(data stored in ACNUC7421 zone)

EMBL: CP000577

ID   CP000577; SV 1; circular; genomic DNA; STD; PRO; 3147721 BP.
XX
AC   CP000577; AAMF01000000-AAMF01000020;
XX
PR   Project:PRJNA15754;
XX
DT   27-FEB-2007 (Rel. 90, Created)
DT   19-AUG-2018 (Rel. 137, Last updated, Version 8)
XX
DE   Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Rhodobacter sphaeroides ATCC 17029
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Rhodobacter.
XX
RN   [1]
RP   1-3147721
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Kiss H., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Richardson P.,
RA   Mackenzie C., Choudhary M., Donohue T.J., Kaplan S.;
RT   "Complete sequence of Chromosome1 of Rhodobacter sphaeroides ATCC 17029";
RL   Unpublished.
XX
RN   [2]
RP   1-3147721
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Kiss H., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Richardson P.,
RA   Mackenzie C., Choudhary M., Donohue T.J., Kaplan S.;
RT   ;
RL   Submitted (16-FEB-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 3bf4e19ae1b0dc18368a07ffc017fe1b.
DR   BioSample; SAMN02598340.
DR   EnsemblGenomes-Gn; EBG00001070249.
DR   EnsemblGenomes-Gn; EBG00001070250.
DR   EnsemblGenomes-Gn; EBG00001070251.
DR   EnsemblGenomes-Gn; EBG00001070252.
DR   EnsemblGenomes-Gn; EBG00001070253.
DR   EnsemblGenomes-Gn; EBG00001070254.
DR   EnsemblGenomes-Gn; EBG00001070255.
DR   EnsemblGenomes-Gn; EBG00001070256.
DR   EnsemblGenomes-Gn; EBG00001070257.
DR   EnsemblGenomes-Gn; EBG00001070258.
DR   EnsemblGenomes-Gn; EBG00001070259.
DR   EnsemblGenomes-Gn; EBG00001070260.
DR   EnsemblGenomes-Gn; EBG00001070261.
DR   EnsemblGenomes-Gn; EBG00001070262.
DR   EnsemblGenomes-Gn; EBG00001070263.
DR   EnsemblGenomes-Gn; EBG00001070264.
DR   EnsemblGenomes-Gn; EBG00001070265.
DR   EnsemblGenomes-Gn; EBG00001070266.
DR   EnsemblGenomes-Gn; EBG00001070267.
DR   EnsemblGenomes-Gn; EBG00001070268.
DR   EnsemblGenomes-Gn; EBG00001070269.
DR   EnsemblGenomes-Gn; EBG00001070270.
DR   EnsemblGenomes-Gn; EBG00001070271.
DR   EnsemblGenomes-Gn; EBG00001070272.
DR   EnsemblGenomes-Gn; EBG00001070273.
DR   EnsemblGenomes-Gn; EBG00001070274.
DR   EnsemblGenomes-Gn; EBG00001070275.
DR   EnsemblGenomes-Gn; EBG00001070276.
DR   EnsemblGenomes-Gn; EBG00001070277.
DR   EnsemblGenomes-Gn; EBG00001070278.
DR   EnsemblGenomes-Gn; EBG00001070279.
DR   EnsemblGenomes-Gn; EBG00001070280.
DR   EnsemblGenomes-Gn; EBG00001070281.
DR   EnsemblGenomes-Gn; EBG00001070282.
DR   EnsemblGenomes-Gn; EBG00001070283.
DR   EnsemblGenomes-Gn; EBG00001070284.
DR   EnsemblGenomes-Gn; EBG00001070285.
DR   EnsemblGenomes-Gn; EBG00001070286.
DR   EnsemblGenomes-Gn; EBG00001070287.
DR   EnsemblGenomes-Gn; EBG00001070288.
DR   EnsemblGenomes-Gn; EBG00001070289.
DR   EnsemblGenomes-Gn; EBG00001070290.
DR   EnsemblGenomes-Gn; EBG00001070291.
DR   EnsemblGenomes-Gn; EBG00001070292.
DR   EnsemblGenomes-Gn; EBG00001070293.
DR   EnsemblGenomes-Gn; EBG00001070294.
DR   EnsemblGenomes-Gn; EBG00001070295.
DR   EnsemblGenomes-Gn; EBG00001070296.
DR   EnsemblGenomes-Gn; Rsph17029_R0001.
DR   EnsemblGenomes-Gn; Rsph17029_R0002.
DR   EnsemblGenomes-Gn; Rsph17029_R0003.
DR   EnsemblGenomes-Gn; Rsph17029_R0004.
DR   EnsemblGenomes-Gn; Rsph17029_R0005.
DR   EnsemblGenomes-Gn; Rsph17029_R0006.
DR   EnsemblGenomes-Gn; Rsph17029_R0007.
DR   EnsemblGenomes-Gn; Rsph17029_R0008.
DR   EnsemblGenomes-Gn; Rsph17029_R0009.
DR   EnsemblGenomes-Gn; Rsph17029_R0010.
DR   EnsemblGenomes-Gn; Rsph17029_R0011.
DR   EnsemblGenomes-Gn; Rsph17029_R0012.
DR   EnsemblGenomes-Gn; Rsph17029_R0013.
DR   EnsemblGenomes-Gn; Rsph17029_R0014.
DR   EnsemblGenomes-Gn; Rsph17029_R0015.
DR   EnsemblGenomes-Gn; Rsph17029_R0016.
DR   EnsemblGenomes-Gn; Rsph17029_R0017.
DR   EnsemblGenomes-Gn; Rsph17029_R0018.
DR   EnsemblGenomes-Gn; Rsph17029_R0020.
DR   EnsemblGenomes-Gn; Rsph17029_R0021.
DR   EnsemblGenomes-Gn; Rsph17029_R0022.
DR   EnsemblGenomes-Gn; Rsph17029_R0023.
DR   EnsemblGenomes-Gn; Rsph17029_R0024.
DR   EnsemblGenomes-Gn; Rsph17029_R0025.
DR   EnsemblGenomes-Gn; Rsph17029_R0026.
DR   EnsemblGenomes-Gn; Rsph17029_R0027.
DR   EnsemblGenomes-Gn; Rsph17029_R0028.
DR   EnsemblGenomes-Gn; Rsph17029_R0029.
DR   EnsemblGenomes-Gn; Rsph17029_R0030.
DR   EnsemblGenomes-Gn; Rsph17029_R0031.
DR   EnsemblGenomes-Gn; Rsph17029_R0032.
DR   EnsemblGenomes-Gn; Rsph17029_R0034.
DR   EnsemblGenomes-Gn; Rsph17029_R0035.
DR   EnsemblGenomes-Gn; Rsph17029_R0036.
DR   EnsemblGenomes-Gn; Rsph17029_R0037.
DR   EnsemblGenomes-Gn; Rsph17029_R0038.
DR   EnsemblGenomes-Gn; Rsph17029_R0040.
DR   EnsemblGenomes-Gn; Rsph17029_R0041.
DR   EnsemblGenomes-Gn; Rsph17029_R0042.
DR   EnsemblGenomes-Gn; Rsph17029_R0043.
DR   EnsemblGenomes-Gn; Rsph17029_R0044.
DR   EnsemblGenomes-Gn; Rsph17029_R0045.
DR   EnsemblGenomes-Tr; EBT00001672669.
DR   EnsemblGenomes-Tr; EBT00001672671.
DR   EnsemblGenomes-Tr; EBT00001672673.
DR   EnsemblGenomes-Tr; EBT00001672675.
DR   EnsemblGenomes-Tr; EBT00001672677.
DR   EnsemblGenomes-Tr; EBT00001672678.
DR   EnsemblGenomes-Tr; EBT00001672679.
DR   EnsemblGenomes-Tr; EBT00001672680.
DR   EnsemblGenomes-Tr; EBT00001672681.
DR   EnsemblGenomes-Tr; EBT00001672682.
DR   EnsemblGenomes-Tr; EBT00001672683.
DR   EnsemblGenomes-Tr; EBT00001672684.
DR   EnsemblGenomes-Tr; EBT00001672686.
DR   EnsemblGenomes-Tr; EBT00001672687.
DR   EnsemblGenomes-Tr; EBT00001672688.
DR   EnsemblGenomes-Tr; EBT00001672689.
DR   EnsemblGenomes-Tr; EBT00001672690.
DR   EnsemblGenomes-Tr; EBT00001672691.
DR   EnsemblGenomes-Tr; EBT00001672692.
DR   EnsemblGenomes-Tr; EBT00001672693.
DR   EnsemblGenomes-Tr; EBT00001672694.
DR   EnsemblGenomes-Tr; EBT00001672695.
DR   EnsemblGenomes-Tr; EBT00001672696.
DR   EnsemblGenomes-Tr; EBT00001672697.
DR   EnsemblGenomes-Tr; EBT00001672698.
DR   EnsemblGenomes-Tr; EBT00001672699.
DR   EnsemblGenomes-Tr; EBT00001672701.
DR   EnsemblGenomes-Tr; EBT00001672702.
DR   EnsemblGenomes-Tr; EBT00001672703.
DR   EnsemblGenomes-Tr; EBT00001672704.
DR   EnsemblGenomes-Tr; EBT00001672705.
DR   EnsemblGenomes-Tr; EBT00001672706.
DR   EnsemblGenomes-Tr; EBT00001672707.
DR   EnsemblGenomes-Tr; EBT00001672708.
DR   EnsemblGenomes-Tr; EBT00001672709.
DR   EnsemblGenomes-Tr; EBT00001672710.
DR   EnsemblGenomes-Tr; EBT00001672711.
DR   EnsemblGenomes-Tr; EBT00001672712.
DR   EnsemblGenomes-Tr; EBT00001672713.
DR   EnsemblGenomes-Tr; EBT00001672714.
DR   EnsemblGenomes-Tr; EBT00001672715.
DR   EnsemblGenomes-Tr; EBT00001672716.
DR   EnsemblGenomes-Tr; EBT00001672717.
DR   EnsemblGenomes-Tr; EBT00001672718.
DR   EnsemblGenomes-Tr; EBT00001672719.
DR   EnsemblGenomes-Tr; EBT00001672720.
DR   EnsemblGenomes-Tr; EBT00001672721.
DR   EnsemblGenomes-Tr; EBT00001672722.
DR   EnsemblGenomes-Tr; Rsph17029_R0001-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0002-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0003-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0004-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0005-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0006-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0007-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0008-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0009-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0010-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0011-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0012-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0013-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0014-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0015-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0016-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0017-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0018-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0020-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0021-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0022-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0023-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0024-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0025-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0026-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0027-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0028-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0029-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0030-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0031-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0032-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0034-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0035-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0036-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0037-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0038-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0040-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0041-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0042-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0043-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0044-1.
DR   EnsemblGenomes-Tr; Rsph17029_R0045-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000577.
DR   SILVA-SSU; CP000577.
DR   StrainInfo; 99113; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC          http://www.rhodobacter.org
CC   JGI Project ID: 4000715
CC   Source DNA and bacteria available from Chris Mackenzie
CC   (Ronald.C.Mackenzie@uth.tmc.edu) and Samuel Kaplan
CC   (Samuel.Kaplan@uth.tmc.edu)
CC   Contacts: Samuel Kaplan (samuel.kaplan@uth.tmc.edu)
CC             Ronald C. Mackenzie (Ronald.C.Mackenzie@uth.tmc.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3147721
FT                   /organism="Rhodobacter sphaeroides ATCC 17029"
FT                   /chromosome="1"
FT                   /strain="ATCC 17029"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:349101"
FT                   /culture_collection="ATCC:17029"
FT   gene            36..1346
FT                   /locus_tag="Rsph17029_0001"
FT   CDS_pept        36..1346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0001"
FT                   /product="ATPase, FliI/YscN family"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: rsp:RSP_1332 H+-transporting two-sector
FT                   ATPase, alpha/beta subunit; TIGRFAM: ATPase, FliI/YscN
FT                   family; PFAM: H+-transporting two-sector ATPase, alpha/beta
FT                   subunit, central region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75121"
FT                   /db_xref="GOA:A3PFK5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFK5"
FT                   /protein_id="ABN75121.1"
FT                   /translation="MSGEFDGLLAEIAAIPLSRRYGRVTGIGRGTLSVGGLEQGTALGD
FT                   RVEICGAGGILGGEVLRLSAHEVTILPDGSPEGLAIGDAVALVGPAEIAPDDSWIGRIV
FT                   DPLGRPLDGRPLFRGPRARPLRAAAPAAAARRSLGPRLPTGVAVFDTLLPLVQGQRIGL
FT                   FAGSGVGKSSLLAKFARSVVADVVVIGLVGERGRELRDFTERVLGPAGMARAVVVTATS
FT                   DQSPLVRRRCGWAAMAVAEHFRDQGLHVLLLVDSITRFAEAHREVALAGGEAASMRGFP
FT                   PSTAHTIMALAERAGPGAEGTGDITAVFSVLVAGSDMEEPVADILRGVLDGHVVMDRKI
FT                   AERGRFPAIDLLRSVSRALPEAASTAENALIAEARRLLGAWDRAEMMIQAGLYARGSDP
FT                   LVDAAIRVWPALDAFLAEDAPDGIDASFRRLADCLGL"
FT   gene            complement(1350..1673)
FT                   /locus_tag="Rsph17029_0002"
FT   CDS_pept        complement(1350..1673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0002"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75122"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFK6"
FT                   /protein_id="ABN75122.1"
FT                   /translation="MVSDPLDSLLDEIRRTVTAGDLAALPNLETRLAEALERLPPDPAR
FT                   LIALRRKAEGNLACLAAAARGVRAARRRLEEIRQAASGTVVVYDGHGRLAETRPEVAPR
FT                   HRL"
FT   gene            complement(1663..1941)
FT                   /locus_tag="Rsph17029_0003"
FT   CDS_pept        complement(1663..1941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0003"
FT                   /product="putative chemotactic signal-response protein
FT                   CheL"
FT                   /note="KEGG: rsp:RSP_1334 possible chemotactic
FT                   signal-response protein CheL"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75123"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFK7"
FT                   /protein_id="ABN75123.1"
FT                   /translation="MSVTITPKPTLAHDPRPDLRRKAEELEAAFLSEMLGHTGLGSASG
FT                   PFGGGIGEQQFASFLRDEQAAGMVRSGGIGLAEQFYRSLTKGMDDGL"
FT   gene            2045..4264
FT                   /locus_tag="Rsph17029_0004"
FT   CDS_pept        2045..4264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75124"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFK8"
FT                   /protein_id="ABN75124.1"
FT                   /translation="MIIGAIPQAVASPELALKAPAATLAGEAFAAELESSALPEPPPAE
FT                   PLTAEAPTSPVPAEDRDADGDASPNEEPVLCVCNPVAPPWQIRVPTSSATEPELPPVPT
FT                   TRLPGEDEGAGTLAAPGPAVEADAGLPPKDGDPAPPPDARHRDPPAEPAADAPPGGGRE
FT                   AGACPSAGLNRLGVAGPETGGAPPPDPDRLSQVSPAQPTPAAPLTVSFAASSGLPEGKT
FT                   VNLSSRTAEALPRRDEAAGAKDTAAASVVAAPLPGDRPDKGEDLPSSGAGKILQPSANE
FT                   AVAEFRQTEASPAAPAPTVLRPSPYPAPPVGLASNGRAPALPLAVSPVSSHSEAPVGRV
FT                   PSGADPAPTAAVPLVSPYPAARLSRVPTGLAPARPPSRVDGLSEQDDAFRARVAYIVSM
FT                   PQARSEPGLNLLPRQGASANMSGSDPTLPNPRGAANGSDVGPPQRQSAHDPAPAVGYDL
FT                   PAKPEMPLSRHAPLQPKEPQPAHPRAERRPVPPPVPASSEGALPAAQPTAVAPRDVAIA
FT                   APVITVPAAAERGGTKESASAERGGTKAIRHQMASERLAGPGNSASSRPEPQAAASGET
FT                   QRQSPETDLAPDLPVAHDPPPSAPVLSEPRVAPDQARTPAHPAPQAPSRAAAEAQSGEE
FT                   DAVEVVLQPDELGRVKMTVAHDGGHVRVLVQADRTDTLDMMRRNSGDLGVEMRQAGFSG
FT                   ASLSFGGREGQPPPRARAALEAESTDVQPPTAATSRSATGLDLRI"
FT   gene            4274..4942
FT                   /locus_tag="Rsph17029_0005"
FT   CDS_pept        4274..4942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0005"
FT                   /product="flagellar hook capping protein"
FT                   /note="PFAM: flagellar hook capping protein; KEGG:
FT                   rsp:RSP_1336 possible FlgD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75125"
FT                   /db_xref="GOA:A3PFK9"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFK9"
FT                   /protein_id="ABN75125.1"
FT                   /translation="MNVTGTETSAGSSTTRSRGDASADKAVTSDYETFLRMLTTQLQNQ
FT                   DPMNPMESDDFAMQLATFSGVEQQVKTNEILTGMGASIGVMGLSELAGWIGREAEVEAP
FT                   AWFDGAPLTLSPKPSEDADRAVLVVRNAAGAVVAQEDIPIGGGQMEWAGTDASGQPLPK
FT                   GAYSFTVESYTGDQVTDTSKVGVYAEIIEARGGSSGTLLVMKGGIEVPASAVTALRDAS
FT                   "
FT   gene            complement(4937..6466)
FT                   /locus_tag="Rsph17029_0006"
FT   CDS_pept        complement(4937..6466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0006"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: rsp:RSP_1337 probable
FT                   ubiquinone biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75126"
FT                   /db_xref="GOA:A3PFL0"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFL0"
FT                   /protein_id="ABN75126.1"
FT                   /translation="MRGPHNIWRLVRTAATMERTGAIGAVLEAMDAPANLRVVARVLGW
FT                   PFKWLGLPGDPALPPATRALTALGPAYIKFGQILSTRPDVVGPEMALQLQYLQDKLPPF
FT                   PTSVAKALIEEELHLPVDRVFSEFSEPVAAASIAQVHRARLADTGVEVAVKVLRPGIER
FT                   AFRTDIDAFYLAAQIIELLSPSSRRLRPTEVIRHFEGVVNGELDLRLESASAGEFAVNT
FT                   EADAGFQVPKPVWNLSARQVMTIGWAEGLSLADNPALDAAGHNRTELGTRVLSLFLSHA
FT                   LRDGFFHADMHQGNLKVAANGDIIAYDFGIMGRLDEYTRRVYAEIIFGFIQRDYRRVAE
FT                   VHFEAGYVPADRDIDEFARALRAVGEPIFGMDASRISMARLLAYLFEVTERFGMETRTE
FT                   LILLQRTMVVVEGVARSLDPHINIWQVARPIVEDYIRDNVGPKAVARDLLRTARILGRF
FT                   GPRLPRLVEARLIRQGHPEVEEPPRRETHPMVWMLAGAGLTAAGVWIGSLL"
FT   gene            complement(6468..7220)
FT                   /locus_tag="Rsph17029_0007"
FT   CDS_pept        complement(6468..7220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0007"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferases; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   rsp:RSP_1338 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75127"
FT                   /db_xref="GOA:A3PFL1"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PFL1"
FT                   /protein_id="ABN75127.1"
FT                   /translation="MSDETSNTTHFGFRTVPEGEKAGMVHGVFTRVASKYDIMNDLMSG
FT                   GVHRLWKDAMMDWLAPRPGQKLLDVAGGTGDISFRFLKRAPGAEATVCDMTESMLVEGR
FT                   QRADAAQMADRLDWVVGDAMALPFASNTFDVYTISFGIRNVTRVQDALNEAYRVLKPGG
FT                   RLMVLEFSQLPNPMMQWAYDRYSFNVIPVMGQIVANDRDSYQYLVESIRKFPDQETFAD
FT                   MIRKAGFGLVKYRNLSLGIAALHSGWKI"
FT   gene            7314..8165
FT                   /locus_tag="Rsph17029_0008"
FT   CDS_pept        7314..8165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0008"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase /
FT                   Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: rsp:RSP_1339 formamidopyrimidine-DNA
FT                   glycolase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75128"
FT                   /db_xref="GOA:A3PFL2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PFL2"
FT                   /protein_id="ABN75128.1"
FT                   /translation="MPELPEVETVRRGLEPAMAGRLIAEARVNRADLRWPFPPRMAERL
FT                   TGQRVLRLRRRSKYILADLSGGQSLLIHLGMSGRMLVSGAQLGEFFHGHPAPSRHDHVV
FT                   LEMEGGARITFNDARRFGAMDLVATEAAEAHPLLAVLGPEPLGNAFDGAYLAARLEGRR
FT                   TPIKAALLDQRIVAGLGNIYVCEVLFRAGLAPGRLAGSLSRAEAEGLVPLIREVLLEAI
FT                   EAGGSSLRDYRQADGELGYFQHTFRVYGREGLPCVTPGCSGTVGRIVQSGRSSFHCPLC
FT                   QR"
FT   gene            8226..9002
FT                   /locus_tag="Rsph17029_0009"
FT   CDS_pept        8226..9002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0009"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rsp:RSP_1340 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75129"
FT                   /db_xref="GOA:A3PFL3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFL3"
FT                   /protein_id="ABN75129.1"
FT                   /translation="MAYETLIVEIEDYVALIRLNRPDALNALNSKMMSELADALGAADR
FT                   NEKVRCIVLTGSEKAFAAGADIKEMAEQSFVDVFGSDFFTSDSEAMLRVRKPIVAAVAG
FT                   YALGGGCELAMMCDFIIAADTAKFGQPEINLGVVAGLGGTQRLTRFVGKSKSMDMHLTG
FT                   RFMDAAEAERCGLVSRVVPAKNLMEEAMKAASKISEKSLLTAMAVKEAVNRSYETTLRE
FT                   GVLFERRLFHALFATEDQKEGMAAFLEKRTPQFRDK"
FT   gene            9113..9391
FT                   /locus_tag="Rsph17029_0010"
FT   CDS_pept        9113..9391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0010"
FT                   /product="SSU ribosomal protein S20P"
FT                   /note="PFAM: ribosomal protein S20; KEGG: rsp:RSP_1341
FT                   ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75130"
FT                   /db_xref="GOA:A3PFL4"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PFL4"
FT                   /protein_id="ABN75130.1"
FT                   /translation="MANSPQSKKRARQAEARAAVNKARRSRIRTFLRKVEEAIATGDAS
FT                   VAAAALKTAQPELARGVTKGVLHKNTVARKMSRLAHRVKVLSQPAAA"
FT   gene            9930..11297
FT                   /locus_tag="Rsph17029_0011"
FT   CDS_pept        9930..11297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0011"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: rsp:RSP_1342 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75131"
FT                   /db_xref="GOA:A3PFL5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PFL5"
FT                   /protein_id="ABN75131.1"
FT                   /translation="MTNETWVQVREGLLKRVGRNNFVTWIEPLRLMGLDEGVARFEVPT
FT                   LFFGDWVQRNFADHIRMRLTEAGSPVERLEFAVSNTPRAPLKEVKAAAPAASPARARPA
FT                   PPEEDLRGAPLDARFTFDSFVVGKPNELAHAAARRVAEGGPVTFNPLFLYGGVGLGKTH
FT                   LMHAIAHDLQKRQPGARVLYLSAEQFMYRFVQALREREILGFKELFRSVDVLMVDDVQF
FT                   IAGKDSTQEEFFHTFNALVDQNKQIVISADRAPGEIKDLEERIKSRLQCGLVVDLHPTD
FT                   YELRLGILQQKADFYREQYRGLVIADGVLEFLAHRITTNVRVLEGALTRLFAFASLVGR
FT                   EITLDLAQDCLADILRASDRKVTIEEIQRKVAEHYNIRLSDMIGPKRLRTIARPRQVAM
FT                   YLAKQLTPRSLPEIGRRFGGRDHTTIMHGVRKIEELMATDSQLADDLQLLRRLLQA"
FT   gene            11415..12533
FT                   /locus_tag="Rsph17029_0012"
FT   CDS_pept        11415..12533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0012"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rsp:RSP_1343 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75132"
FT                   /db_xref="GOA:A3PFL6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFL6"
FT                   /protein_id="ABN75132.1"
FT                   /translation="MKISIERGALLKAVGQAQSVVERRNTIPILANVLIEAEGDTVSFR
FT                   ATDLDIEVVDRTPAVVERAGATTVSAVMLHEIVRKLPDGALVGLSEDPASGRLTVTAGR
FT                   SVFSLATLPREDFPVMASSEYSSTFKAPAPVLRRLFDKAKFAISTEETRYYLNGVYMHV
FT                   ATGEEGPVLRCVATDGHRLARIDAALPEGAQGMPGVIVPRKTVNELRKLLDDDEVEIAV
FT                   SVSETKVRFATPQITMTSKVIDGTFPDYSRVIPTANARRLEVDAQEFAKAVDRVATVSS
FT                   ERSRAVKLSLDEDRLVLSVNAPDSGAAEEELAVAYGDERLEIGFNAKYLLEIASQVDRE
FT                   NAVFLFNSSGDPTLMREGNDMSAVYVVMPMRV"
FT   gene            12601..13692
FT                   /locus_tag="Rsph17029_0013"
FT   CDS_pept        12601..13692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0013"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: rsp:RSP_1344 recombination protein F; TIGRFAM:
FT                   DNA replication and repair protein RecF; PFAM: SMC domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75133"
FT                   /db_xref="GOA:A3PFL7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFL7"
FT                   /protein_id="ABN75133.1"
FT                   /translation="MRGLAVTSLALSHFRSHRAARMAFDGRPVAFVGANGAGKTNLLEA
FT                   ISLLSPGRGLRRAAADEIARRPEALGWKVAAAVTGLHSGHEIETWAEGGGARQVRIDGK
FT                   AATQVMLGRLLRIVWLVPAMDRLWTEAAEGRRRFLDRVAMSFAPHHAEAVLDYEKAMRE
FT                   RNRLLKEQVADAHWHGALEGRMAEAARAIRAHREEAVARLMAAQGAAETAFPRAVLSVA
FT                   SDDPEDLAAAWAEGRRRDMAAGRTLVGPHRADLTAIYAAKDVPAAQCSTGEQKALLISL
FT                   ILANARALAEDLGAAPVLLLDEVAAHLDEGRRAALFDEICALGAQAFMTGTGPELFTAL
FT                   GYRAQRIEVTEAQGLSQTRDIGP"
FT   gene            13689..14111
FT                   /locus_tag="Rsph17029_0014"
FT   CDS_pept        13689..14111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0014"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rsp:RSP_1345 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75134"
FT                   /db_xref="GOA:A3PFL8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFL8"
FT                   /protein_id="ABN75134.1"
FT                   /translation="MTPQRITLVTLGVADLATSVAFYEKLGWKQHRAQEGVAFFQLQGS
FT                   ALALFGRADLAADQGRPEAALGTGAVTLAQNFPTEAEVDAAFEAALAAGATAIKRPEKV
FT                   VWGGYSGYWADPDGHVWEMAMNPVWPLAEDGSLTLP"
FT   gene            14203..16638
FT                   /locus_tag="Rsph17029_0015"
FT   CDS_pept        14203..16638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0015"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: rsp:RSP_1346 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75135"
FT                   /db_xref="GOA:A3PFL9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFL9"
FT                   /protein_id="ABN75135.1"
FT                   /translation="MAEAARVPEEYGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLHHM
FT                   VYEVVDNGIDEALAGHATAVTVKIHADSSVSVRDNGRGIPVDMHASEGVSAAEVIMTQL
FT                   HAGGKFDQNSYKVSGGLHGVGVSVVNALSDWLELRIWRNGREHFARFENGETVEHLRVV
FT                   RDAPGEKGTEVRFLASAKTNRPDGTFSNLDYSFKTLEARLRELAFLNSGVRILLEDERP
FT                   AEPLHSELFYEGGVREFVRYLDRSKSPVMPEPIFITGERGGIGVEVAMWWNDSYHETVL
FT                   PFTNNIPQRDGGTHLAGFRGALTRTITKYAQDSGIARREKVDFTGDDAREGLTCVLSVK
FT                   VPDPKFSSQTKDKLVSSEVRPAVENLVNEKLAEWFEENPAIAKSIVGKIVEAALAREAA
FT                   RKAREMTRRKTAMDVASLPGKLADCQEKDPALSELFIVEGDSAGGSAKQGRARKNQAVL
FT                   PLRGKILNVERARFDRMLSSETVGTLITALGAGIGRDEFDIAKLRYHKIIIMTDADVDG
FT                   AHIRTLLLTFFFRQMPAIIEGGFLYIAQPPLYKVARGKSEVYLKDQAALDDYLIHQGIE
FT                   GAILRLATGEEIAGQDLLRVIEGARQFRRVLDGFPTHYPRNILEQAALSGAFDPGRADD
FT                   DLQLVADRVAERLDLTAAEYERGWKGRITQDHGIRLSRVLRGVEELRTLDGAVLRSGEA
FT                   RRLSQVSGQTRDVYAPGARLVRKDREQPIHGPIALLKAVLAEGEKGLSLQRYKGLGEMN
FT                   PEQLWETTLDPEARTLLQVKVDDLAEADDIFTKLMGDVVEPRREFIQQNALNVENLDT"
FT   gene            complement(16595..17884)
FT                   /locus_tag="Rsph17029_0016"
FT   CDS_pept        complement(16595..17884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75136"
FT                   /db_xref="GOA:A3PFM0"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFM0"
FT                   /protein_id="ABN75136.1"
FT                   /translation="MSPIRLRILWSRIRRTLWFTPALYAVIALLVLSTAPLAGRMLPSD
FT                   VNSLIGLDGVYDLLDVLSNSLLAVSIFSLGIMASSLQAAAGAATPRARPLLTEDRTAQN
FT                   AISTFLGGFIYGIVGLVGLSTNYYGDEAKVILFLVTCAVIMAVIVALIRWVGRLSNLGD
FT                   VSEVIDLVEQAADRAFAADAAEPWLGGVSMTELPEGRSAVLPDRMGFVQAINVAELARL
FT                   ADEWEIDLYVAARPGAYADPNRPLLLAGQRLDTEQVVLARACFVIGGQRTFEADPRFAM
FT                   IVLSETASRALSPGVNDPGTAIDVIGTSSRVLADWAKALEKAKGEVRHRRLHVGRLSPE
FT                   DVLEDAFRWIARDGAGQLEVQIRLQRALAALSTCAPQLFGHPARALSEETLLRAEQALT
FT                   FDRDLDRLRAEAARLGFRCPDSPRSARSAG"
FT   sig_peptide     complement(17768..17884)
FT                   /locus_tag="Rsph17029_0016"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.796 at
FT                   residue 39"
FT   gene            17974..19050
FT                   /locus_tag="Rsph17029_0017"
FT   CDS_pept        17974..19050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0017"
FT                   /product="AFG1-family ATPase"
FT                   /note="PFAM: AFG1-family ATPase; KEGG: rsp:RSP_1349
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75137"
FT                   /db_xref="GOA:A3PFM1"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFM1"
FT                   /protein_id="ABN75137.1"
FT                   /translation="MRKSLTDIYEARVDAEELRADPAQHAVLEDLEGIRQWLEAHPERK
FT                   RGLFGLFAAKEELPKGLYLWGGVGRGKSMIMDLFTEAVEIPMKRRVHFHAFMQEVQQGM
FT                   HEARKKGVEDALQPVADRVAGQVRLLAFDEMQITDITDAMVVGRLFQKLFEQGVVIVTT
FT                   SNRPPEGLYENGLNREVFLPFIDLLRERMTVIELESPTDYRQHRLQGAQVFFHPARKAE
FT                   QAIARIWSDLTGGDRGHPMRLPVNGRTVEIPRFANGVGRATFWDLCARPLGPADFLAIA
FT                   EACRVLILEDIPRLSAENYNEAKRFVTLIDALYEARVRLIASAADEPERLYIEGEGSFE
FT                   FERTASRLREMQSADWAT"
FT   gene            complement(19254..20129)
FT                   /locus_tag="Rsph17029_0018"
FT   CDS_pept        complement(19254..20129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0018"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="KEGG: rsp:RSP_1350 phosphoserine phosphatase;
FT                   TIGRFAM: phosphoserine phosphatase SerB; HAD-superfamily
FT                   hydrolase, subfamily IB (PSPase-like); PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75138"
FT                   /db_xref="GOA:A3PFM2"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFM2"
FT                   /protein_id="ABN75138.1"
FT                   /translation="MFVAVLMTDPAAPGLERTTVESLRNAWGGGDARWLQPGVAAEFPV
FT                   SAMPSNRWQVWEDLQALKVDLAVVPAEGRRKKLLLADMDSTMIRQECIDELADEAGVGE
FT                   YVAGITRRAMNGELNFESALRERVGLLKGLSASVVDRVFETRIQYMPGGRALVQTMKAH
FT                   GARAALVSGGFTAFTEKVAAGLGFDEHRANILHVAEGALTGTVAEPILGREAKLAALEE
FT                   ICARLGIEVADAMAVGDGANDLGMLKRAGAGVALHAKPVVAAECDIRINHGDLTSLLFV
FT                   QGYAEDEIRA"
FT   gene            20269..21426
FT                   /locus_tag="Rsph17029_0019"
FT   CDS_pept        20269..21426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0019"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="KEGG: rsp:RSP_1351 phosphoserine aminotransferase;
FT                   TIGRFAM: phosphoserine aminotransferase; PFAM:
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75139"
FT                   /db_xref="GOA:A3PFM3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006271"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFM3"
FT                   /protein_id="ABN75139.1"
FT                   /translation="MSDLQTPAARPANPRFSSGPCAKIPAYSLDLLSDAPLGRSHRAAV
FT                   GKAKLKEAIDLTREILGVPEGYRIGIVPGSDTGAVEMAMWSLLGARPVEMLAWESFGEG
FT                   WVTDAVKQLKLDATVRKAAYGEIVDLAQVDFTRDVVFTWNGTTSGVRLPDGDAIPADRE
FT                   GLTICDATSAAFAMDLPWDKLDVVTFSWQKVLGGEGGHGMLILSPRAVERLESYTPAWP
FT                   MPKIFRMTKGGKLIEGIFQGETINTPSMLAVEDYLVSLKWAQRIGGLKALVARAEANSK
FT                   VVADFVAAHDWIANLAVDPATASTTSVCLKFTDPRIADGAAFAKAVAKRLEKEGVALDV
FT                   GAYRDAPAGLRIWCGSTVETADVAALMPWIEWAFEAEIAALAKAA"
FT   gene            21507..23102
FT                   /locus_tag="Rsph17029_0020"
FT   CDS_pept        21507..23102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0020"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="TIGRFAM: D-3-phosphoglycerate dehydrogenase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
FT                   region; D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding; KEGG: rsp:RSP_1352 D-3-phosphoglycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75140"
FT                   /db_xref="GOA:A3PFM4"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFM4"
FT                   /protein_id="ABN75140.1"
FT                   /translation="MAPRVLVSDELSETAVQIFRDRGVEVDYMPKLGKDKEKLAEIIGQ
FT                   YDGLAIRSATKVTEKLLEQATNLKVIGRAGIGVDNVDIPAASRKGVIVMNTPFGNSITT
FT                   AEHAIAMMFACARQLPEANASTHAGKWEKSRFMGVELFNKTLGVIGAGNIGGIVCDRAL
FT                   GLSMKVVAYDPFLSEERAKALGVTKVELDDLLARADFITLHVPLTDKTRNILSAEAIAK
FT                   TKKGVRIINCARGGLVDEKALAEAIKSGHVAGAAFDVFEVEPASESPLFNLPNVVVTPH
FT                   LGASTTEAQENVALQVAEQMSDYLLTGAVQNALNMPSVTAEEAAVMGPWVKLAGHLGAF
FT                   VGQMTDEPIKAINVLYDGAVGEMNLAALNCATIAGIMKATNPDVNLVSAPVVAKERGIQ
FT                   ISTTTQAKSGAFDAYIKLTVVTDKRERSVAGTCFSDGKPRFIQIKGINIDAEVGRHMLY
FT                   TTNEDVPGIIGLLGMTMGKNGVNIANFTLGRTSVGQEAIAILYLDQAIDPKVVETLEST
FT                   GLFQQVKPLEFDVA"
FT   gene            23199..23930
FT                   /locus_tag="Rsph17029_0021"
FT   CDS_pept        23199..23930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0021"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: rsp:RSP_1353
FT                   putative protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75141"
FT                   /db_xref="GOA:A3PFM5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFM5"
FT                   /protein_id="ABN75141.1"
FT                   /translation="MRSYAIGDIHGHLSLLQEIHGRIAADRERTGDDEAPVVHIGDLVD
FT                   RGPDSRGVVEYLRQGIEQGENWVVLKGNHDRMFAGFLRDPDHQDPGLRGDLSWLHPRLG
FT                   GGPTLESYGVAHAADRPVAIVHREAVALVPAEHVAFIEALPAFYRRDEALFVHAGIRPG
FT                   VPLAEQIEDDLVWIREPFLSDPRDHGMLVVHGHTAIDAVTHYGNRLNLDSGAAYGGPLS
FT                   AVVIEGRSVWQLGPEGRRPIA"
FT   gene            23980..25182
FT                   /locus_tag="Rsph17029_0022"
FT   CDS_pept        23980..25182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0022"
FT                   /product="acetyl-CoA acetyltransferases"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: rsp:RSP_1354 beta-ketothiolase; TIGRFAM:
FT                   acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75142"
FT                   /db_xref="GOA:A3PFM6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFM6"
FT                   /protein_id="ABN75142.1"
FT                   /translation="MVRPSREKGRAMSDILVLSAVRTAIGGFGGALAAVPPGDLATTVT
FT                   RAALERAGVEPGRVGHVVFGHVINTEPRDMYLSRVAAMQAGIPSEVPAMNVNRLCGSGV
FT                   QAIVSAMQALMLGDAEVALAGGAESMSRAPYALTTARWGQKMGDTRALDMMTGALNCPF
FT                   GTGHMGITAEIVAERHGISREDQDAFALESQTRTARAQEEGRFDGQIVPVEIASRKGPV
FT                   SFSRDEHPKATTLEALAGLRPAFQKGGTVTAGNASGINDGAGALILAREGAVPGARPLG
FT                   RLIGYAHAGVDPEVMGLGPIPAVQALCARTGLSVADFDVIESNEAFAAQALAVARALDF
FT                   DPARVNPNGGAIALGHPVGATGAIITVKALHELHRTGGRRALVTMCIGGGQGIALALER
FT                   V"
FT   sig_peptide     23980..24081
FT                   /locus_tag="Rsph17029_0022"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.936) with cleavage site probability 0.921 at
FT                   residue 34"
FT   gene            complement(25192..27216)
FT                   /locus_tag="Rsph17029_0023"
FT   CDS_pept        complement(25192..27216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0023"
FT                   /product="penicillin-binding protein 1C"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: rsp:RSP_1355 glycosyl transferase, family 51;
FT                   TIGRFAM: penicillin-binding protein 1C; PFAM: glycosyl
FT                   transferase, family 51; penicillin-binding protein,
FT                   transpeptidase; Penicillin-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75143"
FT                   /db_xref="GOA:A3PFM7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFM7"
FT                   /protein_id="ABN75143.1"
FT                   /translation="MIRARWLFAAAAGLFLAAAARDGGEGFIAATVMPPLALQTSVEVE
FT                   ARDGTLLRAYTVADGRWRLEPGPVDPLFLKMLVAYEDGRFYDHGGIDPLALTRAVLQAL
FT                   RYGQVVSGGSTLTMQVARLLEESGTGRVAGKLRQMRVALALERRLSKQEILSLYLRLAP
FT                   YGGNLEGIRAASISYLGKEPARLTAAEAALLVAIPQSPEGRRPDRHPERAEAARARVLA
FT                   RAVRAEVIEPDRAEAALREPVPRARKPFPAVAPHLADRVAKADPLRQTHRLTLDAALQK
FT                   RLETLAAETVEARGERLQVAMLVADHRSGEILASVGSAAYRADRRQGFLDMTVALRSPG
FT                   SLLKPLIYGLAFDEGLAHPETLLDDRPMDFAGYRPQNFDRIFRGEIRAREALQMSLNLP
FT                   AVALTDALGPARLLSALEQAGVKPVLPGGQPGLAVALGGVGVTLSDMVQLYAALARGGV
FT                   VLPLHVEGEGAPGRRLMSEVSAWQVADILSGMAPPPGAPANRLAYKTGTSYGHRDAWAV
FT                   GFDGQHVVGIWLGRADGTPVPGVFGADLAAPVLFRAFARLKPALESLPPPPRAALTVSN
FT                   AELPQPLRRFRSRLAAFQTVGGPQVAFPPDGAEVERLRGGLKVKVEGGTAPFTWLANGA
FT                   PVAVSLGGRETLLDLPAGFLTLSVIDADGRSARTAVRLR"
FT   sig_peptide     complement(27154..27216)
FT                   /locus_tag="Rsph17029_0023"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.883 at
FT                   residue 21"
FT   gene            complement(27213..32639)
FT                   /locus_tag="Rsph17029_0024"
FT   CDS_pept        complement(27213..32639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0024"
FT                   /product="alpha-2-macroglobulin domain protein"
FT                   /note="PFAM: alpha-2-macroglobulin domain protein; N/apple
FT                   PAN domain protein; alpha-2-macroglobulin domain protein 2;
FT                   SMART: Apple; KEGG: rsp:RSP_1356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75144"
FT                   /db_xref="GOA:A3PFM8"
FT                   /db_xref="InterPro:IPR000177"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFM8"
FT                   /protein_id="ABN75144.1"
FT                   /translation="MRIRHLLPVLMLGLMLPLTAAAQDWLPDRRVVLSADTDLPGSDMA
FT                   TLLDTTLDGCERACLSRTGCTAFTFNGRNGSCFPKSTSGDAAPYQGAISGVVVPEDPAR
FT                   QETARARASDLAFLSDYDLTRAKEQAAGLGHEHTVNGYTAEEHLQSAARAEAQGDRIAA
FT                   ANFTGAAVSASDRAESWIDYARRLRAAGEADSSSRDTLRDRAFRAAINGYLRAGSPALR
FT                   HTALVELALSAEAIDRGRDMVQALRLAQSIQPRDDTARLLDTAAGKYGFRITENAVEAD
FT                   RVRPRICVTFSEKLADSGIDYASYVQLGEPGLTVEAEDRRICVGGVAHGARHVLTFREG
FT                   LPAADGQTLAKSVQIAAYVRDRSPSVRFPSRAYVLPRAGAPAIPVETVNARTLDLAVYR
FT                   VSDRNLLRAIQQDYLGRPLDQWQADQFTSEVGEEIWTGTGEVAMEVNRDMTTRLPMEEP
FT                   LRGLPAGIYALKAAIPGQDVYEHPAAWQWFVISDLGVTTLSGTDGLHVFVRSLGSAEPK
FT                   TGVTVELLSRANAVLGTATTDDQGLAAFDAGLTRGTGAAEPALVVVKEGEADIAFLSLT
FT                   DPEFDLSDRGVEGHEPAPPVDVFLATERGAYRAGETIHALALARDGEAAAIEGLPLTAI
FT                   LKRPDGVEYSRALASGTGAGGHVFDLPLAGSAPRGVWRLEVLADLEAAPLAAKTVLVED
FT                   FLPERIDVTASLPEAPIALGDVPELTVEANFLYGAPGADLAIEGEVLLRAAEGLPKFPG
FT                   YVFGRSTASFDPQVASFGGQRTDEAGQARFALDLPQVEDPARPLEILVATRVSEGSGRP
FT                   VERTITRRLRPAEPMIGIRPLFDGVAAQGTDARFALVGVGPEETPVPMSVRWTLNRIET
FT                   DYQWYQQWGNWAWEPVETRTPVAEGEAELGTSPVEIGAPVDWGQYELVVERSDGRQAAS
FT                   STSFYAGWYAPADVTATPDTLELSLDKPAYRPGETAQLRIVPRAPGKALVTVLSNRLIA
FT                   MKAVEVGEGETLVELPVTDEWGTGVYVTATLLRPMDVAAGRNPTRALGLAHAAIDPGEK
FT                   KLATRIETAPEAAPRAPLEVAVKVEGTAPGETAYATLAAVDVGILNLTGFETPDPEDHY
FT                   FGQRKLGVGIRDLYGRLIDGMNGAQGSVRSGGDGGRAQTQAPPPTEELVAFFSGPVEVG
FT                   PDGLARASFDLPAFNGTVRVMAVVWSKTGVGHAEQDVLVRDPVVVTASLPRFLAPGDES
FT                   RLLLEIAHATGPFGRVSLDVSSPGLTVGSVPSGLDLSEKGRARIEVPVSANRTGLQEIE
FT                   VSLTTPDGKQLTKRLVVPVEVNDPEIARRDRLTLEGGQTFTLDENLFAGFVPGTGRTTM
FT                   AIGPIARLDTAGLLASLDRYPYGCTEQITSRALPLLYLSSVARALDLPGTEDMSVRIGQ
FT                   AIDEVLTNQTAEGAFGLWQAQSGDFWLDAYVTDFLSRAKAQGHKVPELALRRALDNLRN
FT                   QVNYSADFDEGGEALAYALMVLAREGAAAIGDLRYYADVKADAFSTPAAQAQLGAALAS
FT                   YGDQQRADAMFRKAAARLNGSLVAQSQQVFRADYGTAYRDAATVLTLAAEAGSQAVDRE
FT                   AVTTSLAARTGTLSTQEAVWTLLATNALIDRPDLEGIAIDGTPATGPLVRLLRDGDPAV
FT                   AVTNSGGPQVLTVTTTGVPSEPEPAGGNGYAIARSYYTMEGEAADPASVGAGTRLVAVL
FT                   EVTPFGNGEGRLMVNDPLPAGFEIDNPNLMRGGQVDALDWLSPVENVAHAEFRQDRFLA
FT                   ALDRYDGEAFRLAYIVRAVSPGTFHHPAASVEDMYRPEFRAWTEAGRVTVTP"
FT   sig_peptide     complement(32571..32639)
FT                   /locus_tag="Rsph17029_0024"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.884 at
FT                   residue 23"
FT   gene            32793..35342
FT                   /locus_tag="Rsph17029_0025"
FT   CDS_pept        32793..35342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0025"
FT                   /product="histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: rsp:RSP_1357
FT                   cytoplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75145"
FT                   /db_xref="GOA:A3PFM9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFM9"
FT                   /protein_id="ABN75145.1"
FT                   /translation="MDIEQKLAKERRARLAAERLLEYKQRELFAANEKLAIHARALSDQ
FT                   IIEQRAVVKTALSEAEKLKGQNSRFLSELERAHTAAVMAERRLWDSIDAIEDGFAVFDA
FT                   GQRLVAANEAYRCHFEGLEVRPGMALADLLQLATTHGLIDLRGEPADLWQQRMIRRWDE
FT                   DPVEPEIVRRCTGQWLRLVNRRARDGDMVSLLIDITEQMRLRAAIDAIPDGFVLFDRAE
FT                   RLVLCNDRYRAIYPRSAEALRPGAPFEEILRHGLAHGQFPEALGREEEWLADRLAAFRH
FT                   LGGAAEQQLDDGRWLRVIEHETPDGGRVGLGVDITELKRQQAALESARAAAEAASRAKS
FT                   AFLANMSHEIRTPMNGIVGMADLLCETVLTEDQRLFSETIRSSGEALLVIINDILDYSK
FT                   IEANRLTLHPEPFDLERTIHEVAMLLQPKARAKGIDLLIDFDLFLPTRFVGDPGRLRQV
FT                   LTNLIGNAVKFTAAGHVLIRVVGLEVAPGRHDLRVTVEDTGIGIAPEHLDHVFGEFNQI
FT                   EAEATRRFEGTGLGLAITRRLIELMQGAVWVESEPGRGSCFGFRLTLPAADDEAAPPVP
FT                   IEVRRALVVDGQFINRTILERQLAPCGIAVTLCRSGIEALAELSADAGYDLLLTDHEMP
FT                   DLDGLALAQRVRAGGFSMPILLLTSNPSAVRDHPAEALLAGVLQKPLLRSDLYRRLQSL
FT                   TVPPAAPDRPPPVPVPELRRMRVLAAEDNRTNQLVFGKMVRDLDIDLTFADNGREAVEL
FT                   YDRIRPDLVFMDISMPEMDGRAAARAIRARERGGAHVPIVALTAHALESDARASAAAGI
FT                   DRTLTKPLRRAMILETLAAFCPAGTRPIQPALVEGPD"
FT   gene            complement(35496..36269)
FT                   /locus_tag="Rsph17029_0026"
FT   CDS_pept        complement(35496..36269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0026"
FT                   /product="protein of unknown function DUF328"
FT                   /note="PFAM: protein of unknown function DUF328; KEGG:
FT                   rsp:RSP_1358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75146"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PFN0"
FT                   /protein_id="ABN75146.1"
FT                   /translation="MLAVLSPAKRLAARPALDLPADLAPSEPRLQDQADALARVARDLT
FT                   AADLRRLMHISEPLARLNVARFAEFHEARNAAVPAVALFDGDTYAGLEARTMDADALRW
