748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0681"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86025"
FT                   /db_xref="GOA:A3NH59"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH59"
FT                   /protein_id="ABN86025.1"
FT                   /translation="MNCTDLAPTSLREAFRGATIETIDARVEGYASVVLTRVRHAAHGF
FT                   GFVEFMPPADGYLVGMSLTPPAARAPRAAPDAAADADADAPHRAACVAVQILQDDEPFR
FT                   ADLLQPFDMLFHALPRRTLAELAADLRMGGVRELASPAGGCDAVLQSLVGVLLAASAGS
FT                   SARSPLLAGHVARAMQIHIVQQYGVAAPSTPAKGGLAGWQLERAKAILTENIAGEVPIS
FT                   QVASACGLSRSYFIKAFRQTVGTTPHRWLLEHKIERVKRSLLSQSAPIADIAHQCGFSD
FT                   QAHLTRVFTSMIGTPPAAWRRVNRP"
FT   gene            complement(653807..654709)
FT                   /locus_tag="BURPS668_A0682"
FT   CDS_pept        complement(653807..654709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0682"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87705"
FT                   /db_xref="GOA:A3NH60"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH60"
FT                   /protein_id="ABN87705.1"
FT                   /translation="MSSPARHSPPQTITKDSLGCTSSGFLTDIERETALLRFYRKHTTG
FT                   LRLEQVSTPASGRGVLIGISLSGGHRRKILRGRRSVTHDFRADSVYVRDFSEDYRADMM
FT                   SDFDFALVELSPSFIDGLAERGRPARIAGVAPTLAHDDRLLGELGRALALALQSGDAAD
FT                   AMLVDQLGIAIGTHAMHAYGGLRADEPKQRRRLSAPLERRAKEMLAAGATSVDEIARAC
FT                   RVSRGYFINAFSATTGKTPHQWLIEQRIEAAKHLLAHGDWTLARIAEHCGFSSQSHFTQ
FT                   SFAKAIGLPPGAWRRRARA"
FT   gene            complement(654706..655062)
FT                   /locus_tag="BURPS668_A0683"
FT   CDS_pept        complement(654706..655062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0683"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86811"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH61"
FT                   /protein_id="ABN86811.1"
FT                   /translation="MSRFARCIACMAEPARCPYNPPVTLGKLRHAPPPRIPARSGKRRA
FT                   AAACARRPRTLAGRAGAAPGTRRHDLPAPQTGTVRKPRHMRLRAASADAARRRMPRAGE
FT                   RSRHVPPTASGTVP"
FT   gene            complement(655059..656261)
FT                   /locus_tag="BURPS668_A0684"
FT   CDS_pept        complement(655059..656261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0684"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85839"
FT                   /db_xref="GOA:A3NH62"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH62"
FT                   /protein_id="ABN85839.1"
FT                   /translation="MNANLASSATAGPVPQMARGLILLFAFSCGAIVANLYYAQPIIAL
FT                   IAPDLHMSGGMASLIVSLTQIGYAAGLFFLVPLGDLVENKKLMVVTALTSIASLALAAT
FT                   VRAPGLFLAVSLIVGFSSVAVQLLIPLAAHLAPSESRGRVVGTIMSGLLLGILLSRPVA
FT                   SFIADHFGWRAVFAFGAATMAVVTVLLMLTVPSRRPAHQATYMQLIRSLGRLVATQPAL
FT                   RERSLYQGLMFGSFSLFWSAAPVELMHRHHLSQSAIALFSLVGAMGASSAPIAGRLADA
FT                   GHTGRATVVALGLAAASFAPALFVPGAGVAGLVATSILLDFAVQMNMVLGQREIYALDA
FT                   HSRNRLNSIYMTSIFVGGAIGSALASALYEHGGWTWIAIVGALFPLAALARFAFASRAA
FT                   R"
FT   gene            complement(656258..656560)
FT                   /locus_tag="BURPS668_A0685"
FT   CDS_pept        complement(656258..656560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0685"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88183"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH63"
FT                   /protein_id="ABN88183.1"
FT                   /translation="MSSIAIQITHDFTCPWCARGEARERRGIARSGVRVPLIVTSRAFE
FT                   VDPARPREGADRLAHRMRRLGSRARAQRADAAARPIRRPARGGRANPMTFTASTR"
FT   gene            656667..657578
FT                   /locus_tag="BURPS668_A0686"