FT                   AQERICILSGLYGLLRPLDRIQPHRLEMGTRLATERGATLYDFWGDRIAEALNARAAET
FT                   GARVLVNCASVEYFTAADRAALKLPVITPTFLEERNGERKVVSFWAKRARGAMARFIAE
FT                   NRLDDPEDLRAFRAGGYAYEPDLSTDERPVFLRAG"
FT   gene            complement(36269..38314)
FT                   /locus_tag="Rsph17029_0027"
FT   CDS_pept        complement(36269..38314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0027"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: rsp:RSP_1359 DEAD/DEAH box helicase; TIGRFAM:
FT                   ATP-dependent DNA helicase, RecQ family; ATP-dependent DNA
FT                   helicase RecQ; PFAM: helicase domain protein; HRDC domain
FT                   protein; DEAD/DEAH box helicase domain protein; SMART:
FT                   DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75147"
FT                   /db_xref="GOA:A3PFN1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFN1"
FT                   /protein_id="ABN75147.1"
FT                   /translation="MPTPRELLHSIFGFSDFRPGQEEIVEAVRQGQNTLAIMPTGGGKS
FT                   LCYQLPALSREGVTLVVSPLIALMRDQVRSLREAGVEAGALTSGNTEAETDEVFRALDE
FT                   GRIKLLYMAPERLASAGAFALLRRVGVGLIAVDEAHCVSQWGHDFRPDYLRIGELRRAL
FT                   DVPLAAFTATADAETQEEIVARLFDGVAPATFLRGFDRPNIHLAFAVKASPRQQILAFA
FT                   AARKGRSGIVYCATRAKTETLAQALREAGHSACHYHGGMEAHDRRAVEIRFQQEDGLIV
FT                   VATVAFGMGIDKPDIRWVAHADLPKSIEGYYQEIGRAGRDGAPAETLTLYGPDDIRLRR
FT                   SQIDEGLAPPDRKAADHARLNALLGLAEATACRRQVLLGYFGEGSEPCGTCDLCDRPAE
FT                   LFDATEAVRKALSAILRTGEWFGTGHLIDILTGTATQKVRDRGHDGLPTFSVGRDLSRP
FT                   AWEAVFRQMMGRDLVRPDPERHGALKMTEAARPILRGEEQITLRRDTVKSAAARPQARA
FT                   LISEEDAPLLSALKAKRRALAEAAGVPAYVIFTDRTLIEMAERRPQTLDEMAGITGVGA
FT                   KKLESYGATFLAVVTGEAEAAMHPQRRRLAGRGAAELFDRLAEAQVALMRGEDGTGKPL
FT                   SLPQSTLRRIAEARPTTLADLDRVGDLGAQKIERFGEAFLDVLREA"
FT   gene            complement(38372..38662)
FT                   /locus_tag="Rsph17029_0028"
FT   CDS_pept        complement(38372..38662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0028"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT; KEGG:
FT                   rsp:RSP_1360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75148"
FT                   /db_xref="GOA:A3PFN2"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFN2"
FT                   /protein_id="ABN75148.1"
FT                   /translation="MISLFQILMLILDIAKFIIFAHIIMSWLINFEVLNLRQPLVGQIW
FT                   DGLSRLLEPIYSQVRRILPSMGGLDLAPLIVLVAIYALQIVLRNNMASFYY"
FT   gene            38791..39318
FT                   /locus_tag="Rsph17029_0029"
FT   CDS_pept        38791..39318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75149"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFN3"
FT                   /protein_id="ABN75149.1"
FT                   /translation="MYPYVRLFMEMRRARRLDPLPVLGTHCSSHRCLPWDLDPWRELNN
FT                   GRTLTLFDLGRAPLLVRTGMQRICSEKGWGMTVAGSSVRYRRRVVLMERLEMVSRCLGW
FT                   DGRFFYMEQSLWRKGDCTSHMLLRAATTTGSGIVPPAEVAAALGAGESPPLPDWVQAWI
FT                   EADALRPWPPAA"
FT   gene            39413..40783
FT                   /locus_tag="Rsph17029_0030"
FT   CDS_pept        39413..40783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0030"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rsp:RSP_1362 major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75150"
FT                   /db_xref="GOA:A3PFN4"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFN4"
FT                   /protein_id="ABN75150.1"
FT                   /translation="MARARLRIWGWYFFDWASQPYSTLLLTFVFAPYFAEVARGRYLAE
FT                   GMDAVAAGAAAQSLWATGLGAASLVVALLAPLLGAVADAGGRRLVWIWGFSAFYILGSA
FT                   GLWALAPGGDGLVWALVCFGLGFVGMEFATIFTNALLPSLGPRDRIGEISGSGFAFGYL
FT                   GGVLALALMLLFLAESAQTGRTLIGLPPAFGLDPELREGTRAVGPFTALWYAVFMVPFF
FT                   LWVREPALPRSPVRFGAALGQLGSFLRSLPRRRSLAAYLASSLLYRDALNALYGFGGVY
FT                   ASGVLGWSIIQIGVFGVVGAVTATVASWVGGRADRRFGPKPVIAACILLLTAVCIVIVG
FT                   TARESLFGQPLPEGSRLPDLIFFGCGALIGGAGGALQAASRTLMACHTTPERATEAFGI
FT                   YALSGKVTSFLAPFLIALATGLSGSQRAGIAPLILLFLAGLVLLVWVKPGGEQRAVT"
FT   gene            40780..41664
FT                   /locus_tag="Rsph17029_0031"
FT   CDS_pept        40780..41664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0031"
FT                   /product="murein endopeptidase. Metallo peptidase. MEROPS
FT                   family M74"
FT                   /note="PFAM: peptidase U6, penicillin-insensitive murein
FT                   endopeptidase; KEGG: rsp:RSP_1363 penicillin-insensitive
FT                   murein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75151"
FT                   /db_xref="GOA:A3PFN5"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFN5"
FT                   /protein_id="ABN75151.1"
FT                   /translation="MIRILSFLLALGMATGVQAEPKANKLFGAQTGPSRHAPMPIGSYN
FT                   RGCAAGLVQMPESGPTWQVMRLSRNRAWGHPEMIEFLQALSVAARQIGWAGLYVGDISQ
FT                   PRGGPMTSGHASHQIGLDADVWMLPPRRLDLTVADRERISSIPVRSADQRSVTANWTRA
FT                   HHTLLRSAASDDRVDRIFVAAAVKLEMCKTATRADRAWLQKIRPVPGHDTHFHIRLKCP
FT                   RGAVACQTQTPTVAELSKGGDGCDETLTWWVTDYLNPPKSPPKKPSGPRPKGARDYTLS
FT                   DLPAQCREVLASR"
FT   sig_peptide     40780..40839
FT                   /locus_tag="Rsph17029_0031"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            41637..42527
FT                   /locus_tag="Rsph17029_0032"
FT   CDS_pept        41637..42527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75152"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR014567"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFN6"
FT                   /protein_id="ABN75152.1"
FT                   /translation="MPRSPRLALIAGLVLGLALGGSADTPGDGVTRFVWTAEDPLFGGL
FT                   SALEMSEDGRSVTVLSDRGAWTRGQVIRDPEGRILDIRTEPMRLLRGRGEEPLARRRND
FT                   SEGLALAPDGTAYVSFEGAARVLRYRDLSGPAENLPVYPDFALMQRNSALEALAIDAGG
FT                   AIYTLPERSGSATRPFPVYRYQNGVWTQPFAVPRRGSFLIVGADFGPDGRLYVLERRFR
FT                   GLLGFASRVRRFTLGPEGITAEETVFETRSGRFGNLEGISVWRDPGGGTVLSLVADDNF
FT                   LFLLRTELVELRLRD"
FT   sig_peptide     41637..41708
FT                   /locus_tag="Rsph17029_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.969 at
FT                   residue 24"
FT   gene            42609..43235
FT                   /locus_tag="Rsph17029_0033"
FT   CDS_pept        42609..43235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0033"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   rsp:RSP_1365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75153"
FT                   /db_xref="GOA:A3PFN7"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFN7"
FT                   /protein_id="ABN75153.1"
FT                   /translation="MTRSLIPAILAMAAIVVASNILVQFLFGQWLTWGAFTYPLAFLVT
FT                   DLTNRFRGAAAARRVVLAGFATGIVCSLIGTQIQGEFGPLVTLRIALGSGLAFLVAQML
FT                   DVTVFDRMRHARGWWQAPLISTLVGSSLDTLIFFGTAFSAALVWLEPSNDVSWANEILP
FT                   LLGAGPEAPLWLSLAVADWSVKLLLALVALLPFRIIVRRMTADVA"
FT   sig_peptide     42609..42665
FT                   /locus_tag="Rsph17029_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.686 at
FT                   residue 19"
FT   gene            43515..43940
FT                   /locus_tag="Rsph17029_0034"
FT   CDS_pept        43515..43940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0034"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   rsp:RSP_1366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75154"
FT                   /db_xref="GOA:A3PFN8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFN8"
FT                   /protein_id="ABN75154.1"
FT                   /translation="MLRITDQITLADWELTESFSRSSGPGGQNVNKVETAVELRFEAER
FT                   SPHLSPAVKARLKRLAGRRWTQEGAIVIRAEETRSQQRNRELARERLAEMVRAALVAPK
FT                   RRIATKPTLGSQRRRLAAKSIRSDVKAGRGRVSDEEG"
FT   gene            complement(43949..45241)
FT                   /locus_tag="Rsph17029_0035"
FT   CDS_pept        complement(43949..45241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0035"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="KEGG: rsp:RSP_1367 nicotinate
FT                   phosphoribosyltransferase; TIGRFAM: nicotinate
FT                   phosphoribosyltransferase; PFAM: Nicotinate
FT                   phosphoribosyltransferase and related"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75155"
FT                   /db_xref="GOA:A3PFN9"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFN9"
FT                   /protein_id="ABN75155.1"
FT                   /translation="MVDIATRVYNHKWKIDPIVRSLIDTDFYKLLMCQSVFRNRPDTVV
FT                   RFSLINRTSSVRLAELIDEGELREQLDHIRTLSLSRGESTFLRGNTFYGKRQMFRPDFM
FT                   EWFENLRMPPYHLEKRDGQYELTFEGKWPEVMLWEIPALAVLMELRSRAVLATMGRFEL
FT                   QVLYARAMTKLWEKIERLKRIERLKIADFGTRRRHSFLWQDWCVQAMIEGLGDAFTGTS
FT                   NCLIAMRREVEAIGTNAHELPMVYSALATTDEDLARAPYQVLADWHEEHDGNLRIILPD
FT                   TYGTEGFLARAPDWLSTWTGIRIDSGDPAQGAETAIRWWQSRGEDPRRKLVIFSDGLDV
FT                   EKIEELHRQFHGRVKVSFGWGTMFTNDFRGLVKDDALAPFSLVCKAVAADGRPTVKLSD
FT                   NPLKAMGPADEIARYKRVFGVGDQVAYEVQV"
FT   gene            complement(45243..45848)
FT                   /locus_tag="Rsph17029_0036"
FT   CDS_pept        complement(45243..45848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0036"
FT                   /product="Nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: rsp:RSP_1368
FT                   probable pyrazinamidase/nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75156"
FT                   /db_xref="GOA:A3PFP0"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFP0"
FT                   /protein_id="ABN75156.1"
FT                   /translation="MRPQTEALIVIDVQNDFCPGGALAVAGGDAIIPRINALLPEFGAR
FT                   IFTQDWHPADHSSFASTHEAVPFSLIEMPYGPQVLWPTHCVQGTRGAEFHPALETAPAD
FT                   LVLRKGFRRGIDSYSAFFENDRTTPTGLEGYLRSRGIEAVTLAGLATDFCVAYSALDAA
FT                   RLGFRVTVLEGASAAIDLNGSLAAIKAQMAEAGVALEP"
FT   gene            46041..46823
FT                   /locus_tag="Rsph17029_0037"
FT   CDS_pept        46041..46823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0037"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: rsp:RSP_1369 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75157"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFP1"
FT                   /protein_id="ABN75157.1"
FT                   /translation="MTDTPAAHPVFPDLKGASVFLSGGGSGIGAALTEGFLRQGAQVAF
FT                   VQRSDATAFCDRMEAETGARPLFLPCDVTDIPALRQALAEVAERQGPIRVLVNAAAHDD
FT                   RHTTAEVTEDYWDRAQAVNLKHYFFAAQAVIPGMKAAGGGSIVNFSSISYMMGNAGYPA
FT                   YTTANSGINGLTRSLAREFGPDRIRVNALAPGWVLTERQKDLWVTEDGLQAHLDRQCLK
FT                   EALVPADIVGGVLFLASEASRMMTGQALVIDGGVVVTG"
FT   gene            46820..47743
FT                   /locus_tag="Rsph17029_0038"
FT   CDS_pept        46820..47743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0038"
FT                   /product="2-keto-3-deoxygalactonate kinase"
FT                   /EC_number="2.7.1.58"
FT                   /note="PFAM: 2-keto-3-deoxy-galactonokinase; KEGG:
FT                   rsp:RSP_1371 putative 2-dehydro-3-deoxygalactonokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75158"
FT                   /db_xref="GOA:A3PFP2"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFP2"
FT                   /protein_id="ABN75158.1"
FT                   /translation="MRPGWIAADWGTSRLRVWAMGAEGVLAEARSDEGMGQVAAGGFEA
FT                   ALLRLIGPWLGDGPAVPVVVCGMAGARQGWQEAPYRRLPCAPVDPQALVPVPSEDPRIA
FT                   VRIVPGLAQAKPADVMRGEETQIAGALALLGSFDGVICLPGTHSKWAQVSAGEVVSFRS
FT                   FLTGELFALLSERSVLRHGLAAEGWDDEAFLAAVSDGMSHPQKLGAKLFGLRAEALLQD
FT                   LPPATARARLSGLLIGLELVGARSYWLGQPVVLVGEEALAARYGAALAAQGVQARLLPA
FT                   AACTLGGLAAAVGQLTLASSGAGRKA"
FT   gene            complement(47701..49311)
FT                   /locus_tag="Rsph17029_0039"
FT   CDS_pept        complement(47701..49311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0039"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: rsp:RSP_1370 alpha
FT                   amylase, catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75159"
FT                   /db_xref="GOA:A3PFP3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFP3"
FT                   /protein_id="ABN75159.1"
FT                   /translation="MSDWWRGSVTYQIYPRSFQDSDGDGVGDLRGIIERLDHVAWLGAD
FT                   AIWLSPIFPSPMEDMGYDVSDYTAIHPLFGSMEDFDALLARAHELGLKVIIDQVLSHSS
FT                   SAHPFFRESRRSRDNPKADWYVWADAQPDGSPPNNWLSVFGGSAWEWDAQRRQYYLHNF
FT                   LISQPDFNFHNPEVQDWLLDQMRFWLDRGVDGFRLDTVNFYFHDAELRSNRPNPQNGPI
FT                   PPVNAYDMQDHAFSKSRIENIAFLLRMRKLLDDYPDRAMVGEVADGLRGLAIMAEYTSG
FT                   ADRLHMAYTFEMLSRTFTAGHFRSRIEEFFATAPHGWPCWAFSNHDVVRHATRWAGHGA
FT                   EDDVARLAAAMLLSFEGSVSLYQGEELGQTETELLYEELTDPPGLRFWPEEKGRDGCRT
FT                   PMVWDDGPAGGFTTGTPWLPVKPPQLARNVASQKGIPGSVLETYRALLQFRRTQPALIR
FT                   GRSRFFDLPEPMLGFTRTLDGQSLACFFNLGIEPVSATLPGHGGLIGPAQAAVLEGDRL
FT                   TLGANGYAFLPAPEDASVS"
FT   gene            49785..51023
FT                   /locus_tag="Rsph17029_0040"
FT   CDS_pept        49785..51023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0040"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rsp:RSP_1372 major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75160"
FT                   /db_xref="GOA:A3PFP4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFP4"
FT                   /protein_id="ABN75160.1"
FT                   /translation="MTKSPIFTPVLISGCIVLMLGFAIRASFGVFQIPIAEEFDWPRSD
FT                   FSMAIAIQNLAWGIGQPIFGMLAEKFGDRRAIVAGALTYAAGLVLSSFAVTPLQHQFLE
FT                   VLVGFGIAGTGFGVILAVVGRATAPEHRSLALGIATAAGSAGQVFGAPAAEILLGFYSW
FT                   QTVFVIFAGVILAALFALPFMRAPVTATKAELEESLGTVLRRAFRDPSYTLIFVGFFSC
FT                   GYQLAFITAHFPAFVTEMCGAIDPRGPLAALGITTTSALGALAISLIGLANIAGTITAG
FT                   WLGKRYSKKYLLAAIYTGRTLAAALFILVPMTPTTVLLFSLSMGALWLATVPLTSGLVA
FT                   HLYGLRYMGTLYGFVFLSHQLGSFMGVWLGGRMYDMTGDYTMVWWIGVGVGAFSAIVHL
FT                   PIRETRSPALQPA"
FT   sig_peptide     49785..49874
FT                   /locus_tag="Rsph17029_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.833) with cleavage site probability 0.488 at
FT                   residue 30"
FT   gene            51116..52288
FT                   /locus_tag="Rsph17029_0041"
FT   CDS_pept        51116..52288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0041"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rsp:RSP_1373 major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75161"
FT                   /db_xref="GOA:A3PFP5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFP5"
FT                   /protein_id="ABN75161.1"
FT                   /translation="MRAGIACLVLAYVLSQFYRAFLAVLAPTLKAELGVSAEDLAAASG
FT                   IWFLAFALMQFPVGWALDRIGPRLTSMVLLGAGGAGGALVFAQAEGPAALMAAMALIGI
FT                   GCSPVLMASYYIFARSFSPALFGTLAAAVVGIGSLGNIAGSVPLAWAVETFGWRETLMA
FT                   LAGVTLAAAAAIGTLVRDPARVEGPARGSMFDLMRMPALWPVLAMMVVCYAPAAGLRGL
FT                   WIGPYYADAFGAAPAEIGRATLVMGLAMVAGSFAYGPLDRLLGTRKGLILGGNLLTALC
FT                   LLALWAWPAVGGWPALLLFAGIGFFGASFPMVIAHGRAFVPPHLTGRGVTLLNFFGIAS
FT                   PGLMQFATGAVHGSVAPVPPAAPYAALFLFFALFILAGCAIYAVSRDRTD"
FT   gene            52337..53371
FT                   /locus_tag="Rsph17029_0042"
FT   CDS_pept        52337..53371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0042"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   rsp:RSP_1374 putative lipopolysaccharide core biosynthesis
FT                   mannosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75162"
FT                   /db_xref="GOA:A3PFP6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFP6"
FT                   /protein_id="ABN75162.1"
FT                   /translation="MPVQPDRIEVIAPNLKRRLSGVTATIARLVPVQARLIGIAATGPG
FT                   LPADIPHLPLWRLPFLPRDRWRVWHARRNTEMLLGLALRHLLRRRLKLLFTSASQRRHT
FT                   GYTRWLIGRMDALVATSRRTASYLERPAEVILHGIDTDTFRPGDRAEVRARLGLPEAVL
FT                   VGCYGRIRAQKGTDVFVHAMMRLLPERPGVAAVVMGRAVGEHQAFLDGLRREVEAAGLG
FT                   PRILFRPEVTVDRMPDWYRALDLYVAPQRWEGFGLTPLEAMACGVPVVATRVGAFEELV
FT                   SAETGRLVPPGDLEAMTAEVAALLDDADLRRRMAEAARARTLQGFRIEDEAAALVALYR
FT                   RLLA"
FT   gene            53368..53994
FT                   /locus_tag="Rsph17029_0043"
FT   CDS_pept        53368..53994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75163"
FT                   /db_xref="GOA:A3PFP7"
FT                   /db_xref="InterPro:IPR001675"
FT                   /db_xref="InterPro:IPR038578"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFP7"
FT                   /protein_id="ABN75163.1"
FT                   /translation="MTRLGFLLARTFRREAPLAALSLPEEALLARFATERIALVGNARS
FT                   LSQTAFGPEIDAADLVIRLNRAPMPDPASHGTRTDALALATSLQAEALDRLAPRLTLWM
FT                   SPKRKRLPWHVASRRGFYLHSRADYEDLNRRLGAPPSTGLMMIDLLARSRAASVTLYGF
FT                   DFFASLSLTGSRTAAQVPHDFGAEARFVQALLETDPRFTQRGSPP"
FT   gene            54123..55145
FT                   /locus_tag="Rsph17029_0044"
FT   CDS_pept        54123..55145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0044"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase, NAD - binding; Semialdehyde
FT                   dehydrogenase, dimerisation region; KEGG: rsp:RSP_1376
FT                   aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75164"
FT                   /db_xref="GOA:A3PFP8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFP8"
FT                   /protein_id="ABN75164.1"
FT                   /translation="MGYRVVVAGATGNVGREMLNILAEREFPVEEIAALASRKSLGTEV
FT                   SFGDKTLTTKDLDTFDFTGWDIALFAVGSDATKIYAPKAAAAGCVVIDNSSLYRYDPQV
FT                   PLIVPEVNADAIEGYKAKNIIANPNCSTAQMVVALKPLHDRARIKRVVVSTYQSVSGAG
FT                   KAGIDELWNQTKGIYVPGQEVEPSKFTKQIAFNVIPHIDSFMEDGSTKEEWKMVAETKK
FT                   ILDPKVKVTATCVRVPVFVGHSEAINIEFEDFLDEEEARDILREAPGVLVVDKREAGGY
FT                   ITPVECVGEYATYISRIRQDSTLDNGLNLWCVSDNLRKGAALNAVQIAEVLGNRCLKKG
FT                   "
FT   gene            complement(55230..55874)
FT                   /locus_tag="Rsph17029_0045"
FT   CDS_pept        complement(55230..55874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0045"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: rsp:RSP_1377
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75165"
FT                   /db_xref="GOA:A3PFP9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFP9"
FT                   /protein_id="ABN75165.1"
FT                   /translation="MHNARPLPNYLVQRFHGWRATTFADNKSWYRRLSESGQHPRAMVI
FT                   SCCDSRVHVTSIFGADEGEFFIHRNIANLVPPYSPDGKQHGTSAAVEYAVTALGVAHIV
FT                   VLGHSNCGGVKGCHDMCSGKAPQLEETSSFVGRWMDILRPGYERVKDLPEEERVTALEK
FT                   EAVLVSIGNLMTFPFVREAVEREVLTLHALWTHIGEGSLEQYTPGQGFVPV"
FT   gene            56013..56396
FT                   /locus_tag="Rsph17029_0046"
FT   CDS_pept        56013..56396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1378 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75166"
FT                   /db_xref="GOA:A3PFQ0"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFQ0"
FT                   /protein_id="ABN75166.1"
FT                   /translation="MACMIMALRPVDRVRQDAEPIAAMYREMGTKAAEQIVHRAFAELA
FT                   MTIAALSHQVRMRDRAEIPRRLRRLQRMCENLGMVSLGLVAADARGAVELGDMTAFAAI
FT                   WARLLRVAERSLASDKELLDLSL"
FT   gene            56467..57852
FT                   /locus_tag="Rsph17029_0047"
FT   CDS_pept        56467..57852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0047"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17, leucyl aminopeptidase domain
FT                   protein; KEGG: rsp:RSP_1379 cytosol aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75167"
FT                   /db_xref="GOA:A3PFQ1"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFQ1"
FT                   /protein_id="ABN75167.1"
FT                   /translation="MPLSFADPAAVSRPVHVVASDALADWLGGRTEAERAWLAATGFEA
FT                   SLGELRLLPDAAGGVAAAVLGSGTARARARSRFGLARGLAALPEGDWHLEGDLSPEAAA
FT                   EAALGWLLSAYAFTRYRAAAKSPKARLKLPAGCDGARLMAMAEAEALTRDLINTPASDL
FT                   GPQELEEAFLALADRFGAETAVIRGDKLLDRNLPMIHAVGRASTRAPRLLEMRWGERGP
FT                   RVTLVGKGVCFDTGGLDIKPSTGMLLMKKDMGGAATVMGLAQMIMALELPVRLRVLVPA
FT                   VENAISGNAMRPKDILTSRKGLTVEVNNTDAEGRLILGDALTLADEEEADLIVSMATLT
FT                   GAARVAVGPDLAPFYTDDEDLAAALQSAAGPACDPVWRLPFWEPYEALIEPGIADLDNA
FT                   PSGGFAGSITAALFLRRFVENPRYMHFDIYGHTPADAPARPKGGVGQGARAILTALPRM
FT                   LGL"
FT   gene            57852..58664
FT                   /locus_tag="Rsph17029_0048"
FT   CDS_pept        57852..58664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0048"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: rsp:RSP_1380
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75168"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFQ2"
FT                   /protein_id="ABN75168.1"
FT                   /translation="MDRRTTPCSGEVAHVSLKGQVAAPRFTDGTPARIGLPVVDLLARP
FT                   DGPRDRQLLLGEDFLVIDRREGHAFGRAAKDGYCGWLPEAALAAPETVTHRVAVPATHL
FT                   YPEPRVQAHEIAALSFGARLTVIGEARNFLQTTMGWVPACHLWPLDRLHSDPVAVARFF
FT                   HGTPYLWGGNSRAGIDCSGLAQAALLACGMDCPGDSDLQQTVGTEVSGDLQAGDLLFWK
FT                   GHVAMAIDAQRMIHATGYVMGVIEEETEAAIARIAAAGEGPVLARRRP"
FT   gene            complement(58771..59991)
FT                   /locus_tag="Rsph17029_0049"
FT   CDS_pept        complement(58771..59991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0049"
FT                   /product="protein of unknown function DUF1006"
FT                   /note="PFAM: protein of unknown function DUF1006; KEGG:
FT                   rsp:RSP_1381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75169"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFQ3"
FT                   /protein_id="ABN75169.1"
FT                   /translation="MILPNPLARRLFLHLHALAEPPTGPAKGEALLALIDRLGFVQIDS
FT                   ISTVARAHHMILFARRQAYRPEALDRLLAQRHLFEHWTHDAAVIPARFFPFWHHRFRRD
FT                   RPRLLARWRGWQREGFEEQFDAVLARIAESGPVSAAEVGEEEERGTGGWWDWHPSKAAL
FT                   EYLWRVGELSITRRDSFRKVYDLTSRVIPSGWLAMDPGDAATIHWACSEALDRLGFATS
FT                   GELAAFWAAASPAEAQAWCHDALARGEIVEVRVEGADGSLRRSYARPEVAALAEAAPDP
FT                   SPRLRILSPFDPVLRDRARAERLFGFRYRIEVFVPEAKRTYGYYVFPILEGDRLIGRID
FT                   MRAHRESGSLRVRALWPELGVRLGSRRLGRLGAELDRLAQFAGCDQVKFEPDWLRETLP
FT                   EGSVAGD"
FT   gene            complement(60006..61184)
FT                   /locus_tag="Rsph17029_0050"
FT   CDS_pept        complement(60006..61184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0050"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="TIGRFAM: radical SAM enzyme, Cfr family; PFAM:
FT                   Radical SAM domain protein; KEGG: rsp:RSP_1382 radical SAM
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75170"
FT                   /db_xref="GOA:A3PFQ4"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PFQ4"
FT                   /protein_id="ABN75170.1"
FT                   /translation="MTANAPITQDVMTLPRKLPEGGPVNIVGLTREELLAALVAAGTPE
FT                   RQAKMRAGQVWQWVYHWGVRDFAQMTNLAKDYRALLAEHFAIVLPEVVTRQISADGTRK
FT                   YLIRIAGGHEVETVYIPEEGRGTLCVSSQVGCTLTCSFCHTGTQKLVRNLTAAEIVGQL
FT                   MLVRDDLGEWPERGAPKDETRLVSNLVLMGMGEPLYNFENVRNAMKVVMDGEGLSLSRR
FT                   RITLSTSGVVPEIARTAEEIGCQLAISFHATTDEVRDILVPINKRWNIRTLLDSLRDYP
FT                   RLSNSERITFEYVMLDGVNDTDADARRLVKLISGIPSKINLIPFNEWPGAPYRRSTPER
FT                   IAAFADIIYKAGYASPIRTPRGEDIMAACGQLKSATERARKSRAQIAAETGL"
FT   gene            complement(61323..61853)
FT                   /locus_tag="Rsph17029_0051"
FT   CDS_pept        complement(61323..61853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75171"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFQ5"
FT                   /protein_id="ABN75171.1"
FT                   /translation="MRTTKGRLLPAAAIVLACLATGAAAQESTNRVATKTDWSVFAESS
FT                   PKECWGVSSPKQTQATRDGKAVDVRRGDILLFVTYRPGSGAKGEISFTGGYPFAPGSTV
FT                   NVDIGGTKFELFTDGEWAWPANAQDDASLLASMKRGSTAVLTARSARGTQTKDTFSLSG
FT                   FTAAMSDAETRCK"
FT   sig_peptide     complement(61776..61853)
FT                   /locus_tag="Rsph17029_0051"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 26"
FT   gene            62020..63009
FT                   /locus_tag="Rsph17029_0052"
FT   CDS_pept        62020..63009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0052"
FT                   /product="L-asparaginase II"
FT                   /note="PFAM: L-asparaginase II; KEGG: rsp:RSP_1384
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75172"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFQ6"
FT                   /protein_id="ABN75172.1"
FT                   /translation="MTDPARMVELWRGGLLESWHTGHAAVWSADGGLVEAWGDPGTVIF
FT                   PRSSCKMMQALPLLESGAGAGLSSQRLALACSSHQGAELHTGHVGRWLTDLGLCEADLR
FT                   CGAHMPADTAERDRLVRAYEEPCQIHNNCSGKHAGFLMLSQHLKAGPEYVEIDHPVQQA
FT                   VRTAFEEVTDEASPGYGIDGCSAPNFATTVAGLARAMAFFAGASAGGGVRERSAARLVE
FT                   AMIAHPELVAGEGRACTELMRAMGGRAAIKTGAEAVFVAIVPEKRLGIALKIVDGSTRA
FT                   SEAAIAALLVRHGLLDPAHPAARKRLDAVQTNWRGRETGILRAAPGFP"
FT   gene            complement(63025..63864)
FT                   /locus_tag="Rsph17029_0053"
FT   CDS_pept        complement(63025..63864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0053"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: rsp:RSP_1385
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75173"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFQ7"
FT                   /protein_id="ABN75173.1"
FT                   /translation="MKTLLSLGHGYSAQALAHRLLPQGWTVIGTTRSAAKAAELEAGGI
FT                   EPLLWPGDLGPALARASHILASAAPGREGDPFLATHGAELARAGARWVGYLSTTGVYGD
FT                   HAGGWVDEDTPLTPSTERGQARVQAERQWQALGLPLHIFRLAGIYGPGRGPFEKVRDGT
FT                   ARRIVKPGQVFSRIHVADIAQVLEASMQHPEPGAIYNVCDDDPAPPEDVLGYAAELLGL
FT                   PPPPEVPYDAAEMTPMARSFYAESKRVRNDRIKARLGIALLHPDYRSGLRSLLAGGD"
FT   gene            63999..65477
FT                   /locus_tag="Rsph17029_0054"
FT   CDS_pept        63999..65477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0054"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /note="KEGG: rsp:RSP_1387 AMP nucleosidase; TIGRFAM: AMP
FT                   nucleosidase; PFAM: purine and other phosphorylases, family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75174"
FT                   /db_xref="GOA:A3PFQ8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFQ8"
FT                   /protein_id="ABN75174.1"
FT                   /translation="MSDAPLLLLVPEVPDRETFTDPARAVDRLEEIYIRSTRFLSGHFS
FT                   ASATGGQPGGRVRAYYPEIRLTTTSFTRADSRLSFGHVAEPGSYSTTVTRPDLFRNYLI
FT                   QQIDLLMQNHGVPVEIGVSATPMPVHFAVANDPTVSVPQEGVLSYPLRDVFDVPDLSTT
FT                   NDDIVNGSRLSNSDGSKPLAPFTAQRVDYSLARLTHYTATNPRHFQNHVLFTNYQFYVD
FT                   EFEAIGRAALADPASGYSAFVGPGDQEITDPETPLALLPRLPQMPTYHLKRPDGQGITL
FT                   VNIGVGPSNAKTATDHIAVLRPHAWLMVGHCAGLRNSQSLGDFVLAHAYLREDHVLDDD
FT                   LPVWVPIPALAEIQIALEDAVEEVTQLQGYELKRIMRTGTVATIDNRNWELRDQSGPVQ
FT                   RLSQSRAVALDMESATIAANGFRFRVPYGTLLCVSDKPLHGELKLPGMASDFYRTQVAR
FT                   HLRIGIRAMEMLRETPIERIHSRKLRSFEETAFL"
FT   gene            65606..65893
FT                   /locus_tag="Rsph17029_0055"
FT   CDS_pept        65606..65893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0055"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: rsp:RSP_1388 DNA-binding protein HU, form N"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75175"
FT                   /db_xref="GOA:A3PFQ9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFQ9"
FT                   /protein_id="ABN75175.1"
FT                   /translation="MSKPMTKTQLVATLADEMGSDKKTANAALDAIASIVAREVAAGGA
FT                   VTLPGLGKVVCRERPERQVRNPATGEQVTKAADKQVKFTIAKALKDSVNA"
FT   gene            65963..66844
FT                   /locus_tag="Rsph17029_0056"
FT   CDS_pept        65963..66844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0056"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rsp:RSP_1390 putative transporter, DMT
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75176"
FT                   /db_xref="GOA:A3PFR0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFR0"
FT                   /protein_id="ABN75176.1"
FT                   /translation="MDLRSIGMGLAFAFMWSSAFASARIIVAQAPPLSALSLRFLCSGL
FT                   IALALGAALGQSARLSPAQWRGVVIFGLCQNALYLGLNFVAMRWVSASFAAIVASTMPL
FT                   LVALAGWIFLHERLRPVTALGLLAGMAGVALIMGTRLSGGEDALGFLLCAAGVIALTAA
FT                   TLTVRVASSGGNLLMIVGLQMLVGSAALAPAALLTETPLEVQWSGSLVAAFAYTTLVPG
FT                   LLATWVWFLLVGRIGAVRGATFHFLNPFFGVAVAAVLLGERMGIWDVAGVVVIAAGILA
FT                   VQLSRVPEAARR"
FT   sig_peptide     65963..66028
FT                   /locus_tag="Rsph17029_0056"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.713 at
FT                   residue 22"
FT   gene            complement(66841..67941)
FT                   /locus_tag="Rsph17029_0057"
FT   CDS_pept        complement(66841..67941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0057"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase; KEGG: rsp:RSP_1389
FT                   chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75177"
FT                   /db_xref="GOA:A3PFR1"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PFR1"
FT                   /protein_id="ABN75177.1"
FT                   /translation="MSYNTFGHIFRVTTWGESHGPALGATVDGCPPGVAIEAEAIQHWL
FT                   DRRKPGQNRFTTQRQEPDAVRILSGTFEGRSTGTPIQLMIENTDQRSKDYGEIARSFRP
FT                   GHADIAYHWKYGLRDYRGGGRSSARETAARVAAGGVARAALAALVPGLRIEGYMVQIGP
FT                   HAIDRARFDADEIERNPFWCPDSDTAALWADYLDGLRKAHDSVGAIVEVRASGVPAGLG
FT                   APIYGKLDSDLAAAMMTINAVKGVEIGEGMAAACLTGSANADEIRMGPEGPEFLTNHAG
FT                   GILGGISTGQDVVVRFAVKPTSSILTPRRSVTTDGCEVEVVTKGRHDPCVGIRAVPVGE
FT                   AMMACVLLDHLLLDRGQTGGLRGTIG"
FT   misc_binding    68054..68153
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 77.13"
FT   gene            68188..69171
FT                   /locus_tag="Rsph17029_0058"
FT   CDS_pept        68188..69171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0058"
FT                   /product="ABC transporter, periplasmic binding protein,
FT                   thiB subfamily"
FT                   /note="TIGRFAM: ABC transporter, periplasmic binding
FT                   protein, thiB subfamily; thiamine ABC transporter,
FT                   periplasmic binding protein; KEGG: rsp:RSP_1391 ABC
FT                   thiamine transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75178"
FT                   /db_xref="GOA:A3PFR2"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFR2"
FT                   /protein_id="ABN75178.1"
FT                   /translation="MRLPIVASCVALAAGTAAAETPVLTVLTYDSFTSEWGPGPAVEKA
FT                   FEETCACDLRFVAAGDGAALLARLQLEGARSEADVVLGLDTNLTAAAAATGLFAPHGVS
FT                   TPLDLPVAWEDPLFLPFDWGWFAFVHDRRMEDVPASFEELAASDSKIVIQDPRSSTPGL
FT                   GLLMWVKAAYGDRAPEIWEGLADNIVTVTPGWSEAYGLFMEGEADMVLSYTTSPAYHLI
FT                   AEEDDTKTAAAFREGHYLQVEVAGKLAATDQPELADRFMAFLLEEPVQSVLPTTNWMYP
FT                   AKLPAAGLPEGFETLVQPETSLLLSADEALALRPEALAEWQDALAR"
FT   sig_peptide     68188..68247
FT                   /locus_tag="Rsph17029_0058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.973 at
FT                   residue 20"
FT   gene            69147..70661
FT                   /locus_tag="Rsph17029_0059"
FT   CDS_pept        69147..70661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0059"
FT                   /product="thiamine ABC transporter membrane component"
FT                   /note="KEGG: rsp:RSP_1392 thiamin ABC transporter membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75179"
FT                   /db_xref="GOA:A3PFR3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFR3"
FT                   /protein_id="ABN75179.1"
FT                   /translation="MARRAGALIVAAALAALTLGPLALVMARAGGGALGPADWAAVRFT
FT                   VLQAALSAVVSVLLAVPVARALARRTFPGRRLMIALLGAPFLLPVIVAVLGLIAVFGRA
FT                   GLLNRGLEAVGLPALSIYGLHGVVLAHVFFNMPFAVRLILQGWLAIPSERFRLAAALGF
FT                   RPADVARHLEWPMLRAVVPGVALVVFVICLSSFAVALTLGGGPRATTVELAIYQALRFE
FT                   FDLGRAALLAALQFALCGAAVLATGVLSLPSAFGAGLDRAPVPLAPGGWRRGADGMALA
FT                   LAAAFLLLPLGMVAARGAPGLLHLPSDVWAAAARSLAVALPSAALSVTGALVLALAGPR
FT                   FGLVATLPLAASSLVLGTGLFLAVHPVLNPTLVALPVTMLVNATLTLPFAYRILAPEAR
FT                   ALEADYGRLAAALGLGGMARLRWLTLPRLRRPLGFALGVASALAMGDLGVIALFAAEGG
FT                   ATLPLLVQRLMGAYRLEEAAGAALLLVLTSFALFWIFDRGGRHAAS"
FT   sig_peptide     69147..69236
FT                   /locus_tag="Rsph17029_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.508 at
FT                   residue 30"
FT   gene            70648..71343
FT                   /locus_tag="Rsph17029_0060"
FT   CDS_pept        70648..71343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0060"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsp:RSP_1393 ABC thiamine transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75180"
FT                   /db_xref="GOA:A3PFR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFR4"
FT                   /protein_id="ABN75180.1"
FT                   /translation="MLHLDRLLIRQGDFTLRADATACAGERIAVIGPSGGGKSTLLMAI
FT                   AGFLAPAEGRILWQGRDLGPLGPGERPVSLLFQDQNLFPHLTLRENLGLGISPALRLAA
FT                   GDRARIAEALERVGLAGLGEAKPGRLSGGQQGRAALARALLRARPILLLDEPFAALGPA
FT                   LKAEMLALVSEIAAETGATVLMVTHDPEDARRFAHRTILVADGRAEAPQPTAALFADPP
FT                   PALRAYLGP"
FT   gene            complement(71393..72250)
FT                   /locus_tag="Rsph17029_0061"
FT   CDS_pept        complement(71393..72250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0061"
FT                   /product="cytochrome c1"
FT                   /note="PFAM: cytochrome c1; KEGG: rsp:RSP_1394 cytochrome
FT                   c1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75181"
FT                   /db_xref="GOA:A3PFR5"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFR5"
FT                   /protein_id="ABN75181.1"
FT                   /translation="MIRKLTLTAATALALSGGAAMAAGGGHVEDVPFSFEGPFGTFDQH
FT                   QLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDRE
FT                   GKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEE
FT                   PPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGH
FT                   DASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVKGKK
FT                   KTNV"
FT   sig_peptide     complement(72182..72250)
FT                   /locus_tag="Rsph17029_0061"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(72268..73605)
FT                   /locus_tag="Rsph17029_0062"
FT   CDS_pept        complement(72268..73605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0062"
FT                   /product="Cytochrome b/b6, N-terminal domain"
FT                   /note="PFAM: Cytochrome b/b6, N-terminal domain; Cytochrome
FT                   b/b6, C-terminal domain; KEGG: rsp:RSP_1395 cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75182"
FT                   /db_xref="GOA:A3PFR6"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFR6"
FT                   /protein_id="ABN75182.1"
FT                   /translation="MSGIPHDHYEPRTGIEKWLHSRLPIVALAYDTIMIPTPRNLNWMW
FT                   IWGVVLAFCLVLQIVTGIVLAMHYTPHVDLAFASVEHIMRNVNGGFMLRYLHANGASLF
FT                   FIAVYLHIFRGLYYGSYKAPREVTWIVGMLIYLAMMATAFMGYVLPWGQMSFWGATVIT
FT                   GLFGAIPGIGHSIQTWLLGGPAVDNATLNRFFSLHYLLPFVIAALVAIHIWAFHSTGNN
FT                   NPTGVEVRRTSKAEAQKDTVPFWPYFIIKDVFALAVVLLVFFAIVGFMPNYLGHPDNYI
FT                   EANPLSTPAHIVPEWYFLPFYAILRAFTADVWVVQIANFISFGIIDAKFFGVLAMFGAI
FT                   LVMALVPWLDTSPVRSGRYRPMFKIYFWLLAADFVILTWVGAQQTTFPYDWISLLASAY
FT                   WFAYFLVILPILGAIEKPVAPPATIEEDFNAHYSPATGGTKTVVAE"
FT   gene            complement(73616..74179)
FT                   /locus_tag="Rsph17029_0063"
FT   CDS_pept        complement(73616..74179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0063"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="KEGG: rsp:RSP_1396 ubiquinol-cytochrome c reductase,
FT                   iron-sulfur protein; TIGRFAM: ubiquinol-cytochrome c
FT                   reductase, iron-sulfur subunit; PFAM: Rieske [2Fe-2S]
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75183"
FT                   /db_xref="GOA:A3PFR7"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFR7"
FT                   /protein_id="ABN75183.1"
FT                   /translation="MSNAEDHAGTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQ
FT                   ALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANID
FT                   AGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIR
FT                   KGPAPENLPIPLAKFIDETTIQLG"
FT   gene            complement(74685..75293)
FT                   /locus_tag="Rsph17029_0064"
FT   CDS_pept        complement(74685..75293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0064"
FT                   /product="glutathione S-transferase"
FT                   /note="KEGG: rsp:RSP_1397 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75184"
FT                   /db_xref="GOA:A3PFR8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFR8"
FT                   /protein_id="ABN75184.1"
FT                   /translation="MRLYASATSPFVRKVDVVLHETGLFGKVERILSGGTPVDPGNLPL
FT                   ALNPLGKIPVLARDDGPALYDSRVICRYLDSVANAGLYPAPPRLWDALTLEATADGILE
FT                   AAVLMVYESRIRPEEKRHEPWVEGQWSKIARALEAVEARWMSQLQGPLDIGQIAMGCAL
FT                   DYLDFRHGPRDWRAARPLLAEWAGSFSQRSSMLATVPVA"
FT   gene            complement(75298..75591)
FT                   /locus_tag="Rsph17029_0065"
FT   CDS_pept        complement(75298..75591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75185"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFR9"
FT                   /protein_id="ABN75185.1"
FT                   /translation="MPLPLVPLAAFALRTGAVAGAVWLVRRALVPGRTDQRAEDALDDL
FT                   GEGLSLHRPADRALEGARQTNAAGRFRRTLTWAGGGVEIDAAWLARLRIRRT"
FT   sig_peptide     complement(75532..75591)
FT                   /locus_tag="Rsph17029_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.880 at
FT                   residue 20"
FT   gene            complement(75722..75847)
FT                   /locus_tag="Rsph17029_0066"
FT   CDS_pept        complement(75722..75847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0066"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="TIGRFAM: ribosomal protein L36; KEGG: rsp:RSP_1398
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75186"
FT                   /db_xref="GOA:A3PFS0"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PFS0"
FT                   /protein_id="ABN75186.1"
FT                   /translation="MKVANSLRSLKLRHRDCQVVRRKGRVYVINKTQKRYKARQG"
FT   gene            complement(75917..75991)
FT                   /locus_tag="Rsph17029_R0001"
FT                   /note="tRNA-Val2"
FT   tRNA            complement(75917..75991)
FT                   /locus_tag="Rsph17029_R0001"
FT                   /product="tRNA-Val"
FT   gene            76144..77004
FT                   /locus_tag="Rsph17029_0067"
FT   CDS_pept        76144..77004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0067"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="PFAM: N-formylglutamate amidohydrolase; KEGG:
FT                   rsp:RSP_1399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75187"
FT                   /db_xref="GOA:A3PFS1"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFS1"
FT                   /protein_id="ABN75187.1"
FT                   /translation="MTPEAYSLIRPERRDTSVIFSSPHSGRDYPASLVGRTILDERMLR
FT                   SSEDAFVDELFSCAPRLGAPLLMARVPRAYVDMNRSADEMDPALIEGISRAPHNPRVSS
FT                   GLGVIPRVVANGRPIYRGKMPLAEAEARIARYWTPYHQALRTLIDESQALFDEAVLVDC
FT                   HSMPHEAIETHARPGQPTPEVVLGDRFGAAASRAVVDRIEAAFVSAGLRVVRNAPFAGA
FT                   YIAQAYGRPSRNQHVVQVEVDRSLYMDEARIERSARFPAFAALMTSVVAEITGIGRPAL
FT                   PLAAE"
FT   gene            complement(77008..78261)
FT                   /locus_tag="Rsph17029_0068"
FT   CDS_pept        complement(77008..78261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0068"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   rsp:RSP_1400 DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75188"
FT                   /db_xref="GOA:A3PFS2"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFS2"
FT                   /protein_id="ABN75188.1"
FT                   /translation="MPALCRDCLTPFDGGTRCPACRSPRVTAHPELFSLSIAHMDCDAF
FT                   YASVEKRDDPSLRDKPLIVGGGSRGVVSTCCYIARISGVRSAMPMFQALKLCPEATVVK
FT                   PRIDVYAGVSRQIRAMMEDLTPAIEPLSLDEAFLDLSGTERLHGAPPAVLLARLLRRME
FT                   EELGITGSVGLSHNKFLAKIASDLDKPRGFSVIGRAETDAFLRKKPVRIIWGVGTATQS
FT                   ALERAGIRTIEDLLRWEKADLVARFGQTGERLWHLARGEDRRRVSADHALKSVSKETTF
FT                   HEDTADPEILDGHLWRLAEQVSDRAKARGLSGRTVTLKLKRTDFALVTRRHALAGPTQS
FT                   ADRIYREARALFDGARTAGPFRLIGVGISDLAGAAEADLTGDLLDPNAGRRIAAERATD
FT                   AIRARFGHDAIIKGRSLR"
FT   gene            78388..79269
FT                   /locus_tag="Rsph17029_0069"
FT   CDS_pept        78388..79269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0069"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: rsp:RSP_1401 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75189"
FT                   /db_xref="GOA:A3PFS3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFS3"
FT                   /protein_id="ABN75189.1"
FT                   /translation="MDPADFIGGNAVLLALAAFLILCVFLGVRIVPQSQKHVVERFGRL
FT                   RAVLGPGINFVVPFLDVVAHKISVLERQLPNAMQDAITADNVLVKVETSVFYRITEPEK
FT                   TVYRIRDVDAAIATTVAGIVRSEIGKLELDQVQSNRADLIQKVREQVAAMVDDWGIEVT
FT                   RAEVLDVNLDDATRAAMLQQLNAERARRALVTEAEGRKRAVELNADAELYAAEQEAKAR
FT                   RVLADAEAYATGVIAEAIRENGIEAAQYQVALKQVEALTAVGQGDAKQLIVVPASAMDA
FT                   FADAFRMLKGRA"
FT   gene            79266..79535
FT                   /locus_tag="Rsph17029_0070"
FT   CDS_pept        79266..79535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0070"
FT                   /product="conserved hypoothetical protein"
FT                   /note="KEGG: rsp:RSP_6157 conserved hypoothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75190"
FT                   /db_xref="GOA:A3PFS4"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFS4"
FT                   /protein_id="ABN75190.1"
FT                   /translation="MIWSVWWIWVVAGLLLGIVEILVPGFVFLGFAVGAVAIGLLIWIG
FT                   LEAGLPLLLVLFALMSLAVWLALRRMFGLPSGSVKIWDRDINDN"
FT   gene            79844..80179
FT                   /locus_tag="Rsph17029_0071"
FT   CDS_pept        79844..80179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1403 conserved hypoothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75191"
FT                   /db_xref="GOA:A3PFS5"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFS5"
FT                   /protein_id="ABN75191.1"
FT                   /translation="MSDYRRDPTPNNRTTAERPVEGSASRTMWYVVGAVIVLLLVLWFL
FT                   FGGMSATNDATMTTPPAATTTTEPAAPPPATAPAPEATTPAPAEPAPEAAPATPAPDAT
FT                   APAAPAQ"
FT   gene            complement(80184..80882)
FT                   /locus_tag="Rsph17029_0072"
FT   CDS_pept        complement(80184..80882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0072"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="KEGG: rsp:RSP_1404 orotidine 5'-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75192"
FT                   /db_xref="GOA:A3PFS6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFS6"
FT                   /protein_id="ABN75192.1"
FT                   /translation="MADDRLIVALDVPNVVQGLDLAERLGDAVSFYKIGLGMLTGGGLA
FT                   LANELKQEQGKRIFLDMKLFDIGATVEAAVRGFASYDLDFLTVHGDPQVVRAAVQGASG
FT                   SGLRILAVTVLTSLDRADLDANMIRAGDLAEITLERAARALDAGAHGVIASPQEAAAIR
FT                   ALPQAAGRLIVTPGVRPTGAALGDQKRVATPARAIADGADHIVVGRPIWQAGDPRAAAL
FT                   AVQAELPTRG"
FT   gene            80986..81873
FT                   /locus_tag="Rsph17029_0073"
FT   CDS_pept        80986..81873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0073"
FT                   /product="N-acetylglucosamine kinase"
FT                   /EC_number="2.7.1.59"
FT                   /note="PFAM: ROK family protein; KEGG: rsp:RSP_1405 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75193"
FT                   /db_xref="GOA:A3PFS7"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFS7"
FT                   /protein_id="ABN75193.1"
FT                   /translation="MLIAFDIGGSRIRAARAFAPDDLEPLGERPMPLSFPGFVAALRDL
FT                   MPEEATSLAIAIAGVVDPDTGRITAANLPAVNQRALAADLCAALGRPVWIGNDADCFVL
FT                   TEALLGVGRGHRSVFGIILGSGVGGGIVLDGRLLTGAGGIAGEWGHAPVLDQRPLGRDL
FT                   PHLPCGCGQSGCVDTYGSARGIERLHLALCGQRLDSREILAAWRAGEMAAAETVEVWLE
FT                   LVAGPLAMLVNVIGPSVVPVGGGLSNDGDLVAALDRAVRHRLLRPASETLLRPAFHPEP
FT                   GLVGAALAGLQALG"
FT   gene            complement(81887..82120)
FT                   /locus_tag="Rsph17029_0074"
FT   CDS_pept        complement(81887..82120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75194"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFS8"
FT                   /protein_id="ABN75194.1"
FT                   /translation="MRILSATIERAHYARDFGQVEATVALLVKDSARPVPYVRRIFTTE
FT                   PARGAAPLRERLIDSAKTLFLARYEPQVDRAA"
FT   gene            82423..85035
FT                   /locus_tag="Rsph17029_0075"
FT   CDS_pept        82423..85035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0075"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: rsp:RSP_1408 chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75195"
FT                   /db_xref="GOA:A3PFS9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFS9"
FT                   /protein_id="ABN75195.1"
FT                   /translation="MNLEKFTERSRGFLQAAQTIAMRESHQRLAPEHLLKALMDDDQGL
FT                   ASNLIRRSGGEPARVAETVELTIAKLPKVSGDAQPFMDPGLVRVLDEAEKLAKKAGDSF
FT                   VPVERILMALAMVASKAKDALDAGAVTAQKLNAAINDIRKGRTADTASAEEGYDALKKY
FT                   ARDLTQAARDGKIDPIIGRDDEIRRAMQVLSRRTKNNPVLIGEPGVGKTAIAEGLALRI
FT                   VNGDVPESLKNKRLLSLDMGALIAGAKYRGEFEERLKAVLNEVTSAAGEIILFIDEMHT
FT                   LVGAGKSEGAMDAANLIKPALARGELHCIGATTLDEYRKHVEKDAALARRFQPLMVEEP
FT                   TVEDTISILRGIKEKYELHHGVKIADAALVAAATLSHRYITDRFLPDKAIDLVDEAASR
FT                   LRMEVDSKPEELDALDRQILQAQIEAEALKKEDDAASKDRLAKLEKELSGMTERAAEMT
FT                   AQWQAERDKLEAARDLKEQLDRARAELEQVKREGNLARAGELSYGVIPQIEKKLEEAEA
FT                   REGDLLVSEAVRPEQIAEVVERWTGIPTSKMLEGEREKLLKMEEELGRRVIGQRAALRA
FT                   VANAVRRARAGLNDERRPLGSFLFLGPTGVGKTELTKAVAEYLFDDDQAMVRIDMSEFM
FT                   EKHSVARLIGAPPGYVGYDEGGVLTEAVRRRPYQVVLFDEVEKAHPEVFNVLLQVLDDG
FT                   VLTDGQGRTVDFKQTLIILTSNLGAYALSQLPEGADPAPARAAVMEAVRGHFRPEFLNR
FT                   LDEMVIFDRLSRDDMGQIVEIQLGLLGKRLATRKIGLELDAAAKQWLADEGYDPVYGAR
FT                   PLKRVIQRHLQDPLAEMILAGDVLDGSVVQVSAGADGLIIGDRVSSSRRERPQDAVVH"
FT   gene            complement(85096..85566)
FT                   /locus_tag="Rsph17029_0076"
FT   CDS_pept        complement(85096..85566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0076"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="PFAM: beta-Ig-H3/fasciclin; KEGG: rsp:RSP_1409
FT                   beta-Ig-H3/fasciclin"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75196"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFT0"
FT                   /protein_id="ABN75196.1"
FT                   /translation="MRKTLLALSLGLLAAPAFAETGDIVKTATGAGSFTTLLTAAEAAG
FT                   LVDTLKGEGPFTVFAPTDAAFAALPEGTVEDLLKPENKEKLTEILTYHVVPGEVMSSDL
FT                   TEGMTAETVEGGALTVTLEGGPKVNGVAISQPDVDASNGVIHVIDGVLMPGA"
FT   sig_peptide     complement(85507..85566)
FT                   /locus_tag="Rsph17029_0076"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            85763..86668
FT                   /locus_tag="Rsph17029_0077"
FT   CDS_pept        85763..86668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0077"
FT                   /product="oxidoreductase, molybdopterin binding"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding; KEGG:
FT                   rsp:RSP_1410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75197"
FT                   /db_xref="GOA:A3PFT1"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFT1"
FT                   /protein_id="ABN75197.1"
FT                   /translation="MRRLGWSDVTPRADWLNRRQILAGAGALGLAGPAFARIEAKASRF
FT                   STDEKPNSFEEISNYNNFYEFGLDKGDPAQNAGALTVDPWSVEIGGLVERPGAYPLDDI
FT                   LKGVTLEERIYRLRCVEGWSMVVPWIGFELRTLLERAGVQPGARFVAFETLVRPEEMPG
FT                   VRSRILDWPYREGLRIDEAMHPLTILATGLYGEEMPKQNGAPIRLVVPWKYGFKSIKSI
FT                   VRISLVEKMPATSWNMQNAREYGFYSNVNPAVDHPRWSQASERRIGSGFFAPRIETQLF
FT                   NGYGDQVAQLYAGQDLSVDF"
FT   sig_peptide     85763..85873
FT                   /locus_tag="Rsph17029_0077"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.991 at
FT                   residue 37"
FT   gene            86669..87274
FT                   /locus_tag="Rsph17029_0078"
FT   CDS_pept        86669..87274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0078"
FT                   /product="Ferric reductase domain protein transmembrane
FT                   component, N-terminal domain"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component, N-terminal domain; KEGG: rsp:RSP_1411
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75198"
FT                   /db_xref="GOA:A3PFT2"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFT2"
FT                   /protein_id="ABN75198.1"
FT                   /translation="MIAQRINGALRPVPTGLVYAAGLLPLGLLVWQAATGGLGVDPVKG
FT                   IEHRLGELALQFLVGGLVISPLRWWTGINLIRFRRAVGLLAFFYVCLHLAVWLALDLQF
FT                   RWAEIGADIAKRPYITLGMLAFAAMIPLALTSNNGAIRRMGAAAWTRLHKLTYAVALLG
FT                   ALHFLLLVKAWPLEPILYMAGVVALLSMRLWRTLRRRA"
FT   gene            complement(87359..87685)
FT                   /locus_tag="Rsph17029_0079"
FT   CDS_pept        complement(87359..87685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_3837 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75199"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFT3"
FT                   /protein_id="ABN75199.1"
FT                   /translation="MPSYRSNVTHKTVKLSPTSSPKLVSRYASGPPSKRPNRPHIPSSS
FT                   SMSKSTEDKTNRDASQPAIPSASSSRFPKASRQHSRLSTPSPSPFRFGEALSREPQKNP
FT                   QEEK"
FT   gene            87772..89231
FT                   /locus_tag="Rsph17029_R0002"
FT   rRNA            87772..89231
FT                   /locus_tag="Rsph17029_R0002"
FT                   /product="16S ribosomal RNA"
FT   gene            89452..89528
FT                   /locus_tag="Rsph17029_R0003"
FT                   /note="tRNA-Ile1"
FT   tRNA            89452..89528
FT                   /locus_tag="Rsph17029_R0003"
FT                   /product="tRNA-Ile"
FT   gene            89576..89651
FT                   /locus_tag="Rsph17029_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            89576..89651
FT                   /locus_tag="Rsph17029_R0004"
FT                   /product="tRNA-Ala"
FT   gene            90067..92815
FT                   /locus_tag="Rsph17029_R0005"
FT   rRNA            90067..92815
FT                   /locus_tag="Rsph17029_R0005"
FT                   /product="23S ribosomal RNA"
FT   gene            92917..93030
FT                   /locus_tag="Rsph17029_R0006"
FT   rRNA            92917..93030
FT                   /locus_tag="Rsph17029_R0006"
FT                   /product="5S ribosomal RNA"
FT   gene            93075..93151
FT                   /locus_tag="Rsph17029_R0007"
FT                   /note="tRNA-Met1"
FT   tRNA            93075..93151
FT                   /locus_tag="Rsph17029_R0007"
FT                   /product="tRNA-Met"
FT   gene            complement(93108..93380)
FT                   /locus_tag="Rsph17029_0080"
FT   CDS_pept        complement(93108..93380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75200"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFT4"
FT                   /protein_id="ABN75200.1"
FT                   /translation="MMSCDHQGCGSRGRCRTKAGGPGGGGVARGHGALVVRYDAAARRH
FT                   WVELRGKLLEMLQKANPAGGAGYVGSVGSLELVAGAGFEPAAFRL"
FT   gene            complement(93400..94098)
FT                   /locus_tag="Rsph17029_0081"
FT   CDS_pept        complement(93400..94098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75201"
FT                   /db_xref="GOA:A3PFT5"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR031723"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFT5"
FT                   /protein_id="ABN75201.1"
FT                   /translation="MHSLSERVEQLRLNDCPDWLYLLHEFDALYRQGSDGGSRPIRTHR
FT                   KRVRDSLALIVEANPAVNDRPPEVKPVTAHLGRALDLGERGAVQGMSRALARVAGRLTW
FT                   EYGYEKVPKALARKYAYCEILGPRGPICAERLILGFVLFAPSTTYPQHSHKDIEESYIS
FT                   VAGAWSENDAAVHAPGSLILNRPGLEHRITTGDLSPCLLAYAWTGSEERLNQPGMKLSS
FT                   PRKARIEKGI"
FT   gene            complement(94118..95098)
FT                   /locus_tag="Rsph17029_0082"
FT   CDS_pept        complement(94118..95098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0082"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rsp:RSP_1434 putative Zn-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75202"
FT                   /db_xref="GOA:A3PFT6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFT6"
FT                   /protein_id="ABN75202.1"
FT                   /translation="MRAVLIEKSEDTQSVSVTELAEDQLPEGDVLVDVAYSTLNYKDAL
FT                   AITGKAPVVRRFPMVPGIDFTGTVAQSSHADFKPGDRVILNGWGVGEKHWGGLAERARV
FT                   RGDWLVPLPAPLDLRQAAMIGTAGYTAMLCVLALERHGVMPGNGEIVVSGAAGGVGSVA
FT                   TTLLAAKGYEVAAVTGRASEAEYLRGLGAASVIDRSELIGKVRPLGQERWAGGIDVAGS
FT                   TVLANMLSMMKYRGVVAACGLAAGMDLPASVAPFILRGVTLAGVDSVMCPKADRLAAWA
FT                   RLASDLDPAKLEEMTTELPFSEVIETAPKFLDGTVRGRIVIPVTP"
FT   gene            complement(95114..95773)
FT                   /locus_tag="Rsph17029_0083"
FT   CDS_pept        complement(95114..95773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0083"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: rsp:RSP_1435
FT                   regulatory protein TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75203"
FT                   /db_xref="GOA:A3PFT7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFT7"
FT                   /protein_id="ABN75203.1"
FT                   /translation="MPLTDTPPSVPQKPRRGRPRGAPDASLAHQSLIRAGLEHLTEKGY
FT                   SSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEAYDTYFARLLDQAFLDGSLAPLAR
FT                   LRLFTRMAEEGMARHGFRRGCLVGNLGQEMGALPDDFRAALIGVLETWQRRTAQLFREA
FT                   QACGELSANHDPDALAEAFWIGWEGAILRAKLELRPDPLHSFTRTFGRHFVTRTQE"
FT   gene            96282..96911
FT                   /locus_tag="Rsph17029_0084"
FT   CDS_pept        96282..96911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0084"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsp:RSP_1436 ABC transporter, duplicated ATPase
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75204"
FT                   /db_xref="GOA:A3PFT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFT8"
FT                   /protein_id="ABN75204.1"
FT                   /translation="MPASVSVSGLSWSTPDDAPLLADLNLTFGPERTGIVGRNGAGKST
FT                   LLRLISGDLPPASGLVRVTGSIAMMRQEAMEQPDDIIADLFGVRPALDLLDRAEAGLAD
FT                   ADDLGDADWTLPARMEGALLRCGLSVGPKTPLATLSGGQRSRAALAALILAEPDFLLLD
FT                   EPTNNLDRDGRKAVIDLLRGWTGGAIVASHDRELLDRSTRGCAGCL"
FT   gene            complement(96933..97337)
FT                   /locus_tag="Rsph17029_0085"
FT   CDS_pept        complement(96933..97337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75205"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFT9"
FT                   /protein_id="ABN75205.1"
FT                   /translation="MGRIVVGARSGIRRPHSPAFEIRQHVAERGISVGGRPSGTSLPHH
FT                   ANSRPVEIAAGRGFPFGLGRPALFRPLRRVSPARSGGLSVRDARSDRGLLPVAAPCPAS
FT                   RGGGRQRGRGGHAARSTVLSGASDPRNAAS"
FT   gene            complement(97368..98135)
FT                   /locus_tag="Rsph17029_0086"
FT   CDS_pept        complement(97368..98135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0086"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsp:RSP_1437 ABC Fe+3 hydroxamate (ferrichrome)
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75206"
FT                   /db_xref="GOA:A3PFU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFU0"
FT                   /protein_id="ABN75206.1"
FT                   /translation="MTLFSIRDLSVDVPGRRLLEGISLDLPQGRVTGLIGHNGSGKSTL
FT                   LKVLARQIEARGAVAFEGRALAGWSARDYARRLAFLPQTTPPAEGMLVRELVELGRYPW
FT                   HGALGRFGQQDETVVARAMAECGVERFADRLVDTLSGGERQRVWLAMMVAQQASTLLLD
FT                   EPISALDIAHAVEVMRLVRTMCREEGRSVVVVLHEVNMAAQFCDHIVALKQGQVVLEGP
FT                   PDELMTAERLQQIYSVRMEVLHRADGQRVAVPA"
FT   gene            complement(98132..100108)
FT                   /locus_tag="Rsph17029_0087"
FT   CDS_pept        complement(98132..100108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0087"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   rsp:RSP_1438 ABC Fe+3 hydroxamate (ferrichrome)
FT                   transporter, fused inner membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75207"
FT                   /db_xref="GOA:A3PFU1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFU1"
FT                   /protein_id="ABN75207.1"
FT                   /translation="MSRPAQLALAGVGLLAAALWAWAAVGLLPLGSWPPLPFRAEAMSL
FT                   EQILLAFGLMPRGTVALLAGAALGLSGALLQTVLRNPVADPTTLGISSGAQLALVLSTI
FT                   FAPTLLVDGRWPVAMAGAALAAALVLAVGARRAFAPVTMVIVGMLVSLTASAIATALTL
FT                   AQGEYLLSLVIWNGGSLVQQDWSGVRALALVLASGGLAAALLARPLRVLSLGAEGAASL
FT                   GLRVAAVRLAGIAVAVILAGSVSAELGLIGFVGLAGPALARSLGARTIPERLLLSSLIG
FT                   ALLLSLCDGVVLTVAGASGEMFPTGALTGLIGGPLLIWLLPRLRGSTPPGTEAAEGPAV
FT                   RLARPRPVLLALAATLVAVSLALVWIGRVPGGWVILDTQSFADFLPMRLPRLIAAASAG
FT                   AALATAGALLQRLTGNPLASPEVLGVSGGAALGYALAIYLVVAPTAPLLHAATMAGGVI
FT                   ALALVAAYLLRREMPAERILLAGIAVSALASAVLSAMMASGDARSWAVLAWLSGSSSAV
FT                   LMPGALALAAVALTLWAAALATARWLAILPLGPGVAGGLGLPLRRARVALILLAGLATG
FT                   AATVLVGPLSFVGLMAPHMARRAGLARPAHHVTGAALIGALLMLLADFGARVAGFPYEL
FT                   PLGLFASLIGAPWLLWLLMRANR"
FT   sig_peptide     complement(100037..100108)
FT                   /locus_tag="Rsph17029_0087"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.693 at
FT                   residue 24"
FT   gene            complement(100105..101004)
FT                   /locus_tag="Rsph17029_0088"
FT   CDS_pept        complement(100105..101004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0088"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   rsp:RSP_1439 ABC Fe+3 hydroxamate (ferrichrome)
FT                   transporter, periplasmic siderophore binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75208"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFU2"
FT                   /protein_id="ABN75208.1"
FT                   /translation="MVGGGALSRRSFLAAASLALAAASSLRAAPPVAPRLAAIDWAMLE
FT                   TAIALGHMPVAACELIRFRKDAPEPPVPEGVVDLGLRGAPNFELLQLVRPDLILTSPYY
FT                   TRYEARLSQLAPVLNLPFYIRGEPPLPKTFAALHNLARAIDDPGAALRAEEAAEARFDA
FT                   VAADLAPMADRPICLVNIGDARHLRAFGFDSLFGSVATRLGLTNGWEGQTRFSFLAPVQ
FT                   IEELARLPEARVVIVGEIPVQARRGLARSKLWQALPAVRGGRVYQLPEVNAFGGLPSAL
FT                   RFARMLGAALTRPAELRL"
FT   sig_peptide     complement(100918..101004)
FT                   /locus_tag="Rsph17029_0088"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(100998..103097)
FT                   /locus_tag="Rsph17029_0089"
FT   CDS_pept        complement(100998..103097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0089"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug;
FT                   KEGG: rsp:RSP_1440 TonB dependent, hydroxamate-type
FT                   ferrisiderophore, outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75209"
FT                   /db_xref="GOA:A3PFU3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFU3"
FT                   /protein_id="ABN75209.1"
FT                   /translation="MKTKHRSMLLAGASTIALAPAALFAQEAIELDAIVVTATTDVTTQ
FT                   ADGYKADYNQSATKSDTPVAETTQSVSVVTAEQIKDQGAETLGQALRYSPGVLGDPYGV
FT                   DPRFDSPTIRGFEARGSQYVNGLRQLRYMGAPAYETFALQQIEVLNGPNSSLYGAGSPA
FT                   GIINQVQKRAQGFDFGELGVGLDDNGSRQSFFDWNRTVSDTLSFRATGIAKDYESQVEE
FT                   IGLERGYLGLAARWKPTDRTTLDIISSYTDDAPTSPPGIPFALTGQGNDKYLRELYTGE
FT                   PGWDDHDRQIFNIGYELSHEFDSGWTFSQGFRYEKFDWEYTGHYVTGIDASGTGITRGA
FT                   NYQRENTTGLSLDSRLAGEVLTGGMEHKLLFGLDLRKYDADTVTEFYNATGGVTNLDWR
FT                   NPIYGGVPTGAPWYVSTPDVTQTQIGLYAQDEITAGRWRGSIALRHDWSKQEGTTYTNF
FT                   AGEGEIDQSDKALSGRAGLGYEIAPGALVYANYSTSFDPEIGVDGAGEQLEPTTGKQWE
FT                   LGVKYQPDSFNALFTAAIYDLRQENLTVNLGGAEGRRQVGEVKSSGLELGAVGELAPGL
FT                   NLRASYAYNDTEQVDPSGANDGNEMPNAPRHLASLWLDKAFDNGVSLGGGLRYIGEREG
FT                   DLANLYSLDSVTLLDLAVGYSRENMEASINLNNLSDEVYLANCGSFGCYYGEGRTISAK
FT                   ISYKW"
FT   sig_peptide     complement(103020..103097)
FT                   /locus_tag="Rsph17029_0089"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            103424..104557
FT                   /locus_tag="Rsph17029_0090"
FT   CDS_pept        103424..104557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0090"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; transcriptional regulator
FT                   TrmB; KEGG: rsp:RSP_1441 regulatory protein, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75210"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFU4"
FT                   /protein_id="ABN75210.1"
FT                   /translation="MTLTGSALAVLRALVERGPSTRPQLGQDLGLSRPTMSAAMAELME
FT                   AGLVEPIGSVQGGMGRRAVEYRVATHAGHVIAVDAGSTHIRLRLSTLDRRLLHASLHPL
FT                   PNSQYSLTPQISSVVADAVAEALEKTEADWGPLLAMVIAIPTRVVGPEGDTAATDQEVI
FT                   FTNFTPPPQVDCTLVNNVNCAAVAEYHYGAARGHQTFAFLQVGVKIGLGLMLNGQILPG
FT                   VNGAAGEIGHITFPFAPGLTPVPGEAERYIGTEAFMARVRADWPESSGRPPADTYELLA
FT                   RAGEGDAAALRHVEGHAAEIGAVIAICVSVIDPGLVVLGGGYGASPLLRPKVEEVVRHL
FT                   AFPAEITTSTLAAEATVLGAERLAVDRAVSVLLGLPA"
FT   gene            104675..105931
FT                   /locus_tag="Rsph17029_0091"
FT   CDS_pept        104675..105931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0091"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: rsp:RSP_1442 ABC sugar transporter, periplasmic
FT                   sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75211"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFU5"
FT                   /protein_id="ABN75211.1"
FT                   /translation="MTMRTTAASLLALALATGGTAAGAQTLEYWVYSDFAQGEALALQQ
FT                   EFIKEFQESHPGVTVNIVGKGDDDLTAGQIAGAASGNLPDVFMNAVGVGAQLVDVGALA
FT                   NIHDKWMAMPEEFRAQFNKGAVENCAPRPEEMYCIPYTGYGTLLFRNLTVLEEAGIDTS
FT                   APPADWADWLAQMEKVKAAGKFAIPDQALVFNSIAEMYGVTGDVSTWGIDWESKTTRID
FT                   PAVMTSVLEKFVAMQPLTSGTSRNDQATKDLFVTDQLAFHTIGPWVNPTYVEAVENSGL
FT                   KYDFVLMPGETADKHGGIKNFEIVGVAPGENLDLAFEFATYITAKEQMARWAKLLSRYN
FT                   SNDAAMAEADVAALPLVARSVAAVEVTMDVSPPYLIQPVPACYQSTVVDYVSATADGEF
FT                   TPEEGAAEMIAELNDCLAG"
FT   sig_peptide     104675..104749
FT                   /locus_tag="Rsph17029_0091"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.639 at
FT                   residue 25"
FT   gene            106020..106910
FT                   /locus_tag="Rsph17029_0092"
FT   CDS_pept        106020..106910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0092"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsp:RSP_1443 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75212"
FT                   /db_xref="GOA:A3PFU6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFU6"
FT                   /protein_id="ABN75212.1"
FT                   /translation="MRVLRHHLPHFLMIAPFLVLFGAFFLYPILSGLYYSFHDWNGVRE
FT                   PVYVGLENYTRLLGSRDFSRAMWNLFQYIVITVPLGLTVAFCLALLVDSFTGRWANFFR
FT                   NAYFLPVVLPAFLAATIWRWIYAPNFGLLNMMLGWVGAEPVSFLNDTSTMLYALIAVDV
FT                   WVSAGFNMVIILAGLKNIPADLYEAARLDGASKLQQVIHITLPMLAPVLFFVLTYAVIS
FT                   AMQVFDTPWLLTGSSFSEYGGRRGALLFPVMDMMGRAFGGVQFGLASAYGFLLTIAIIA
FT                   VTALLFAVRTWSNRR"
FT   gene            106907..107755
FT                   /locus_tag="Rsph17029_0093"
FT   CDS_pept        106907..107755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0093"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsp:RSP_1444 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75213"
FT                   /db_xref="GOA:A3PFU7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFU7"
FT                   /protein_id="ABN75213.1"
FT                   /translation="MTSAAAARISVWTVLKWAIAIAIAVITIFPIWWMINVVFSLPGEP
FT                   VAINPRLWPTSLSAGLEKIEMIFTQTGYLRAYGISLAYALLTILGVLFIGSLAAFEFAL
FT                   FDFPAKGPIFGIVMLSLMVPTAVTIIPTYLLTSNLGWLNSLQGLVVPGLASAFGLFMLV
FT                   QFMRAIPKDMIEAARLDGAGHFQIYWHVALPLCRNALVTLAILTFMQTWGNYMWPLIVT
FT                   TSPEMYTVGQVVGMFNAPLSHQTVDVVMTANLLAAVPPLLFFLIFQRKIVEGIAMSGTK
FT                   G"
FT   gene            107775..108878
FT                   /locus_tag="Rsph17029_0094"
FT   CDS_pept        107775..108878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0094"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: rsp:RSP_1445 ABC sugar transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75214"
FT                   /db_xref="GOA:A3PFU8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFU8"
FT                   /protein_id="ABN75214.1"
FT                   /translation="MAFLEIRSLCKSFESYPVLKDIDLSIEKGEFVVFVGPSGCGKSTL
FT                   LRMITGLETPTSGTIAIEDEVINDVDPARRGTAMVFQSYALYPHMTVFQNISFGLRMSR
FT                   KPKALIRERVEKAAAILRLDKLLDRKPAQLSGGQKQRVAIGRAIVREPRVFLFDEPLSN
FT                   LDAELRVQMRAELLELHERLGTTMIYVTHDQVEAMTLADKMVVMSGGRIQQYGRPLDLY
FT                   DDPDNRFVAGFVGSPKMNFLSATVTSAGADGLRADLAAGGAAALPLIESLAPGARIDIG
FT                   IRPEQLSVVPAGQAPSADAVSVAGRVALIEDLGAESYLHLHLADDSRIGVRTARHAAHL
FT                   GEEVRVAAPASGVLVFDEAGARLRGRA"
FT   gene            108875..109816
FT                   /locus_tag="Rsph17029_0095"
FT   CDS_pept        108875..109816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0095"
FT                   /product="ATPase, BadF/BadG/BcrA/BcrD type"
FT                   /note="PFAM: ATPase, BadF/BadG/BcrA/BcrD type; KEGG:
FT                   rsp:RSP_1446 putative sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75215"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFU9"
FT                   /protein_id="ABN75215.1"
FT                   /translation="MSLTAYSEAGAPVVGVDIGGTKTEIRLARRDGTRLVKLRETVLPS
FT                   RSWRGAGVAEDAANLLAQVHLLIGDEPIAALGVGAHGCDDDGECEALAAALRARSPLPL
FT                   RVVNDAELMPLAMGRVGQIGLVAGTGSIAVCRDAEGRMISAGGWGWLIGDDGSAAGLVR
FT                   EAARAVAVALDAGATTEDPLIRLMYASLGQPDLPRLGSTLASLGSAAAIGAHAPAVFDA
FT                   CDEGSPLAAAVIRAGAEALAELVMNLQVRGSTASHVVAGGSVIVSQPPLWRAFAAAVAQ
FT                   RSEGQITPHLFNGHPVEGACRLAADLVTPALS"
FT   gene            109843..110847
FT                   /locus_tag="Rsph17029_0096"
FT   CDS_pept        109843..110847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0096"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: rsp:RSP_1447
FT                   possible glucosamine--fructose-6-phosphate aminotransferase
FT                   (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75216"
FT                   /db_xref="GOA:A3PFV0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFV0"
FT                   /protein_id="ABN75216.1"
FT                   /translation="MSYRSTIARQPEALADTHATVLDQLGAADLSGLLRPVIGVTGIGA
FT                   SFAAAVVGAAELQARGQRGVAIRACDLAAGHDLADTLVGLSAGGRSIETVTAFQKLPSA
FT                   KRIGISQDGAGPLAGVSDFHLTIRQGTDATPSSVGYTATLLGMGMLFDRLRGSDGTGFA
FT                   DLPAVVEEVLSQAADKMARIGTQFADRRAIDCVGAGAALGTADGASLLIREAARLPASA
FT                   YDTRHYLHGPLEAMDATTGVLIIGDGREVELARQVERIGCPVVLVTTDRSVQDGDGLTV
FT                   IHVPRRDNLIAQGIVDILAPQLIAAQLSDAAGLTDVKFRYRMQDTKVKTDAAA"
FT   gene            110902..111921
FT                   /locus_tag="Rsph17029_0097"
FT   CDS_pept        110902..111921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0097"
FT                   /product="L-threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase, class I and II;
FT                   KEGG: rsp:RSP_1448 putative L-allo-threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75217"
FT                   /db_xref="GOA:A3PFV1"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFV1"
FT                   /protein_id="ABN75217.1"
FT                   /translation="MTIIDDFRSDTVTRPGPEMRAAMAAADVGDAVYDDCPTTLRLEAV
FT                   AAERLGKEASLFFPSGTQSNLAAIMAHCERGDEFLVGQQAHAYRHEGGGAAVLGSVQPQ
FT                   PLPNGPDGCIPLDAIREAIKPDDFHFARTRLLALENTFNGRVLDPAYVQAATALARDHG
FT                   LAAHLDGARLMNAAVASGQAAATLAAPFDTVSLCLSKGLGAPVGSVLAGPRPVIERARR
FT                   IRKMLGGGMRQTGVLAAAALHALERNVDRLAEDHARAARLAEVLSRFPALGSGPAQTNM
FT                   VFMAPDGIDVASFKAFLSARGIAMGGGYGVLRWVTHLDLDDAALTRVAEACEAFFAGE"
FT   gene            complement(112106..112876)
FT                   /locus_tag="Rsph17029_0098"
FT   CDS_pept        complement(112106..112876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0098"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; Helix-turn-helix,
FT                   type 11 domain protein; KEGG: rsp:RSP_1449 putative
FT                   transcriptional regulator of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75218"
FT                   /db_xref="GOA:A3PFV2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFV2"
FT                   /protein_id="ABN75218.1"
FT                   /translation="MQSYERHAKVLELLAVERRVFTNQLARMFDVSRETVRRDLLDMEQ
FT                   EGVLVRVHGGATAVERDIAPEPAFSERLVAHAGKKAAIGALAATLIPRGSTVFIDAGTT
FT                   TCAFARALARVGDFRIITNSIEIARLAGPAQTCDTLLLGGRPHADVPATYGEMTLSEID
FT                   RFLADYAVISPVGLHADRGATDYALHEAEVARAMMRRSRDCIMLCHSEKIGTESRVSIC
FT                   RLDEIGHLVTDETAERSLRLPRGEIHYAPIRPGA"
FT   gene            113149..113943
FT                   /locus_tag="Rsph17029_0099"
FT   CDS_pept        113149..113943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0099"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: rsp:RSP_1450
FT                   inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75219"
FT                   /db_xref="GOA:A3PFV3"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFV3"
FT                   /protein_id="ABN75219.1"
FT                   /translation="MSELGDALRFANDTADEARRIALKHFRQALDVESKADDSPVTLAD
FT                   RAVEALIRDRIMAAFPDHGIFGEEEAPLRPDSDHLWVVDPIDGTKSYVTGNPLFGGLMA
FT                   LLKDGAPCLGQIDMPALGERWSGIEGQATTFNGRPCRTSDCRDPAEAFAYTTDPMLFTG
FT                   ADAQVLEMLRRSVRMLRFGGDCYAYALLASGHCDLVLETGLQPYDYLPLVQVIRGAGGV
FT                   ITDWQGQALGVGSAGEVLAAATPELHRAMLDRIERLRAGQAA"
FT   gene            114016..115590
FT                   /locus_tag="Rsph17029_0100"
FT   CDS_pept        114016..115590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0100"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: rsp:RSP_1451 ABC peptide/nickel/opine transporter,
FT                   periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75220"
FT                   /db_xref="GOA:A3PFV4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFV4"
FT                   /protein_id="ABN75220.1"
FT                   /translation="MDRRSFLRYGALAGTALGAARINPDFFFSSAFAQESRPLVFLSAE
FT                   NITGNWDPTAHTTLSQTNIEGFVMGYLTRAPMRPEEPDKVVYELATEITELDAHRLQIK
FT                   LRDGVTFHDGKPFTAEDVKATFEYGAKLDRPKQVYPGGPETFSVETPDDHTVIVDTSKG
FT                   GYGASLFIFLASYLPILSAKDVAEGPKGPLSQRLNGTGPFRFVEQRGNDTVMEAYDGYF
FT                   RGAPKVTGVTFSFVGDATTRMLSLMNGQADVIERLEPEQVETLQARDDIKISRLVSVEN
FT                   KYLWFRCSKPPFDDWRVRKAACHAIDRSMIMEIMGSAGEASSNFVSPIKFGYIDLENYP
FT                   EYNPEECQRLLAEAGYPNGEGLPELEYITSTGFYPKTKEYGELIAALLQEQGFPVTLNV
FT                   MEVAAWNERLYDRPGGGPGHMVDCGWSTGSPEPDLVLRTHFHSTAKRICGIVDPEIDAA
FT                   LDAERDAPSLEARKESLQTNLMPMLADKAPALSLFTSVLIHGMRANVEGLFIYPDGQSD
FT                   ASQTTLG"
FT   sig_peptide     114016..114117
FT                   /locus_tag="Rsph17029_0100"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.842) with cleavage site probability 0.818 at
FT                   residue 34"
FT   gene            115669..116649
FT                   /locus_tag="Rsph17029_0101"
FT   CDS_pept        115669..116649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0101"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsp:RSP_1452 ABC
FT                   peptide/nickel/opine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75221"
FT                   /db_xref="GOA:A3PFV5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFV5"
FT                   /protein_id="ABN75221.1"
FT                   /translation="MFILRFLARRLGQGAIIIFLVSALIFTLLRVVPGDPVRLMVGGMA
FT                   PDTLVEEIAAEMGLRDPIYVQFGRYMGKVLQGDLGESFVRPASGAAVGGASFDDATRGE
FT                   RAKVLDLIAETAPMTLQLAVLAMVFALMVGVPIGVWGGLYPGRLPDRLALYTSSLFVSL
FT                   PNFWLGIVLALLLSVKLNLLPAIGYRGFSYTILPALVLAVEIAPFIIRTLTVSVAGVMG
FT                   QTFIDIARVRGLSRNQIVFRHALKNSAVPLLNLLGVQFSMLLGGVLVIEFIFDYPGLGL
FT                   LTINAVMQRDFPLIQGIAIVTAAVFVLINIAVDLLATAIDPRLDY"
FT   gene            116649..117560
FT                   /locus_tag="Rsph17029_0102"
FT   CDS_pept        116649..117560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0102"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsp:RSP_1453 ABC
FT                   peptide/nickel/opine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75222"
FT                   /db_xref="GOA:A3PFV6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFV6"
FT                   /protein_id="ABN75222.1"
FT                   /translation="MTSTDLPLAMAVPATGRRVSTRIWQTAFASVEFRIGLAVFVLLLA
FT                   AALLYPELSGIDPSKMNIRAKLTPPIFMGEGWSWAHPLGTDQLGRDMLARALVGLRYSL
FT                   LIGVSTTVLMLLAGAMIGLFSGYFGGRTDTVLMRLTDAQLSIPMIILAITILGVSRPTI
FT                   PSIILVLGLAGWPVYARVMRSTVMSERRKEYVRGAMVLGATDLRIMFTLLLPLVLPPMA
FT                   FVAVLDIARMMIFESVLGFLGLGVQPPTPTFGNVIADGRKYLMNAWWIATMPGVFLVLT
FT                   LTSINLMGAALERARNSIYGGA"
FT   gene            117562..119415
FT                   /locus_tag="Rsph17029_0103"
FT   CDS_pept        117562..119415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0103"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: rsp:RSP_1454 ABC peptide/nickel/opine
FT                   transporter, fused ATPase subunits; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter, C-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75223"
FT                   /db_xref="GOA:A3PFV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFV7"
FT                   /protein_id="ABN75223.1"
FT                   /translation="MALDMGAAPETLLSVRGLSVAAGDRPILTDISFDLAPRSILSVIG
FT                   ATGSGKTVLARALASWLSPPLRVTGGRILFRGRDLVADPAHARSLAGREIAYVGGNPAG
FT                   ALDPTMTVGAQLVEKLRAVRPDMSADEARKKAIRLLEAVHIPSAQRRFHEYPFQYSGGM
FT                   MQRAMIVDALISDPALLIADNITQPLDVTVAAQILKLMRELNAQFSTAILFICSSLPVA
FT                   CDASDEVMVLHEGRVVERQTPAALVASPGHTYTRELIAELPTLWQGGENSASRPTDRER
FT                   RAIMSVRGLAKAYEVRARGQAGISRVQAVRNVDFDVFPGDNFGVVGESGCGKSSLMRLL
FT                   TGLERPDAGSVFFEGENVGAASPKRLRELRRRFQLVLQDPYGCLPPQSPIGAILEEPLK
FT                   IHRIGNAAERRDRARAVMAEVGLDDGLYRSLPTGLSAGQRQRLNVARAMILEPRLLIMD
FT                   ETLSALDQTEQGKLLDLFDKLQAQHGFTYIFISHDLTMVRRVCSRIAVMYLGETVEVAP
FT                   NERLFFDPGHPYSRALLSAAPTLEERRYRPEDCLLEGEPPSPIDLPPGCAFASRCPHAF
FT                   DRCRIENPALRARGGHALAACFLNPEPDIGLHETVTETPHV"
FT   gene            119408..120682
FT                   /locus_tag="Rsph17029_0104"
FT   CDS_pept        119408..120682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0104"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: rsp:RSP_1455 N-carbamoyl-L-amino acid
FT                   amidohydrolase; TIGRFAM: amidase, hydantoinase/carbamoylase
FT                   family; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75224"
FT                   /db_xref="GOA:A3PFV8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFV8"
FT                   /protein_id="ABN75224.1"
FT                   /translation="MSETQSLSRIDADLLNALMEKVSEFGSTGDGGIDRPALTDAHRDA
FT                   RDWFRSELEARGYTVLVDEIGNLFGRIDLAGPGAPLVMIGSHLDSQPRGGRFDGAYGVI
FT                   AALAAIETFRRDGGTPRCNYVIADWMNEEGARFQPSLLGSSVFAGLIELDWALGRRDRD
FT                   GRSVGEELVRTGYKGTDAAPRPDLYLELHIEGDAKMETAGARIAPFLRHWGALKVRIEV
FT                   TGEQNHTGPTPMEDRKDAVLGAAYIIAEVRRLADVAEDTLFTSVARVDISPNSPNIVPG
FT                   KAVLFCELRAPEPAMLDWSEASLRAALPELAAKAATRAEIVSIDRRPAGKFDPRLARLT
FT                   ERVADDFGLPRMQLDTIGGHDAVALNAILPSIVFAVPSVGGVIHRNDEYTSPEDLAAGG
FT                   DVLTDMVRRIDRAGADLDLALGANA"
FT   gene            120679..121623
FT                   /locus_tag="Rsph17029_0105"
FT   CDS_pept        120679..121623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0105"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: Choline/ethanolamine kinase; aminoglycoside
FT                   phosphotransferase; KEGG: rsp:RSP_1456 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75225"
FT                   /db_xref="GOA:A3PFV9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFV9"
FT                   /protein_id="ABN75225.1"
FT                   /translation="MTGALVSSEMMARAAAAAGLSDEAARPGPAPLASPSYLALESASI
FT                   LTDGGVFLKVMHPEMRQDFDLGAAMALARQAGEAGIGPRVLWADPAQGAIAMEALTEAG
FT                   GWRRAMQVDLQEAPVLGAAMAALKALHATPALSSRFDPFAQIDGLIADYSRLGAPLPED
FT                   TGWLRRLIGAAEPVLRTGADLAPCRNDGAASNLMLGPGGAVRLVDYDRAGMNDPLYDVG
FT                   ALLAETTDFEREMQAGFAAYAGTFDEVAFARARLWSFVDDMLHALWSRLKARTSARGSV
FT                   EWLKYGEWRLMRLRMALNHPQYEQKIRLAGGAA"
FT   gene            121620..122564
FT                   /locus_tag="Rsph17029_0106"
FT   CDS_pept        121620..122564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0106"
FT                   /product="Choline/ethanolamine kinase"
FT                   /note="PFAM: Choline/ethanolamine kinase; aminoglycoside
FT                   phosphotransferase; KEGG: rsp:RSP_1457 putative choline
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75226"
FT                   /db_xref="GOA:A3PFW0"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFW0"
FT                   /protein_id="ABN75226.1"
FT                   /translation="MTRKTLGEASHPMEEAIEAVIRKAPLFRGGTGMVYGPVSGGISNE
FT                   NWRVTASDGSGDWFVKIPGNGTEMFIDRKAAFEASQRAAAAGLGPRVYGDLAEEGVEIN
FT                   DFMADRRPATHSDFAEPAKRQAAMAAYRTLHGLAPLTATKTVFDMIDEHAAQAADLGAP
FT                   RFPDHDWIMLNEAMAREALTASGLDLVPCFNDPMPGNFMVGADGSILLIDYEYASMNDR
FT                   CYDFGLFFGEMFFTPEQELELIETYFGEVRPEIVSRVIVHKALADVKWALWSMVQLRVS
FT                   RLAFDFHKYGMWKLMRFRQITGHADWPKHLRTI"
FT   gene            complement(123074..123337)
FT                   /locus_tag="Rsph17029_0107"
FT   CDS_pept        complement(123074..123337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75227"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFW1"
FT                   /protein_id="ABN75227.1"
FT                   /translation="MEPGHAGQGCLREKRLKPPRFIRTFRGGLCQDRSLKNAVDFRLGQ
FT                   SAHGLIPCRSDTCRRSDPDVVARESPWQMFPLRSTQTSTSRR"
FT   gene            complement(123743..125347)