FT   CDS_pept        656667..657578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0686"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86450"
FT                   /db_xref="GOA:A3NH64"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH64"
FT                   /protein_id="ABN86450.1"
FT                   /translation="MDKLLALQTFAVVADTGGFSKAARQLGTATSSVTRLMDALEASLG
FT                   VTLLTRTTRHVTLTDAGATYLEQVGALLSQLVEADESVADAGGEPVGTLRVSVPVTYAR
FT                   IVLGPHLSAFLDAYPRVSLDLAVSDAYLDLATDRIDVAVRIGAPSRDPGLVVRGLAPNR
FT                   RIVVASRDYLDRMGTPAAPGDLAAHRCLRFPYRQGRQSWTFSRDGHSEKIDVGGRLTAN
FT                   SLDILREGVLSGQGVALVPMWLVHDDIVAGRLLPLFESWRVTPPGGDAQVYAAYLPNRR
FT                   HSRKVQTFIAFLAQRMPGAPGR"
FT   gene            complement(657851..658705)
FT                   /locus_tag="BURPS668_A0687"
FT   CDS_pept        complement(657851..658705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0687"
FT                   /product="hydrolase, isochorismatase family"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86388"
FT                   /db_xref="GOA:A3NH65"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH65"
FT                   /protein_id="ABN86388.1"
FT                   /translation="MRRISAPAAGMRSVPPAPGAPRDALASDARRWARLPRSPRTSFVN
FT                   PALNGVTPETVMSDPKLEVLTPHNSQLIFIDQQPQMAFGVQSIDRQTLKNNVVGLAKAA
FT                   KIFNVPTTITTVESESFSGFTYPELLDVYPDHKLLERSSMNSWDDQKVRDALKANGRRK
FT                   VVVSGLWTEVCNTTFALCAMAEGGYEIYMVADASGGTSKDAHDYAMQRMIQAGVVPVTW
FT                   QQVLLEWQRDWAHRDTYDAVMSLVKEHSGAYGMGVDYAYTMVHKAAQRTANAHDMLAPV
FT                   PAR"
FT   gene            658797..659378
FT                   /locus_tag="BURPS668_A0688"
FT   CDS_pept        658797..659378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0688"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07235;
FT                   match to protein family HMM TIGR03510"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87106"
FT                   /db_xref="GOA:A3NH66"
FT                   /db_xref="InterPro:IPR009872"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH66"
FT                   /protein_id="ABN87106.1"
FT                   /translation="MGFARSRAGAAIAAEADVAAPSHRTTSRRLARASEARRIAIVQNA
FT                   RQTFNTGACANAIVRRVGSRRARPVRAARFADTDRPAISFGSLIMKVYVLSLAMGLLVG
FT                   VIYGVFNVRSPAPPVIALVGLLGILAGEQVPPLVKRLAGRAETSTTWFQHQVKPHMFGQ
FT                   LPSCPKAPDAPAQVAAARPPASRSGDTHHG"
FT   gene            659371..661269
FT                   /locus_tag="BURPS668_A0689"
FT   CDS_pept        659371..661269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0689"
FT                   /product="metal-dependent hydrolase"
FT                   /note="identified by match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87890"
FT                   /db_xref="GOA:A3NH67"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH67"
FT                   /protein_id="ABN87890.1"
FT                   /translation="MADTAARSTPDLILHRGRFTTLDRAHPLASAVAIKDGRFVAVGGD
FT                   EILASAGPATRIVDLQGKGVLPGLIDNHLHIIRGGLNFNMELRWDGVRSLADAMAMLRR
FT                   QVAVTPAPQWVRVVGGFTEHQFAEKRLPTIDELNAAAPDTPVFILHLYDRALLNGAALR
FT                   AVGYTKDTPEPPGGQIVRDAAGNPTGLLLARPNAAILYATLAKGPKLPFDYQLNSTRHF
FT                   MRELNRLGVTGAIDAGGGFQNYPDDYAVIERLAKDGQLTIRLAYNLFTQKPKEEKQDFL
FT                   NWTASSTYHDGTDYFRHNGAGEMLVFSAADFEDFREPRPDLPAQMEGELEAVVRVLAQN
FT                   RWPWRLHATYDETIRRALDVFERVNRDIPLAGLNWFFDHAETISDESIDRIAALGGGIA
FT                   VQHRMAYQGEYFVERYGAAAAEATPPVARMLERGVNVSAGTDATRVASYNPWVSLAWLV
FT                   TGKTVGGMSLYPRANCIDRETALRMWTEHVTWFSNEVGKKGRIQVGQLADLIVPDRDFF