FT                   /locus_tag="Rsph17029_0108"
FT   CDS_pept        complement(123743..125347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0108"
FT                   /product="putative DNA repair enzyme"
FT                   /note="KEGG: rsp:RSP_1458 putative DNA repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75228"
FT                   /db_xref="GOA:A3PFW2"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFW2"
FT                   /protein_id="ABN75228.1"
FT                   /translation="MARRRILSLWFPRLGAERLLRRRKDTLPPPFAVVGDRQGAQVLVS
FT                   VSAEAEALGLGPGQGLRDATAICPHLMTAPEDPASEAAFLAALRRWAGKFSPWVAEEPP
FT                   AGLMIDLTGCAHLFGGEEKVLGVVEADCAGLGLTVRAAVADTPGAAWALARHAGRALQG
FT                   NLNGDAIEQEAHATRSRASRRRTFAPPSGGPLGLISAPGALRAALEPLPVAALRLSEGT
FT                   VQSLARLGLRRVGDLLDLPRASLARRFGQEVTRRIDQALGLEPEPVSPAGAPLHFAVRL
FT                   TLPDPIGLREDVEAGLDRLLGPLCDRLKEKGRGARRVRLQAFRSDGQVPAVEVGLAQTT
FT                   CAPERIRPLLALKLDQIDAGFGIDMLRLSAVETELLTVDSGKGRGPAGRPAEVLADVVG
FT                   RLGARLGAEGVTRLHPAESHVPAKTALVLAAAWSEAAGPWPEPPGRRPLILFPPEPVEV
FT                   VGAPPHRVCWRRRDRRIVRAEGPERILPEWWLEEPDWRSGARDYWAVELEEGERIWLFE
FT                   AMGGVVSGGWWVEGEMA"
FT   gene            complement(125572..125844)
FT                   /locus_tag="Rsph17029_0109"
FT   CDS_pept        complement(125572..125844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75229"
FT                   /db_xref="InterPro:IPR021719"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFW3"
FT                   /protein_id="ABN75229.1"
FT                   /translation="MRRTLLLLAAAASLTACGRKEPEIILPTDSCGAVRLTGLVGQPAE
FT                   VLETIRFTQPVRVVRPGDMVTMDFSPARLTVETNEAGRIVRLACG"
FT   sig_peptide     complement(125788..125844)
FT                   /locus_tag="Rsph17029_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.763 at
FT                   residue 19"
FT   gene            126046..126792
FT                   /locus_tag="Rsph17029_0110"
FT   CDS_pept        126046..126792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0110"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75230"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFW4"
FT                   /protein_id="ABN75230.1"
FT                   /translation="MSDPRAPRLCVLIDADNVPANYAEAIFEEIAALGEASVRRIYGDW
FT                   SAMRLNAWAKKVAALGLVADQQFSNTKGKNASDIGLVISAMDFLHSGLFDGFVLVSSDS
FT                   DFTRLAARIREQGLDVYGIGEKKTPEAFRMACKRFIYVENLGSDEPPAREPRPADEPQQ
FT                   PPAQRGREKEEPMKAIPLIAAAMRAIDPEGEWYSLGQIGQFITQANPDFDTRTYGSAKL
FT                   SDLIKKISRFEVKPGPGGQLLARDIA"
FT   gene            126923..127168
FT                   /locus_tag="Rsph17029_0111"
FT   CDS_pept        126923..127168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0111"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75231"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFW5"
FT                   /protein_id="ABN75231.1"
FT                   /translation="MAQRLHLVFGGELASPTKNVFKDVKAIHIVGMFPDYASAFAAWKA
FT                   EAQRTVDDAHVRYFIAHLHRLRDEEQPASATEELGN"
FT   gene            127216..128367
FT                   /locus_tag="Rsph17029_0112"
FT   CDS_pept        127216..128367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0112"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; KEGG: rsp:RSP_1461 putative
FT                   3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75232"
FT                   /db_xref="GOA:A3PFW6"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFW6"
FT                   /protein_id="ABN75232.1"
FT                   /translation="MRRDPAEGPVRPQRPLGRLIWLHAPTRDSARPMAELGRRIILDEG
FT                   FPVLLTTHVPVSSGGILIVQPPPPDTPAAVAAFLDHWRPDAAFMAEGELRPSLINAAFD
FT                   RNVPLALVDGAAPRILPGRESWWPGQMRNLLAKFRHIFTLDEAAARAFRKAGSSSHVTQ
FT                   VAGRLEEGSLALPCTEAERAALARLLAPRQVWLAAGLPAEEEAAAIAAHHAALKLAHRM
FT                   LLFVVPQEPDRAAAFAARCEAEGWKVARRAADEEPDADTEVFVADGMAELGLWYRLAPV
FT                   TWLGGSLSVGCVLDPLEAASLGSALIHGPHFGPHGATLARLSAARASLPVASARGLAEA
FT                   LADLLAPDRVARLAHAGWAVASEGTEVTDRMVALAGRLVEREA"
FT   gene            128367..129365
FT                   /locus_tag="Rsph17029_0113"
FT   CDS_pept        128367..129365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0113"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="KEGG: rsp:RSP_1462 putative
FT                   tetraacyldisaccharide-1-P 4'-kinase; TIGRFAM:
FT                   tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75233"
FT                   /db_xref="GOA:A3PFW7"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PFW7"
FT                   /protein_id="ABN75233.1"
FT                   /translation="MRPPAFWFTPPDSPALAARLLAPLGQAYAAATARRLRAPGHRAGV
FT                   PVICIGNLNAGGTGKTPTAIALMQRLAARGIEAHVVSRGYGGRLEGPVEVDARRHRAAD
FT                   VGDEPLLLAAFGRAWVARDRAAGVRAAEAAGAQAILLDDGFQNPSVVKDLSLIVVDAAV
FT                   GFGNGRCLPAGPLREPVEAGLARADLLLSIGGPEAQRRFATDWPALPVPRLTGRLATLQ
FT                   MGMDWQGARVLAFAGIGRPEKFFASLRAEGAELLRAEALDDHQPLGEALMKRLEIEAMA
FT                   LGAQLVTTEKDAVRLPPSFRQKVLTLPVRLEFDDGAALDEALDRLGLAARS"
FT   sig_peptide     128367..128456
FT                   /locus_tag="Rsph17029_0113"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.936) with cleavage site probability 0.925 at
FT                   residue 30"
FT   gene            complement(129464..130609)
FT                   /locus_tag="Rsph17029_0114"
FT   CDS_pept        complement(129464..130609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0114"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rsp:RSP_1463 putative acyl-CoA
FT                   transferase/carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75234"
FT                   /db_xref="GOA:A3PFW8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFW8"
FT                   /protein_id="ABN75234.1"
FT                   /translation="MSAPLAGIRVVELARILAGPWAGQVLADLGADVVKVEAPEGDDTR
FT                   RWGPPFIEREGDRSAAYFHAANRGKRSVTADFRTPEGQETVRRLVADADVVIENFKVGG
FT                   LAKYGLDWPSLQKVNPRLVYCSITGFGQDGPYAHRAGYDFIIQGMAGLMSVTGAAEGQP
FT                   QKVGVAVTDIFTGIYAATAILAALHQRAGTGRGQQVDMALMDVAAGIMANQAMNYLATG
FT                   VAPRKMGNEHPNLAPYAVFDCADGWIIIATGNDAQYRRLCTLLGLPGLATAPAFLTNAD
FT                   RVANRAELTRALTAVTSGWRKAELLAACEAEGVPAGPINDMAEVFADPQIRHRGMQIAP
FT                   DGVPGVRSPFRFSEAKLALARPAPRLGEHQAEVLGEPADQD"
FT   gene            complement(130606..131277)
FT                   /locus_tag="Rsph17029_0115"
FT   CDS_pept        complement(130606..131277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0115"
FT                   /product="putative periplasmic thiol-disulfide interchange
FT                   protein (DsbA family)"
FT                   /note="KEGG: rsp:RSP_1464 putative periplasmic
FT                   thiol-disulphide interchange protein (DsbA family)"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75235"
FT                   /db_xref="GOA:A3PFW9"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFW9"
FT                   /protein_id="ABN75235.1"
FT                   /translation="MVKKLGLAALALTTVAGVALWNGSRDAGQTQLPPMAASAQEAGAA
FT                   QTTAAVEDMSMGAEDAPVTIVEYASFTCPHCANFEKEVLTPLKRDYIDTGKVRFTFREV
FT                   YFDRYGLWAAMVARCGGEMRYFGIADLIFEQQKEWVTNDPAQVATNLRKIGKTAGLDDA
FT                   ALDACMNDQAKAEAMVAAFQKNSQADDITATPSLIINGTKHSNMSYEELKKIIDAELAK
FT                   G"
FT   sig_peptide     complement(131194..131277)
FT                   /locus_tag="Rsph17029_0115"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.444 at
FT                   residue 28"
FT   gene            complement(131289..131819)
FT                   /locus_tag="Rsph17029_0116"
FT   CDS_pept        complement(131289..131819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0116"
FT                   /product="protein of unknown function DUF1159"
FT                   /note="PFAM: protein of unknown function DUF1159; KEGG:
FT                   rsp:RSP_1465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75236"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFX0"
FT                   /protein_id="ABN75236.1"
FT                   /translation="MTRAPAPPPAKPNRRMRGFEAASGLLQDRIRKAGEKRGFAVTRLL
FT                   THWPEVAGEDLARITRPVKVGYGAREGFGATLTILVSSAHAPLVQMQLPALKERVNACY
FT                   GYAAIHRITLTQTAPSGFAEGQALFDPAPPAPRPVDPAVKARAAETADGVQDEGLKAAL
FT                   ERLAQNFLSRSKA"
FT   gene            131901..133004
FT                   /locus_tag="Rsph17029_0117"
FT   CDS_pept        131901..133004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0117"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   helix-hairpin-helix motif; HhH-GPD family protein; KEGG:
FT                   rsp:RSP_1466 putative MutY, A/G-specific adenine
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75237"
FT                   /db_xref="GOA:A3PFX1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFX1"
FT                   /protein_id="ABN75237.1"
FT                   /translation="MRDTDESPDDGDISARLLAWYDRHARVMPWRVGPAERRAGHRPDP
FT                   YRVWLSEIMLQQTTVAAVRDYFRRFTDRWPDVEALAAAPDADVMAEWAGLGYYARARNL
FT                   LKGARAVVALHGGRFPETRDGLLSLPGVGPYTAAAVASIAFDEPATVVDGNVERVVSRL
FT                   FAVETPLPAAKPELTRLAATLTPQERPGDHAQAMMDLGATICTPRKPVCSLCPLRPDCE
FT                   GHRAGLEAELPRKAPKAEKPVREGRLWIAVRADGAVLLETRPERGMLGGMLGWPGTDWD
FT                   RSGGPAGAPLEADWRETGVEVRHTFTHFHLRLEVLVAQVAEGAVPARGSFVPRAEFRPA
FT                   ALPTLMRKGWSVAAAAIRHPTGEERLA"
FT   gene            133042..134313
FT                   /locus_tag="Rsph17029_0118"
FT   CDS_pept        133042..134313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0118"
FT                   /product="alkane 1-monooxygenase"
FT                   /EC_number="1.14.15.3"
FT                   /note="PFAM: fatty acid desaturase; KEGG: rsp:RSP_1467
FT                   possible alkane hydroxylase (fatty acid desaturase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75238"
FT                   /db_xref="GOA:A3PFX2"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR033885"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFX2"
FT                   /protein_id="ABN75238.1"
FT                   /translation="MVSAPDVVKPNPPPIAHLKRALPFAIPFATVPLALIGAAQGGWTV
FT                   LLLPLFVWGLFDLLDLALGADPRNEDPATETRDLFWFRLLSLIWVPLQLLTVFGLVFHV
FT                   SHAAHLGLIEKIGLFIGIGAMTGSVGLVHAHELIHRNGRLERGLGDLLLASVLYSHFRT
FT                   LHLRVHHLLVGTAEDPATARFGEDFPTYLQRALTEGHRRAWETEVGLLARTGRPPQALR
FT                   NPFWIYGVLQFAMIVAALVLGGAQGLLLFLVQAFVGVCQLELMGYVAHYGLTRRLLPDG
FT                   TPEPVQPHHSWNAPQKASGWLLLNLGRHSDHHARPDRRYPLLQALPAAEAPQLPHGYPV
FT                   MAAMALVPKLWHRRMDLRVLDWRQARYPDIEDWTPYGSGAGAAADAAPPLPETVAAETP
FT                   VAPVVPPASEVPEAPAAERRPETV"
FT   gene            complement(134469..135587)
FT                   /locus_tag="Rsph17029_0119"
FT   CDS_pept        complement(134469..135587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0119"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   rsp:RSP_1468 site-specific DNA-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75239"
FT                   /db_xref="GOA:A3PFX3"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFX3"
FT                   /protein_id="ABN75239.1"
FT                   /translation="MATKTKTTEAPVLPLNQILAGDCIETMRSLPECSVDLIFADPPYN
FT                   LQLRGDLHRPDNSRVDAVDDHWDQFSSFSVYDQFTREWLAAARRLLKPNGAIWVIGSYH
FT                   NIFRVGAALQDQGFWILNDVVWRKSNPMPNFKGKRLTNAHETLIWASKQEASKYTFNYE
FT                   ALKALNEGVQMRSDWVIPICTGHERLKDEQGDKAHPTQKPEALLHRVMVATTNPGDVVL
FT                   DPFFGTGTTGAVAKMLGRDFIGIEREESYRRIAAERLSRVRRYDASALEVSGSKRAEPR
FT                   VPFGQLVERGMLRPGEELYSMNNRHKAKVRADGTLIGNDVKGSIHQVGAALEGAPSCNG
FT                   WTYWCYKREGKMIPIDILRQQIRAEMEDPRPN"
FT   gene            complement(135676..136314)
FT                   /locus_tag="Rsph17029_0120"
FT   CDS_pept        complement(135676..136314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0120"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG: rsp:RSP_1470
FT                   ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75240"
FT                   /db_xref="GOA:A3PFX4"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PFX4"
FT                   /protein_id="ABN75240.1"
FT                   /translation="MEITCPDWTHETAALAEGFTCVVGVDEVGRGPLAGPVTAAAVRLF
FT                   PGRIPEGLNDSKKLTALRREMLAAEIHTVAEVSIAHASVEEIDRLNILQASHLAMGRAL
FT                   AGLPSRPDFALIDGHMVPKGLGHRCRAIVKGDALCLSIAAASIVAKVARDRIMVDLEQQ
FT                   HPGYGWRTNAGYGTKDHLQALLNLGPTPHHRRSFKPVHNILYQEASISP"
FT   gene            complement(136470..136934)
FT                   /locus_tag="Rsph17029_0121"
FT   CDS_pept        complement(136470..136934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75241"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFX5"
FT                   /protein_id="ABN75241.1"
FT                   /translation="MIPFGRLPHSLAAALICAAPLLPAAAWSQTGVPLPLVSAGDRPVT
FT                   LPWTRPVVPGEGHDRPAAWGRIYPPPQEIPVPRHRADGPRHAHGDHHPWDDRRAWEDWR
FT                   RWSEHHDRGLHREGPPRPVLRELPRECLIVTRSDRAAFDAGCLARNGFRS"
FT   sig_peptide     complement(136848..136934)
FT                   /locus_tag="Rsph17029_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.778 at
FT                   residue 29"
FT   gene            137258..137581
FT                   /locus_tag="Rsph17029_0122"
FT   CDS_pept        137258..137581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75242"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFX6"
FT                   /protein_id="ABN75242.1"
FT                   /translation="MIGARETRSSSMRLSVLLAALALGSALAAPVEAACFADYKAKQDR
FT                   PLRLHYGVAKVPDGACNRKGATRVLKPRLQQAGWTLLNVLSTFGPEGLDERKASAGSYF
FT                   LRY"
FT   sig_peptide     137258..137344
FT                   /locus_tag="Rsph17029_0122"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.968 at
FT                   residue 29"
FT   gene            137553..138257
FT                   /locus_tag="Rsph17029_0123"
FT   CDS_pept        137553..138257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0123"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: rsp:RSP_1472 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75243"
FT                   /db_xref="GOA:A3PFX7"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFX7"
FT                   /protein_id="ABN75243.1"
FT                   /translation="MREATSSATDALRAGNRVVAGGISAIVLILAAAAVFLFLNLPDAD
FT                   AFNARVERLFVEVDALRSGPEIRLLEILAQSGTTFSEVLASYRTVIFVLLVFSTSLLVA
FT                   ALVLLVTIVALNRRMSAIQRSGIQVASLMISRESRSVFINDMEFSLTEAAIETLSVLAE
FT                   ARMDDDMLSGAQIEAVISGKNVTDCDEAAGATRVKRLRDALGNQLVSELLVKTVARRGY
FT                   MLAVEKDVIRMV"
FT   gene            complement(138283..138654)
FT                   /locus_tag="Rsph17029_0124"
FT   CDS_pept        complement(138283..138654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75244"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFX8"
FT                   /protein_id="ABN75244.1"
FT                   /translation="MTFPRLGLALAAVLATSAAFAQEGASQTGEQKAQVTGELQSISMT
FT                   PPPQLELLAPDGARWIIDLGEPERMERAGLDAETAQPGVAVHVLGLRAADGANRMEALR
FT                   VTIDGTAYDLQPEEVEPKT"
FT   sig_peptide     complement(138589..138654)
FT                   /locus_tag="Rsph17029_0124"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            138858..139955
FT                   /locus_tag="Rsph17029_0125"
FT   CDS_pept        138858..139955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0125"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /note="TIGRFAM: carboxynorspermidine decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: rsp:RSP_1474 putative
FT                   carboxynorspermidine decarboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75245"
FT                   /db_xref="GOA:A3PFX9"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFX9"
FT                   /protein_id="ABN75245.1"
FT                   /translation="MIQTPYYLIDADRLRQNMAVVDRLRQASGAKALLALKCFATWPAF
FT                   EHMRDHMDGTTSSSLYELRLGREKFGKETHAYSVAWPDHEIDEAVGYADKIIFNSVGQL
FT                   ARFRNRTGGIARGLRLNPGLSTSGFDLADPARPFSRLGEWSAEKIEAVLPDISGVMIHY
FT                   NCENADVDLFDRQLSEIEGRFGAILDRLDWVSLGGGIHFTGEGYPVDRLAARLKAFAAA
FT                   HGVQVYLEPGEAAITRSATLEVTVLDLLDNGKQLAIVDSSVEAHMLDLLIYRQSAKVEP
FT                   DAGDHSYMVCGKSCLAGDIFGEFRFAQPLQVGDRLSIADAAGYTMVKKNWFNGVKMPSI
FT                   VIREPDGSLRVAREFGYGDYASSLG"
FT   gene            139992..141230
FT                   /locus_tag="Rsph17029_0126"
FT   CDS_pept        139992..141230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0126"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG: rsp:RSP_1475
FT                   saccharopine dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75246"
FT                   /db_xref="GOA:A3PFY0"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFY0"
FT                   /protein_id="ABN75246.1"
FT                   /translation="MKKNVLIIGAGGVAQVVAHKCAQNNDVLGDLHIASRTVSKCEAII
FT                   ASVHEKGAMKVAGRFEPHAVDATDTAAVAALIRGTGAEIVINVGSAFVNMPVLEACLET
FT                   GAAYMDTAIHEDPAKICETPPWYGNYEWKRRERCAEAGVTAILGVGFDPGVVNAYARLA
FT                   ADEYLDEVRSIDIVDINAGSHGRWFSTNFDPEINFREFTGTVYSWQNGDWQSNRMFEVG
FT                   QEFDLPVVGKQQAYMTGHDEVHSLAANYPQADVRFWMGFSDHYINVFTVLKNLGLLSEK
FT                   PVRTAEGLEVVPLKVVKAVLPDPSSLAPDYTGKTCIGDIVKGTKDGQPAEVFIYNVADH
FT                   AEAYAEVGSQGISYTAGVPPVAAAILVAEGTWDVRKMANVEELDPKPFLALLNRMGLPT
FT                   RIKDAAGDRALEF"
FT   sig_peptide     139992..140054
FT                   /locus_tag="Rsph17029_0126"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.800) with cleavage site probability 0.557 at
FT                   residue 21"
FT   gene            complement(141424..143367)
FT                   /locus_tag="Rsph17029_0127"
FT   CDS_pept        complement(141424..143367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0127"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: rsp:RSP_1476 heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75247"
FT                   /db_xref="GOA:A3PFY1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFY1"
FT                   /protein_id="ABN75247.1"
FT                   /translation="MSVAATEPWTSPMTDDRAPLILTGLTLVGMFAAAVVRWGIGTTEA
FT                   PWPAVEAGALLLVFLAGGVPAAIRALKALWQEHELDIDLLMVIAALAAAAVGAAMEGAV
FT                   LLTLFSFSTTLEQRAMGRARRAIEALMELRPDRTLRRTEAGTEEVAVEDLRPGDVVVLR
FT                   PGARVPVDGVVVEGEGSIDESTITGESVPVAKSRGAAVFEATVNLHGVLEVEVRRPLTE
FT                   STVARMIALVTEAQAARAPSERFSEWFGQRYTVAVLAGSILALLGFLWAGRAWDDALYR
FT                   AATLLVAASPCAIVISVPAAILSALSAAARGGVLFKGGAALETLARVESFAFDKTGTLT
FT                   TGRQEVVEIACDGDRDAFLTRLAGLEAHSEHPIADAIRRAAEARGLQPFPVREARAVPG
FT                   EGMVGVDDEGMIWAGNARLAARMGARSTPAEPSASVSALHRGAETLVLLGRGARLLGAL
FT                   TVADRPRDSAGPGIAALRQSGVRRIAMLTGDRRAVADRIGAGLGIGPDEIRADLLPEDK
FT                   VRIVAEFAAQGRVAFVGDGVNDAAALARADVGIAMGAAGSEVALQAADVALLSEDIGRL
FT                   ALAHRLSRRTARIIRQNLVFAMGAMVTLVLSGLFLDLPLPLAVIGHEGGTVLVVLNGLR
FT                   LLADPIRRRRTA"
FT   gene            complement(143446..143625)
FT                   /locus_tag="Rsph17029_0128"
FT   CDS_pept        complement(143446..143625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75248"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFY2"
FT                   /protein_id="ABN75248.1"
FT                   /translation="MTDDSKSAPQDRRREDDVVDQRHQQIDPAGKDREDPGEAGPHRSQ
FT                   KQPGQTPEDPQDKP"
FT   gene            complement(143652..145271)
FT                   /locus_tag="Rsph17029_0129"
FT   CDS_pept        complement(143652..145271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0129"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase; KEGG: rsp:RSP_1478 ABC
FT                   oligopeptide transporter, fused ATPase subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75249"
FT                   /db_xref="GOA:A3PFY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFY3"
FT                   /protein_id="ABN75249.1"
FT                   /translation="MEPVLDVKGLRVAFQTNDGEVQAVRGIDLSVMPGETVAIVGESGS
FT                   GKSQTTMALMGLLAQNGRATGSALYRGRELIGLSERELNKVRGDKITMIFQEPMTSLDP
FT                   LYRIGDQLAEPLRFHRGLSKREARPRIVELLRLVGIPEPERRIDSYPHELSGGQRQRVM
FT                   IAMALACDPDILIADEPTTALDVTIQAQILTLLADLQKRLGMAILFITHDLGIVQRFAD
FT                   RVYVMQAGEVVETGETAALFEAPSHPYTRMLLDAEPEGTKAPPPETAPVLMEGRNVEVV
FT                   FSSGGGLFEAPNKLRAVDGVSVRLRQGQTIGVVGESGSGKSTLGRALLRLLPSAGLVTF
FT                   EGRELARDAAEMRPLRRRMQLVFQDPFGSLSPRMTVGRIITEGLKIHEPDLSTRERDRR
FT                   AGEALAEVGLSPAMRNRYPHEFSGGQRQRIAIARSMILKPRVIVLDEPTSALDRSVQKQ
FT                   IVDLLRDLQARHGLSYLFISHDLAVVRALADYILVMKEGRIVEEGQTADIFDRPQEAYT
FT                   RTLMAAALETRRFREEAERTGV"
FT   gene            complement(145273..146412)
FT                   /locus_tag="Rsph17029_0130"
FT   CDS_pept        complement(145273..146412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0130"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsp:RSP_1479 ABC
FT                   oligopeptide transporter, inner membrane subunit OppC"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75250"
FT                   /db_xref="GOA:A3PFY4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFY4"
FT                   /protein_id="ABN75250.1"
FT                   /translation="MTEMPIPTPGTPSPQPEAIVGRSLWQDAWIRLRRNRAAVASALVL
FT                   AFLGLVGIFGPMLSPHDYTRVYPQFVRAPASLEPYPRADVVIPSFERTMARARIEGAPV
FT                   LENGTVSVRIEDEDPIDDRILRYFQRSDLFINPRLDLAPDGLSGTLSADVEQLYFLFGT
FT                   DAVGRDLMSRIFIGVRISLAIGLLASAMALLLGVTYGAISGYLGGRVDNVMMRIVDVLY
FT                   SLPFIFFVILLVVFFGRNLVIIFIAIGATEWLDMARIVRGQTLSLKRQEFVQAAEALGA
FT                   TRAGILMRHVVPNTLGPVIVFVTLLVPKAILLESLLSFLGLGVQEPLTSLGLLISEGAA
FT                   NMRGAPWLLIWPALTLTAILFALNFLGDGLRDSLDPKDR"
FT   gene            complement(146405..147328)
FT                   /locus_tag="Rsph17029_0131"
FT   CDS_pept        complement(146405..147328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0131"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsp:RSP_1480 ABC
FT                   oligopeptide transporter, inner membrane subunit OppB"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75251"
FT                   /db_xref="GOA:A3PFY5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFY5"
FT                   /protein_id="ABN75251.1"
FT                   /translation="MLRYTLRRLASAVPTVFIIVTLTFFMIRLAPGGPFDLERPLDPLI
FT                   MENLKRAYNLDGSLWSQYLTYMGNLMQGDLGPSFTKRDFTVNDLFASGLPISMLLGGLA
FT                   ISLAVAIGTILGAIAALRQNSWLDYTIVGLATFGITTPNFVVAPLLSLFFGVILRWLPA
FT                   GGWSSSDPAYWVLPVVTLALPQVAVIARLVRGATIEALRSNHVRTARAYGLPARTVVVK
FT                   HALRAAMLPAVSYLGPTAAGLLTGSVVVETIFGLPGIGRYFVQGALGRDYTLVMGTVVV
FT                   IALFILLFNLIVDLLYTLLDPRVRYD"
FT   gene            complement(147385..148974)
FT                   /locus_tag="Rsph17029_0132"
FT   CDS_pept        complement(147385..148974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0132"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: rsp:RSP_1481 ABC oligopeptide transporter,
FT                   perplasmic substrate-binding protein OppA"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75252"
FT                   /db_xref="GOA:A3PFY6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFY6"
FT                   /protein_id="ABN75252.1"
FT                   /translation="MTLFSLRAGACALALMAGTAGMAAAQVTIVRGNDTDPATLDHHLT
FT                   STVAESRIMNDLYEGLVVQDAQAKVVPGVAESWEISEDGLTYTFKLRDDAKWSNGDPVV
FT                   AEDFVFALRRIMTPATAAVYANILYPIANAEAIATGAKQPEELGVEAVDAHTLKFTLNA
FT                   PTPYFLELLTHQSSLPMHRATVEAEGSNFTKPGVMVTNGAYKLVSFVPNDRIVMEKNEH
FT                   FHGAANVAIDRVEWVPFEDRSACLRRFEAGEVQMCTDVPAEQMAYMRENLKDELHIAPY
FT                   LGTYYLPVKGADGSPLKDKRVRQAISMVLDRDFIAEEVWQETMLPGYSMVPPGISNYVE
FT                   TPPALDYADEDLLDREDKAKALLEEAGVAEGSLTVQLSYNSSENHRNTMTAIADMLKNI
FT                   GINATLNEMEGTNYFNYLKEGGAYDIVRAGWIGDYSDPQNFLFLFEGGVPFNYPRWENA
FT                   EYDALMDKAAVTQDLGQRAQIMADAETILLDEVPAIPLLTYSSRALVSGKVQGYADNLP
FT                   DVHLTRWLSLAE"
FT   sig_peptide     complement(148897..148974)
FT                   /locus_tag="Rsph17029_0132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.929 at
FT                   residue 26"
FT   gene            complement(149421..149762)
FT                   /locus_tag="Rsph17029_0133"
FT   CDS_pept        complement(149421..149762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_4596 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75253"
FT                   /db_xref="GOA:A3PFY7"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFY7"
FT                   /protein_id="ABN75253.1"
FT                   /translation="MQDENFASERRAAAAVARRSRGDRQRRQPRFACILVGTGPAGLTA
FT                   AISVLLLGGGQSRALLIPRSPNPPALPKGIRSAGRLSRMRGRPGIAPEPGRGVTLGCPD
FT                   GGEERFDAV"
FT   gene            149816..150175
FT                   /locus_tag="Rsph17029_0134"
FT   CDS_pept        149816..150175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75254"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFY8"
FT                   /protein_id="ABN75254.1"
FT                   /translation="MIATDDPLQDRPRAGGQDRTEKRLAGAVRVMACEAAPLEAAAPPA
FT                   EGAILRLERDPQRPFASGAVLLLDEAGRAVAQLSALPVRMLAALLDNGCESFALVEQTG
FT                   SRVSVAIHLAAPFWG"
FT   gene            complement(150248..152629)
FT                   /locus_tag="Rsph17029_0135"
FT   CDS_pept        complement(150248..152629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0135"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA, RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: rsp:RSP_1485
FT                   ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75255"
FT                   /db_xref="GOA:A3PFY9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFY9"
FT                   /protein_id="ABN75255.1"
FT                   /translation="MAVNPGAAARPPFGRYMTQTDIAAPLAAALAAKGYESLTPVQEAV
FT                   LAEGVAGRDALVSAQTGSGKTVAFGIAIADQILQGADRLLFADTPIALAIAPTRELALQ
FT                   VARELGWLYGEAGAHIATCVGGMDYRTERRALDRGAHIVVGTPGRLRDHIERGSLDLSG
FT                   LRAVVLDEADEMLDLGFREDLEFILGSAPEERRTLMFSATVPKEIEALAKEFQQDAVRI
FT                   QTAGERKQHADIEYRALTVSARDKEHAIFNVLRFYEAPSAIVFCKTRLAVNHLLARMGN
FT                   RGFQVVALSGELSQQERTHALQALRDGRARVCIATDVAARGIDLPGLELVIHADLPTNS
FT                   ETLLHRSGRTGRAGSKGVSVLIAAPSEVRKAQRLLTGAKLVADWGKPPSADEVQERDDA
FT                   RLLEHPVLGQDLSDEMPLAEKLLERFGPAQMSAAFVRLWREGRSAPEVLQDLAPPEPSQ
FT                   RAPRERGEFGEAVWYAVAVGHTGRAEARWLLPKICEAGGVTKNEIGAIRVQQEQTFVQI
FT                   AKAAAGKFGAALEIEAGVGMVRLDGEPMLERPERAPRKPFAERAPRARDEAPRREKAPY
FT                   QPKPSRFVEEEPGEARGGWTPDDRPERAPRPRREDGAPFAKREMNDAPRPRRESAAEDE
FT                   GRKPRRTSDERPARPAAAGRSAGFKSHGGTASRSAGYKSHGDAAPRGKRDDEGPRPYKP
FT                   RGEDAPRAAGFKSHGKPVRAEGDGPRARPARSADDRPAKAGGFKAREDRPAKPRAEGAA
FT                   ERPARSGFKKDFGKKDAPRKPRAEASDTSRRFTPPKKPRS"
FT   gene            152772..153377
FT                   /locus_tag="Rsph17029_0136"
FT   CDS_pept        152772..153377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0136"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: rsp:RSP_1486
FT                   regulatory protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75256"
FT                   /db_xref="GOA:A3PFZ0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFZ0"
FT                   /protein_id="ABN75256.1"
FT                   /translation="MTTGDGRSRLLAAATRLIRTQGFAATSVEAICREAGVTKGAFFHH
FT                   FPSKEALGVAAAEAWSDVTGRLFAEAPYHRPADPLDRVLAYIDFRRALVAGEIADYTCL
FT                   VGTLVQEAYGSDPIRAACGASILGHAGTLEADMAAAAEARGVADVDPASLARHTQAVLQ
FT                   GAFILAKAGGGAAAVEEALDHLKRYLRLLFANPGASGA"
FT   gene            153444..153791
FT                   /locus_tag="Rsph17029_0137"
FT   CDS_pept        153444..153791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0137"
FT                   /product="protein of unknown function DUF1428"
FT                   /note="PFAM: protein of unknown function DUF1428; KEGG:
FT                   rsp:RSP_1487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75257"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFZ1"
FT                   /protein_id="ABN75257.1"
FT                   /translation="MPYVDGFVCAVPVENRQKYIDHALFAARKFKEVGALQVVECWGDD
FT                   VPEGKLTSFRMAVKQEEGEAAIFSWVVWPSKEVRNAAWQKMMEDTEMAGMEMPFDGKRM
FT                   IYGGFEQVVEV"
FT   gene            153793..154536
FT                   /locus_tag="Rsph17029_0138"
FT   CDS_pept        153793..154536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0138"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rsp:RSP_1488 possible
FT                   glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75258"
FT                   /db_xref="GOA:A3PFZ2"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFZ2"
FT                   /protein_id="ABN75258.1"
FT                   /translation="MGGFVWHELTTADPDGAAAFYGRLLGWEAETFPGSAPPYLVLKAA
FT                   DVGVAGLCAAKAPQPAGWIGYLHVADVEEACRRAEAAGGTAVAPAEEMEGIGRMQLMRD
FT                   PDGVPFVLMTPAPREAPPRPPEGTTGLSVWDEHYGADVERSFAFYAGLAGWTKDSAMDM
FT                   GEMGTYQMVAAGGRAIAGLMRAPEAMGPRWLAYFNVPSVTGAMEEAERLGGRPFFGPQE
FT                   VPGAMWIAQILDPQGHPFGIVGPKG"
FT   gene            154668..155582
FT                   /locus_tag="Rsph17029_0139"
FT   CDS_pept        154668..155582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0139"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Tetratricopeptide TPR_4;
FT                   Thioredoxin domain; KEGG: rsp:RSP_1489 protein containing
FT                   thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75259"
FT                   /db_xref="GOA:A3PFZ3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFZ3"
FT                   /protein_id="ABN75259.1"
FT                   /translation="MLGFGDKPANGAAPQGDLVKDTSEATFMQDVIDASRDVPVIVDFW
FT                   APWCGPCKTLGPALEAAVTAAKGKVRMVKVNVDENQMIAAQLRIQSIPTVYAFFQGQPV
FT                   DGFQGALPPSEVKKFVEKIAAMGGDDGLADALAAAEEMLAEGAVVDALETFAAILGEEP
FT                   ENAAAYAGLIRCHLASGDLDQAEAYAAAAPAAIAKAKEIEGARAQIELARQAAKAGPVT
FT                   ELSRAVEADPANHQARFDLALALHASGRVDEAVDQLLELFRRDREWNEGAARTQLFTIF
FT                   DALKPTDPIVLKGRRRLSSMIFA"
FT   gene            155586..156254
FT                   /locus_tag="Rsph17029_0140"
FT   CDS_pept        155586..156254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0140"
FT                   /product="peptidase S16, lon domain protein"
FT                   /note="PFAM: peptidase S16, lon domain protein; KEGG:
FT                   rsp:RSP_1490 putative ATP-dependent protease La, LON"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75260"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFZ4"
FT                   /protein_id="ABN75260.1"
FT                   /translation="MGRASSEPMIKQADLPDVIPVFPLPGALLLPRARLPLHIFEPRYL
FT                   QMLDDTLKTPNRLIGMVQPRDVPGGAEKRLHAIGCAGRLTGFSETEDGRYMITLSGISR
FT                   FRVISEVQGFTPYRRCTVDWADFSRDLGPAETDAGFRREAFLDLLGRYFTAMELSTDWG
FT                   SLREAEEELLINSLSMLCPFDPEDKQALLEAPSLETRRETLVTLIEFALRGGTGEEVMQ
FT                   "
FT   gene            156251..156430
FT                   /locus_tag="Rsph17029_0141"
FT   CDS_pept        156251..156430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0141"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   rsp:RSP_1491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75261"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PFZ5"
FT                   /protein_id="ABN75261.1"
FT                   /translation="MIGNTLFDRRMLEALVCPVTQAGLAYDADRQELISKQARLAFPIR
FT                   DGIPIMLVSEAREL"
FT   gene            complement(156507..157736)
FT                   /locus_tag="Rsph17029_0142"
FT   CDS_pept        complement(156507..157736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0142"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase /
FT                   2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase,
FT                   FAD-binding; KEGG: rsp:RSP_1492 UbiH/COQ6 monooxygenase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75262"
FT                   /db_xref="GOA:A3PFZ6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFZ6"
FT                   /protein_id="ABN75262.1"
FT                   /translation="MTQAADILIAGGGLNGPALALALARNGFSVTVVDGRPAPQRAEPG
FT                   FDGRAYALALASKRLLAALGLWDGLASQAQPILRVVTADGTTAGGPSPFVLAFDHAEIE
FT                   EGPMGYLLEDRFLYAAFLAALEAEPRIRLVSGTTVEAQEVGPQGVTVTLSTGAQLSGRL
FT                   LVGCDGRQSGTARRAGIRRSGWGYGQTALVTAIEHERPHEGTAWQYFLPAGPLAILPLP
FT                   GGHRSSIVWSESDAAAAGIQRLPDADYLGALRPRFGDFLGSIRLAGDRFTYPLSLSLAH
FT                   SFVAPRVALVGDAAHGVHPIAGQGLNLGLRDVAALAEVLTLAARRGEDVGSPLVLDRYQ
FT                   QWRRFDATALALGMDMVNRLFSNDNPMLRAGRDLGMGIVNALPGLRRGFIRQAAGLSGD
FT                   LPRLLQGRPI"
FT   gene            157818..159143
FT                   /locus_tag="Rsph17029_0143"
FT   CDS_pept        157818..159143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0143"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: rsp:RSP_1493 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75263"
FT                   /db_xref="GOA:A3PFZ7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFZ7"
FT                   /protein_id="ABN75263.1"
FT                   /translation="MDRLWMTAAELGRGIEAGRIHPVELAEAFLAAAADHPEGTRIYAR
FT                   LCPTRARTEAMAAAERAKRGLRRGPLDGVPVSWKDLFDTAGVATEAGSALLKGRVPEED
FT                   AAVLGTATLGGLVCLGKTHMSELAFSGLGLNPVTATPPCVNDPAAVAGGSSSGAAASVA
FT                   FGLAPAAIGSDTGGSVRIPAAWNDLAGLKTTAGRLSLAGTVPLAARFDTVGPLARTVED
FT                   CALLLAVLEGGRPADLRGASLAGRRFLVLETLALEDLREAPARGFEEAVARLARAGARI
FT                   ERGAAPEVVEAMAMAGPLFTGEAYATWAEVIEGAPDLMFPRILERFRSGASITAVEFVT
FT                   AWQRLEALRAAWAARTAGYDAVLVPTSPILPPDAKRLLTDESYYVGENLLALRNTRIAN
FT                   LMGLPALTLPTGQPSCGISLMGQPMGEERLLRLGAAAERALG"
FT   gene            159266..160444
FT                   /locus_tag="Rsph17029_0144"
FT   CDS_pept        159266..160444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0144"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   rsp:RSP_1494 putative aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75264"
FT                   /db_xref="GOA:A3PFZ8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFZ8"
FT                   /protein_id="ABN75264.1"
FT                   /translation="MAFPERFSNLPDYAFPRLRKLLDPHAPGGEPVAMTIGEPKHPMPE
FT                   FVGPVLAESLAGFGLYPPNDGTPELLSAIGGWLKRRYRVDLGPERLMVLNGTREGLFNA
FT                   ALALVPETKRGARPVVLMPNPFYQVYAMAALALGAEPVYVPALASNGFLPDYASLPAEI
FT                   LERTALAYLCSPANPQGSVASRDYWAGLMDLAETHDFRLFADECYAEIWRTAPPAGALE
FT                   VADATGADPERIFAFHSLSKRSNLPGLRSGFVAGGPEGIARIRQLRAFAGAPLPLPVQR
FT                   VSERAWADETHVEANRALYQEKFRIADEVFSGLQGYMGPEGGFFLWLPVPDGEEAALKL
FT                   WTETGVRVLPGAYLAREVGGENPGKGYIRVAMVAPKDEMQRGLVRLRDCLYG"
FT   gene            160455..163739
FT                   /locus_tag="Rsph17029_0145"
FT   CDS_pept        160455..163739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0145"
FT                   /product="DNA translocase FtsK"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: rsp:RSP_1495
FT                   putative cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75265"
FT                   /db_xref="GOA:A3PFZ9"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:A3PFZ9"
FT                   /protein_id="ABN75265.1"
FT                   /translation="MASYHARQRDPLLDQNMQAMLERRGRELLGIGLLIVAFLFMLILG
FT                   TYSPEDPGWMVATDEPAQNALGRIGAAISSTLMIIAGKGSWGLPIVAGAWGARFLLHRG
FT                   EERALGRIVFAVIAIALGSIYAATHVPGSEWTHSFGLGGLFGDTVLGALLEILPLPAAY
FT                   GLKLLSLLVGGGLVAMGLFVCGFDLRELRQVTQFLLVGLVVTYNAALQLAGRGSVQAAQ
FT                   LMQEKIRAHREGRAAVDAAAVRGEARAEAMPRPRSRFRDPEPEPEPAPRMGFLSRLRAQ
FT                   APEDDPEPVIEEAAWGRPATLRADTTRPAALRSEGLRAEPRHVEPAPAPAQPRTGLLAR
FT                   MPQIIRRVTDPEAELVEHALSDAAANAEGPTEDRIKARINDVIRSRVRQSTGPLSPIAA
FT                   AIARREPPMARRRSGPAPMVASRRAPMELPPEPPVVAGAGEKIRFASGMVASRMPGAAT
FT                   ARLAVSALEADAAPAHAPRLMAEAYDAYEACETGEPILTAREQLAYADEDEAAAYDEAY
FT                   AAEEEVESYAAEEAAWLPHEDFDDSTDWAPEPAAPAAPMMAPAMAPKPAAAPAARAPAV
FT                   RPPEAQPKPRFEEQEAHYELPPLSLLACPSTIVRNTLSVDALKENARMLESVLEDYGVK
FT                   GEIVDAQAGPVVTLYELEPAPGLKASRVIGLADDIARSMSALSARVSTVPGRTVIGIEL
FT                   PNVSREKVILREILAARDFGDSSMRLPLALGKDIAGRPVVANLAKMPHLLIAGTTGSGK
FT                   SVAINTMILSLLYKLTPEECRLIMIDPKMLELSVYDGIPHLLSPVVTDPKKAVVALKWV
FT                   VGEMEERYRKMSKLGVRNIEGYNGRVSEALEKGEMFKRTIQTGFDEDTGEPVFETEDLQ
FT                   PVRLPFIVVVVDEMADLMMVAGKEIEACIQRLAQMARASGIHLIMATQRPSVDVITGTI
FT                   KANFPTRISFQVTSKIDSRTILGEQGAEQLLGMGDMLYMAGGAKITRIHGPFVSDEEVE
FT                   EIVNHLKSFGPPKYMSGVVEGPEDDRADDIDAVLGLGGNTDSEDALYDQAVAIVAKDRK
FT                   CSTSYIQRKLGIGYNKAARLVEQMEEQGVVTAANHVGKREILLPEQ"
FT   gene            163871..164509
FT                   /locus_tag="Rsph17029_0146"
FT   CDS_pept        163871..164509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0146"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: rsp:RSP_1497 putative outer membrane
FT                   lipoprotein carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75266"
FT                   /db_xref="GOA:A3PG00"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG00"
FT                   /protein_id="ABN75266.1"
FT                   /translation="MRSPRGAPSFITMKPMRLILAPLAFLALALPAAAEKIPLSALSSY
FT                   LNGLSTAEADFTQVNADGSVSTGRIFIKRPGRVRFEYAPPEKSLVVAGGGQVAIFDAKS
FT                   NQPPEQYPLSRTPLSLILAQNIDLGRAKMVVGHREDKNTTRVVAQDPAHPEYGTIEMVF
FT                   TANPVALRQWVITDDAGNQTTVILGAMAQGRNLPASLFSIQSEAAKRSR"
FT   sig_peptide     163871..163975
FT                   /locus_tag="Rsph17029_0146"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.982 at
FT                   residue 35"
FT   gene            complement(164571..165152)
FT                   /locus_tag="Rsph17029_0147"
FT   CDS_pept        complement(164571..165152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0147"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75267"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG01"
FT                   /protein_id="ABN75267.1"
FT                   /translation="MSRLLRAAILLVFLASCGGGRYSPPRDLENACSIVAERPQYYRAM
FT                   KATERRWGIPVSVQMATIHQESKFVGNARTPHQFLLGIIPMGRQSSAYGYSQALDGTWE
FT                   EYMDERRKRRARRDRIEDATDFMGWYMDGTTRRLGIPKWDATNQYLAYHEGRTGYSRGS
FT                   HNAKPWLLAVAQRVGDREQRYRAQLTSCRR"
FT   gene            165384..165749
FT                   /locus_tag="Rsph17029_0148"
FT   CDS_pept        165384..165749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0148"
FT                   /product="hemimethylated DNA binding protein"
FT                   /note="TIGRFAM: hemimethylated DNA binding protein; PFAM:
FT                   Hemimethylated DNA-binding region; KEGG: rsp:RSP_1498
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75268"
FT                   /db_xref="GOA:A3PG02"
FT                   /db_xref="InterPro:IPR011722"
FT                   /db_xref="InterPro:IPR036623"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG02"
FT                   /protein_id="ABN75268.1"
FT                   /translation="MAAGIMEWSGVRDMLKTQAKYHLGQVLRHRKHPFRGVVFDVDAMF
FT                   ANTEEWYDAIPEESRPSRDQPFYHLLAENDQSYYVAYVSEQNLVPDDTGEPVEHPDLAE
FT                   LFGEFEDGRYPLQFQLN"
FT   gene            complement(165790..167418)
FT                   /locus_tag="Rsph17029_0149"
FT   CDS_pept        complement(165790..167418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0149"
FT                   /product="gamma-glutamyltransferase 2. Threonine peptidase.
FT                   MEROPS family T03"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   rsp:RSP_1499 probable gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75269"
FT                   /db_xref="GOA:A3PG03"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG03"
FT                   /protein_id="ABN75269.1"
FT                   /translation="MENVSHASRLLPDQEDDMRDFHLPGRSAVYAGNGLCATSHPLASK
FT                   VVIDILQAGGNAADAAIAAAVLLGICEPQMTGIGGDCFVLLKPPGEDRIVALNGSGRAP
FT                   AGLSAALMREKGHATVPLHGPEAVTVPGAVDAFCRLSADWGNLELAQVLAPAIQYAEEG
FT                   VPVAPRTAFDWALAKEKLQGAARQYYLVDGAAPRAGQIFRAAGQAEVLRRIAQQGRAGF
FT                   YEGEVAEDMVTSLRSVGGTHMLEDFAATACNYGEPISGTYKGVELVEHPPNGQGATAIL
FT                   MLNILSQFDVAAMDPFGTARAHLEAEAAKLAYDARNRFLADPDHVRRLDHMLSPQTAER
FT                   LAALIDPTRAMPEAAPLSEAVHRDTVYLTVVDRDRMAVSLIYSVYHSFGSGLASARFGI
FT                   NFQNRGAGFCLTKGHANEAMGAKRPMHTIIPGMIRRNGRVIVPFGVMGGAYQPAGHARF
FT                   VSNLVDFGMDPQEAIDAPRSFSGPDGMLVERGYDERVRAELAAMGHDVRVPHEPIGGAQ
FT                   AILIGEDGVLVGASDPRKDGCALGY"
FT   gene            complement(167479..168021)
FT                   /locus_tag="Rsph17029_0150"
FT   CDS_pept        complement(167479..168021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0150"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: rsp:RSP_1500 possible anti-sigma regulatory
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75270"
FT                   /db_xref="GOA:A3PG04"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG04"
FT                   /protein_id="ABN75270.1"
FT                   /translation="MPSEGDPASASYRLRLDSRPLAVRAALTELADCPPLRALPAEARD
FT                   AAQILLAEVLNNCTEHAYAGSAGPVEVALDLRRGQLSCEVADRGRPMPGAGPEARPGLP
FT                   CPVLSLREGGFGWMLIRALAEELRYCHEDGVNRLSFRVARTCLAAPEPCRCPRTAISPE
FT                   SGCESAPGDCEGRACSG"
FT   gene            complement(168011..168334)
FT                   /locus_tag="Rsph17029_0151"
FT   CDS_pept        complement(168011..168334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0151"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   rsp:RSP_1501 antisigma-factor antagonist (STAS) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75271"
FT                   /db_xref="GOA:A3PG05"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG05"
FT                   /protein_id="ABN75271.1"
FT                   /translation="MDLETEVRGDLLVVRVQEERIDAAAAIEFKDRMRELVDTPASRVL
FT                   LDLSCVTFLDSSGLGAVVAVMKLLGPDRRLELATLGPVVRKVFRLTRMDRVFTIHERVS
FT                   DAL"
FT   gene            168452..168904
FT                   /locus_tag="Rsph17029_0152"
FT   CDS_pept        168452..168904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0152"
FT                   /product="GAF domain protein"
FT                   /note="KEGG: rsp:RSP_1502 GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75272"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG06"
FT                   /protein_id="ABN75272.1"
FT                   /translation="MDYDQLDQTIEALCHGEQDTVALMATVACEIHHAHPLSDWTGFYR
FT                   VTGPELLKIGPYQGAHGCLVIPFSRGVCGAAARTGRIQLVPDVEAFPDHIACSSTTRSE
FT                   IVLPVRNGEGRLLGVLDLDSNTPAAFTEEDAARLQALLDRTFRDAV"
FT   gene            168956..169292
FT                   /pseudo
FT                   /locus_tag="Rsph17029_0153"
FT   gene            complement(169308..169568)
FT                   /locus_tag="Rsph17029_0154"
FT   CDS_pept        complement(169308..169568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75273"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG07"
FT                   /protein_id="ABN75273.1"
FT                   /translation="MTEATTTRDHDKIRKWAEARDGHPAKVETGGKGGILRIDFGEPED
FT                   SLTRIDWDEFFRIFDENKLSFLHQEKTKDGGQSRFNKFVSE"
FT   gene            169652..170299
FT                   /locus_tag="Rsph17029_0155"
FT   CDS_pept        169652..170299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0155"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.-"
FT                   /note="PFAM: pseudouridine synthase; KEGG: rsp:RSP_1506
FT                   pseudouridine synthase, Rlu"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75274"
FT                   /db_xref="GOA:A3PG08"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG08"
FT                   /protein_id="ABN75274.1"
FT                   /translation="MTDLYAPPDVPLSLIHHDAQIVVVDKPAGLLSVPGKGEDKADCLI
FT                   ERLRGVFPEILLVHRLDRDTSGVMVFALTKAAQGALGQQFEKRQTKKIYVARVAGRLEP
FT                   REGRVDLPLCVDWPNRPKQHVDPENGRPAQTDWRVVKYLPKETRVRLMPVTGRSHQLRV
FT                   HMAETGHPILGDALYAEGAARDFPRLMLHAESLRVRHPDTGKSLTYSAPCPF"
FT   gene            complement(170275..171030)
FT                   /locus_tag="Rsph17029_0156"
FT   CDS_pept        complement(170275..171030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0156"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: rsp:RSP_1505
FT                   putative metallo-phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75275"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG09"
FT                   /protein_id="ABN75275.1"
FT                   /translation="MRLAVLADIHGNADALEAVRADLALQSPDLVVNLGDCLSGPLEVE
FT                   RTADLLMEANWPAVRGNHDRWLVEPEGGTVWETDARPRLSAAQRDWLAALPATRVEAGA
FT                   FLCHATPGSDLIYWLHRVTPEGHVAPSPLERISRFADGIAERLILCGHTHLARSVRLPD
FT                   GRLVVNPGSVGCPGYEDDAPVPHRVESGTPAACYAILDSKGDDWRVTFRQIPYDHDRAA
FT                   RLAGRYDRPDWETVLATGWLPPQKGQGAL"
FT   gene            complement(171027..172487)
FT                   /locus_tag="Rsph17029_0157"
FT   CDS_pept        complement(171027..172487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0157"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: rsp:RSP_1507
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75276"
FT                   /db_xref="GOA:A3PG10"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG10"
FT                   /protein_id="ABN75276.1"
FT                   /translation="MIERRDFYINGGWTAPAKARDCEVIDPSTEEACAVISLGDQADTD
FT                   AAVAAAKAAFEGWAATPPAERLRLVKGILAQYEARKEEMAQAISLEMGAPIDLARNSQA
FT                   PCLPWHLTNFLKAFEEIEWVRPLGPHAPNDRIALEPIGVVGLITPWNWPMNQVTLKVIP
FT                   ALLAGCTCVLKPSEEAPLSSLLFAEFVHDAGLPAGVFNLVNGDGAGVGTQLSSHPDVEM
FT                   ISFTGSTRAGRAISKAAAESLKRVTLELGGKGANLIFADADERAVERGVKHCFNNSGQS
FT                   CNAPTRMLVERPFYDRAVEIAAEVAAKTRVASAHEEGPHIGPVVNKRQFEQIQSYIQKG
FT                   IDEGARLVAGGLGRPDGLNRGFFVRPTVFADVTPGMTIEREEIFGPVLSILPFETEEEA
FT                   VRIANDTPYGLTNYVQSEDGARRNRLARRLRSGMVEMNGKSRGAGAPFGGVKASGRARE
FT                   GGVWGIEEFLEVKAISGWDPEAEALAAE"
FT   gene            complement(172949..173024)
FT                   /locus_tag="Rsph17029_R0008"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(172949..173024)
FT                   /locus_tag="Rsph17029_R0008"
FT                   /product="tRNA-Thr"
FT   gene            complement(173191..174639)
FT                   /locus_tag="Rsph17029_0158"
FT   CDS_pept        complement(173191..174639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0158"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein; KEGG: rsp:RSP_1508
FT                   uncharacterized HemY-like membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75277"
FT                   /db_xref="GOA:A3PG11"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG11"
FT                   /protein_id="ABN75277.1"
FT                   /translation="MLWSLIKILIFVALVVALTFGASQLMESGGALRLAVGDLELNLGP
FT                   LQAVIAALLLILAVWLFLKIVGFLFAVLRFLNGDETAVSRYFDRSREQKGLRALSEGMM
FT                   ALAAGEPRTAMSRAAKARKYLGQNAMTTLLNAQAAQQAGDSRRAQESYKLLLEDERTRF
FT                   VGVRGLLKQKLDEGDTETALALAQKAFEINPKHSETQDILLKLQADLHDWSGARSTLSA
FT                   KMKSGALPKAVYKRRDAVLALQTAKDVFDENASIEAREAAILANKQSPDLIPAAAMAAR
FT                   SYLAQGNKKYATRVLKKAWEAEPHPDLAAAFAEIEPDETPAERLKRFRTLTAIHPDHDE
FT                   TRMLIAELSLAAEDFPGARRALGDIVARHPTQRALTIMAAVERGEGGDEAVVRGWLARA
FT                   LTAPRGPQWCCDNCQTVHATWAPICDNCGGFDTLSWREPTQKSTPSATGTELLPLIVGA
FT                   PAARPADPMDEDVIDEKAVEPTSK"
FT   sig_peptide     complement(174556..174639)
FT                   /locus_tag="Rsph17029_0158"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.394 at
FT                   residue 28"
FT   gene            complement(174650..175951)
FT                   /locus_tag="Rsph17029_0159"
FT   CDS_pept        complement(174650..175951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75278"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG12"
FT                   /protein_id="ABN75278.1"
FT                   /translation="MSEPESREAGEKKRDGDAPDPQTLSTPEPVEPAAAGEPAPPAAPV
FT                   DADPAPLSAAGPDSERALPDEAELMAEMPPATEPERFDPPEEAPAAPPPPPRKTEPQRS
FT                   SGGPAGVVLLLLGGIAGAAGGFAYSRHAQPDWPLANYGQTAQSTAQQREIEQLRAELAA
FT                   ASERPAPEPAPAAGPSAEELTAAQDRAAAAEARVAELEAQLAKAPAEGGAPGADTGALM
FT                   AEIEALRTQIAEASGSAVSDAQAEAQARIAEAEKAAADLKAEAEAQAQAAVTAAALAQV
FT                   QAAIDAGQTYRAPLDELTAKGVTVPEALSAHAEGGIPTLDTLEDEFPAAAREALAVSRR
FT                   ATMGDSWTSRAQAFLLSEAGVRSLAPRAGDGPDAVLSRAEAAVRAGDLQKALDEVAALP
FT                   PEGQQAMAGWTDAVRKRIEAIDAVAALAAAAEGK"
FT   gene            complement(176019..176762)
FT                   /locus_tag="Rsph17029_0160"
FT   CDS_pept        complement(176019..176762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0160"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   rsp:RSP_6208 putative uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75279"
FT                   /db_xref="GOA:A3PG13"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG13"
FT                   /protein_id="ABN75279.1"
FT                   /translation="MVPQSRPLVTAVLLTRPEAQGARFAAALAEALGPVRLVTSPLMAP
FT                   AFLVPAIPLRPDALIFTSETGVEGYRRLAAPELSDVRRAWCVGNRTARAAEAAGLAAHS
FT                   AEGDAERLIAAILAADEPGPLLHLRGAESRGEVAPRLAAAGLTAAEAVVYDQRPQPLSS
FT                   EARALLTDGAPVIAPLFSPRTARLLAQELARIGGTGPLWVAAMSPAVAEAAAALPVARL
FT                   SVAARPDAEALLHAVKALLDAEADA"
FT   gene            176835..177929
FT                   /locus_tag="Rsph17029_0161"
FT   CDS_pept        176835..177929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0161"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: rsp:RSP_1509 glycoprotease (M22)
FT                   metalloprotease; TIGRFAM: putative metalloendopeptidase,
FT                   glycoprotease family; PFAM: peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75280"
FT                   /db_xref="GOA:A3PG14"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PG14"
FT                   /protein_id="ABN75280.1"
FT                   /translation="MSRPLTFLGIESSCDDTAAAVVRAEGTRAEILSSVVDGQTALHAA
FT                   FGGVVPEIAARAHAERLDLCVERALEEAGLGLRDLDGIAVTAGPGLIGGVLSGVMLAKG
FT                   LAAGTGLPLVGVNHLAGHALTPRLTDGLAFPYLMLLVSGGHCQFLIARGAEEFSRLGGS
FT                   IDDAPGEAFDKTAKLLGLPQPGGPSVEAEAASGDPRRFAFPRPMLDRPGCDMSFSGLKT
FT                   ALLRARDGLVAEKGGLTRADRADLCAGFQAAVVDVLAEKTRRALAFYAAEGAARPALAV
FT                   AGGVAANGPIRAALTSVAEAAGVRFLAPPLRLCTDNAAMIAWAGIERFRAGGRDGMELS
FT                   ARPRWPLDRSAPALIGSGRKGAKA"
FT   gene            177926..178843
FT                   /locus_tag="Rsph17029_0162"
FT   CDS_pept        177926..178843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0162"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: rsp:RSP_1510 putative
FT                   glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75281"
FT                   /db_xref="GOA:A3PG15"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG15"
FT                   /protein_id="ABN75281.1"
FT                   /translation="MIGILGAGAFGTALAVTLGREQPVTLWARGGTPRLAVDLPEQVRL
FT                   TADFGEALAGTVLLAVPMQALGGLLRAEAARLRGRALVACCKGVDLATGLGPTGLIAEA
FT                   CPGSPAAILTGPSFAADIARGLPTALTLATQDEAAGEALQRQLSTAALRLYRTTDTVGA
FT                   ELGGALKNVIAIAAGVVIGAGLGQSARAALMTRGYAEMQRLALALGARPETLAGLSGLG
FT                   DLVLTCTSDQSRNFRYGQALGAGAAFDGSVTVEGRATARAVVDLAVRHGIDMPIAAMVD
FT                   ALVEGRVTLPQAIQSLLSRPLKQE"
FT   gene            178847..179119
FT                   /locus_tag="Rsph17029_0163"
FT   CDS_pept        178847..179119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0163"
FT                   /product="YCII-related"
FT                   /note="PFAM: YCII-related; KEGG: rsp:RSP_1511 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75282"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG16"
FT                   /protein_id="ABN75282.1"
FT                   /translation="MRVALICTDKAGALQTRLDNRSAHLAYIAETGVVEMAGPFLSPEG
FT                   QMTGSLVVLEVGSLAEAEAWAAGDPYAQAGLFESVAISEWKKVVG"
FT   gene            179119..179544
FT                   /locus_tag="Rsph17029_0164"
FT   CDS_pept        179119..179544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0164"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   rsp:RSP_1512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75283"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG17"
FT                   /protein_id="ABN75283.1"
FT                   /translation="MACWLFKSEPDAWSWDQQVAKGAEGEEWTGVRNYQARNHMRAMQL
FT                   GDRGFFYHSNIGKEVVGIVEVCGLSAPDSTADDPRWDCVTVRAVEPLPKPVTLEAIKAE
FT                   PRLAQMVLVTNSRLSVQPVSEAEWRTICEMGGLRGDR"
FT   gene            179840..181045
FT                   /locus_tag="Rsph17029_0165"
FT   CDS_pept        179840..181045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0165"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: rsp:RSP_1513 tryptophan synthase subunit beta;
FT                   TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75284"
FT                   /db_xref="GOA:A3PG18"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG18"
FT                   /protein_id="ABN75284.1"
FT                   /translation="MSAYLKSHPTHDGFFGPYGGAMLPPPLEPHFAAIREAYGRISKSA
FT                   DFIAELRYIRKHFQGRPTPVSHLKNLSALCGGAQIYAKREDLNHTGAHKLNHCMAEGLL
FT                   ARFMGKTKLMAETGAGQHGVALATAAAYFGMECEIHMGEIDIAKEAPNVTRMKLLGATV
FT                   VPVGFGGRSLKEAVDSCFQSYLAQADTALFAIGSVVGPHPFPMMVRDFQHVVGVEAREQ
FT                   FLEMTGELPDMVAACVGGGSNAMGIFSGFLDDEVALYGIEPCGTSSKLGDHAATIAYGE
FT                   DGDIHGFRTMVLKDAEGNPAPVHTVASGLDYPGVGPEHAFLHRSGRVTYTGADDREALA
FT                   AFFALSRHEGIIPALESAHAVAFAMREAKAHPGKSILVNLSGRGDKDIDYVTQTFGFGE
FT                   TA"
FT   gene            complement(181203..182594)
FT                   /locus_tag="Rsph17029_0166"
FT   CDS_pept        complement(181203..182594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0166"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: rsp:RSP_1514 S-adenosyl-L-homocysteine
FT                   hydrolase; TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75285"
FT                   /db_xref="GOA:A3PG19"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG19"
FT                   /protein_id="ABN75285.1"
FT                   /translation="MADFIVKDLSLADFGRKELDIAETEMPGLMALREEFGASKPLKGA
FT                   RIAGSLHMTVQTAVLIETLVALGADVRWASCNIFSTQDHAAAAIAASGVPVFAIKGETL
FT                   EDYWAYTDKIFQFADGTCNMILDDGGDATLYILLGARVEAGETDLIAVPQSDEEVCLFN
FT                   QIRKRMAETPGWFTKQRDAIKGVSEETTTGVHRLYDLHKKGLLPFPAINVNDSVTKSKF
FT                   DNKYGCKESLVDGIRRATDVMMAGKVAVVCGYGDVGKGSAASLRGAGARVKVTEVDPIC
FT                   ALQAAMDGFEVVVLEDVVQDADIFITTTGNRDVIRIEHMREMKDMAIVGNIGHFDNEIQ
FT                   VAALKNHKWTNIKDQVDMIEMPSGSRIILLSEGRLLNLGNATGHPSFVMSASFTNQVLA
FT                   QIELWTKGADYQPGVYILPKALDEKVARLHLKKIGVKLTELRPEQADYIGVKVEGPFKA
FT                   EHYRY"
FT   gene            182717..183673
FT                   /locus_tag="Rsph17029_0167"
FT   CDS_pept        182717..183673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0167"
FT                   /product="glycosyl transferase, family 8"
FT                   /note="PFAM: glycosyl transferase, family 8; KEGG:
FT                   rsp:RSP_1515 hypothetical protein of glycosyl transferase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75286"
FT                   /db_xref="GOA:A3PG20"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG20"
FT                   /protein_id="ABN75286.1"
FT                   /translation="MTVEASRPARSRQAVIFCCNAGYLPFALHAAERIDRLTPGRAFDI
FT                   CICHGEEPILVPDSLSRLDVRLIRIDTTGVFTGLRLDPGRTHDVYLRLALPQALAADYD
FT                   RILYLDADIFVQGGDFTALLGLDLGNHPLGAVRDNIQWRTPERRAEQFRRLGIPAAPYF
FT                   NAGLLLMDVARYNEMNLLDRCVELGRREASRMIRHDQNLYNAVLRGDWAELSPMWNWQY
FT                   SWSARLFEAMRYPHIVHFIGTLKPWADRKGHYSPRFAQSYDRFIADHFPDRPRNPVSGG
FT                   LSPDSRMMRRMLVKHFLSSSKLARYLDRFPSDLTVIR"
FT   gene            183670..184254
FT                   /locus_tag="Rsph17029_0168"
FT   CDS_pept        183670..184254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0168"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; KEGG: rsp:RSP_1516 putative S-adenosyl
FT                   L-homocystein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75287"
FT                   /db_xref="GOA:A3PG21"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG21"
FT                   /protein_id="ABN75287.1"
FT                   /translation="MKRAWQRMLSGRRLDLLDPTPVDIEIEDIAHGLAFVARWNGQTRG
FT                   DFAFSVAEHSLLVEEILGRCQPRVQTRWRLAALLHDAPEYVIGDMISPVKDAIGAQYGD
FT                   LDARLTAAIHLRFGLPAQLPLQVKRDIKKADRISAWLEAVQIAGFTETEATRFFGRPAE
FT                   AVLDGLEIRLRPPVEVRAAYAARHQELLSAL"
FT   gene            complement(184266..184580)
FT                   /locus_tag="Rsph17029_0169"
FT   CDS_pept        complement(184266..184580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0169"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: rsp:RSP_1517 histone-like protein of
FT                   HNS family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75288"
FT                   /db_xref="GOA:A3PG22"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG22"
FT                   /protein_id="ABN75288.1"
FT                   /translation="MDIDLDSMSLKELKSLQAQVAKAISTYEDRRKRDALAELEEKARE
FT                   LGFSLSELTGTAATKRRAAAQPKYANPENPSDTWSGRGRKPRWFEAAIKSGKPAESMAI
FT                   "
FT   gene            complement(184816..185370)
FT                   /locus_tag="Rsph17029_0170"
FT   CDS_pept        complement(184816..185370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0170"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rsp:RSP_1518 PrrA (RegA), response regulator involved in
FT                   oxygen regulation of photosynthesis genes"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75289"
FT                   /db_xref="GOA:A3PG23"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG23"
FT                   /protein_id="ABN75289.1"
FT                   /translation="MAEDLVFELGADRSLLLVDDDEPFLKRLAKAMEKRGFVLETAQSV
FT                   AEGKAIAQARPPAYAVVDLRLEDGNGLDVVEVLRERRPDCRIVVLTGYGAIATAVAAVK
FT                   IGATDYLSKPADANEVTHALLAKGESLPPPPENPMSADRVRWEHIQRIYEMCDRNVSET
FT                   ARRLNMHRRTLQRILAKRSPR"
FT   gene            complement(185363..186058)
FT                   /locus_tag="Rsph17029_0171"
FT   CDS_pept        complement(185363..186058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0171"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   rsp:RSP_1519 PrrC"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75290"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG24"
FT                   /protein_id="ABN75290.1"
FT                   /translation="MTKLYAGVAAAAIAALLAGSAAWVFLGRSEERFAGCGANQVAGGA
FT                   IGGPFTLVDQEGRTVTDREVLAKPSLVYFGYTFCPDVCPFDMARNAQAVDILTEWGIEV
FT                   TPVFISIDPKRDTPEQLKFFAEAIHPDTIALTGTEAQVKAASQAYKTFYRVQESDDDYY
FT                   LIDHSTFTYFMLPGTGFVDFFKREDTPEQIAERISCFANDSHVSTSFDARAQKSYQASR
FT                   GKQMGDNHG"
FT   sig_peptide     complement(185984..186058)
FT                   /locus_tag="Rsph17029_0171"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.363 at
FT                   residue 25"
FT   gene            186150..187538
FT                   /locus_tag="Rsph17029_0172"
FT   CDS_pept        186150..187538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0172"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: rsp:RSP_1520 sensor histidine kinase PrrB
FT                   (RegB)"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75291"
FT                   /db_xref="GOA:A3PG25"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG25"
FT                   /protein_id="ABN75291.1"
FT                   /translation="MILGPDGILNRDTRGDWVRLRTLILLRWMAVAGQLAAIVVTDWYL
FT                   GVRLPMGLCFMAVGASVIANVIATFVFPQNRRLTEFQALMILLFDLTQLSFLLFLTGGL
FT                   TNPFALLILAPVTISALALELRTTVILGAIAIGLLTFTAYFHLPLILADGSSLSVPRMF
FT                   EFGFWLAIVIGILFLGLYSRRVAIEIRSMSDALLATQMALDREQKLTDLGGVVAAAAHE
FT                   LGTPLATIKLVSSELAEELSEQPALRDDAELIREQADRCRDILRSMGRAGKDDLQMRQA
FT                   PLGEVLREAAEPHVGRGKRVEFDLYPSRGGDERQPVILRRPEVIHGLRNLIQNAVDFAR
FT                   STVWIDGEWTGDRIAIRIVDDGEGYPPAIIGRIGDPFVRQRRAEESQSRRPGYEGMGLG
FT                   LFIAKTLLERSGAELSFANAADPFLRSHERPERCGAIVEVIWPVDRLVVVRNAPLGENV
FT                   LIQT"
FT   gene            187665..189227
FT                   /locus_tag="Rsph17029_0173"
FT   CDS_pept        187665..189227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75292"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG26"
FT                   /protein_id="ABN75292.1"
FT                   /translation="MTFDWPLALGLILTAVAAASAAVVLAGLLQTRAGRRPEGVFSDSQ
FT                   AGTVFLFDGETLLDATPGARAILALSPARGGPWLRLLAYLVPRFPDLEARLSRLARDGR
FT                   FTLASAAEGEPLLLMAEMRGGITRLTIDDPSSAERPRLDHLSQRALAEELDQLRATVAQ
FT                   APLMMWRESAGGEVIWANAAYLREAAKRLPPDRDLSWPLPRLFDRAASAQGAPRQRQRI
FT                   EVKGVDRWFDLESFADPAGRLLFALPADAAVQAEATLRDFMQTLAKTFAHLPIGLAIFD
FT                   QHRKLALFNPALLDLTGLPPDMLALQPSLFSFLEALRDRQMIPEPKDYPSWRRQILELE
FT                   KAAASGLYAETWSLPSGQTYRVIGRPHPNGALALMFEDISTEMTRTRRYRADLELGQAV
FT                   VDAMEDAIAVFSPAGDLVMTNAAYGALWGHDPVETVGGGAAVQLCEQWRARSSPSPIWV
FT                   EAERFLAALGPRDPWSGEIRLEDGRLVSCRFAPLTGGATLVLFRILEVRAAEAADPATL
FT                   RTA"
FT   sig_peptide     187665..187745
FT                   /locus_tag="Rsph17029_0173"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.460 at
FT                   residue 27"
FT   gene            189460..189969
FT                   /locus_tag="Rsph17029_0174"
FT   CDS_pept        189460..189969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0174"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   rsp:RSP_1522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75293"
FT                   /db_xref="GOA:A3PG27"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG27"
FT                   /protein_id="ABN75293.1"
FT                   /translation="MRRGAALGMVAAMPDPAPLLLALASEEDTARLGAALACLLRPGDV
FT                   LLLEGPIGAGKTHLARALIRAALGHEEEVPSPTFTLVQTYEAPGHEIWHADLYRLTHPD
FT                   EVLELGLEAAFATAVCLVEWPDRLGDLAPPGALRLRLEAEGEGRRATLSGGRPGLLAEL
FT                   AEAWHG"
FT   sig_peptide     189460..189534
FT                   /locus_tag="Rsph17029_0174"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.765) with cleavage site probability 0.662 at
FT                   residue 25"
FT   gene            189962..190987
FT                   /locus_tag="Rsph17029_0175"
FT   CDS_pept        189962..190987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0175"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   rsp:RSP_1523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75294"
FT                   /db_xref="GOA:A3PG28"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG28"
FT                   /protein_id="ABN75294.1"
FT                   /translation="MADPAPSDRAARAAAFLAQAGWGAAERRHLAGDASDRSYERLRRG
FT                   AETAVLMDAPPGKGDDPAAFVAIAAHLGGLGLSPPAVLAQDLANGFLLLEDLGDGLFAR
FT                   LLERAGADEADLYAAATDVLVHLQRAPAPAGLPDLSAADWARAAAMAPEWYARAATGAA
FT                   PDAARVTALLEEALLRHADGPRVLILRDYHAENLLWLPDRAGLARVGLLDFQLAQMGQP
FT                   GYDLVSLLQDARRDVPEPVERAMIARFAAATGAEPQAFGAAYAVLGAQRALRILGIFAR
FT                   LCLVAGKPGYVALIPRVWGQLWRNLGHPALAPLAAECRALLPEPAPAVLERIRAQCGRM
FT                   R"
FT   gene            190969..191634
FT                   /locus_tag="Rsph17029_0176"
FT   CDS_pept        190969..191634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0176"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: rsp:RSP_1524
FT                   nucleotidyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75295"
FT                   /db_xref="GOA:A3PG29"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG29"
FT                   /protein_id="ABN75295.1"
FT                   /translation="MRPDAVMIFAAGFGTRMGALTATRPKPMIEVAGRPLIDHALALAE
FT                   AAGISRIVANTHYLPESLTAHLAGRALVSHEEEILETGGGLRRALPLLGEGPVYTLNSD
FT                   AVWTGENPLDELAAGWREGMEALLLLAPSGSAPGDFTMDAAGRLARARGAPGYTYLGAQ
FT                   ILRTDRFAGVAEAKFSLNLIWDAMIAAGTAHGLVHRGGWCDVGRPEGIAAAEAMLADV"
FT   sig_peptide     190969..191034
FT                   /locus_tag="Rsph17029_0176"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.657) with cleavage site probability 0.584 at
FT                   residue 22"
FT   gene            191627..194620
FT                   /locus_tag="Rsph17029_0177"
FT   CDS_pept        191627..194620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0177"
FT                   /product="putative helicase/exonuclease"
FT                   /note="KEGG: rsp:RSP_1525 putative helicase/exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75296"
FT                   /db_xref="GOA:A3PG30"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG30"
FT                   /protein_id="ABN75296.1"
FT                   /translation="MFDTPGPRLFGLPPGVDFPAALVRGLRARMAGAAPEAMARVELYV
FT                   NTQRMRRRITELMTAEGTGFLPRIRLVTELPPVPGLPAPVPPLRRRLELAQLVARLIEA
FT                   QPDIAPRSALFDLSDSLAELIDEMQGEGVPPEAIARLDVADHSAHWQRTQAFMAIVAPM
FT                   FGADAPDAQALARMAVERIAARWAEAPPDHPVIVAGSTGSRGTTSLFMQAVARLPQGAL
FT                   VLPGFDFDLPAAVWEGMDDALTAEDHPQFRFHRLMGLVGAGPAEVGRWTDEIPPSPDRN
FT                   RLISLSLRPAPVTDQWLTEGRHLTGLAEAARGMTLIEAPGPRAEALAVAMILRKAAEEG
FT                   RRAALITSDRGLTRQVAAALDRWGIVPDDSAGKPLALSAPGRFLRHVARLFGRRLTGET
FT                   LLTLLKHPLTATGADRGNHLRWTRDLELHLRRKGPPFPAAADLALWAGTRPADGVADWA
FT                   RWLGGLIEGLDAAGPRPLADHVAAHLALAEALATGPAGDTTGELWLKEAGEAARAAVEE
FT                   LRREAPHGGELTPADYTDLFDAILARGEVREAVQARPDLMIWGTLEARVQGADLVILGG
FT                   LNDGTWPQLPPPDPWLNRQMRLKAGLLLPERRIGLSAHDYSQAVAAPEVVLTRATRDAE
FT                   AETVPSRWLNRLMNLMSGLKAGGGPEALAGMRARGRDWLDLAAALEQPATPVPLATRPA
FT                   PQPPVPARPERLAVTGIRTLIRDPYAVYARHILRLYPLDPLHRAPDARLRGSILHRILE
FT                   AFVKDRAPGGDRPAERARLMRIAEAVLAEEVPWPAARALWLARLDRAADFFLETEAAHA
FT                   GTPVVLEEEGRVDLTPLRFTLTAKPDRIDVLPDGRLHILDYKTGTPPTKKQQEQFDKQL
FT                   LLEAAMAERGGFRGLGPAEVARISYIGLGTSPKVESVETDAALLGQVWEGLHALIGRYM
FT                   RREQGYVSRRAMFGERFPGDYDHLARFGEWEMSDAPVPAPVGAEAPGAGSAEAGTDRDR
FT                   GSCPEDAA"
FT   gene            194649..197969
FT                   /locus_tag="Rsph17029_0178"
FT   CDS_pept        194649..197969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0178"
FT                   /product="UvrD-like DNA helicase, C terminal"
FT                   /note="TIGRFAM: UvrD-like DNA helicase, C terminal; PFAM:
FT                   UvrD/REP helicase; KEGG: rsp:RSP_1527 helicase, UvrD/Rep
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75297"
FT                   /db_xref="GOA:A3PG31"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG31"
FT                   /protein_id="ABN75297.1"
FT                   /translation="MSGQRDEASERQVQAADPRASTWLSANAGSGKTRVLTDRVARLLL
FT                   DGVEPQRILCLTYTKAAASEMQNRLFRRLGEWAMLDDAELRHALDTLGVAAVGHEVLAQ
FT                   ARRLFARAIETPGGLRIQTIHSFCATLLRRFPLEAGVSPQFTELDDRAARLLREEIVEE
FT                   LADRIAPGVVADLARAYTGEDFGALAEEVARNAAGLLPPLDAPACRALYGVEGDEAALL
FT                   AQVFLGGEAEWMPALIAALEAGSANDQKAAAKLRLLSFASPTTATLAGLEGVLLTGASA
FT                   KEPYTAKLGSFPTKATRGALGPLADRLDALMRRVEAARPVRCCLLAAERARLIHAFAGV
FT                   FLPLYQARKAARGWLDFDDLIQRAKGLLTDPSVAQWVLFRLDGGIDHILVDEAQDTSPD
FT                   QWKVIELLAQEFTSGRGAREVERTIFVVGDKKQSIYSFQGADVAAFDRMRAEFGERLAG
FT                   ARRRLEELDLLHSFRSSPAILRLVDLTFDEPRRQALGGEVRHIAFRGDMPGRAELWPLV
FT                   EAAEEPEPENWFDPVDLVSDEHHAARLARQVATRIRAMIEAGVQIPQPGGFRPVAAGDF
FT                   LILVQRRSDIFGEIIRACKEARLPIAGADRLKLGAELAVRDLSALLAFLATPEDDLSLA
FT                   AVLRSPLFGWSEGELFDLAHGREGYLWRRLYDREAAHPATVAILRDLRDQADFLRPFDL
FT                   IERALTRHDRRRRLLARLGEEAEDGIDELLSQALAYERTDVPSLTGFLTWLQTDEVEVK
FT                   RQMEAAGGRIRVMTVHGSKGLEAPIVILPDTADRKPRERDELFTLEGGARVWKTPAAES
FT                   PPQIAAAREARRARDAAENLRLLYVAMTRAQCWLIAAAAGKLETGGAWHDLIRQGMEAA
FT                   GAERRDDGALVLDEGLWPPAAPQASAAAAAARPVLPAWALAPAAEPPAAPEVLSPSALG
FT                   GAKALPGDAMPTEEALAHGSAVHRLLEHLPLHPPEGWEAAARGLLPDLPDVAPVLAEAR
FT                   AVLSAEHLAEALVPHALLEVAVTAKVAGRRLSGTIDRLVVEPDRVLAVDYKTNRVVPDR
FT                   PEEVPEGILRQMGAYAEALAQIYPGRTIETAILWTQAARLMRLPRDIVRSAMVRATTT"
FT   gene            198028..198348
FT                   /locus_tag="Rsph17029_0179"
FT   CDS_pept        198028..198348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0179"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: rsp:RSP_1529 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75298"
FT                   /db_xref="GOA:A3PG32"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG32"
FT                   /protein_id="ABN75298.1"
FT                   /translation="MSTVPVTDATFDTEVRKSDVPVVVDFWAEWCGPCRQIGPALEELS
FT                   KEYAGKVKIVKVNVDENPESPAMLGVRGIPALFLFKNGQVVSNKVGAAPKAALATWIAS
FT                   AL"
FT   gene            complement(198481..199389)
FT                   /locus_tag="Rsph17029_0180"
FT   CDS_pept        complement(198481..199389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0180"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75299"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG33"
FT                   /protein_id="ABN75299.1"
FT                   /translation="MPHSRILNIYLPSPMREDAAAGKVNIVNRIEAAVAPHGLRIAVHG
FT                   DTPEERADPYRRQGWSLFHMQEPVGPRCLCLRQAYQNPFWQIEATNQRWWFDVAQAAFD
FT                   PDTVDPAAARPFFQRWRRHLVGERTCSRDGFLFMPLQGRISEHRSFQSMSPLAMIQATL
FT                   EHDLRPIRATLHPRETYSAADLHALEDLVRRHPRLSVVRSDPLALLAACDLVVTQNSSV
FT                   ALTGYFLRKPAVLFAGVDFHHIAGSVPREGVERAFQKAEGTLPDHERYLYWFFQLQTIN
FT                   GAAPEAEAQIMARFARHGWHF"
FT   gene            199526..200083
FT                   /locus_tag="Rsph17029_0181"
FT   CDS_pept        199526..200083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0181"
FT                   /product="HslV component of HslUV peptidase. Threonine
FT                   peptidase. MEROPS family T01B"
FT                   /note="PFAM: 20S proteasome, A and B subunits; KEGG:
FT                   rsp:RSP_1531 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75300"
FT                   /db_xref="GOA:A3PG34"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PG34"
FT                   /protein_id="ABN75300.1"
FT                   /translation="MAEDRFPGWHGTTILAVRRGGEVVVAGDGQVSLGQTVIKGTARKV
FT                   RRLSPGGHEVVAGFAGSTADAFTLLERLEKKLEAAPGQLARACVQLAKDWRMDKYLRNL
FT                   EAMLIVTDGETLLVLTGAGDVLEPEHDVTAIGSGGNFALAAARGLMATDLPAEEIARKA
FT                   MAIAADICVYTNGNLTVERISK"
FT   gene            200080..201381
FT                   /locus_tag="Rsph17029_0182"
FT   CDS_pept        200080..201381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0182"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: rsp:RSP_1532 ATP-dependent protease
FT                   ATP-binding subunit; TIGRFAM: heat shock protein HslVU,
FT                   ATPase subunit HslU; PFAM: ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75301"
FT                   /db_xref="GOA:A3PG35"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PG35"
FT                   /protein_id="ABN75301.1"
FT                   /translation="MTDLTPREIVSELDRFIIGQKEAKRAVAVALRNRWRRKQLADDLR
FT                   DEVYPKNILMIGPTGVGKTEISRRLARLAKAPFLKVEATKFTEVGYVGRDVDSIIRDLV
FT                   DAAIVETRARMREDVKARAAKAAEDRVIEAVAGRDAREQTREMFRGKLKRGELDNTVIE
FT                   IDVADTSNPMQMLDPTGQGQMGMMNLGEIFGKAFGGRTQRRKMTVAESHDILMNEEADK
FT                   LLDDEVVKATALEAVQQNGIVFIDEIDKVCARSDMRGADVSREGVQRDLLPLIEGTTVS
FT                   TKYGPVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELRALTEEDFVRILSETDNA
FT                   LTLQYKALMQTEKVGITFTEDGIAALASIAAEVNRSVENIGARRLYTVMERVFEELSFQ
FT                   APDRSGEEVTVDAAYVEKNLGELARSSDLSRYVL"
FT   gene            complement(201432..202964)
FT                   /locus_tag="Rsph17029_0183"
FT   CDS_pept        complement(201432..202964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0183"
FT                   /product="membrane bound O-acyl transferase, MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase, MBOAT
FT                   family protein; KEGG: rsp:RSP_1533 putative alginate
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75302"
FT                   /db_xref="GOA:A3PG36"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG36"
FT                   /protein_id="ABN75302.1"
FT                   /translation="MLFHSPEFLFAFLPLTLLGYYLLGRLPNKLWAVGWLAAASLFFYG
FT                   WWNVAFLPMLLISLGLNYLLGIMLVEKPRRWLLLAGVAANLAAIGFFKYAGFLVEILNA
FT                   LTAADVPVPHILLPLAISFYTFQQIAYLVDCHEGRIGRPNPIRYAMFITFFPQLIAGPI
FT                   VHYREIVPQIERDETFRVDQAKLVLGFTVFCFGLFKKIGMADTLAPLAQPLWDLAAGGE
FT                   AAYLAFAWRGAVAFALQLYFDFSGYSDMAIGLGLMFGILLPFNFDSPYKSQTIIEFWSR
FT                   WHITLTRFLTAYLYNPITKTVMRRRMERGQPVWNPRKPQVLPFLVMLAFPTLVTMGLAG
FT                   VWHGAGWQFIVFGVLHGAMLVANHGWRATSAGRARIPAPLSWLLSPVKVLVTFLAVTVS
FT                   FVFFKSPTLTDALTVVRGLAGMGEHGGYLYLGDTVVVLFGLFIIWALPNTQEWVGLKPH
FT                   TAPKAPARERARFAAFYWKPSPMHGLMVGAVLCITLLRIFGSPPAEFLYFAF"
FT   gene            complement(202964..203209)
FT                   /locus_tag="Rsph17029_0184"
FT   CDS_pept        complement(202964..203209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0184"
FT                   /product="putative acyl carrier protein"
FT                   /note="KEGG: rsp:RSP_1534 putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75303"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG37"
FT                   /protein_id="ABN75303.1"
FT                   /translation="MTDPEIYDGLTSILRQVFDDPELVATPDLSAHDVAEWDSFNHINI
FT                   VVASEMRFGVSFKSSELEDLKNVGDFVALIRDKKAA"
FT   gene            complement(203270..205183)
FT                   /locus_tag="Rsph17029_0185"
FT   CDS_pept        complement(203270..205183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0185"
FT                   /product="FkbH like protein"
FT                   /note="TIGRFAM: HAD-superfamily phosphatase, subfamily
FT                   IIIC; FkbH like protein; KEGG: rsp:RSP_1535 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75304"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010037"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR035679"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG38"
FT                   /protein_id="ABN75304.1"
FT                   /translation="MKSKPLELHWLPVAADFEGDLVRARARAADDPPETWRALRHLAGH
FT                   RIDFLQTTRIERALRTAEAPPEVPRLRLALLGSFTVEHLVPGLTVGALRRGLALEVHVP
FT                   PYGQWRQAILDPASELAAFSPDAVLICSCETDLVPQLPLATPADEVEAALEASLSETVH
FT                   RWRALRAMGAAVIQQLPVPTTDPVFGHLDRLIPASRRAMVAEMQHRLIRAAREERVLIL
FT                   DPVAAAETEGLDALQDRLMWLHAKQHVSPAAGPWFGDQVARILAAMRGLTRKVLVLDLD
FT                   NTLWGGVIGDDGIEGIVIGEGSARGEAFKAFQLYCRALRERGILLAVSSKNDPERALAA
FT                   FDHPEMVLRRSDFAAFVANWEDKGRGLQRIAQELNLGLEALVFFDDNPAERALLREQFP
FT                   AVAVPEVPEEPEAYIRCLAAAGLFEAVGYTPDDALRAEQYAANAARRQLEVVAPDMESF
FT                   LAGLDMEMQVGPVQPVDLVRVTQLINKTNQFNLTTRRYTEAEVGAMIGDPGMLTFCVRL
FT                   KDRFGDNGIVSVVLGRLRPDGEGGQLFEVDTWLMSCRVLGRRVEEAVAAVIARAARQAG
FT                   ASTVVGCYRPTPKNGMVADLFPRLGFAPAGADGLAALWRLDLAVPPPSPPHIRLTERGV
FT                   TH"
FT   gene            complement(205164..205904)
FT                   /locus_tag="Rsph17029_0186"
FT   CDS_pept        complement(205164..205904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0186"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rsp:RSP_6005 putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75305"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG39"
FT                   /protein_id="ABN75305.1"
FT                   /translation="MTGGLLVTGGSGAIGGALCRIAARRRPVWVGYGTGAARARALVAE
FT                   IAEAGGRAEPVALPLQDPAALEAALAALPEPPASLALCAWPAPFVAPFGRQGEDLALQA
FT                   AALAGCHALIATAWRLWWRRAGGGHVLAVLSAASEPPVARHMAAYVAQKAALRALLAAA
FT                   AAELGPAGLRVSVVAPGFVETPMLGAFDPRLLERARADAGGRFLPPERVAQALVAALDA
FT                   PPPAGTVQDIHLAEEVESDEKQTA"
FT   gene            complement(205901..206305)
FT                   /locus_tag="Rsph17029_0187"
FT   CDS_pept        complement(205901..206305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0187"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   rsp:RSP_1536 conserved hypothetical protein that may be
FT                   involved in lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75306"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG40"
FT                   /protein_id="ABN75306.1"
FT                   /translation="MTIAFDFTVTTDRMEAFRSISGDDNPIHFDTFFARERGFDGPIVY
FT                   GGLLIAEVSRLLGTALPGHGCVWQSLTMKFRRPLLVGERARLEAEVKHETPPLGIRLIR
FT                   LTISAGGRRIAEGEAMTLLPEPQSAREAAE"
FT   gene            206583..207497
FT                   /locus_tag="Rsph17029_0188"
FT   CDS_pept        206583..207497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75307"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG41"