FT                   ACPESDIADTTSLLTVVGGKVVYGAGPFADLDEGAPPPAMPDWSPARTFGGYAGWADRE
FT                   GGAPLQQVVRQAAQSCACANSCGVHAHRHASAWGSPLPVADLKSFWGALGCSCWAV"
FT   gene            661266..661634
FT                   /locus_tag="BURPS668_A0690"
FT   CDS_pept        661266..661634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0690"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86330"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH68"
FT                   /protein_id="ABN86330.1"
FT                   /translation="MTAGGARRGARVARVARRSSSVAWRTAYRASRMQLARLRRMGATM
FT                   RERALARRRAHRDGGRVLLAGFACMHAMRSFARVRAIRASTSGFSKRTRSESRTGRRRC
FT                   SARSARTCSTAGSRTTGG"
FT   gene            661778..662704
FT                   /locus_tag="BURPS668_A0691"
FT   CDS_pept        661778..662704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87367"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH69"
FT                   /protein_id="ABN87367.1"
FT                   /translation="MAVRSALWGAALMFGLAQAPAAFADAAAEASAPARAAASAPAVSV
FT                   GPQYDTTHVYVAASDLDAFVDSFVATFGGKASPRVTLTVTPTPSETLSQYVQTPVGMLS
FT                   VFGFKTPVPYPFGAERTGYLVTDLDAAVKAARAAGADLVVDSFDDPIGRDAVVRWPGGV
FT                   MMQLYWHRKAPSYAPLATVPDNRVYLSPYEADRFVTSWVRFSHGKVVADDRRGDGGAIG
FT                   RPGTDVRRIVIESGFGRVVAFVTDGKLPYPYGRETTGYAVADLDAVLDKAKAAGVEVLA
FT                   PPYRTRAGRTAMLAFPGGYLAEVHDAK"
FT   gene            662701..664362
FT                   /locus_tag="BURPS668_A0692"
FT   CDS_pept        662701..664362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0692"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85779"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH70"
FT                   /protein_id="ABN85779.1"
FT                   /translation="MIARRAVALGGWALMSVLAAARAHAADAMDAPGAAAAAAAPGSRF
FT                   ARVPATSESAPSSAFEFASPAASASALAVVPMSALTLASAPAPAPAPSAAPSPSPTSPP
FT                   VQPGVRPGASCAKTRPATLFNRWQEDWSALADPCVPRRPLDALKYVPLFGRVDSYLSLG
FT                   AGLRERLEVNDAPLFGLGRARGDTYVLQRVQVHADLRIAGHVQAFVQLEDARPFGKDNV
FT                   GPVDRNRVDLRQAFVTYVDAIGSGAFKARVGRQEMAFDLQRFVSVRDGPNVRQAFDGIW
FT                   ADWEQGPWRLIGYATQPVQYRDDGAFDDVSNRNLTFSGVRIERQRVGPGDLSAYYSRYN
FT                   RTQAQFPDGAGGEHRDVFDVRYAGKRRNVDWDIEGMYQTGRVGAQRIEAWAVGSLAGYT
FT                   FAGVGWMPRIGLQVDAASGDRRPRDGRIETFNPLFPNGYYFALAGYTGYTNLIHVKPSL
FT                   TLKPSSALTLLAAVGLQWRATTADAVYAQGATPVPGTAGRGGNWTGFYTQLRADWAVTA
FT                   NLAAALEVVHFQIGDALRAAGGRNADYVGAELKFGW"
FT   gene            complement(664436..664840)
FT                   /locus_tag="BURPS668_A0693"
FT   CDS_pept        complement(664436..664840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0693"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86694"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH71"
FT                   /protein_id="ABN86694.1"
FT                   /translation="MVLRHRRTAPRRRTPNAGRTAMRDAPSGTRHAAHNAGAADAPAHG
FT                   APASRPNNTAARCDRASRARLRITHRGRPSQPRIAAITRFTAGARTPAGRRRFEQAPAR
FT                   SATLRPDAARLAPPSRAGRPLANSPAESAD"
FT   gene            664928..665749
FT                   /locus_tag="BURPS668_A0694"
FT   CDS_pept        664928..665749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0694"
FT                   /product="Non-heme chloroperoxidase"
FT                   /EC_number="1.11.1.10"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86653"
FT                   /db_xref="GOA:A3NH72"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH72"
FT                   /protein_id="ABN86653.1"
FT                   /translation="MDTITTKDGTRIFYKDWGAGRPVVFSHGWPLNADAWDAQMLFLAQ
FT                   RGYRAIAHDRRGHGRSGQPAMGNDMDTYADDLAALLDALDLREATLVGHSTGGGEVARY
FT                   IGRHGSKRVAKAVLIGAVPPIMLQTEANPGGLPMEAFDGIRRGVAGNRSQFYRDVALPF
FT                   FGFNRPDAQVSQATIDAFWAQGMTGGILGQYACIREFSEVDYTADLKKIDVPTLILHGD
FT                   DDQMVPIDASARLSAKLVAGATLKVYPGGSHGICVTHADEVNADLLAFLES"
FT   gene            665814..666182
FT                   /locus_tag="BURPS668_A0695"
FT   CDS_pept        665814..666182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0695"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87588"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH73"
FT                   /protein_id="ABN87588.1"
FT                   /translation="MVRVGALEDSGLVARRVGAMAPCTCATPAYLQRYGVPETLDALDG
FT                   HVGVHYTSMNTGKARVWCFIDDGEPKTVAMKGAVSVNDADAYVAAVLAGLGLGKTSRYL
FT                   VEPHPRTGALRRVPSRFD"
FT   gene            666195..666308
FT                   /locus_tag="BURPS668_A0696"
FT   CDS_pept        666195..666308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0696"
FT                   /product="transcriptional regulator LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87839"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH74"
FT                   /protein_id="ABN87839.1"
FT                   /translation="MSILPLPNRNLPHKVRVFIEWLSARFERHDGLRPPVG"
FT   gene            666626..667255
FT                   /locus_tag="BURPS668_A0697"
FT   CDS_pept        666626..667255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0697"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86449"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH75"
FT                   /protein_id="ABN86449.1"
FT                   /translation="MKLLLVGSTGLVGRHVLELALADPRVDGVTALARRALPAHPKLRA
FT                   LRVDFDRLPEDAPWWRADAAICTLGTTMRAAGSRPAFRRVDHDYPLEVARIARRHGTPT
FT                   YVLNSALGADPSSRFFYNRVKGELERDLAGLGFASFTAVRPGLIGGQRDAFRAGERAAV
FT                   LALTLFGPLLPRGWRLNPAQRIAGALLDAALNPAPGLHVVASDQLV"
FT   gene            667297..667878
FT                   /locus_tag="BURPS668_A0698"
FT   CDS_pept        667297..667878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86266"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH76"
FT                   /protein_id="ABN86266.1"
FT                   /translation="MGPRFSAPRFSMLDARCSMLGTRCSAFDAQRSTPGARRAARGAWR
FT                   ANGRRGPAQPHAMRRTPYACSAKTAGERYPCVCGAPRIPSLAGGYRRTAATVAGMFRID
FT                   PLIRRSTPRRRRARGCGPGGFLRWRARPETANAGARQAGQPASVDIGTWTHRHIGTSAR
FT                   RRRPPRAAGAKARARRATSPRRQDFFTESE"
FT   gene            667875..668480
FT                   /locus_tag="BURPS668_A0699"
FT   CDS_pept        667875..668480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0699"
FT                   /product="flavin reductase family protein"
FT                   /note="identified by match to protein family HMM PF01613"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85971"
FT                   /db_xref="GOA:A3NH77"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH77"
FT                   /protein_id="ABN85971.1"
FT                   /translation="MNSHIAAVDLKKAYRLINHGPTVLVSAHHDGVDNVMAAAWACALD
FT                   FSPPKLTVVLDKAAKTRELIEQSGRFVIQVPTAAQLQLTQEVGSHSLASRPDKLRRAGV
FT                   ELFSIDGHDAPFVAGCSAWLACTLVREPHNQQAYDLFIGEVDAAWSDTRAFKNGRWQFE
FT                   QADPAWRSLHHVAGGHFYAIGEALSAREADRHDAEAAL"
FT   gene            complement(668617..668994)
FT                   /locus_tag="BURPS668_A0700"
FT   CDS_pept        complement(668617..668994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88305"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH78"
FT                   /protein_id="ABN88305.1"
FT                   /translation="MSSDILYTDSEISSSPSAFSTRFAYDSDWVAANNSINTSLIFKHN