FT                   /protein_id="ABN75307.1"
FT                   /translation="MRSYILSAAAGMVLMAGALAAAFTAAAAIWPDRMPPPAISGSIAT
FT                   DEKLKYLRDRGREPVDVLAIGSSITWKHLDGAPFDGRVGNFVNGGTAYLQVHEIRTFTR
FT                   FYLDLYPRISQVVMLSALPDYGTCAGEGRIMDLEDAASYVRGGVPEAWFYMRYFAPLRY
FT                   VLQARRRSERLKPYDAFGYWLDRHGTTPSMLPTEVGYDLRYDEIALDPACLEALDGLNR
FT                   DLKARGVTFTLVMTPVAPRYSDLHPATTRATERIESFARSRGIRLIDFFGDPSFEDADF
FT                   WDAFHMQWPAARRLSREVADTLL"
FT   sig_peptide     206583..206666
FT                   /locus_tag="Rsph17029_0188"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.812 at
FT                   residue 28"
FT   gene            207576..208349
FT                   /locus_tag="Rsph17029_0189"
FT   CDS_pept        207576..208349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0189"
FT                   /product="glucose-1-phosphate cytidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate cytidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: rsp:RSP_1538 probable
FT                   glucose-1-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75308"
FT                   /db_xref="GOA:A3PG42"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR013446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG42"
FT                   /protein_id="ABN75308.1"
FT                   /translation="MKAVLLAGGYGTRLSEETGIVPKPLVEIGGRPILWHIMKIYAAHG
FT                   ITDFVICCGYKGHMIKDYFLSYFHRNSDITIDVRSNQIELHRPVSEPWRVTMVDTGLET
FT                   MTGGRIKRIREHIGDETFCLTYGDGVSDIDIGSLVAFHKEQGVAGTVTAVRLPGRFGAL
FT                   DLSEGTRVNRLREKSMMDGQTINGGFFVLEPSVFDYIDGDATVWEEEPLQGLVRDGQLA
FT                   VYRHEGFWQNMDTLRDKTLLQGLWEKGKAPWKIWD"
FT   gene            complement(208585..209592)
FT                   /locus_tag="Rsph17029_0190"
FT   CDS_pept        complement(208585..209592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0190"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   rsp:RSP_1539 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75309"
FT                   /db_xref="GOA:A3PG43"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG43"
FT                   /protein_id="ABN75309.1"
FT                   /translation="MRTAVIIPFYQREAGILSRALDSVDGQILPEGHSLTVFVIDDESP
FT                   VPARSEVEGRQGKVPVRLIAQKNGGPGAARNAGLDAVAAEGFDHVAFLDSDDIWQPTHL
FT                   ADALDLLARGYDFHFCDHQRTDDDITYFERTPALRRMREERHAGVTVLDAEAPILAFDQ
FT                   PSIMAASVDTYLSQTSTVVVRQSFVETLRFDPRLRNAGEDQLFWLSLIAAGARTVVSWK
FT                   MNVLCGRGVNVYFDAFDWKSTKVVDRTGYMLMFFHTVGRRLSLTASDRRTVADRIRRYR
FT                   RAYSYLFLRALLQGRVPTLSLTWKLAALDPGLVPAMPLRFLAVLPNREAESQQW"
FT   gene            complement(209934..211028)
FT                   /locus_tag="Rsph17029_0191"
FT   CDS_pept        complement(209934..211028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0191"
FT                   /product="secreted hydrolase"
FT                   /note="KEGG: rsp:RSP_1540 predicted secreted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75310"
FT                   /db_xref="GOA:A3PG44"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG44"
FT                   /protein_id="ABN75310.1"
FT                   /translation="MNAERLSPFRFALRIAAAILLVTLGHTAPAGAQGFAGLGATAEGF
FT                   ATPQRGRPLVFPRDHGPHPEYRIEWWYLTSVLTGEDGRDYGIQWTLFRSVLAPHEGAGW
FT                   ESPQLWLGHAALTTPDRHFVAERYGRGGIGQAGVTAEPFEAWIDDWHMTGTASPGADAL
FT                   SALSLAASGSGFSYDLRLKAEGPLVAQGEQGYSVKSAAGQASWYYSQPFYRVEGRIEVE
FT                   GKSIAVTGKAWLDREWSSQPLAEDQTGWDWFSLMFDDGARLMGFRLRDGGEGYTSASWI
FT                   SPGGRPEPMPPGALQVTPGREAEVAGRKIPVEWRVELPAKGLDVTVEAMNDRAWMDTSV
FT                   PYWEGPIAIRGSHAGRGYLEMTGY"
FT   sig_peptide     complement(210930..211028)
FT                   /locus_tag="Rsph17029_0191"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.981 at
FT                   residue 33"
FT   gene            complement(211018..213405)
FT                   /locus_tag="Rsph17029_0192"
FT   CDS_pept        complement(211018..213405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0192"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rsp:RSP_1541 putative ABC transporter, fused inner membrane
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75311"
FT                   /db_xref="GOA:A3PG45"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG45"
FT                   /protein_id="ABN75311.1"
FT                   /translation="MSTALAALLSHWRRSPLQLAMLLLGLALATALWSGVQAINAEARA
FT                   SYAQAAATLGQDRLSRIAAEGPVLQETYVALRRAGWRVSPVVEGRLRIDERRSLRLIGI
FT                   DPLTLPAPAQQVEFGEGDALLPFLTAPGLIFADPETLARMQGAELPPLRAAEGLPPGTG
FT                   LMDIGQAQRLLGMEGRISHLLLDPAAPQPGPLPDGLRLIPPDSESDVARLTDSFHLNLT
FT                   AFGLLSFAVGLFIVHSAIGLAFEQRRPMFRTLRALGVTARTLIGLLFAELLLFALLAGA
FT                   AGLLLGYLVAALLLPDVAATLRGLYGAEVPGTLAFRSGWAAAGLGIALLGTLVSSAQSL
FT                   WRVAHLPLLAPAQPRAWAVASERALWRQAMAAVGLLILAGALLLWGRGIVAAFMLLAAL
FT                   LLGAALLLPVLLAALLRGAQGLARGPIAQWFWADTRQQLPGLSLALMALLLALAANIGV
FT                   GTMVSSFRLTFTGWLDQRLAFELYLSAPDRDTADRVVRWLEPRAEAVLPIVRAETEVLG
FT                   QPAQLYGMADHPTYRENWPLLAEVPGVWDLLAGGDWALVNEQLARREGLEPGDPIRLPG
FT                   WEGRIAAVYSDYGNPSAQVILGLDRFFALHPEAERRRYGIRAAPDRAAALAEEMRAAFD
FT                   LGDEGLIDQASLKGFSLQVFERTFAVTAALNVLTLGVAGLAMFASLMVLSGMRLPQLAP
FT                   VWAMGLTKARLARLEMLRTLLLAAGTMAAALPLGLALAWVLLAVVNVQAFGWRLPMHVF
FT                   PLDWLTLGALALVAAALAAAVPVRRLARLRPADLLRVFANER"
FT   sig_peptide     complement(213289..213405)
FT                   /locus_tag="Rsph17029_0192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.439 at
FT                   residue 39"
FT   gene            complement(213402..214082)
FT                   /locus_tag="Rsph17029_0193"
FT   CDS_pept        complement(213402..214082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0193"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsp:RSP_1542 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75312"
FT                   /db_xref="GOA:A3PG46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG46"
FT                   /protein_id="ABN75312.1"
FT                   /translation="MRVKDPSDKLLSLEGVTKSYATGEGPVQVLAGVDLTLAAGESLAL
FT                   TGESGSGKSTLLHLAAGLDAADAGRIVVAGHDISQAGDADRARLRRGTVGLVFQQFNLI
FT                   PSLDVAANLAFQARLAGRHDPQWQAELAETLGLAACLHRYPEQLSGGQQQRVAIGRTLA
FT                   ARPRLVLADEPTGNLDEATGDAVIALFLRLVSQTGAGLLMVTHSARLAGRLQGRVQLSA
FT                   GRVA"
FT   gene            complement(214368..215426)
FT                   /locus_tag="Rsph17029_0194"
FT   CDS_pept        complement(214368..215426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0194"
FT                   /product="Uncharacterized conserved protein UCP028101"
FT                   /note="PFAM: Uncharacterised conserved protein UCP028101;
FT                   KEGG: rsp:RSP_1543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75313"
FT                   /db_xref="InterPro:IPR008311"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG47"
FT                   /protein_id="ABN75313.1"
FT                   /translation="MATRRHILAGLVASALPRLGWADAGSPAFLAAARMPSGDFALHGL
FT                   TEAGAMIFAIPLPARGHAAAAHPTRAEAVAFARRPGTYALVIGCASGTLHARLTPPDGR
FT                   QFNGHGAYSADGSLLYTSEVVAETSEGVVGVWDTSGWHRVDEFPSGGIGPHELRRMPGS
FT                   DRLVVANGGIQTDPQDRSKLNIGTMRPNLSYLSPDGALLEQAELPEELRQNSIRHLALA
FT                   EDGTVAFAMQWEGDPAEPVPLLGLHRRGEALRLCPPREEDLFAMRGYAGSIARSEGMIA
FT                   LTSPRGGVVQLHAEDGAPLATLARPDACGVAPLPGGFLVTDGGGAITRLTPEGFRPLER
FT                   TASAWDNHLVRI"
FT   sig_peptide     complement(215358..215426)
FT                   /locus_tag="Rsph17029_0194"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.988 at
FT                   residue 23"
FT   gene            complement(215428..216417)
FT                   /locus_tag="Rsph17029_0195"
FT   CDS_pept        complement(215428..216417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0195"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rsp:RSP_1544 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75314"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034984"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG48"
FT                   /protein_id="ABN75314.1"
FT                   /translation="MHPALSAPLCGLLALLAAVPLRAGVPEAVSETILPGYEGFTAATA
FT                   ALDTAARADCSAEALKAPWNAAFDAWMAVSHLRIGPSETAGRALAIAFWPDPKGSGART
FT                   QARLLEAADPDLLAPERFAEVSVAARGLFALERLLYDPAFAGDYACALTRATAADLARM
FT                   AADLETDWRETFAPLVLTAGRDGNDRFLTEAEARQALFTQLMAGLEFTADQRLGRPLGS
FT                   FDRPRPERAEARLSGRSLRNVELSLAALERLALVLAPDSPRSREGFDQARSRAARLDDP
FT                   RFDGVADPSGRLRVEILQQRLHALRDVLSAEVGGALGVSVGFNAADGD"
FT   sig_peptide     complement(216346..216417)
FT                   /locus_tag="Rsph17029_0195"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.989 at
FT                   residue 24"
FT   gene            complement(216417..217925)
FT                   /locus_tag="Rsph17029_0196"
FT   CDS_pept        complement(216417..217925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0196"
FT                   /product="protein of unknown function DUF1111"
FT                   /note="PFAM: protein of unknown function DUF1111; KEGG:
FT                   rsp:RSP_1545 probable thiol oxidoreductase with 2
FT                   cytochrome c heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75315"
FT                   /db_xref="GOA:A3PG49"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG49"
FT                   /protein_id="ABN75315.1"
FT                   /translation="MSRLPVLLSLLAFPVAAEPLDPPNLTVVPRTAAEAARIAGVLAPP
FT                   TDFSAPEAFEAMPGGAASVRARDTADAFSLSSGNMPFEREMDFKLGNGLFRKLWVASPS
FT                   STQASDGLGPLYNARGCQNCHLKDGRGHVPEGPGDDAVSMFLRLSVPGGPTPEGIEEWI
FT                   ATSAEPTYGGQLQDFAAPGLAPEGRMRIDWQEVPVTLGDGTVVTLRKPSYSVEDPGYGP
FT                   LAAGVMLSPRVTPQMIGLGLLEAIPAADILAHADPDDRDGDGISGRPSFVWSAEADAPM
FT                   LGRFGLKAGAPTVLQQSAAAFSGDMGIANALFPEPWGECTEAQAACRAAPHGIEPGKRD
FT                   DLEIDRTGLALTAFYARNLAVPERRRVEDPQVLRGKQLFHEAGCPACHVPKFVTHRLKD
FT                   QPEQSFQLIWPYTDLLLHDMGEGLADGRPEGRATGREWRTAPLWGIGLTEQVSGHANFL
FT                   HDGRARSILEAVLWHGGEAEAARARVMALPAPDRAALVAFVEDL"
FT   sig_peptide     complement(217872..217925)
FT                   /locus_tag="Rsph17029_0196"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.987 at
FT                   residue 18"
FT   gene            complement(218104..218589)
FT                   /locus_tag="Rsph17029_0197"
FT   CDS_pept        complement(218104..218589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0197"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Ferritin, Dps
FT                   family protein; KEGG: rsp:RSP_1546 bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75316"
FT                   /db_xref="GOA:A3PG50"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG50"
FT                   /protein_id="ABN75316.1"
FT                   /translation="MQGDAKVIEYLNAALRSELTAVSQYWLHYRLQEDWGFGSIAHKSR
FT                   KESIEEMHHADKLIQRIIFLGGHPNLQRLDPLRIGQTLRETLDADLAAEHDARTLYIEA
FT                   RDHCEKVRDYPSKMLFEELIADEEGHIDYLETQIDLMGSIGEQNYGMLNAKPADEAE"
FT   gene            complement(218579..218833)
FT                   /locus_tag="Rsph17029_0198"
FT   CDS_pept        complement(218579..218833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0198"
FT                   /product="putative bacterioferritin-associated ferredoxin"
FT                   /note="KEGG: rsp:RSP_1547 probable
FT                   bacterioferritin-associated ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75317"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG51"
FT                   /protein_id="ABN75317.1"
FT                   /translation="MIVCHCMGITDKDIRSAIDWMRASDPETIVTPGKIYRALGKRADC
FT                   GGCMPHFLDTMRKCDSFEVPMNLRGLRRATTAGMNGNAG"
FT   gene            complement(218915..220240)
FT                   /locus_tag="Rsph17029_0199"
FT   CDS_pept        complement(218915..220240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0199"
FT                   /product="imelysin. Metallo peptidase. MEROPS family M75"
FT                   /note="KEGG: rsp:RSP_1548 putative iron-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75318"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG52"
FT                   /protein_id="ABN75318.1"
FT                   /translation="MKSGRGTAWPPAPSRQRTAMKARLLALATVAPCALLPLPALAVER
FT                   SEVVETYADIAEATYADSLATARELQTAVKALVDQPSEAALMAARSAWLAARVPYQQSE
FT                   AFRFGNPIVDDWEGKVNAWPLDEGLIDYVDASYGGATEENDLAALNVIATPKFTLSGTE
FT                   IDATEITPELISGTLHEADGIEANVASGYHAIEFLLWGQDLNGTEAGAGDRPFTDYAKG
FT                   EDCTGGNCDRRAAYLVAATDLLVSDLDYMAAQWADGGAARVAVTEDPGKGLRAMLTGMG
FT                   SLSYGEQAGERMKLGLMLNDPEEEHDCFSDNTHNSHYYDGLGIRNVYRGHYARVDGSTV
FT                   EGPSLSDLVAEADPELDKVLTGQLDATVDRLDALRTAVAGGMAYDQMLAPGNAEGEALI
FT                   MGAVDALVTQTASIERATTALGLTGVAFEGSDSLDNPNAVFQ"
FT   sig_peptide     complement(220112..220240)
FT                   /locus_tag="Rsph17029_0199"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 43"
FT   gene            complement(220237..220398)
FT                   /locus_tag="Rsph17029_0200"
FT   CDS_pept        complement(220237..220398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75319"
FT                   /db_xref="InterPro:IPR019600"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG53"
FT                   /protein_id="ABN75319.1"
FT                   /translation="MNAMTDPMELIEAGIPVHDARSLTDGGTQARILLDGQIYCLRITR
FT                   AGKLILTK"
FT   gene            220749..221432
FT                   /locus_tag="Rsph17029_0201"
FT   CDS_pept        220749..221432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0201"
FT                   /product="protein of unknown function DUF533"
FT                   /note="PFAM: protein of unknown function DUF533; KEGG:
FT                   rsp:RSP_1549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75320"
FT                   /db_xref="InterPro:IPR007486"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG54"
FT                   /protein_id="ABN75320.1"
FT                   /translation="MDETGFLRGGPAERPAGVCPPAGLAGTAGDGSGCSGLADLIAGFL
FT                   LGDRSRCCVAGAAARRGIVALSCVVAGRAWADWRDGQDEMAGASGGDRVPLGLDADGAA
FT                   AEGLCERLLQAMVAAAKCGGRVCREERRFIHRRLRELDLDCDAQALIAAELEAPQDAGR
FT                   IARLARTPEEAAGIYAASLLAAGHGSVAEGSYLADLAARLKLEAGLVAHLHRRAASAGS
FT                   AALGD"
FT   gene            complement(221445..222275)
FT                   /locus_tag="Rsph17029_0202"
FT   CDS_pept        complement(221445..222275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0202"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: rsp:RSP_1550
FT                   regulatory proteins, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75321"
FT                   /db_xref="GOA:A3PG55"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG55"
FT                   /protein_id="ABN75321.1"
FT                   /translation="MVQSSPATTRRARGRPKAAEDKTEQNTVQSLDRALAMLRLLSQSE
FT                   GMTLSELAAESGEAAATVYRALVTLQAHQMIEMEEQGQVWHIGGGAFRVGSAFLRRAKF
FT                   VERARLPMDRLMRAAGETAALGVEADGRVMYLAQVETRQAIRAYFPEGSSAPLHATAVG
FT                   KALLAWYPEERIETILDREGLAKFTSLTITSASTLMRDLARTRDRGYALEDQEGAEGMR
FT                   AVAAPVFNSFGEPVAAITLAGPAFRVSLSDSTRFGTLVREAADEVTEATGGVRG"
FT   gene            222543..222923
FT                   /locus_tag="Rsph17029_0203"
FT   CDS_pept        222543..222923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0203"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rsp:RSP_1551 putative glyoxalase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75322"
FT                   /db_xref="GOA:A3PG56"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG56"
FT                   /protein_id="ABN75322.1"
FT                   /translation="MIDQCSLHVTDLERSRCFYDAALGRLGIPTGRAARSGVHWVGDGV
FT                   EAFSINEIRSGRNARQVREAHLAFVARSRPAVDAFHAAALRAGGRNDREPGLRPEYHPN
FT                   YYAALVLDPDGHRIEAVCHTPD"
FT   gene            complement(223041..223532)
FT                   /locus_tag="Rsph17029_0204"
FT   CDS_pept        complement(223041..223532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0204"
FT                   /product="Ureidoglycolate hydrolase"
FT                   /EC_number="3.5.1.116"
FT                   /note="PFAM: Ureidoglycolate hydrolase; KEGG: rsp:RSP_1552
FT                   ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75323"
FT                   /db_xref="GOA:A3PG57"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG57"
FT                   /protein_id="ABN75323.1"
FT                   /translation="MPRPPIRPEPLTAAGFAPFGDLIAAEGPPDRLINQGLCGRWHDRA
FT                   RLDFGPGGRAGLSIFRAEPRRLPYRLEMVERHPEGSQAFLPMTDHPFLVLVAPDEAGRP
FT                   GTPRAFRTAPGQGINLHRGTWHGVLTPLAEPGLFAVLDRIGDSPNLEEHWFEEPWTIED
FT                   "
FT   gene            complement(223649..224485)
FT                   /locus_tag="Rsph17029_0205"
FT   CDS_pept        complement(223649..224485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0205"
FT                   /product="protein of unknown function DUF861, cupin_3"
FT                   /note="PFAM: protein of unknown function DUF861, cupin_3;
FT                   Cupin 2, conserved barrel domain protein; KEGG:
FT                   rsp:RSP_1553 probable glyoxylate induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75324"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG58"
FT                   /protein_id="ABN75324.1"
FT                   /translation="MTSYHAPMGGLPPQTRLMTGRAVFTEAYAFIPRGVFSDIVTSALP
FT                   GWSQTKLWMIARPMTGFSETFSQYVMEVAPGGGSDAPEPEAGAQSVLFVTHGEVWLSLD
FT                   GQEHELGPGGYAYIPAGCRWRLHNGSHEPARFHWVRKLYEPAPGVSPPAAFVTNEREIA
FT                   PMAMPDTGGRWATTRFVDPADLAHDMHVNIVTFQPGGLIPFEETHVMEHGLFVLEGKAV
FT                   YKLNRDWVEVEAGDFMWLRAYCPQACYAAGPGPFRYLLYKDVNRHAKLRGPGAFGR"
FT   gene            complement(224482..225897)
FT                   /locus_tag="Rsph17029_0206"
FT   CDS_pept        complement(224482..225897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0206"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: rsp:RSP_1554
FT                   possible polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75325"
FT                   /db_xref="GOA:A3PG59"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG59"
FT                   /protein_id="ABN75325.1"
FT                   /translation="MKRYPRDMRGHGPTPPDAAWPGGARIAVSIVLNYEEGGENCLLHG
FT                   DAQSEAFLSDIAGAQPWPGQRHWNMESIYDYGARAGFWRLHRLFTGLNIPVTVYGVATA
FT                   LARSPEQVAAMKSAGWEIASHGLKWVEHRDMPEEEERRQIAEAIRLHTEVVGERPRGWY
FT                   TGRCSVNTVRLTAEEGGFDWISDTYDDDLPYWLETGTRDQLVIPYTLEANDMRFATAPG
FT                   YIEGEQFFTYLRDSFDTLYAEGCAGQAKMFSIGLHCRLIGRPGKIAGLKRFLDYARTHE
FT                   RVWFPRRGDIARHWHETHPHRRRPRPSRMDRESFEAHFGGIYEHSPWIAERAFELELGP
FT                   AHDSPAGLANALARIFRSATPAERLSVLKAHPDLAGKLAQARRLTASSSFEQSSAGLDA
FT                   LTDAERAEFATLNADYVAKHGFPFIIAVRDHDKAGILAAFETRLAHDSATEFATACRQV
FT                   ERIAELRLQDMLK"
FT   gene            226044..226397
FT                   /locus_tag="Rsph17029_0207"
FT   CDS_pept        226044..226397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0207"
FT                   /product="Transthyretin"
FT                   /note="PFAM: Transthyretin; KEGG: rsp:RSP_1555
FT                   transthyretin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75326"
FT                   /db_xref="GOA:A3PG60"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023418"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG60"
FT                   /protein_id="ABN75326.1"
FT                   /translation="MGRLTTHVLDTAQGRPAAGVRIVLCRLEGGNRSEIGTAVTNDDGR
FT                   TDRPLLEGAALVPGTYELTFGAGAYLRAGGLGAAAPLFLDEIPIRFCIADAAGHYHVPL
FT                   LLSPYGYSTYRGS"
FT   gene            226641..226796
FT                   /locus_tag="Rsph17029_0208"
FT   CDS_pept        226641..226796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0208"
FT                   /product="antenna complex, alpha/beta subunit"
FT                   /note="PFAM: antenna complex, alpha/beta subunit; KEGG:
FT                   rsp:RSP_1556 light-harvesting complex, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75327"
FT                   /db_xref="GOA:A3PG61"
FT                   /db_xref="InterPro:IPR000066"
FT                   /db_xref="InterPro:IPR002362"
FT                   /db_xref="InterPro:IPR023623"
FT                   /db_xref="InterPro:IPR035889"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG61"
FT                   /protein_id="ABN75327.1"
FT                   /translation="MTDDPKKVWPSGLTIAEAEEVHKQLILGTRVFGGMALIAHFLAAA
FT                   ATPWLG"
FT   gene            226810..227583
FT                   /locus_tag="Rsph17029_0209"
FT   CDS_pept        226810..227583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0209"
FT                   /product="antenna complex, alpha/beta subunit"
FT                   /note="PFAM: antenna complex, alpha/beta subunit; KEGG:
FT                   rsp:RSP_6158 light-harvesting complex alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75328"
FT                   /db_xref="GOA:A3PG62"
FT                   /db_xref="InterPro:IPR000066"
FT                   /db_xref="InterPro:IPR018332"
FT                   /db_xref="InterPro:IPR035889"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG62"
FT                   /protein_id="ABN75328.1"
FT                   /translation="MNNSKMWLTVNPNLGVPLLLGSVAVASLVVHGAVLTTTPWIANYY
FT                   QGSEPWPVAAAPAEEAAAPVEAAAPADEAAAPVEEAAPVAEAAAPAEEAAPAAEAAAPV
FT                   EEAAPAAEAAAPAEEAAPAAEAAAPVEEAAAPAEEAAPAAEAAAPAEEAAPVAEAAAPA
FT                   EEAAPVAEPAAEPAPAAEAAAPVAEVSAPAAELAAPVAMSLVDIAAKLNGLGYSVQSVT
FT                   KTEGGYVVNMTDANGMPVAATLDPVTGLPFVPAAQ"
FT   sig_peptide     226810..226908
FT                   /locus_tag="Rsph17029_0209"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.995 at
FT                   residue 33"
FT   gene            228028..229242
FT                   /locus_tag="Rsph17029_0210"
FT   CDS_pept        228028..229242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0210"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.42"
FT                   /note="KEGG: rsp:RSP_0446 isocitrate dehydrogenase;
FT                   TIGRFAM: isocitrate dehydrogenase, NADP-dependent; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75329"
FT                   /db_xref="GOA:A3PG63"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG63"
FT                   /protein_id="ABN75329.1"
FT                   /translation="MSKIKVANPVVELDGDEMTRIIWDFIKQKLILPYLDIDLHYYDLG
FT                   IEERDRTEDKITVDAAHAIKQHGVGVKCATITPDEARVEEFGLKSMWKSPNGTIRNILG
FT                   GVIFRQPIICRNVPRLVPGWTKPIVVGRHAFGDQYRATDFRFPGKGKLTLKFVGEDGAV
FT                   IEREVFDAPGSGVTMAMYNLDQSIIDFARASMNYGLNLGWPVYLSTKNTILKAYDGRFK
FT                   DLFQQVYEEEFAEKFKAAGITYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDTVAQ
FT                   GFGSLGLMTSVLMTPDGQTVEAEAAHGTVTRHFRQHQAGKETSTNSIASIYAWTGGLKH
FT                   RAKLDGNADLARFAETLERVTVQTVEDGFMTKDLALLVGPDQKWLTTMGYLEKVDEYLD
FT                   RALGA"
FT   gene            complement(229561..230535)
FT                   /locus_tag="Rsph17029_0211"
FT   CDS_pept        complement(229561..230535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0211"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: rde:RD1_2198 2-dehydropantoate 2-reductase,
FT                   putative; TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE, N-terminal domain
FT                   protein; Ketopantoate reductase ApbA/PanE, C-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75330"
FT                   /db_xref="GOA:A3PG64"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG64"
FT                   /protein_id="ABN75330.1"
FT                   /translation="MRICIFGAGAIGGYMGAKLAAAGADVSLVARGPHLAAMQARGLTL
FT                   IEEGGTRTVPVRAASDPAALGPQDYVIVTLKAHSVPAVVPQLSRLLGAEGTLVSGVNGL
FT                   PWWYFHRHGGPLEGRRLESVDPGGVQWDGLGPDRVLGCVVYPAAEVVEPGTVRHLEGNR
FT                   FSLGEPSGEKSDRALRLSEALTAAGLKAPVRPRLRDEIWVKLWGNLSFNPISALTGATL
FT                   DRLCTDPGTRAVARSMMLEAQAIAERLGVKFPIDVERRIDGGAAVGAHRTSMLQDLEAG
FT                   RPMEIEALVGSVAELGRIVNLPTPTIDTVLALVRLRAKVADLT"
FT   sig_peptide     complement(230470..230535)
FT                   /locus_tag="Rsph17029_0211"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.758) with cleavage site probability 0.523 at
FT                   residue 22"
FT   gene            complement(230532..232067)
FT                   /locus_tag="Rsph17029_0212"
FT   CDS_pept        complement(230532..232067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0212"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rsp:RSP_1561 AMP-forming acyl-CoA synthetase/ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75331"
FT                   /db_xref="GOA:A3PG65"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG65"
FT                   /protein_id="ABN75331.1"
FT                   /translation="MTATLSDLFAFHRNDGLAVGAPDRPWLTYAGLRELVGHTVTALHA
FT                   AGVGKGDRVAIVLPNGPEMATAFVALAEGAVTAPLNPAYRLEEFEFYLSDLGAKAIVLA
FT                   EGYDGPALAAATHLGLAVLRLGHDAADPAGSFTLRAESVAPGEPDRATARPRDLALILH
FT                   TSGTTSRPKIVPLRHGNLSASAHHIAGSLALTPHDRCLNMMPLFHIHGLVAAVSASLAA
FT                   GASVWCAPGFDALKVFGWIEAARPTWYTAVPTMHQAILARAPRNAEVIERVPLRFIRSS
FT                   SASLPAQVMEALSATFRAPVIEAYGMTEAAHQMTSNPLPPRAQKPGSVGVAAGPQVRIA
FT                   DEASDRLIEGTGEVVISGPNVTAGYESNEAANAKSFFEAEGERWFRTGDQGRFDSEGYL
FT                   TITGRLKEIINRGGEKISPLEVDGVLMDHPAVLQVVTFALPHPKLGEEVAAAVVLREGM
FT                   AADEAAIRAFCADRLAEFKVPRRVVLLDEIPKGATGKLQRIGLAEKLGLVSPA"
FT   gene            complement(232200..232886)
FT                   /locus_tag="Rsph17029_0213"
FT   CDS_pept        complement(232200..232886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0213"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rsp:RSP_1562 fumarylacetoacetate hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75332"
FT                   /db_xref="GOA:A3PG66"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG66"
FT                   /protein_id="ABN75332.1"
FT                   /translation="MSDHVFAPPAAPSLPVAESQTLFPVRRVYCIGRNYAAHAVEMGGD
FT                   PDREPPFFFQKNPDNLDPSGRFPYPPESSDVHHEVELAVMLGSGGTDIPVEEAMAHVWG
FT                   YALALDMTRRDLQGEAKKAGRPWEVGKAFERSAPVGPVHPAARIGHPEAGRIELRVNGA
FT                   LRQEGDLNQMIWKVPEMISVLSRHFALAAGDVILTGTPSGVGAVQRGDVMEASIDGLGT
FT                   LRVEVV"
FT   gene            complement(232953..233936)
FT                   /locus_tag="Rsph17029_0214"
FT   CDS_pept        complement(232953..233936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0214"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: rsp:RSP_1563
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75333"
FT                   /db_xref="GOA:A3PG67"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG67"
FT                   /protein_id="ABN75333.1"
FT                   /translation="MIPYSVLDLAPVPEGATTSEALAQTVTLARHAEALGFHRYWLAEH
FT                   HAMPGIASAATAVLIGHVAAHTQRIRVGSGGIMLPNHAPLMVAEAFGTLAELHPGRIDL
FT                   GLGRAPGTDGRTAQALRRNLDVTDSFPADVLELLRYFGEPEPGAIQAIPGQGTRVPLWI
FT                   LGSSLYGAQLAAHFGLPYAFASHFAPPALEAALAAYRQGFRPSTQLDRPRAMVAINVFA
FT                   GADDAEGRYLRSSAQLAFANLRLGRPGKLPRPVEDISAHVDPGMLRTVDQALSVSATGG
FT                   PETVRRELAALLERHRPDEVILTGQIHDPAARLRSFTIAAEALASL"
FT   gene            complement(234013..235233)
FT                   /locus_tag="Rsph17029_0215"
FT   CDS_pept        complement(234013..235233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0215"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   rsp:RSP_1564 putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75334"
FT                   /db_xref="GOA:A3PG68"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG68"
FT                   /protein_id="ABN75334.1"
FT                   /translation="MGGTAVTAMNETRTDRLGEHRLPPKRVRRPLITDISAARWLLLLI
FT                   LAASVYFFHGFLVPVLAALIIAFASWPLMLKLERSLPISRGIAGALLVMMIVGFLVIPV
FT                   MMALLYAFRELQAWIGWAINTNSTGAPPPVWLEALPHVGPWVGEKWRTYIGEPGAISEM
FT                   VQLVSGANIGTISRGILTAGTLAFHLALTLLFMLIALFIFYRDGERIAAQVDRVGTRIL
FT                   PDRWDRISRVVPATISSTVTGMTLIAMGEGVVLGTAYWIAGMPSPVTLGVITGFMALIP
FT                   GGAPFCVIVASSYLAASGSPWAGLGLFLWGTVELFVVDKTIRPVLVGGPVKLPFLPTFF
FT                   GLVGGIETMGIVGLFVGPVLMALLVAMWREWQREIDIAETEEMGHPLEPLPDPLPAPLH
FT                   PFRSESR"
FT   gene            complement(235325..236677)
FT                   /locus_tag="Rsph17029_0216"
FT   CDS_pept        complement(235325..236677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0216"
FT                   /product="BLUF domain protein"
FT                   /note="PFAM: BLUF domain protein; KEGG: rsp:RSP_1565 AppA,
FT                   antirepressor of PpsR, sensor of blue light"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75335"
FT                   /db_xref="GOA:A3PG69"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG69"
FT                   /protein_id="ABN75335.1"
FT                   /translation="MQHDLEADVTMTGSDLVSCCYRSLAAPDLTLRDLLDIVETSQAHN
FT                   ARAQLTGALFYSQGVFFQWLEGHPAAVSEVMSHIQRDRRHSNVEILAEEPIAKRRFAGW
FT                   HMQLSCSEADMRSLGLAESRQIVTVGRSLVADNTNIFSFDRIAAVRRFLSDVCAARTLA
FT                   PDTPVEADTFALYALTEAQAGRSGRAKAVARLSDLLSTDPLGRLTEVEELLRAHAPTAA
FT                   DFARLFEACAERLTRALAEDRISRMQVTLAYSALQMALRRIHHLPDPQKSVGAVLVAGV
FT                   PGHKPILEAALAAEMLRAVGWSTSVVHPESVAALAARLKTSRTSTLVMAPSLLEGTEQE
FT                   ADTLRFVSALRARTDLPGLSILIGGRLAQLPPSKLKDSGADAGFAHLALLPAALARVAC
FT                   PANADCCSMRACRMPASQCCDKRINPEFLLANVMPSVLTRISSRQDRRRSA"
FT   gene            237150..237839
FT                   /locus_tag="Rsph17029_0217"
FT   CDS_pept        237150..237839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0217"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: rsp:RSP_1566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75336"
FT                   /db_xref="GOA:A3PG70"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG70"
FT                   /protein_id="ABN75336.1"
FT                   /translation="MDETALIVAHGQPSDPLPAAAEIEALAAAVGAHLPGWRLRAATLA
FT                   EPGALAREVAAAGRPGIVYPLFMAGGWFTRTNLPRQLSAAGGTGWRIAEPFGTDPAVSD
FT                   LTVEIACEALSHRPAPAILLAAHGSFRSPAPSEVARAMAARLSEETGLPCEAAFIDQEP
FT                   QIAARARLMPEALCLPFFAARGGHVVEDLPAALAEAAFRGMVLEPVGLDLRVPALIARA
FT                   ISALDRA"
FT   gene            complement(237873..240440)
FT                   /locus_tag="Rsph17029_0218"
FT   CDS_pept        complement(237873..240440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0218"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: rsp:RSP_1567 probable sensory transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   response regulator receiver; ATP-binding region, ATPase
FT                   domain protein domain protein; histidine kinase A domain
FT                   protein domain protein; Hpt domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75337"
FT                   /db_xref="GOA:A3PG71"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG71"
FT                   /protein_id="ABN75337.1"
FT                   /translation="MSARRDTDLRRTVAAPRLWQRLRLPAAVLVMLAGATAIIGLANDA
FT                   RERFQQLDYIVTDGVQTRLSDLDGNLSQFASALGVTGSSPSPAAVRTSLRQLQEGLAQL
FT                   DTAMAEAGVLWDPAYGEGIARLRQFERDRADLIAAPDATVTAAMPGLTRALPQLEQAVA
FT                   ELSATASADRESRNLENRAIIGSSIMRLVALTIGLVLMLSAGSFQLLRLYLRSREQAEA
FT                   AGRASARLEAIFRISADAILVTDWSARVIDCNRAALAIFGHQRERLAGADAMELLFPAE
FT                   LQGRQRMRVVDALRNSDPRIDGPLRLELEAVHADGSRFPVEVSLAAARVEGEDIIVALM
FT                   RDISARRRAERELTEARDRALAGEQTKADFLAVMSHEMRTPLNGLAGSLELLAQTPLDP
FT                   RQRELVSVLRASAEILLDHVNSVLDIARSEARPSVAEMVDFDLDRLIEDCIANQSGFAA
FT                   VVGNRIDHRPLTGPVGILNGEPQRLRQVLLNLLNNAVKFTRNGRIIVESEVQGADVEIR
FT                   VLDTGIGIAPENLEKVFDDFVTLDASYERRSGGTGLGLGIARRLARIMGGDLTVQSTPG
FT                   RGSRFTLRLPLRRPREELAACRGPDEALSVLLVEDNDINRFIAQNFLESAGHRVLTARS
FT                   GLEGLTAAQSRHFDVILTDISMPGLDGLQVARRIRDGGGPSAASRILAITAHSLTADPG
FT                   ALRAAGIDGWLEKPVSRDALLRMLRHPAEPAPPPPEEALDTARLRELEDQIGPVALQGL
FT                   IRQMILDGTAILERLAALGPEPPPEEARPLVHQLAGAISTFGTGPLHRRLRQAQEALRT
FT                   GAEAGPHLAALPALWDRMRTALEEAAPDRPLDTAAPVRSSGAL"
FT   sig_peptide     complement(240312..240440)
FT                   /locus_tag="Rsph17029_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.658) with cleavage site probability 0.613 at
FT                   residue 43"
FT   gene            complement(240508..241902)
FT                   /locus_tag="Rsph17029_0219"
FT   CDS_pept        complement(240508..241902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0219"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   rsp:RSP_1568 glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75338"
FT                   /db_xref="GOA:A3PG72"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG72"
FT                   /protein_id="ABN75338.1"
FT                   /translation="MTDQPSPSGSTLSEAETFLAAHPEIEAFDIVLHDANGIGRGKIIR
FT                   RHELLSFYKGGRHLPISILGLDICGEDVHETGLIWDQGDGDLRAWPIPGTLVPLHGTTP
FT                   PRGEVFMCMYDLDGRPMSSDPRHALARQVEALAELGLHPSAAFELEFFLLANERGPDGR
FT                   VQPAADVLDGRRSAKTEVYSVDHLHGMMPLFSDIYAGAEAAGIKAETMISEYAPGQYEL
FT                   TLHYRTDVLQAADDLMRLKRIVRAQARRHGVTACFMAKPVESYAGSGMHLHVSLCDAEG
FT                   RNIFVEETEGQWSRPILHALGGLRETMGESMLVFAPHANSWRRFASQSYAPVSPSWGVN
FT                   NRSVALRIPAGDIRARRIEHRPAGVDANPYLVAATVLAGIRRGLEQQIDPGPETTGNGY
FT                   EDPGDTQPIPTCWRSAIAAAQHSAFLREALGPDMHRTFTAIKAAEYARVARTIPDVDYD
FT                   LYLHTV"
FT   gene            complement(241911..243284)
FT                   /locus_tag="Rsph17029_0220"
FT   CDS_pept        complement(241911..243284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0220"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG: rsp:RSP_1569
FT                   glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75339"
FT                   /db_xref="GOA:A3PG73"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG73"
FT                   /protein_id="ABN75339.1"
FT                   /translation="MSADPPRTAGVAEDRLAAFLADETARFERENPRSKEALQRGAQSY
FT                   LGGVPMHWMKDWPSPFPLVAAEAQGARLTDLDGHRLDDFCLGDTGSMFGHSPAPVARAI
FT                   RRQARQGLTYMLPTEATFEAGRLLSRTFGDFRWQVALTATDANRFALRVARAVTGRRKV
FT                   LVFNGCYHGTVDDTMVMLENGRTRARPGLVGMVADLASKAVAVEFNDVAGVEAALATGE
FT                   IAAILTEPVMTNSCMVLPEAGFHDALRTLSRRYGAVLILDETHTLSSGLGGYGRVHSLS
FT                   PDILVVGKCVAGGMPTAVWGLTPDLGARFEAYNATRPAGHSGMGTTLSANPMQFACLCA
FT                   TLSEVMTPEAYAHMERGAKRLAKGLAAVIARVGAPWHVVRVGARVEFICAPGPLRNGTE
FT                   AAGAHRPRLEGAVHLGLLNRGSLIAPFHNMMLVSPMTRTRQIDRLIAAFDAILTDLFA"
FT   gene            complement(243281..244363)
FT                   /locus_tag="Rsph17029_0221"
FT   CDS_pept        complement(243281..244363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0221"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: rsp:RSP_1570 phosphoribosylaminoimidazole
FT                   carboxylase, ATPase subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein, ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75340"
FT                   /db_xref="GOA:A3PG74"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG74"
FT                   /protein_id="ABN75340.1"
FT                   /translation="MTDRLPPGSTIGILGGGQLGRMLSVAAARLGFRTHIFEPSANPPA
FT                   ADVAHAVTTAPYEDEAALRAFAASVDVITYEFENIPTSALDLLEALKPLHPNRRALAVS
FT                   QDRLEEKGFLTGLGLAVAPYRPVGSREDLEAAIHGIGTPAILKTTRLGYDGKGQARLME
FT                   PDDAAEAFAAMNGQPAVLEGFVRFTHEVSVIAARGRDGSVAVYEPGENVHLSGILHTTT
FT                   VPARLTASQRTDAVLLAGRILNALDYVGVMGVELFVTPEALLVNEIAPRVHNSGHWTQN
FT                   GCAVDQFEQHIRAITGWPLGDGSRFADVEMENLIGHDVARVPALALEKHTAIHLYGKSE
FT                   ARPGRKMGHVNRILRPVTGA"
FT   gene            complement(244356..244841)
FT                   /locus_tag="Rsph17029_0222"
FT   CDS_pept        complement(244356..244841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0222"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: rsp:RSP_1571 phosphoribosylaminoimidazole
FT                   carboxylase, catalytic subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75341"
FT                   /db_xref="GOA:A3PG75"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG75"
FT                   /protein_id="ABN75341.1"
FT                   /translation="MTVDVGIIMGSQSDWATMKEAAAILDELGISHEARIVSAHRTPDR
FT                   LWSYGKTAVERGLKVIIAGAGGAAHLPGMMASKTRVPVIGVPVQTRALSGVDSLYSIVQ
FT                   MPKGFPVATMAIGSAGAANAGLMAAGILALSDPALGQRLDAWRAALSASIPEEPTDD"
FT   gene            complement(245077..245295)
FT                   /locus_tag="Rsph17029_0223"
FT   CDS_pept        complement(245077..245295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0223"
FT                   /product="protein of unknown function DUF465"
FT                   /note="PFAM: protein of unknown function DUF465; KEGG:
FT                   rsp:RSP_6218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75342"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG76"
FT                   /protein_id="ABN75342.1"
FT                   /translation="MNASPELSFEDMLRIRLEVLRREHRDLDEAIAAIEAGGRGDQLML
FT                   RRLKKQKLALKDQIVKIEDQLIPDIIA"
FT   gene            245623..246090
FT                   /locus_tag="Rsph17029_0224"
FT   CDS_pept        245623..246090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0224"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: rsp:RSP_1572