FT                   LKCIPYPLCLFFSPDQEAVYPLIWNYYGPNAGNPVSIKLDQTKVTLSIGSGIPLHGYFD
FT                   PQTGGWTYWRSGFFRVTIPNQ"
FT   gene            complement(669329..670765)
FT                   /locus_tag="BURPS668_A0701"
FT   CDS_pept        complement(669329..670765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0701"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392; match to protein
FT                   family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87414"
FT                   /db_xref="GOA:A3NH79"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH79"
FT                   /protein_id="ABN87414.1"
FT                   /translation="MAICMMSSASWIDCDAASYDRESIQSNNCHGYIGMAHARYKRLVD
FT                   TLAADIRSGRLPPGARLPTHRKLAAAEGLALVTATRVYAELEAMGLVSGETGRGTFVRE
FT                   TALPRGLGVDQHASAAGVVDLAFNYPSLPEQAELLRGALRQLASSGDLDALLRYQPHGG
FT                   RWHERASVARHLARRGLSVDAQRVAIVNGTQHGLAVTAMALLRPGDVVAVDALTYPGFK
FT                   VVADAQHLELAPLPASGQGPDPDALERLCRTRRVRAVYTMPTLHNPLGWVTSAHRRRRL
FT                   VAIARRHGLLIIEDGAYAFLADDPPAPIAALAPEATVYVSGLSKNVATGLRVGFVAAPE
FT                   PWAPAIERAIRGTTWNTPGVMTAIACGWLDDGTVERLEADKRRDAAARQAIASEAFAGL
FT                   RCIRHPASYFVWLPLADDARADRVAMTLMRERVAVSTAEPFATSAHAPHAIRVALGSVD
FT                   PPTLRDALGKVRRAIDAHSY"
FT   gene            670752..671369
FT                   /locus_tag="BURPS668_A0702"
FT   CDS_pept        670752..671369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0702"
FT                   /product="DJ-1/PfpI family protein"
FT                   /note="identified by match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABN86535"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH80"
FT                   /protein_id="ABN86535.1"
FT                   /translation="MHIAILTFDGFNELDSLIALGVLNCVKKPGWRVSIASPTPRVCSM
FT                   NGVAIDAQASLREANDADAVLVGSGMRTREIVADAALLAQLRLDASRQLLGAQCSGTLV
FT                   LAKLGLLDGVPACTDLTTKPWVQEAGVDVLNRPFYANGNVATAGGCLASHYLAAWVIAR
FT                   LEGRQAAERALHYVAPVGEKEAYVSRAMAHVTPYLAVSATAA"
FT   gene            671544..671738
FT                   /locus_tag="BURPS668_A0704"
FT   CDS_pept        671544..671738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0704"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87801"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH81"
FT                   /protein_id="ABN87801.1"
FT                   /translation="MPRAALDCAARIRPGRARRNAPALKCTGASRETVRRGAWSDAGRR
FT                   LAAPTERPPPNPARFVNCR"
FT   gene            complement(671725..672777)
FT                   /locus_tag="BURPS668_A0703"
FT   CDS_pept        complement(671725..672777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0703"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /note="identified by match to protein family HMM PF00768"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88338"
FT                   /db_xref="GOA:A3NH82"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH82"
FT                   /protein_id="ABN88338.1"
FT                   /translation="MLPIVLASALAVPSFGAQARSSVSKRHAAAAASIRTASFHPQSGH
FT                   APLARHALASRHLKAGRYRLAGGVRRVAFSPRAPLGGRAFEPRDASQSFGLRSNIVYMV
FT                   DQHTGETLFDRNSRSVVPIASVTKLMTAMVVLDSNAPLDERIEVTDDDRDQDKFTGSRL
FT                   AIGSALSRDDMLHIALMASENRAAAALSRYYPGGREAFVDAMNRKARSLGMVDTYFENP
FT                   TGLSKHNVSSARDLAKMVEAAYQYPLIRQYSTDLKYDVDTGLRTLYYHSTNVLLRDNAW
FT                   NIGVQKTGYIKESGICLVMQTTIDGRDVVMVLLDSAGRHSDFFDAARLRTMLTSGAAHV
FT                   TEANSATSGN"
FT   gene            672671..672958
FT                   /locus_tag="BURPS668_A0705"
FT   CDS_pept        672671..672958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0705"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87038"