FT                   heat shock protein, HSP20 family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75343"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG77"
FT                   /protein_id="ABN75343.1"
FT                   /translation="MSLLQGHDGMTKLTFGGHPFLLGFEQLERLVERTAKTASEGYPPF
FT                   NIEAVAENAYRITLAVAGFREDDIAITVEDRQLVVRGRQAEDPAERVFLHRGIASRAFQ
FT                   RSFVLADGVEVAGATMEHGLLHIDLHRQVPQAVVQTIPIGRNRAIKEGVEQ"
FT   gene            246087..246311
FT                   /locus_tag="Rsph17029_0225"
FT   CDS_pept        246087..246311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0225"
FT                   /product="protein of unknown function DUF1150"
FT                   /note="PFAM: protein of unknown function DUF1150; KEGG:
FT                   rsp:RSP_1573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75344"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG78"
FT                   /protein_id="ABN75344.1"
FT                   /translation="MNTPFDFPEGAGRLVYVRPVPVAELPEDVQSMARGLDHIYALHGA
FT                   DGERLALVRDRHLAFVLARQNDLAPVNVH"
FT   gene            246585..247061
FT                   /locus_tag="Rsph17029_0226"
FT   CDS_pept        246585..247061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0226"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: rsp:RSP_1574 cytochrome
FT                   b562"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75345"
FT                   /db_xref="GOA:A3PG79"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG79"
FT                   /protein_id="ABN75345.1"
FT                   /translation="MTQEPGYTRLQITLHWAIAGLVLFNYIFGETMERAYDAVRQNVEP
FT                   AGVGHYLHVVVGLAVLVLTLVRIGARFVVGVPEKGTTPGDKVAAGLQGLLYLLTLLVPA
FT                   LGMTAWGGGQAWAAGPHVLAANAIMLLALVHAISALFHQYVLKDRLLLRMMRPR"
FT   gene            complement(247151..248857)
FT                   /locus_tag="Rsph17029_0227"
FT   CDS_pept        complement(247151..248857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0227"
FT                   /product="adenylylsulfate kinase / sulfate
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /EC_number="2.7.1.25"
FT                   /note="KEGG: rsp:RSP_1575 binfunctional sulfate
FT                   adenylyltransferase subunit 1/adenylylsulfate kinase
FT                   protein; TIGRFAM: sulfate adenylyltransferase; PFAM:
FT                   ATP-sulfurylase; adenylylsulfate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75346"
FT                   /db_xref="GOA:A3PG80"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG80"
FT                   /protein_id="ABN75346.1"
FT                   /translation="MSLPNHAPVPELYVSYDSAQKLKADAGSLPSWDLTQRQICDLELL
FT                   MNGGFHPLKGFLTEADYDGVVENMRLADGRLWPMPVTLDVSEKFAEGVEPGQDIALRDA
FT                   EGVILAILSVTDKWVPNKDREAEKVFGANDLAHPAVNYLHHTAGKVYLGGPITGIQPPV
FT                   HYDFKMRRDTPNELRAFFRKMGWTRVVAFQTRNPLHRAHQELTFRAAREAQANLLIHPV
FT                   VGMTKPGDIDHFTRVRCYEAVLDQYPSSTTTLSLLNLAMRMGGPREAVWHGLIRRNHGC
FT                   THMIVGRDHAGPGKNSEGKDFYGPYDAQELFKAHADEIGVEMVDFKQMVYVQEKAQYFP
FT                   VDEVPEGSTVLDISGTELRRRLREGLEIPEWFSFPDVVSELRRTSPARSKQGFTVFFTG
FT                   LSGSGKSTIANALMVKLMEMGGRPVTLLDGDVVRKHLSSELGFSKEHRDINIKRIGYVA
FT                   SEITKNGGIAICAPIAPYTATRRAVREMIEAFGAFIEVHVATPIEECERRDRKGLYKLA
FT                   REGKIKEFTGISDPYEVPAKAELVVDTANVSVDHCAHQVILKLEQMGLIRA"
FT   gene            complement(249049..249987)
FT                   /locus_tag="Rsph17029_0228"
FT   CDS_pept        complement(249049..249987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0228"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="KEGG: rsp:RSP_1576 thioredoxin reductase; TIGRFAM:
FT                   thioredoxin reductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75347"
FT                   /db_xref="GOA:A3PG81"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG81"
FT                   /protein_id="ABN75347.1"
FT                   /translation="MAETRHTRVLIIGSGPAGYTAAVYSARAMLNPLLIQGLQPGGQLT
FT                   ITTEVENWPGDREVQGPELMVRMEDHARAMGAEIVSDYISSLDLSQRPFTAQADSGMTY
FT                   TADAVILATGAQARWLGLPSEERFKGFGVSACATCDGFFYRGKEVVVAGGGNTAVEEAL
FT                   FLTNFASKVTLVHRRDSLRAEKILQDRLFKHPKIEVLWNHTIEEVAGTEAPLGVTGIVA
FT                   RNVLTGETTEVPCEGFFVAIGHAPASELVKDQLELHHGGYVKVEPGTTRTSIPGVFAAG
FT                   DLTDHVYRQAVTSAGMGCMAALDAERFLAGA"
FT   gene            250209..250709
FT                   /locus_tag="Rsph17029_0229"
FT   CDS_pept        250209..250709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0229"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   rsp:RSP_1577 proline dehydrogenase transcriptional
FT                   activator"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75348"
FT                   /db_xref="GOA:A3PG82"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG82"
FT                   /protein_id="ABN75348.1"
FT                   /translation="MAGSKLDPIDRHILAELQSDGRMTNVELAKRVGISAPPCLRRVRT
FT                   LEEAGYIRGYHADIDPRELGFEVQVFAMVRLHSQAEADLSAFESRCRAWPLVRECHMLN
FT                   GEIDFILKCVAPDLPSFQSFLTQELTAAENVASVKTSLVIRCAKDEPGVPFEVLEARLQ
FT                   RSA"
FT   gene            complement(250830..251582)
FT                   /locus_tag="Rsph17029_0230"
FT   CDS_pept        complement(250830..251582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0230"
FT                   /product="protein of unknown function DUF152"
FT                   /note="PFAM: protein of unknown function DUF152; KEGG:
FT                   rsp:RSP_1578 conserved hypothetical protein TIGR00726"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75349"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG83"
FT                   /protein_id="ABN75349.1"
FT                   /translation="MMELITADALAPFRHGFFTRKGGASSGVFAGLNCGPGSSDLAEVV
FT                   TINRARVAEAMGVTADRLVTVNQVHSPDVLTVTGPLAERPRADALVTAVPGLAIAVLTA
FT                   DCQPVLMADAEAGVVAAAHAGWRGTKAGVLEATLAAMEDLGADRARVAAVIGPTISQAA
FT                   YEVGPEFVEEFLDEDPEAARFFAQGPGDRALFDLPAFGLARLRAAGVGQAEWTRHCTYR
FT                   DPERFFSYRRTTHAGEADYGRLISAIRL"
FT   gene            complement(251579..252640)
FT                   /locus_tag="Rsph17029_0231"
FT   CDS_pept        complement(251579..252640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0231"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   rsp:RSP_1579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75350"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG84"
FT                   /protein_id="ABN75350.1"
FT                   /translation="MTALAALLARRIGATGPVTVADYMAECLLHPEHGYYSTREPFGAA
FT                   GDFTTAPEISQMFGELLGLCLAQAWLDQGQPSPVTLAELGPGRGTLMADLLRATRGVPG
FT                   FHDAARVHLVEASPRLRALQREMLGGHPAAWLDRAADLPEGPLFLVANEFFDALPIRQF
FT                   VRGPEGWRERMVGLTEGRLTWGLGPETALAALAHRLEDTAPGDVVELCPAAGPIMAEIA
FT                   RRIAAAGGLALAVDYGGWRSRGDTLQALRAHRFDDPLAAPGEADLTAHVDFEALAQAAA
FT                   PCGTALVPQGALLLRLGLAQRAARLARSLTGEALASHEAASRRLTDATEMGTLFKALAV
FT                   FPPQGPAPAGFDT"
FT   gene            complement(252637..253515)
FT                   /locus_tag="Rsph17029_0232"
FT   CDS_pept        complement(252637..253515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0232"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase;
FT                   KEGG: rsp:RSP_1580 prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75351"
FT                   /db_xref="GOA:A3PG85"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PG85"
FT                   /protein_id="ABN75351.1"
FT                   /translation="MSYIPFPDISPELFSIELFGVTFALRWYALAYIAGLLIGWRLVLR
FT                   MIRAERLWSFGPPMTEDQLERLLTWVILGVILGGRLGFVLFYQPAHYLAHPLDILKVWE
FT                   GGMSFHGGFLGVMTALVAFCLKERISILPVADLLAAATPPGLFLGRIANFINAELWGRP
FT                   TTLPWGVAFPGEAAQSCPGIEGICARHPSQIYEAGLEGILLFAVLSLLVWRRGWLHWPG
FT                   SVSGMFLAGYGATRFLVEFVRQPDAQFVSAGNPLGLAWQISGYGLTMGQILSLPMILLG
FT                   LYLILRSRRTA"
FT   gene            253620..253868
FT                   /locus_tag="Rsph17029_0233"
FT   CDS_pept        253620..253868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0233"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   rsp:RSP_1581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75352"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG86"
FT                   /protein_id="ABN75352.1"
FT                   /translation="MQTRNKFFDDMSQLMTNAMGVAQGARTEAETAMKGLLDRWMADRD
FT                   FVTREEFDAVRAMAQKAREENEALSARLAALEAKSKG"
FT   gene            254288..254557
FT                   /locus_tag="Rsph17029_0234"
FT   CDS_pept        254288..254557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0234"
FT                   /product="putative sulfate transporter/antisigma-factor
FT                   antagonist"
FT                   /note="KEGG: rsp:RSP_1582 putative sulfate
FT                   transporter/antisigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75353"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG87"
FT                   /protein_id="ABN75353.1"
FT                   /translation="MTPLTLSGTLRLQDAPGLIERLAAALAAGDVEIDPSGVLAVDAAA
FT                   VQVLVSAARTAGATGRRLVLAQDHPALTDAFAGLALDPVPEGLA"
FT   gene            254554..254919
FT                   /locus_tag="Rsph17029_0235"
FT   CDS_pept        254554..254919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0235"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rsp:RSP_1583 chemotaxis response regulator, CheY3"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75354"
FT                   /db_xref="GOA:A3PG88"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG88"
FT                   /protein_id="ABN75354.1"
FT                   /translation="MSRTVLAVDDSPSVRCMVAMTLREAGYRVIEATDGREGLEKALSE
FT                   PVDAIITDQNMPNLDGLGFIRAFREHPESKGKPIIFLSTDSADTLKQQAREAGAMGWMV
FT                   KPFTQPQLLAVIKKVLG"
FT   gene            254916..256880
FT                   /locus_tag="Rsph17029_0236"
FT   CDS_pept        254916..256880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0236"
FT                   /product="CheA signal transduction histidine kinases"
FT                   /note="PFAM: CheW domain protein; ATP-binding region,
FT                   ATPase domain protein domain protein; Signal transducing
FT                   histidine kinase, homodimeric; Hpt domain protein; KEGG:
FT                   rsp:RSP_1584 chemotaxis histidine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75355"
FT                   /db_xref="GOA:A3PG89"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG89"
FT                   /protein_id="ABN75355.1"
FT                   /translation="MMDDDMMAVFRQEATDLIESLERGLLDLSDSPEDRDLINAVFRDL
FT                   HTIKGSGAMFGFADMAAFVHAFESAFDLLRSGKAVVTPEIIRLALSARDEIIGFLADEP
FT                   DPDGRRPAILSALEAAVGGSGVATAPAVAAAAAPPADRLWFRLTGNALALGARPDLLLA
FT                   ELRELGATDIRADLSAVPPLDALDPEVCMIGWSMSFPNRVTREAIENVFLFNEVELRLE
FT                   AAPATAPAAAPVPAAPVSAAAAPPPPAAPRKAADEATGADKAGATMRVAAERLDHLMDR
FT                   VGELVIADARLLQLAQQSRDPALMAAAEEISRLAAGLRDTTMRIRMVPVRSMVGRFRRL
FT                   IHGLSEMVGKPVSFVVLGEETELDKTVIEQLADPIVHMLRNSVDHGLEAPADRAAAGKP
FT                   AEGRITLEAEQSGAEVVIRISDDGRGLNRDRIRAKAIANGIIGPDAILTESAMNALILE
FT                   PGFSTAEAITEISGRGVGMDVVKKTIEGLRGSIEVQSVEGRGTTFTLRLPLTLAIIEGL
FT                   LVEVAGERFSIPLAAVQEIVELPPDRREEDGSADFLDVRDRLVPLVRLRRIFSSPGTPD
FT                   EFQTVVIVRAGETRAGAVVDRIIGTNQIVIKQMSRLHSGIRAFSGATILGDGTVALILD
FT                   VPHLAGVGQGVEDRRGAAA"
FT   gene            256877..257368
FT                   /locus_tag="Rsph17029_0237"
FT   CDS_pept        256877..257368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0237"
FT                   /product="putative CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: rsp:RSP_1585
FT                   chemotaxis protein, CheW2"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75356"
FT                   /db_xref="GOA:A3PG90"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG90"
FT                   /protein_id="ABN75356.1"
FT                   /translation="MSNIIDLKSAAMMTVVTMRLGRQMLAIPASALREILDPLPVTRVP
FT                   TADRSVWGVINVRGAVVPVAELRFAFGIAEESRTEASKMLVVEVDLAGEPLVVAVAADA
FT                   VLEVSELDRAAMEPLPPKGSSWPQSFVQGVFRTRKGLLLLPHLSNIFAAQASAAGVAVA
FT                   "
FT   gene            257492..258028
FT                   /locus_tag="Rsph17029_0238"
FT   CDS_pept        257492..258028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0238"
FT                   /product="putative CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: rsp:RSP_1586
FT                   chemotaxis protein, CheW3"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75357"
FT                   /db_xref="GOA:A3PG91"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG91"
FT                   /protein_id="ABN75357.1"
FT                   /translation="MISMTASSSTMQAEPVGPAEAPPVVTFMAGEALYALPVERVQEIL
FT                   DLQPVAPLPNAPAHLLGLCDVRGAGVPVVDLRSLLGLPPTEDTGHSRILVTWVASAGAR
FT                   HVVGLKTERVIEVTALDEGRMQQMSSADMLNWTDTAVMGIGKRNGAFVTLLDIDRLMDP
FT                   SRLGLQADLRQGELQ"
FT   gene            258025..258861
FT                   /locus_tag="Rsph17029_0239"
FT   CDS_pept        258025..258861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0239"
FT                   /product="Protein-glutamate O-methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase, CheR-type; KEGG:
FT                   rsp:RSP_1587 chemotaxis methyltransferase, CheR2"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75358"
FT                   /db_xref="GOA:A3PG92"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG92"
FT                   /protein_id="ABN75358.1"
FT                   /translation="MSQALRPAHDQRFSDLIRSRTGIQLPVHRRQMIESRLRPRIAAVG
FT                   ATGFEGYLEQLFDHGLLDDELPLVIDLLTTNKTDFYRESAHFDVLVDKIVPETIRHATP
FT                   HAPRLKIWSAASSEGAEAYTAAIVLAEAQRAGHRFSYAILGTDISHRMLERARRAIYTA
FT                   EQLSPVPAELRARYTMAGRAPSHAGTARIVPELRDRVQFMHLNLMDSTYPVDRDVDVIF
FT                   LRNVLIYFGPEDQAAVIARMAGHLRPGGYLMVGHSESMVVSHPQMKQHSPSVFRKT"
FT   gene            258864..259973
FT                   /locus_tag="Rsph17029_0240"
FT   CDS_pept        258864..259973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0240"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: rsp:RSP_1588 chemotaxis methylesterase,
FT                   CheB1"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75359"
FT                   /db_xref="GOA:A3PG93"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG93"
FT                   /protein_id="ABN75359.1"
FT                   /translation="MTTHAAAPSTRVLIVDDSAAARAMFKVIVESDPALQVMAAVPDAF
FT                   AAARAMRTELPDVILLDLELPGMDGLTFLRKIMQQHPIPVVVCSSHVGAGTEAMVSALE
FT                   LGAREVISKPAARNDLERQEASIRICDAIRAATETTRRRSQPEPRPLAPGPKLTADEIL
FT                   PARPPRPVPETMPVVCIGASTGGTEALRDVLTALPASAPPIVIVQHMPRGFTAAFARRL
FT                   DSLCAIEVLEAEDEMQVMPGRAIIAQGDRHLLLRRRNQGYRVSVLDGAYVCRHRPSVDV
FT                   LFRSAAQEAGGNALGVIMTGMGDDGARCMAEMRAAGAETIAQNEESCVVYGMPREAVAH
FT                   GGVGKVEPLDRLAARIMEFGRRHTERTVR"
FT   gene            259970..261712
FT                   /locus_tag="Rsph17029_0241"
FT   CDS_pept        259970..261712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0241"
FT                   /product="transducer-like protein, TlpC"
FT                   /note="KEGG: rsp:RSP_1589 transducer-like protein, TlpC"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75360"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG94"
FT                   /protein_id="ABN75360.1"
FT                   /translation="MKLEPDLPEAIRMAQPAHPLDFVLLSTEQTFLRAGETLAQAVRHL
FT                   NDLRVDFGRLDAALGPGQARRFLSLTAETGTQASCLAGEFVQFEEASRALRTAVGAMRA
FT                   EVTDLMATIRAISIVKLQARIIGNMLTGSRQRVEAFTGGLTRMAAEAADLVAEVDEAMN
FT                   EIAAETAAMDDEAAHLSQTLRELVLPNLTAIGAAAAEVSLDRQRMAEGHEALARRMEAI
FT                   FGAVSHLILALQAGDSARQRFEHVRHLTSDALAAAAGETGLEAVLLDLGVTQTAATVRG
FT                   LTVHLGAAQGTFLEVQGSASAAIGLASGLYLGDASRGSGAIQTMMGRAQTVETGLTRCG
FT                   AHLHRLAGHAARVAAHLEKIRHHEGRMRRIEDQVRLFGLNAVIVCAKLGQEGRALQEIS
FT                   RQLRDLTQISAEVFTRLHGRLERTQERAATIGSEAVAGLEREMGRVADGAQAVRALLEE
FT                   AEAAHAAAGNAFGKAGRILTSSLETAAGLMGNYRRNLVSLQAFEEQLVRRRAVVSGPLD
FT                   LTPAAEGLLAAVRKSYTVPEEREIHDAIVRAALPSHTEEEAAPPRVEAGPGAGSEEDLA
FT                   DIFF"
FT   gene            261760..262761
FT                   /locus_tag="Rsph17029_0242"
FT   CDS_pept        261760..262761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0242"
FT                   /product="glutathione S-transferase"
FT                   /note="KEGG: rsp:RSP_1591 predicted glutathione
FT                   S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75361"
FT                   /db_xref="GOA:A3PG95"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG95"
FT                   /protein_id="ABN75361.1"
FT                   /translation="MGELIEGVWHPNWYDTASNGGRFVRSRARFRNWITADGSPGPSGE
FT                   GGFPAEAGRYHLYVAHACPWAHRTMIFRVLKDLAPLIDVSVVHPEMLEDGWTFDRSFPG
FT                   ATGDRLHGLAFLREIYLKADPGISARVTVPVLWDRKRETIVSNESAEIIRMFNAAFDHL
FT                   TGNRVDFLPDGDLDEIDRLNDRIYGTVNNGVYRAGFATTQEAYDEAAAPLFETLDWLEE
FT                   RLATRRYLVGDRLTEADWRLFTTLVRFDKVYHTHFKCNRRQIVQYPNLWGWLRELWQVP
FT                   GVAETVHFDHIVRHYYFSHDTINPHRIVPLTPDPDFAAPHGRDQLFQASRLR"
FT   gene            complement(262731..264188)
FT                   /locus_tag="Rsph17029_0243"
FT   CDS_pept        complement(262731..264188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0243"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; SMART: AAA ATPase; KEGG: rsp:RSP_1590 two
FT                   component, sigma54 specific, transcriptional regulator, fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75362"
FT                   /db_xref="GOA:A3PG96"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG96"
FT                   /protein_id="ABN75362.1"
FT                   /translation="MTQVTRSTGNEGHARPAAGSAEASRPRPILLIEDTPSLQMVYRSV
FT                   LASAGHRVAVAGTAAEGLSRFRETLPNVVLLDLMLPDRNGLDLMQDMLRLRPETNVIVI
FT                   TANGSINKAVEAMRAGAHEFLVKPFDEQRFLGAVENASLAREARPTRRPPPQPAGPAPV
FT                   TGAFLGSSEAMARIHAKIRSAARSMATIFITGESGTGKELCALAVHDTSPRAAGPFIAL
FT                   NCGAIPQDLLESEVFGHVKGSFTGAIADKPGAAAAADGGTLFLDEICEMAPALQTKLLR
FT                   FLQTSMVQPVGATRPRKVNVRIVCATNRDPLDAVRRGHFREDLYYRLFVVPIHMPPLRD
FT                   RGNDVIEIAEAALSRFAAEEGREFFGLDAEVKALFRRHPWPGNVRQVLNVIRNVVVLNE
FT                   GGLVTMRMLPDAFTDHPSPPEDLPPPSLPAPAEPMLDGLIGRTLAEIEQIVIEATIARH
FT                   GGSVPKAARMLDVSPSTLYRKREAWKS"
FT   gene            complement(264185..264736)
FT                   /locus_tag="Rsph17029_0244"
FT   CDS_pept        complement(264185..264736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0244"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75363"
FT                   /db_xref="GOA:A3PG97"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG97"
FT                   /protein_id="ABN75363.1"
FT                   /translation="MTASHDPSADGSQGAFRHPPGAELWATVAEALDRLAGLETSVDPA
FT                   RLAPLRETLLRLRDQVGALAPPPVPETVDEGRFRRLLEIAGPDTANELVHRLHVDLKST
FT                   RERLDEAMAGTDWVEIRAQTHVLMSLAGTVGAGGLQRLSEALNAAAHQRDRDRAAGLRT
FT                   ELLMRLDGLLAFVAQQRDGA"
FT   gene            complement(264972..266864)
FT                   /locus_tag="Rsph17029_0245"
FT   CDS_pept        complement(264972..266864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0245"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rsp:RSP_1592 possible acyl-CoA sythetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75364"
FT                   /db_xref="GOA:A3PG98"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG98"
FT                   /protein_id="ABN75364.1"
FT                   /translation="MAYASLYKWSLEDPNGFWMKAAEQIDWVSPPSKALFDEKEPFYEW
FT                   FADGQVNACWNAVDRHVEAGRGKQIAIVHESPITHSSKGITYAELQARVASLAGALRAK
FT                   GVEKGDRVIIYMPMIPEALEAMLACARLGAIHSVVFGGFAAHELAVRIDDCTPKAIIAA
FT                   SCGLEPSRVVHYKPLLDQAIEEATHKPDFCVIFQREQEVAKLIEGRDVAWHTFQYGVEP
FT                   AECVPVEGNHPAYILYTSGTTGQPKGVVRATGGHLVALNWTMKAIYDIDAGDVFWAASD
FT                   VGWVVGHSYICYGPLIAGATTIVYEGKPVGTPDAGAFWRVMQNHKVKTFFTAPTALRAI
FT                   KREDPQGALIQDYNLRNLKALFLAGERADPDTIVWAQKNVGVPVIDHWWQTESGWAMAA
FT                   NPLGIEALPVKIGSPSLPMPGYDVRVLDEGGHQLEAGQLGAIAIKLPLPPGTLPTLWNA
FT                   QDRFVKSYLTHFPGYYETGDAGYIDEDGYIYIMARTDDVINVAGHRLSTGAMEEVLASH
FT                   EDVAECAVIGVTDALKGQSPLGFLCLNKGSNRAAEDVVKECVKLVREKIGPVADFKRAC
FT                   VVDRLPKTRSGKILRGTMVKIADGQEFKMPATIDDPAILDEIRVALEAVGYPRA"
FT   gene            complement(267025..269304)
FT                   /locus_tag="Rsph17029_0246"
FT   CDS_pept        complement(267025..269304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0246"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)), Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   enzyme domain protein; malic enzyme, NAD-binding; KEGG:
FT                   rsp:RSP_1593 phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75365"
FT                   /db_xref="GOA:A3PG99"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A3PG99"
FT                   /protein_id="ABN75365.1"
FT                   /translation="MDEARQDNARHAALDYHEFPKPGKLEIRATKPLANGRDLARAYSP
FT                   GVAEACLEIKADPATASRYTSRGNMVGVVTNGTAVLGLGNIGALAAKPVMEGKAVLFKK
FT                   FAGIDCFDIELAEPDPLKLAEIVCALEPTFGAINLEDIKAPDCFIVEKICRERMNIPVF
FT                   HDDQHGTAIVVGAAATNALHVAGKRFEDIKVVSTGGGAAGIACLNMLLKLGVKRENVWL
FT                   CDIAGLVWKGREAEMTPQKAEYAQDSDLRTLAEVIEGADLFLGLSGPGVLTPAMVERMA
FT                   ERPIIFALANPTPEILPEEVRSIRPNAIIATGRSDYPNQVNNVLCFPFIFRGALDVGAT
FT                   TINDEMQLACIEGIASLARATTSAEAAAAYKGEPMSFGADYLIPKPFDPRLIGVVALAV
FT                   ARAAMESGVATRPIADLDAYRRRLEGSVFRSALIMRPVFEASAAESRRIVFAEGEDERV
FT                   LRAANAVLEETVHKPILIGRPEVVEMRCERAGLPIRPGRDFDLVNPENDPRYRDYWESY
FT                   HALMARRGVTPDTARAVMRTNTTAIGAIMVHRGEADSLICGTYGQYLWHLNYVTQILAT
FT                   RNRRPIGALSLMILEDGPLFVADTHVHHEPTPEEIAETVIGAARHVRRFGLAPKVALCS
FT                   SSQFGNLDCSTGRRMRAALEILDERRVDFAYEGEMHIDAALDQGIRDRIFPGGRFDGPA
FT                   NVLVFGNSDAASGVRNILKVKANGLEVGPILMGMGNLAHIVTASITARGLLNMSALAGT
FT                   PVTHYG"
FT   gene            269515..269907
FT                   /locus_tag="Rsph17029_0247"
FT   CDS_pept        269515..269907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0247"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /note="TIGRFAM: cytidine deaminase; PFAM: CMP/dCMP
FT                   deaminase, zinc-binding; KEGG: rsp:RSP_1594 cytidine
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75366"
FT                   /db_xref="GOA:A3PGA0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGA0"
FT                   /protein_id="ABN75366.1"
FT                   /translation="MSLLEAATAVRENAYAPYSRFKVGAALRTASGAVHAGCNVENVAY
FT                   PEGTCAEAGAIAAMVAAGETRIAEILVIADSPEPVPPCGGCRQKIAEFAGPEVPVTLCT
FT                   IDGQSLRTSVADLLPGSFRAAHMDRA"
FT   gene            269909..271216
FT                   /locus_tag="Rsph17029_0248"
FT   CDS_pept        269909..271216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0248"
FT                   /product="thymidine phosphorylase"
FT                   /EC_number="2.4.2.4"
FT                   /note="KEGG: rsp:RSP_1595 thymidine phosphorylase; TIGRFAM:
FT                   pyrimidine-nucleoside phosphorylase; PFAM: glycosyl
FT                   transferase, family 3; Pyrimidine nucleoside phosphorylase,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75367"
FT                   /db_xref="GOA:A3PGA1"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013465"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGA1"
FT                   /protein_id="ABN75367.1"
FT                   /translation="MDARSINAKLRRGEVPSAAELGWFAEGLASGHVTDAQAGAFAMAV
FT                   CLQGLGEEGRVALTRAMRDSGRVLAWDLPGPVLDKHSTGGIGDCTSLLLAPALAACGAY
FT                   VPMISGRGLGHTGGTLDKLEAIPGFRVALGEERLRAQIEDVRCAIVAADEGMAPADRRL
FT                   YLIRDVTGTVESIDLITASILSKKLAAGLEGLVLDVKVGSGAFMKSMDEAEALARALVG
FT                   TAQGAGCMTSALITDMSQPLATAAGNALEVIEVMETLTGTSINAALWDVTVALGGEALA
FT                   LGGLAADAEDGAHRIEQALESGHAAEFFARMVAAQGGPVDFVERWPDRLPSAPVMREVP
FT                   SLRTGFVLRIDTAALGQAVVHLGGGRLRETDRVNPSVGLADIAGIGEEVSEDLPLAMIH
FT                   AATEADADAAVAAIQAAYVISDQEPAEPPLIHARIA"
FT   gene            271216..272412
FT                   /locus_tag="Rsph17029_0249"
FT   CDS_pept        271216..272412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0249"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="KEGG: rsp:RSP_1596 phosphopentomutase; TIGRFAM:
FT                   phosphopentomutase; PFAM: metalloenzyme domain protein;
FT                   Phosphopentomutase N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75368"
FT                   /db_xref="GOA:A3PGA2"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGA2"
FT                   /protein_id="ABN75368.1"
FT                   /translation="MPRAFLIVMDSVGCGGAPDAAAFGDAGSNTLGHIAEACAAGRAEE
FT                   GRSGPLRLPVLDALGLGRAIELASGLTAPGLGAEPSGRWGAATEVSKGKDTPSGHWELA
FT                   GVPVPWDWHYFPDRCPAFPDDLTAEICRRAGTEGILGNRHASGTAVIEELGAEHLRTGW
FT                   PICYTSADSVLQIAAHEEAFGLDRLLALCAGLAPTLHAMRVGRVIARPFTGAPGSFART
FT                   PNRRDYAIAPPAPTLLDIAAAAGRATHAIGKIGDIFSHRGIGQLHKGRDDAALFDRLDA
FT                   LADTAEEGALTFANFVEFDSLYGHRRDVSGYARALEWFDGRAGAFLARLRPGDMALFTA
FT                   DHGNDPTFRGTEHTRERVPVLIAGTGAGPLGLCAYADVAATVAAHLGLSNPGPGRALA"
FT   gene            272409..273392
FT                   /locus_tag="Rsph17029_0250"
FT   CDS_pept        272409..273392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0250"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: rsp:RSP_1597 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75369"
FT                   /db_xref="GOA:A3PGA3"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGA3"
FT                   /protein_id="ABN75369.1"
FT                   /translation="MSLPKIELHLHLEGAAPPAFIRGLAREKSIDISGIFAEDGSYAYR
FT                   DFRHFLKVYEAATSVLTGPEDYRRLTLAVLEESAASGVVYSETFLSPDFCGGRDLGAWR
FT                   EHLHAIEEAAAEAERTMGIALRAIVTPIRHFGPDKAKETALCAAETAGRFVTGFGLAGD
FT                   ESVGKPKDFAWSFDMAREAGLRLTCHAGEWGGPDSIRDALRDLRVERIGHGVRAIEDLA
FT                   LVDELAERGIVLECCPGSNIALGIYPGWRRHPIGELFRREVKVTVSTDDPPFFHTTMAR
FT                   EYDRLAEAFDWDEGVFRTIARTALDAAFCDPDTRARIAKLLEPDHA"
FT   gene            273385..274017
FT                   /locus_tag="Rsph17029_0251"
FT   CDS_pept        273385..274017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0251"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: rsp:RSP_1598 putative
FT                   uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75370"
FT                   /db_xref="GOA:A3PGA4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGA4"
FT                   /protein_id="ABN75370.1"
FT                   /translation="MLDHLTVVTHPLVQHKLTIMRNKETSTAGFRRLLREISLLLAYEV
FT                   TRELDMTTTTIQTPLREMQAPILDGKKLALISILRAGNGLLDGILELVPAARVGFIGLY
FT                   RDPETLKPVQYYAKVPDALEDRLVIAVDPMLATGNSSAAAIDLLKEKGAKNIRFLCLLA
FT                   APEGVARMKEAHPDVPIVTAAVDECLDHHGYIVPGLGDAGDRMFGTK"
FT   gene            274084..275031
FT                   /locus_tag="Rsph17029_0252"
FT   CDS_pept        274084..275031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0252"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: rsp:RSP_6008
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75371"
FT                   /db_xref="GOA:A3PGA5"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGA5"
FT                   /protein_id="ABN75371.1"
FT                   /translation="MLIRAVSAAICALVAGAGAVPAQDGPAETPPSDFVAPQYVDSEGC
FT                   VFLRAGVEGAVSWVPRVTRDRKPLCGYPPSLSPVVEASPEDAPAVAADATTAAPQADAP
FT                   AMTAETDPAPAAGDPAAKAAAKAAISTVAAAVARSEPDRPAKTWKKRTRFPAVRVQPAD
FT                   AAEALALDRLTLGPDEIRPASDMPDEILCPSAVPQPRRFAIKGGGSTVLCIRPGRGLEQ
FT                   ARVPRLPATEMALLARQPRAEAQDGRYVQVGAFLDPANARSVRQSLAALGLPAAVAEGG
FT                   ALEIVLAGPFNEEASARAALRRLRGTGFRDAFLR"
FT   sig_peptide     274084..274143
FT                   /locus_tag="Rsph17029_0252"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.951 at
FT                   residue 20"
FT   gene            complement(275178..276197)
FT                   /locus_tag="Rsph17029_0253"
FT   CDS_pept        complement(275178..276197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75372"
FT                   /db_xref="GOA:A3PGA6"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGA6"
FT                   /protein_id="ABN75372.1"
FT                   /translation="MTALKKYQKLECTGLWRSAPDAQRREVVVNFGEASLTMSDPATEL
FT                   ALSHWSLPAVERLNPGEQPALYAPGEDSDETLEIEDGDMIAALGTVREALGSTRPRPGR
FT                   LRGSVLGGLAVVLLCLGIFWLPGALVDHTAAVVPPATRAEIGRLALADMIRVTGKPCAA
FT                   PLGRRAADRLARRLFGNERMTILVVREGVRRPVHLPNRQIIFPRSMVEAADGPEVLAGY
FT                   ALAEQLRARLQDPLIPVLEHAGLAATFRLLATGELPQDSVDGYAAQLLQGTPALLTDEA
FT                   LATRFGEAGVSATPYAFAVDPTGESMLGLVEADELGGSEDKPVLTDEDWVSLQGICTD"
FT   gene            complement(276278..277927)
FT                   /locus_tag="Rsph17029_0254"
FT   CDS_pept        complement(276278..277927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0254"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rsp:RSP_1599 AMP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75373"
FT                   /db_xref="GOA:A3PGA7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGA7"
FT                   /protein_id="ABN75373.1"
FT                   /translation="MGWLADERGLEKCAANYAALTPLSHLKRAAEVHTDRTALVNGSIR
FT                   LTYGEYHARVSRLASALAGMGIQPGDVVATLLPNIAAHAEAHFGVPACGAILNAINTRL
FT                   DLDTVSYILEHGGAKLLLCDTAFLKLAKDACARLEGKAPILVEVCDREAGFSPSGEVLE
FT                   YEDLMDRGNPWAPWVMPEDEWESIALNYTSGTTGRPKGVVYHHRGAYLSTYGNAIAWRM
FT                   QLYPVYLTIVPLFHCNGWCHTWMVPMLGGTVVCCRDITAKAIYAAIADEGVTHFGGAPI
FT                   VLNTLINAAPEDRRSFDQVVEVFTAGAPPPAATLAAIEPLGFNVTQVYGLTEVYGPATE
FT                   CIWKPEWDETAGEERAALKARTGVAMATLEGAEVHDTHGQPIPRDTVHLGEIAMRGNMV
FT                   MKGYYKNPEATAEAFRDGWFRSGDIAFQHPDGYIKITDRAKDIIISGGENVSSVEVEGV
FT                   IAHHPAVSLCAVVAKPDERWGEVPCAFVELKRGRQATEEEIIAFARERLAGFKTPKQVI
FT                   FCELPKTSTGKIQKFELRAVAKLAVTETEDAR"
FT   gene            278026..278958
FT                   /locus_tag="Rsph17029_0255"
FT   CDS_pept        278026..278958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0255"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rsp:RSP_1600 possible transporter, DME
FT                   family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75374"
FT                   /db_xref="GOA:A3PGA8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGA8"
FT                   /protein_id="ABN75374.1"
FT                   /translation="MISQDRTRAAAGFILLYAVVIGFTDNYVRVIADEAGLWQFHLTRS
FT                   VMALAILAAVAPALGLRLRPVDWRAVAARSAIHGTAMLIYFGALAFLPVAQVAAGLFTA
FT                   PIFVLVISRFVYGERIGPVRVLAVLTGFAGVLLVLGPEAMAGASFAAGLPVLAGLLYGM
FT                   GNIATRAWCPQESAGTLLGGFFVALGVLGAAGLAVLALVSPPVPAGPDGFVMRGFVVPS
FT                   QDFWFWTFVQAAGSLFAVGMMIRAYQAATASRVSVFEYVILPASAIWGWLLWDERLSPV
FT                   AAAGMALIALAGIAIAVGSRPPAATATPA"
FT   gene            complement(278962..279591)
FT                   /locus_tag="Rsph17029_0256"
FT   CDS_pept        complement(278962..279591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0256"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: rsp:RSP_1601
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75375"
FT                   /db_xref="GOA:A3PGA9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGA9"
FT                   /protein_id="ABN75375.1"
FT                   /translation="MAQHHGHLGAVYDAAGPQEVAALYDRWAETYESEMARAGYRHPAI
FT                   GVALLARHLPRGARPLLDAGAGTGLLGEWLEIVGYPEVEALDISAGMLEVARAKGIYAR
FT                   CHNLPLGAALPFRDGAFAGIISTGVFTTGHVGAEALPELLRICRPGGVIVLTVKESLWQ
FT                   GGFAVSLEAAVASGRAGLAEMTEPYVSMPGEPGTTPSRAVALRVTP"
FT   gene            complement(279765..281036)
FT                   /locus_tag="Rsph17029_0257"
FT   CDS_pept        complement(279765..281036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0257"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: rsp:RSP_1602 TRAP-T family
FT                   transporter, DctM (12TMs) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75376"
FT                   /db_xref="GOA:A3PGB0"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGB0"
FT                   /protein_id="ABN75376.1"
FT                   /translation="MTWFIVIALMFALFALNMRIYLAMFAAVVAYFVFFSTVPLPIAVQ
FT                   RIISPTQNTSLLAIPFFVLLGTLLGTTGIAGRLLKLADLMVGRLTGGLGHTNVMLSTLM
FT                   GGISASNLADAAMMCRILVPEMRRQGYSAGAAAAITACGSLITPIIPPGIALIIYALVA
FT                   DVSIGAMFTAGILPGLMCAALLIFAVWLNARSRGLKPSRDSWPTAQETRQTIIGAWPAL
FT                   FLVLVIVGGIRLSIFTPTEAGAVATIVTLAIGLFLYREMKLADVGAAFAETARQTSAVL
FT                   LVIMTSSALAWIFSMERAGITMAELITNLTTNPWLFLLAVNLMLLVLGMFIEGTALMII
FT                   LVPLLKPVVQQLGIDPVHFGIVLILNLSIGTLTPPVGTVLLLVTNLTGAKLAEFLRDGW
FT                   PFLLALVVALLLVTFVPAISLALV"
FT   sig_peptide     complement(280965..281036)
FT                   /locus_tag="Rsph17029_0257"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.735) with cleavage site probability 0.401 at
FT                   residue 24"
FT   gene            complement(281061..281546)
FT                   /locus_tag="Rsph17029_0258"
FT   CDS_pept        complement(281061..281546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0258"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component; KEGG: rsp:RSP_1604 TRAP-T
FT                   family transporter, DctQ (4TMs) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75377"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGB1"
FT                   /protein_id="ABN75377.1"
FT                   /translation="MRLIFLAASAFGALSVAILVVMTAAAVVARYILGMPIAWTEEVSG
FT                   LLMIWIVMVGAIACEANRQHLTIDLIEGVLSPRLNRALSAVVGLASIGLLIFMSWQAWA
FT                   LGQTTAFKKTQILGVSWFWLDLAVVVGAAGTAIVMAWRLIRPDAEARSDAAADRLEH"
FT   sig_peptide     complement(281466..281546)
FT                   /locus_tag="Rsph17029_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.531 at
FT                   residue 27"
FT   gene            complement(281616..282590)
FT                   /locus_tag="Rsph17029_0259"
FT   CDS_pept        complement(281616..282590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0259"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: rsp:RSP_1605 TRAP-T family transporter, periplasmic
FT                   binding protein, DctP"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75378"
FT                   /db_xref="GOA:A3PGB2"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGB2"
FT                   /protein_id="ABN75378.1"
FT                   /translation="MKLKSLALAALLGAAAVLPAAAQEVVVRVAYENNPGEPTDLVMNR
FT                   WAELVKEASDGNVALELYPSSQLGAKQDVIEQGLLGVNVITIADVGFLTDYDPDLGILF
FT                   APYLTDSPEQLFKIYESDWFKEKEAALREKGVHIVISNYLYGTRQLLAKKKVEKPEDLA
FT                   GMKIRVPNNIMQIKAFELMGATPTPMPLGDVYPALTQGVIDGVENPLPVLYGGKFHEQA
FT                   KELSMISYLTNTSLWLGGEAYFSTLDPEVVTMLHETGYQAGLYSQELAAQEEAKMLEAM
FT                   KEASVTVTEPDVEAFREKTKAFYTMFPEWSEGLYEQIQAALAE"
FT   sig_peptide     complement(282522..282590)
FT                   /locus_tag="Rsph17029_0259"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            complement(282614..283315)
FT                   /locus_tag="Rsph17029_0260"
FT   CDS_pept        complement(282614..283315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0260"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: rsp:RSP_1606 putative regulatory protein,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75379"
FT                   /db_xref="GOA:A3PGB3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGB3"
FT                   /protein_id="ABN75379.1"
FT                   /translation="MAGQSAVEDIRETLRREIVERMEVGDLLPNERELAERFGVARNTV
FT                   RETMIHLEAFGLIEKTRRGARVRQPDFDPIFSVFAQHFDHSGKTLGDVLNFRRIVETGA
FT                   APLAVQGATPETLTRMAEANERMVRSLTVSASAASDYDFHMAMIEATGNTVLIRMYRVL
FT                   SVPLKFYLEVGKSRSLETEESNAQHMRIIEALRARDAAELTAALNAHFDHSGAVLASAS
FT                   ARLAAQAAPAS"
FT   gene            complement(283428..284330)
FT                   /locus_tag="Rsph17029_0261"
FT   CDS_pept        complement(283428..284330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0261"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: rsp:RSP_1607 putative regulatory protein,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75380"
FT                   /db_xref="GOA:A3PGB4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGB4"
FT                   /protein_id="ABN75380.1"
FT                   /translation="MARDRNLFKMLVNRLLDRLARLPVGAELGSEGELAAELQASRTTV
FT                   RAVLTHLAEAGLLSWEGRRKVVLRAPSPSDRFDEGETRPRQELVEEPFLAWVLQGDLPP
FT                   GTLLHESDLARRLGVPVATVREFLIRFEPFGLIEKQPNRHWVLKGFTRAFAEEMFAVRE
FT                   MFERHALRGLLAAAAPGGPLRADLESLRAEHEALSAGPEEELTAFPALDARFHRLLCRA
FT                   AHNRFILDFSRTISIIVHFHYRWNKRDELRRNRAALNEHLAIIKAVLAGDAPRAAAALD
FT                   AHLATAYRTLMTSVTWADA"
FT   gene            284471..285454
FT                   /locus_tag="Rsph17029_0262"
FT   CDS_pept        284471..285454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0262"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rsp:RSP_1608 putative Zn-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75381"
FT                   /db_xref="GOA:A3PGB5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGB5"
FT                   /protein_id="ABN75381.1"
FT                   /translation="MKALVCVEPGRFEQQDRPRPEAKPGHIRIRILQVGICGTDYHIYG