FT                   /db_xref="GOA:A3NH83"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH83"
FT                   /protein_id="ABN87038.1"
FT                   /translation="MRIDAAAAACRFDTDDRACAPNDGTASAEARTIGNTVRFDVRSTN
FT                   SHIAFNEENGIAFMTPLFISDAGFGTIIVMAYYVSNYNGIRNIPHPIYWI"
FT   gene            complement(672994..673272)
FT                   /locus_tag="BURPS668_A0706"
FT   CDS_pept        complement(672994..673272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0706"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87083"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH84"
FT                   /protein_id="ABN87083.1"
FT                   /translation="MPPQRRHETADAPAPPADAGVMAVSVSPRIPGGARGLAARRFLST
FT                   FSDGNKRQRRFRAAAQAPNPPLGFVERAAAGHGVCRRGATPPPPPAP"
FT   gene            complement(673275..673457)
FT                   /locus_tag="BURPS668_A0707"
FT   CDS_pept        complement(673275..673457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0707"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87709"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH85"
FT                   /protein_id="ABN87709.1"
FT                   /translation="MCRACESRTGASATALATGDGGAEHDATTIVSHGRRGHPRSRSRA
FT                   MNPPARRHSGMSNEK"
FT   gene            673676..673819
FT                   /locus_tag="BURPS668_A0709"
FT   CDS_pept        673676..673819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0709"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABN85851"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH86"
FT                   /protein_id="ABN85851.1"
FT                   /translation="MACRCLIQRNGGRRARLMLGTMMTGGAARCREPTGAFVRSRATRE
FT                   GL"
FT   gene            complement(673814..673939)
FT                   /locus_tag="BURPS668_A0708"
FT   CDS_pept        complement(673814..673939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0708"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABN88012"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH87"
FT                   /protein_id="ABN88012.1"
FT                   /translation="MDRHDRPRVTWRARRGSTARNGSVRRARASRALSLYLALPS"
FT   gene            673928..675856
FT                   /locus_tag="BURPS668_A0710"
FT   CDS_pept        673928..675856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS668_A0710"
FT                   /product="DNA polymerase X family protein"
FT                   /note="identified by match to protein family HMM PF02811"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS668_A0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABN87282"
FT                   /db_xref="GOA:A3NH88"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:A3NH88"
FT                   /protein_id="ABN87282.1"
FT                   /translation="MPIHNADFAAVFAEIADLLEIQGANPFRVRAYRNAARTIGGLGRD
FT                   IGALIAAGRSLDDIPTIGADLAGKLREIATTGTCALQRQLRGALPAALVELLGVPGLGA
FT                   KRVRALHDALGVETLEQLKTAAEHGKIRGLPGFGEKTEAHIAEAIGARLRRKSQRFLLS
FT                   FATQYLTPLLTYLRETPGVSEAVAAGSFRRRRESVGDLDIVVTSGDPAKVSARFVEYGE
FT                   VARVLASGDTRSSVVLRCGIQADLRVVSPAALGAALVYFTGSKAHNIAMRRIAQARDLK
FT                   INEYGVFDGERRIAGATEESVYASIGLAWVPPELRENRGEIEAAREGRLPALVERKHLR
FT                   GDLHAHTNATDGRDSLRDMALEARKRGLDYLAITDHARGPGVAHGLDAERLARQIDEID
FT                   RLNETLDGIVLLKGIEVDILEDGSLDLPDGVLARLDLVVGAVHGHFDLSRAAQTERVLR
FT                   AMDHPYFSILAHPSGRLLGERDACDIDLARVIEHARARGCHLELNAQPQRLDLADVWCR
FT                   HAAEAGVLVSIDSDAHRREDLGHLGIGVDQARRGWLTKAQVLNTRTLAQLRPLLARTMG
FT                   GGAMSVSASESASVPAPVSASKSASTSASTSASTGASRKRSSGKRDTAGSAEGGARRTK
FT