FT                   GHQPFLAYPRIMGHELSGRAMEASADGRIAEGDLVVINPYLTCGTCRACRAGKPNCCEN
FT                   IAVLGVHTDGGMCEEIVVPEGNVYGAEGLTEQSAAMVEFLAIGAHGVRRGGVRAGSAAL
FT                   VVGAGPIGIGAALFAAIEGAAVTLRDTSASRLALAQKVLPEARIELVGEEAAEVYDTVF
FT                   DATGNIRAMNAGLQYVGHGGAYVLLSVVKGDLSFADPEFHKREATLFASRNALKKDFEH
FT                   VIAQIRNGRVPVEALATHATSFEDAVTNLPLWAEDRGTLIKAIIRV"
FT   gene            285447..286547
FT                   /locus_tag="Rsph17029_0263"
FT   CDS_pept        285447..286547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0263"
FT                   /product="Mannitol dehydrogenase, C-terminal domain"
FT                   /note="PFAM: Mannitol dehydrogenase, C-terminal domain;
FT                   KEGG: rsp:RSP_1609 putative altronate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75382"
FT                   /db_xref="GOA:A3PGB6"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGB6"
FT                   /protein_id="ABN75382.1"
FT                   /translation="MSDIRTPVLQFGTSRFLQAHADLFFSEAAEPRAVTVVQSSGDPAR
FT                   AARLGALAAPEGFPVVIRGLTDGVASETETRVTSVKRTLSTATDWSALTAIFCSEVELV
FT                   ISNTGDAGYQPGPADFDADFSQEMSFPAKLFQLLAARFAAGARPLTIMPMELVPENGRV
FT                   LRDRLLAIGTGNRAPAALMDWIAGLPFANSLVDRIVSEPLEPAGAVAEPYALWAIERAP
FT                   RIAAPCAHPAVQLVDDLEEIERLKLHVLNLGHTSLVDFWKRRGGAPDALVRELMDGPEG
FT                   RALLELYETEVLPGFAHKGRGDEARAYLEVTLDRFRNPFLDHRIADIAQNHPQKAERRI
FT                   GAFLDWVGRSGPDMPDLHAILKRARE"
FT   gene            286544..288046
FT                   /locus_tag="Rsph17029_0264"
FT   CDS_pept        286544..288046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0264"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein; SAF domain; KEGG: rsp:RSP_1610 altronate
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75383"
FT                   /db_xref="GOA:A3PGB7"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGB7"
FT                   /protein_id="ABN75383.1"
FT                   /translation="MTASRPAFMHLSPADTVGIALRALSAGEEALGVTLAADVPLGHKF
FT                   AVTAMPAGAAVVKYGQVMGVATADIAPGDHVHSHNCAMSDSHSDRSDAKGTLHAAPARQ
FT                   TFEGYLRPDGRVGTRNYIGIMASVNCSSTVCNAIADAANRTLLPRFPGIDGFAPIVHDQ
FT                   GCGMASAGEGFDALVRVLKGYRDHPNFGGVLIVGLGCEVNQLTLYKRTDWTEERIGIFN
FT                   IQDVGGSASAVRRALELLEPICAAANEDRRSAQPVSKLVLGMQCGGSDGFSGITANPAL
FT                   GVASDMLVAAGGTSILSETPEIYGAEHLLIARADAETGRKIEGMIDWWRDYAAKNGASL
FT                   DNNPSPGNKRGGLTTILEKSLGAVAKGGLSPLSGAFAYAEPIRIPGFVYMDSPGYDPVA
FT                   ATGQVASGANLIAFTTGRGSCFGAKPAPSIKLTSNSDLARRMPEDMDIDCGVVIEEGVS
FT                   LEEMGRRIYDLLLDTASGKKSKSEEFGYGDNEFVPWKIGATL"
FT   gene            288123..289916
FT                   /locus_tag="Rsph17029_0265"
FT   CDS_pept        288123..289916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0265"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: rsp:RSP_1611 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75384"
FT                   /db_xref="GOA:A3PGB8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGB8"
FT                   /protein_id="ABN75384.1"
FT                   /translation="MAHPASHPVRRSPGSRLAGILLLAATLALSLATYQGVRYASLAGL
FT                   DTELQDRLTVARHAVVSEIERFRYLPGLVGQDARVTGLLEGQASAEAANGYLRRVRDLS
FT                   GVDEIYVIDPSGTTRAASNWNEPGSFLGQNYGFRPYFRRALAEGEARYYAVGVTTGKPG
FT                   YFLASRLGPADRPLGVAVAKVDLAGLQSTWVRAGEAVALADPLGVVFLAGPQGWLYRPL
FT                   APLDPQSRALLRAERRYAGLAVDEAQPLGPEMATDAGLALRVADAAIAPDDWRLLVGLP
FT                   TAPALATARLSALIVALAGLLASAGLLALHERRQLLRERLNQHALLERAVAERTEALAH
FT                   EIEERRRAEHELRETHEHLVHAAKLAVLGRMSSTIVHEVSQPLSALEATLAAAELHLGR
FT                   ENPERALRSVRSGRDLLLRMQKMVKALKSFGSRQRLDPPEPVDMGTVLAAAAEVLAPRL
FT                   RELGVALDLPPAEVLPPVRGHAVRLEQVATNLILNAAEATASGGGRDPVEVRLEPLAEG
FT                   LRLTIADRGPGIPEALREKILEPFFSTRTTGLGLGLSIVRTMLEQMAGSLSFAERPGGG
FT                   TLTQVDLALYEPGREALRRRA"
FT   sig_peptide     288123..288221
FT                   /locus_tag="Rsph17029_0265"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.858) with cleavage site probability 0.225 at
FT                   residue 33"
FT   gene            289913..291232
FT                   /locus_tag="Rsph17029_0266"
FT   CDS_pept        289913..291232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0266"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; SMART: AAA ATPase; KEGG: rsp:RSP_1612 sigma-54
FT                   dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75385"
FT                   /db_xref="GOA:A3PGB9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGB9"
FT                   /protein_id="ABN75385.1"
FT                   /translation="MTRGSIAFIDDEPQLCAAAADWLEASGFEVETFTDAGLALGRIEP
FT                   ARCDCVVTDLRMPGLDGQEVLARLRAADPDLPVILLSGHGDVPVAVEAMRMGAHDFLEK
FT                   PYGAEHLVEVLDRAVELRRVRREARTSRRSDLASARIEGRLVGASPAIAALRRTVQDLS
FT                   DVAVDLLIRGETGSGKEELARTFHDFSRRARRPFVAIHCAGLPEAQFEAELFGHERGYL
FT                   AGTAAARIGKLEHASGGTVFFNEIEAMPLSLQSRLLRAMQERGVERLGSNALRPVDLRI
FT                   MAATRVDLLAEVAAGRFRADLYYRLSPVTLDLPPLRERSEDIPLLFLRFAEEAAARFGR
FT                   PVPALREADLRALRGESWPGNVGELKAAAERAVLGMRPPAITAEPETLPLPERMARIEA
FT                   GLIAEALEECGGSSALAADRLGIPRRTLNEKIARYGLRAS"
FT   gene            291443..292396
FT                   /locus_tag="Rsph17029_0267"
FT   CDS_pept        291443..292396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0267"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: rsp:RSP_1613 TRAP-T family transporter, DctP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75386"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGC0"
FT                   /protein_id="ABN75386.1"
FT                   /translation="MFRRTTLSAAAAAAVLSLQPQVAAAQEFINVLTGGTSGVYYPLGV
FT                   GLSEIYAENIEGARTQVQATKASVENLNLLAQRKGELAFALGDSVTLAWEGNEEAGFPR
FT                   PLKNLRAIAAIYPNYIQIVADAASGVTTLEDLKGKTLSVGAPASGTELNARAIFGAAGM
FT                   SYEDLAKVEYLPYAESAELIKNRQLQATLQSSGLGVAFIKDLSSTHDINLVSIPAEVVE
FT                   KIGAPYQPAVIPAGTYSGQDADVPTAAVGNLLVTHEDVSEETAYQMTKLMFENLDRLKS
FT                   AHAAAGNIKPETAIEALPIPLHPGAEKYYREIGLIQ"
FT   sig_peptide     291443..291520
FT                   /locus_tag="Rsph17029_0267"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.890 at
FT                   residue 26"
FT   gene            292500..293594
FT                   /locus_tag="Rsph17029_0268"
FT   CDS_pept        292500..293594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0268"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="TIGRFAM: TRAP transporter, 4TM/12TM fusion protein;
FT                   PFAM: TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: rsp:RSP_1614 TRAP-T family transporter with
FT                   fused DctQ/DctM subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75387"
FT                   /db_xref="GOA:A3PGC1"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGC1"
FT                   /protein_id="ABN75387.1"
FT                   /translation="MSAPSAAPGPASSAVHAPDVHEEVTEGLPPGFGPGIMGKVAFWIA
FT                   VAFSLFQLWTAGYGTLPSQVVRAMHVGFLLLLGFGLVGNLLARTAVTRAIFWGLGLIGF
FT                   GTGIYNWVLYEELIRRTGFLTHADLVVGTVLVVLVFEASRRLMGWPLAIIAGLFLAYCF
FT                   LGQHMPPPFIHRGYDFEQIVEHFAFGTEGIYGTPIYVSSAYIFIFVVFAAFLERAGMLN
FT                   LFNDFALGLVGGVRGGPAQVAVLSSALMGTISGSGVANVVASGQFTIPMMKRFGFKPAF
FT                   AGGVEATASMGGQIMPPVMGAVAFIMAETLNVPYAAVVQAAILPAVLYFGVVFWMVWLQ
FT                   AGRDGLRGLPRSELPNPWHAVRDQ"
FT   gene            293667..294617
FT                   /locus_tag="Rsph17029_0269"
FT   CDS_pept        293667..294617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0269"
FT                   /product="TRAP C4-dicarboxylate transport system permease
FT                   DctM subunit"
FT                   /note="PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: rsp:RSP_1614 TRAP-T family
FT                   transporter with fused DctQ/DctM subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75388"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGC2"
FT                   /protein_id="ABN75388.1"
FT                   /translation="MGLALVAVLILGTPLAAMIGPMAFRLVFWVALGLASAAFLKLGVN
FT                   FLVLVIGLLVLACALFKGARPTIGILRDALAQGARNALPVGIACAIVGIVIGTLTLTGI
FT                   ASTFIGAIIAIGRDNLFLSLVLTMITCLVLGMGIPTIPNYIITSSLAGPALLDLGVPLL
FT                   VSHMFVFYFGIMADLTPPVALACFAAGPIAKAPGLKISLQAVRLAAAGFVIPFMAVYTP
FT                   SLMLQDGGAIAETWGYPVEVVYIFLKAVLAIGLWGVAVVGQLFGRATMLERALALAAGV
FT                   SLILALPATDEVGFALAVATVLLHWLRVRRAARAA"
FT   sig_peptide     293667..293720
FT                   /locus_tag="Rsph17029_0269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.608) with cleavage site probability 0.363 at
FT                   residue 18"
FT   gene            294614..294982
FT                   /locus_tag="Rsph17029_0270"
FT   CDS_pept        294614..294982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75389"
FT                   /db_xref="InterPro:IPR015001"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGC3"
FT                   /protein_id="ABN75389.1"
FT                   /translation="MSLCVVAGAAVLSLAASSFTLSWTHSVEHVEWWERWEVTEAGLRP
FT                   VEARIQGSGAGMELPPDAWREADGWHYVPRLQPQREVRLAASGMTGGGWRLCAAGRCHD
FT                   LGATATEGIRLWQSADCG"
FT   sig_peptide     294614..294688
FT                   /locus_tag="Rsph17029_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.306 at
FT                   residue 25"
FT   gene            complement(295290..295711)
FT                   /pseudo
FT                   /locus_tag="Rsph17029_0271"
FT   gene            complement(295859..295948)
FT                   /locus_tag="Rsph17029_R0009"
FT                   /note="tRNA-Ser2"
FT   tRNA            complement(295859..295948)
FT                   /locus_tag="Rsph17029_R0009"
FT                   /product="tRNA-Ser"
FT   gene            296073..296789
FT                   /locus_tag="Rsph17029_0272"
FT   CDS_pept        296073..296789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGC4"
FT                   /protein_id="ABN75390.1"
FT                   /translation="MQNPCSLFTACSATSAGARIAMAEDLAKQLRDIAVNGDSLFSRRY
FT                   IRTLERSASRLDALEARLSALAEAEREMRSLEKIEAKFALLKNACDLLSQEIAAARGSE
FT                   RSTSRGLPTKWSDCWAVFLRERCSCTGRDEDRLPSTALISAFREWLLQRGEGDCGPVTA
FT                   SKALAALVPIWRCAETGRSLDRHKAGTTYYRGLAFKPASTSDDGASPRTPAAVNAAEGT
FT                   PSRVRRRRKIGNEAQA"
FT   sig_peptide     296073..296144
FT                   /locus_tag="Rsph17029_0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            297607..297867
FT                   /locus_tag="Rsph17029_0273"
FT   CDS_pept        297607..297867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75391"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGC5"
FT                   /protein_id="ABN75391.1"
FT                   /translation="MGYAERPVRRKAADLPELDRFRFDEMVNGDRKVWGLPAIAQVLGC
FT                   GVDKARRLANDPSTGAPISKKGGQYFALRNRLLAWLVEGDQ"
FT   gene            297943..299121
FT                   /locus_tag="Rsph17029_0274"
FT   CDS_pept        297943..299121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0274"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="TIGRFAM: phage portal protein, HK97 family; PFAM:
FT                   phage portal protein; KEGG: nwi:Nwi_1628 phage portal
FT                   protein, HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75392"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGC6"
FT                   /protein_id="ABN75392.1"
FT                   /translation="MKLWPLTRKSLATPSEDLSAIFGVTPTISGASVTPLEALKVPAVS
FT                   AAVRTISEAAATLDVKVVEIAANGRETDTPAHPILPLLRDRANDWTSGSELIRDLVIDA
FT                   LLTDIGALAWVNRIDGRPVEVIHYRRGVMAVEFDQATGEPRYSLNSTPLRSSDVIHLRE
FT                   PFGRCPVTLAREAIAAAIVMERHAARLFGRGARPSGVLSFPKGMGDEAVKKARIAWRST
FT                   HEGQDAGGATAILYDGATFQPLTLASTDAQFLENRKFQITEIARAFNIPAPMIGDLERA
FT                   TWGNAEQKAKEFLSYCLEPRLKALEGALGRALLTEEERGRFAIRFDRDDISRADLATRS
FT                   TTINSLITSQVLNPNEGRAWLGMEPRQGGDEFRNPNITAASEPPQQEPPNAE"
FT   gene            299111..299506
FT                   /locus_tag="Rsph17029_0275"
FT   CDS_pept        299111..299506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_1627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75393"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGC7"
FT                   /protein_id="ABN75393.1"
FT                   /translation="MLNDLSAILADAEDQERGVWFDLLDPVTGTATGMRVRVAGPDSRT
FT                   QAKARLALADELAEAADMEGRVSAEARERARVNSLARCVLGWEITQDGELVPFTHANVV
FT                   RLLRAATWVEAQIDAYAADRRAHRGGR"
FT   gene            299506..300012
FT                   /locus_tag="Rsph17029_0276"
FT   CDS_pept        299506..300012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0276"
FT                   /product="phage prohead protease, HK97 family"
FT                   /note="TIGRFAM: phage prohead protease, HK97 family; PFAM:
FT                   peptidase U35, phage prohead HK97; KEGG: nha:Nham_2490
FT                   peptidase U35, phage prohead HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75394"
FT                   /db_xref="GOA:A3PGC8"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGC8"
FT                   /protein_id="ABN75394.1"
FT                   /translation="MERAFLETKILADAAGAISGVAWKFATADRIGDMVEKGAFAGVSL
FT                   PLPMLFGHDMSDPIGVWDAASEKADGLHLSGRLLVDELPRAREVRALVQAGAVRGISIG
FT                   FVTKKAAPRAGGGRTIKALELVEASLVVVPMHPGARVTSAKDAVSALRLAEALQRATAQ
FT                   LAARK"
FT   gene            300012..301169
FT                   /locus_tag="Rsph17029_0277"
FT   CDS_pept        300012..301169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0277"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="TIGRFAM: phage major capsid protein, HK97 family;
FT                   PFAM: phage major capsid protein, HK97; KEGG: nwi:Nwi_1625
FT                   phage major capsid protein, HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75395"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGC9"
FT                   /protein_id="ABN75395.1"
FT                   /translation="MRHMTKDQLLGSTKLDRKGEEDDPAGIVTKALEDLSKTLNERIGD
FT                   LEKKADTSPLVARLDKLEAKVNRPGTTEPKPEAEVERKAFGAYLRSGPAAPAEELKALT
FT                   VSSDPQGGYLAPAEMSTEFIRDLVEFSPVRGVAAIRGTAAPSVIYPTRTGITNAKWKGE
FT                   TQAQEASEPGFGQAEVVVKEVNTYVDISNQLLADSAGQAEAEVRLALAEDFGQKEGLAF
FT                   VSGDGVLAPEGFMNAAGISYTANGHATDLKADALITMLYAIPATHRNRGAWAMNGTTLG
FT                   VLRKLKDGQGNFLWQPSYQAGQPETILGRPVVEMVDMPDLESGSFPIAYADWSGYRIVD
FT                   RTSLSILVNPYIKATEGLTRIHATRRVGGRVLQPAKFRKLKMATS"
FT   gene            301182..301559
FT                   /locus_tag="Rsph17029_0278"
FT   CDS_pept        301182..301559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75396"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGD0"
FT                   /protein_id="ABN75396.1"
FT                   /translation="MRDMYSNIKAVAALAPAIQSAAANGATIDLLGVSAAAFVVNTGAI
FT                   VSSGDFGVKLQESDDGTSWGDVAAGSVKSDAPATLEASKSYRLGYTGHKRYARVALTKA
FT                   GGTSIAAGAVAILNPLDKPVA"
FT   sig_peptide     301182..301259
FT                   /locus_tag="Rsph17029_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.930 at
FT                   residue 26"
FT   gene            301562..301921
FT                   /locus_tag="Rsph17029_0279"
FT   CDS_pept        301562..301921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0279"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   rsp:RSP_2355 HNH nuclease / probable phage PHI-105
FT                   holin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75397"
FT                   /db_xref="GOA:A3PGD1"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGD1"
FT                   /protein_id="ABN75397.1"
FT                   /translation="MPGKPPRICGCGRKVPAGLRCECQAKADAERKARFDRTRPSSSAR
FT                   GYTSKWERARAEFLAAHPFCRRCGAPATVVDHVKPHRGDAALFWDRKNWQALCVNHHSS
FT                   AKQSEERRAARGQRK"
FT   gene            301918..302391
FT                   /locus_tag="Rsph17029_0280"
FT   CDS_pept        301918..302391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_1894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75398"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGD2"
FT                   /protein_id="ABN75398.1"
FT                   /translation="MIFATNGAKCYIGGVIADPGADVTETTFASQTWTEIKEVESIGTF
FT                   GDTASEITFESVSQSRTKRLKGTRNAGSMDLVCGIDYADAGQLALIAAEKTIHDYAFRI
FT                   VFNDAPAGGTPSERLFIAKVGSAAEAMDTANAVMKLNASLWINSNIVRINAEA"
FT   gene            302396..302824
FT                   /locus_tag="Rsph17029_0281"
FT   CDS_pept        302396..302824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75399"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGD3"
FT                   /protein_id="ABN75399.1"
FT                   /translation="MLLPTAGGRLFISALPVLSWTEVAHVEALGTVGIEWDTENANGFS
FT                   NNELGQAVRVFKTTIRPSVMQIVMGIEAADPGQLLVWQAVRSYDEYAFRLTFPGVAAAR
FT                   NWRGLVTAFREIFDTANSVIRLQADVHVASYDREATAP"
FT   gene            302821..303135
FT                   /locus_tag="Rsph17029_0282"
FT   CDS_pept        302821..303135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0282"
FT                   /product="putative phage protein"
FT                   /note="KEGG: nwi:Nwi_1622 uncharacterized phage protein
FT                   (possible DNA packaging)"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75400"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGD4"
FT                   /protein_id="ABN75400.1"
FT                   /translation="MTTAITLDELKAQLSFTDDIGATDDALLELKLKAAQNHIERLLGY
FT                   KIAETFGGAGQDPVPPSLVEAILQLAAWWYENREAAGPGAREVPFGVREIVAEYREWSF
FT                   "
FT   gene            303135..303548
FT                   /locus_tag="Rsph17029_0283"
FT   CDS_pept        303135..303548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0283"
FT                   /product="phage protein, HK97 gp10 family"
FT                   /note="TIGRFAM: phage protein, HK97 gp10 family; PFAM:
FT                   TP901-1 ORF40 family protein; KEGG: nwi:Nwi_1621 phage
FT                   protein, HK97, GP10"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75401"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGD5"
FT                   /protein_id="ABN75401.1"
FT                   /translation="MADDGGLGKFQRRMQAIPKAAREAVRPALVKQAEQMAATMRAITP
FT                   KDTGDLAGSIAVTGPGEATPAYSQPGGSMMVGENQAAVTVGNSDVRYAHLVEYGTTKNE
FT                   AKPFFWPAVRLHRAKAAAAIKRAVAKAVRETGR"
FT   gene            303545..303958
FT                   /locus_tag="Rsph17029_0284"
FT   CDS_pept        303545..303958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_1620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75402"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGD6"
FT                   /protein_id="ABN75402.1"
FT                   /translation="MSAELAVQVALRQRLALDAGVTALVPAGNILDVNQRPAPSPSIIL
FT                   GESQAVDEGDSIARNRQRIYHTVHVWQKEPSLQGVKRICGEIRRAIHADRLLLAAGFHA
FT                   ADARVADMRQMRDPDGLTSHGVVTVEVLVQEVA"
FT   gene            303958..304281
FT                   /locus_tag="Rsph17029_0285"
FT   CDS_pept        303958..304281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0285"
FT                   /product="phage head-tail adaptor, putative"
FT                   /note="PFAM: phage head-tail adaptor, putative; KEGG:
FT                   nwi:Nwi_1619 phage head-tail adaptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75403"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGD7"
FT                   /protein_id="ABN75403.1"
FT                   /translation="MQAGKLARVIEIEGATFATDDFGTPIPTWSRKAILRAEIVTAEAS
FT                   EFIRGWGVSEETAIVFRTRFLDGITMSDRVSFDGQHFNIKGVVPIGRRKGLELRCVAVD
FT                   GGS"
FT   gene            304281..304715
FT                   /locus_tag="Rsph17029_0286"
FT   CDS_pept        304281..304715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0286"
FT                   /product="phage terminase, small subunit, putative, P27
FT                   family"
FT                   /note="TIGRFAM: phage terminase, small subunit, putative,
FT                   P27 family; PFAM: phage terminase, small subunit, putative,
FT                   P27; KEGG: nwi:Nwi_1473 phage terminase, small subunit,
FT                   putative, P27"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75404"
FT                   /db_xref="InterPro:IPR006448"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGD8"
FT                   /protein_id="ABN75404.1"
FT                   /translation="MRGTKPHIRIEREPLGDRPPPAWLSEDAKAEWTRIVPILAERKIL
FT                   TEADLGSLENYCLAMGTVREMEREIQRCGAIQKVYKVDKDGNSCLVSMRKNPAVAIQSE
FT                   AMNRARLLAAEIGATPVSRSRPSVDEGDDDDGLFDWAGAS"
FT   gene            304712..306319
FT                   /locus_tag="Rsph17029_0287"
FT   CDS_pept        304712..306319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0287"
FT                   /product="phage Terminase"
FT                   /note="PFAM: phage Terminase; KEGG: nwi:Nwi_1472 phage
FT                   terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75405"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGD9"
FT                   /protein_id="ABN75405.1"
FT                   /translation="MIVPGWIQDGSEIADPLGYGERAVRFLKMLKHPKNRAPGRPFQLD
FT                   PWQERIVRRIYGPRHSDGTRIVRRVVLLLPRGNRKTALCAALTLLHLIGPEREPGGLIV
FT                   SAASAHEQAMELFNEAALIVQNDQRLAKRLSVREYVSKISFKDMGTRYIAVASDGKVQH
FT                   GKTPNVVIADELHAWEGRAGLRQWEALDSALVKVPGTLMIVASTSGRGQENLAWQTVDY
FT                   AIKVQKGEIDDPATLPVIFMAEPEDDWTDEDLWRLVNPGLAHGYPDIEGFRDKARKAVH
FT                   SPFERDSFLQFNLNRWLDQTTSPFVEMHVYDEGAHEVDLEELEMVQAPCWLGVDLSKNE
FT                   DLTCVVAAWQDGQDGYQAHPWFFCPEDNLRARGERHGVDYVSWAEEGFIIPTPGNTVDL
FT                   RAVEAHIRELCARFNVREIAFDPTYGRAMMANLTEDALPAVEFRQGWVTMAPAVKELER
FT                   AIIGRRFRHGGHPVLRWNFGNVQMHIDQAGNRSFHKGKSGNKIDGAVATAMAVARAAAG
FT                   EEQFTTSASWFTDDMWTA"
FT   gene            306330..308675
FT                   /locus_tag="Rsph17029_0288"
FT   CDS_pept        306330..308675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75406"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGE0"
FT                   /protein_id="ABN75406.1"
FT                   /translation="MAGDQERLVVLLEARVRDFEKNFQRAEQRGTRSYNRLRRDSRSAT
FT                   QAMEQDMVRSTARINQALASTSARMGTFGKAFIGGLAGGVITAAFAGISSSITDTVRSV
FT                   AQLGDEAKRAGLSAQAFQEWKFVAEQNRIGVDSLVDGFKELSLRADEFIVTGAGPAAEA
FT                   FQRLGLGASALRDGLKDPSELMLEIIRRMEGLDRAAQIRVADEIFGGTGGERFVELLSQ
FT                   GETGLRKTIARAHEAGAVLDAEMIQRAAELDRKFQELTTTAGNFFKAVMVGAAEAAAEA
FT                   IDLRARLDEIFPDRAQADALLGPGVADALAGDRDALEAHAEEVARIRQAYELLGDRASA
FT                   LIPEMQQVAATLEAWGYAEASAELAAVAEETRRLVEGMRDGSITAEEFETGLTGVTTRA
FT                   NAAMAALDEVDRAQFSNVIAGIGGLATALARAVGIARTLRDALPGGSVATSDDERGGDT
FT                   GNVRNAWTGTQNAPKTSPRPQRPGVDSYGDFLGAGASKAGGGGGSAPKSEYAGQVISTR
FT                   EATAALEAEAAALNAAETSMQGYADVAAYASKRAELLVAAQKDGIEITPQLAAEIDRLA
FT                   KDYVKAGHGADEARERHQTFEDALNESKTTMEGAFKGLVTGALSFGDALSTVAAKLADM
FT                   MLSQAFQGLWSGGLGDAVKGLLGGLGFSSGGYTGPGGRLEPAGIVHKGEVVWSQNDVAR
FT                   AGGVAAVEAMRRGARAAAGGPSGGSAGAMGGKSEVHVEVTLSPDLEARILQKAEDRATQ
FT                   ITTAGMNQVDRNIPVRIQQYQRNPDRRW"
FT   gene            308675..309031
FT                   /locus_tag="Rsph17029_0289"
FT   CDS_pept        308675..309031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_1614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75407"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGE1"
FT                   /protein_id="ABN75407.1"
FT                   /translation="MDPMKRLERQLCAALAEVAAGRNPPVPEAGRVLWQAFWQLSRRRT
FT                   YHAAGPNPLSWTEIEAWTRLMRTPFEPHHVRILAALDDAFLDHLDASRGGSSPAMHERS
FT                   GHPLTPELMDALFG"
FT   gene            310583..310933
FT                   /locus_tag="Rsph17029_0290"
FT   CDS_pept        310583..310933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75408"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGE2"
FT                   /protein_id="ABN75408.1"
FT                   /translation="MQTITRRTALAVPLACAGGALAMPPAEETAIMALYRRFCALGAAA
FT                   AAHPSMDDQELDRLFYIEQGEIEDAIMAAPTTTALDLAVKMLVAYDHGQIDCLSHDRHP
FT                   LWIEVRTMVGRA"
FT   sig_peptide     310583..310651
FT                   /locus_tag="Rsph17029_0290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            310936..311286
FT                   /locus_tag="Rsph17029_0291"
FT   CDS_pept        310936..311286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75409"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGE3"
FT                   /protein_id="ABN75409.1"
FT                   /translation="MQTITRRAALAAPLVLAATIPAAEAQPQETPVLRLFREWQALDDV
FT                   LDALPSDISEEVLESMIDDLHALEERLLDTHSQGALDIVAKASVAARFGLSSGTDHDHL
FT                   MWVEARELLGRA"
FT   sig_peptide     310936..311013
FT                   /locus_tag="Rsph17029_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.966 at
FT                   residue 26"
FT   gene            311713..312777
FT                   /locus_tag="Rsph17029_0292"
FT   CDS_pept        311713..312777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0292"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   gox:GOX2318 prophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75410"
FT                   /db_xref="GOA:A3PGE4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGE4"
FT                   /protein_id="ABN75410.1"
FT                   /translation="MPLKLLKRGSVYYLRGTVAGHRVYESTRIGDKRQAEIFRARREAE
FT                   LIERAGSGKALTYTFAEAALCYMQAGGEGRYLDRIIKHFGPRFRIADLDNDAVNRASIA
FT                   LYPNAAPATINRQLVTPISAVYSLAADDGKAPPRRFRRRPEPKALPRWLTPEEAERLLA
FT                   ACDRRLLPLVAFLLGTGCRTGEALGLAVQHLHIETRQAHVGITKNGDGKMVSFPTRTKR
FT                   ILAACGLPEAGAVFRTPKGRPYRLVNGDGQKLGGQIKGAFDAARTAAKLGEDVTPHTLR
FT                   HTFATWHYAVNKDLILLMERGGWKRADLAIGYTKLAPDDLPRRLLDHGWDMRAQSVHGD
FT                   EVSDNFGSKISVLR"
FT   gene            312856..313209
FT                   /pseudo
FT                   /locus_tag="Rsph17029_0293"
FT   gene            complement(313218..313676)
FT                   /locus_tag="Rsph17029_0294"
FT   CDS_pept        complement(313218..313676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75411"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGE5"
FT                   /protein_id="ABN75411.1"
FT                   /translation="MREAGRRQTLDPAQAPAVHERDLDRYDRRGNRRDAVLGCRLDRQE
FT                   PGLLRQAFAPPPELGPPLVDVLPGQVMTTGDIRNPRPIHTNLRQDRPLLRIRPATSPLD
FT                   ARQTLLPHHTIRHRRCQSRQLARRRTKASEGGHNRVLPIRPVLGERRA"
FT   gene            313738..314046
FT                   /pseudo
FT                   /locus_tag="Rsph17029_0295"
FT   gene            complement(314101..314176)
FT                   /locus_tag="Rsph17029_R0010"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(314101..314176)
FT                   /locus_tag="Rsph17029_R0010"
FT                   /product="tRNA-Arg"
FT   gene            314475..315512
FT                   /locus_tag="Rsph17029_0296"
FT   CDS_pept        314475..315512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0296"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: rsp:RSP_1663
FT                   putative transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75412"
FT                   /db_xref="GOA:A3PGE6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGE6"
FT                   /protein_id="ABN75412.1"
FT                   /translation="MAKEPSSALQRRPLTLRDVSDASGVSEMTVSRVLRNRGDVSGATR
FT                   ERVLAAARELGYVPNRIAGALASQRVNLVAVIIPSLSNMVFPEVLTGVSEVLEDTGLQP
FT                   VVGVTNYSPEREEKVLYEMLSWRPSGIIIAGLERSHAARAMLENAGIPIVEIMDVDGTP
FT                   VDNAVGISHRRAGRHMAEAIVAAGYRRIGFLGTMMPYDHRARKRLEGFESALIAAGLTV
FT                   EDREFYSGGSALLKGREMTETILSRSPDLDFLYYSNDLIGAGGLLWCLNHAIEVPEKVG
FT                   LAGFNGVELVQGLPCHLATMDACRLEIGRKAAEIVAGKRADGAMSGLVIELEPKLEPGD
FT                   TIRRR"
FT   gene            complement(315519..315971)
FT                   /locus_tag="Rsph17029_0297"
FT   CDS_pept        complement(315519..315971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0297"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75413"
FT                   /db_xref="GOA:A3PGE7"
FT                   /db_xref="InterPro:IPR021836"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGE7"
FT                   /protein_id="ABN75413.1"
FT                   /translation="MTRTPRSALLLGLAGLLPFLWSALTELRPALGDWAATTLGPRFVG
FT                   PYAGLAYGTVILSFMSGVLWGFATRTSGREAAIGYGLSVIPALWAFFFVGGGPTSAAIY
FT                   LAAGFAGLLALDWTFWSQGLAPEWWMRLRLLLTAVVLACLAVTIFA"
FT   sig_peptide     complement(315903..315971)
FT                   /locus_tag="Rsph17029_0297"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.493 at
FT                   residue 23"
FT   gene            complement(315968..316576)
FT                   /locus_tag="Rsph17029_0298"
FT   CDS_pept        complement(315968..316576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0298"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rsp:RSP_1665 putative RhtB family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75414"
FT                   /db_xref="GOA:A3PGE8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGE8"
FT                   /protein_id="ABN75414.1"
FT                   /translation="MSPEFLLTAFIVCAAPGIGVLYTLSATLGGGIRAGLLAVLGCTLA
FT                   TGVHLVAAMAGLAAVLHASAVLFQGLKIAGVAYLLWMAWATLQEHGGLRLEAAAPEPAA
FT                   RIVRRGILLNLLNPKLPLFFMAFLPQFIPAGSPEAPRLLIELGLGFTAMTAATFLGYVA
FT                   LAALSRGAVLSSPRLVTWLRRLFAASFAGLGARLAFERT"
FT   sig_peptide     complement(316499..316576)
FT                   /locus_tag="Rsph17029_0298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.705) with cleavage site probability 0.602 at
FT                   residue 26"
FT   gene            complement(316587..317546)
FT                   /locus_tag="Rsph17029_0299"
FT   CDS_pept        complement(316587..317546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0299"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.7.4"
FT                   /note="KEGG: rsp:RSP_1666 4-hydroxy-3-methylbut-2-enyl
FT                   diphosphate reductase; TIGRFAM: hydroxymethylbutenyl
FT                   pyrophosphate reductase; PFAM: LytB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75415"
FT                   /db_xref="GOA:A3PGE9"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGE9"
FT                   /protein_id="ABN75415.1"
FT                   /translation="MTMPPLTLYLAAPRGFCAGVDRAIKIVEMALEKWGAPVYVRHEIV
FT                   HNKFVVDRLRDMGAVFVEELDEAPTDRPVIFSAHGVPKAIPAEAERRNMVYVDATCPLV
FT                   SKVHLEAERHHENGLQMIMIGHAGHPETVGTMGQLPEGEVLLVETVEDVAGLEVRDPER
FT                   LAYITQTTLSIDDTAAIVAALRERFPAIAIPRKEDICYATTNRQGAVKAIAGRIDALLV
FT                   IGAPNSSNSKRLVEVGRAAGCRVAQLVQRATDIDWEALQGATSVGVAAGASAPEVLVDE
FT                   VIAAFRARFDTTVKAVETVKERVEFKVPRILREPAETP"
FT   gene            complement(317697..318269)
FT                   /locus_tag="Rsph17029_0300"
FT   CDS_pept        complement(317697..318269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0300"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   rsp:RSP_1667 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75416"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGF0"
FT                   /protein_id="ABN75416.1"
FT                   /translation="MFYKDERLALFIDGSNLYAAAKALGFDIDYKLLRQEFMRRGKLLR
FT                   AFYYTALLENDDYSPIRPLVDWLHYNGFTMVTKPAKEYTDSQGRRKVKGNMDIELTVDA
FT                   MELAPRVDHIVLFSGDGDFRPLVESLQRQGVRVSVVSTIRSQPPMIADELRRQADNFIE
FT                   LDELREVIGRPPREPRVEREEIAVEAK"
FT   gene            318459..318995
FT                   /locus_tag="Rsph17029_0301"
FT   CDS_pept        318459..318995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0301"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK;
FT                   KEGG: rsp:RSP_1668
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75417"
FT                   /db_xref="GOA:A3PGF1"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGF1"
FT                   /protein_id="ABN75417.1"
FT                   /translation="MPSAGRFPEGNVSEAISAVASAFQAPFRVSRLFKTPFFPAGAAPD
FT                   FVNAAMALHLTDDVDPRKILAQLHEIEADFGRSRSHRWADRTLDLDLIALDDSVRPDAD
FT                   TQERWRHLPPEEQARRTPDGLILPHPRLQDRAFVLVPLADVAPEWRHPLLGLTVREMLA
FT                   ALPEAERAAAVPLGA"
FT   gene            319080..319433
FT                   /locus_tag="Rsph17029_0302"
FT   CDS_pept        319080..319433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0302"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: rsp:RSP_1669 DNA-directed
FT                   RNA polymerase omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75418"
FT                   /db_xref="GOA:A3PGF2"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGF2"
FT                   /protein_id="ABN75418.1"
FT                   /translation="MARVTVEDCVDKVPNRFELVMLAAHRAREIASGSSLTIDRDNDKN
FT                   PVVALREIAEETQSAESLRERMIESHQTQIEVDEPEEDQMALLMGSEVDRPVQDDMSEE
FT                   KLLRALMEAQGQN"
FT   gene            319464..321581
FT                   /locus_tag="Rsph17029_0303"
FT   CDS_pept        319464..321581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0303"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: rsp:RSP_1670 RelA/SpoT family protein;
FT                   TIGRFAM: RelA/SpoT family protein; PFAM: amino acid-binding
FT                   ACT domain protein; TGS domain protein; metal-dependent
FT                   phosphohydrolase, HD sub domain; RelA/SpoT domain protein;
FT                   SMART: metal-dependent phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75419"
FT                   /db_xref="GOA:A3PGF3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGF3"
FT                   /protein_id="ABN75419.1"
FT                   /translation="MIDVEDLIALVRNYNPRTNADLIRRAYAYGRQMHEGQFRHSGEPY
FT                   FTHPVAVAAILTEQRLDDATIVTALLHDTIEDTKSTYTEVARLFGEDIAELVNGVTKLT
FT                   NLELSSAQSKQAENFRKLFMAMSKDLRVILVKLADRLHNMRTIKSMRPEKQAQKARETM
FT                   EIFAPLAGRMGMQWMREELEDLAFRVLNPEARNSIIRRFITLQRETGDVVHKITADIRL
FT                   ELEKAQIEADVYGRAKKPYSIWRKMQEKDLAFSRLSDIYGFRVICKDVADCYRILGVIH
FT                   QRWRAVPGRFKDYISQPKSNGYRSIHTTVSGRDGKRVEVQIRTRQMHEVAEAGVAAHWS
FT                   YREGVRVHNPFAVDPARWIASLTERLDEDDHDEFMENVKLEMYTDQVFCFTPKGDVIQL
FT                   PRGATPLDFAYAIHTRIGHSTVSAKVDGIRVPLWTRLKNGQSVEIITAEGQRPQASWID
FT                   IVTTGRAKAAIRRSLREEDRGRFVKLGQELVRAAFDHVGRKATDKALRTAAKMLGLSDE
FT                   TELLAQLGSAELTARKVVETLYPELVRSSGPEVDMQRPVVGLSDDQQFRRAKCCQPVPG
FT                   ERIVGITYRGQGVVIHAIDCPALEEFEEQPSRWIDLHWHAGRHAPVHTVTLDLTISNDA
FT                   GVLGRICTLIGEQKANISDLRFTDRKPDFYRLLVDVDLCDVEHLHTLMTALEAETDVAQ
FT                   ISRHRDLSRKP"
FT   gene            321598..322254
FT                   /locus_tag="Rsph17029_0304"
FT   CDS_pept        321598..322254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1671 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75420"
FT                   /db_xref="GOA:A3PGF4"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGF4"
FT                   /protein_id="ABN75420.1"
FT                   /translation="MVFKRRNPRTWRQIAQESVWPRGGWSRAAQYVKHRLTRLPDEPHR
FT                   IARGVFAGVFISFTPFFGFHLIGGALLGWILRGNILAALLATFVGNPVTMPVIALVSVE
FT                   IGHWMLGIDVPLNIVNIFKAFSDAGTELWANFLAIFSDEPARWSNLGRFFETIYLPYLV
FT                   GGILPGLAVSYGFYHLTIPVIRAYQKLRAMRVQARRARERRRAGAEADDAGAGSQ"
FT   gene            322291..323049
FT                   /locus_tag="Rsph17029_0305"
FT   CDS_pept        322291..323049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0305"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /note="TIGRFAM: pyridoxal phosphate biosynthetic protein
FT                   PdxJ; PFAM: Pyridoxal phosphate biosynthetic protein PdxJ;
FT                   KEGG: rsp:RSP_1672 pyridoxal phosphate biosynthetic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75421"
FT                   /db_xref="GOA:A3PGF5"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGF5"
FT                   /protein_id="ABN75421.1"
FT                   /translation="MKPLGRLRLGVNIDHVATVRNARGTSYPDPLRAGLLAEAAGADGI
FT                   TAHLREDRRHIRDEDITALMQGLRVPLNLEMATTPEMQAIALRHKPHAVCLVPERREER
FT                   TTEGGIDVAGDIGRLKDFVAPLRAAGCRVSMFIGHDVRQIEASAEIGAAVVELHTGHYC
FT                   DLVAEGRTAEAARELEALREGAALAHSLGLEVHAGHGISYDTVAEIAAFPQVMELNIGH
FT                   FLIGEAIFRGLGSAIEGMRRRMDAAREAAA"
FT   gene            323081..323494
FT                   /locus_tag="Rsph17029_0306"
FT   CDS_pept        323081..323494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0306"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="TIGRFAM: holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase; KEGG: rsp:RSP_1673
FT                   4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75422"
FT                   /db_xref="GOA:A3PGF6"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGF6"
FT                   /protein_id="ABN75422.1"
FT                   /translation="MILGIGTDLANIDRMEKTLARFGERFRNRVFTPLEQAKAERRADV
FT                   AGTYAKRWAAKEACSKALGTGLRMGISWKDMSVANLETGQPVMRLTGWAAERLASMTPP
FT                   GHEAVVHVSLTDDHPWAQAFVVIEARPRAAPPA"
FT   gene            323566..324354
FT                   /locus_tag="Rsph17029_0307"
FT   CDS_pept        323566..324354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0307"
FT                   /product="signal peptidase I. Serine peptidase. MEROPS
FT                   family S26A"
FT                   /EC_number="3.4.21.89"
FT                   /note="KEGG: rsp:RSP_1674 type 1 signal peptidase; TIGRFAM:
FT                   signal peptidase I; PFAM: peptidase S24, S26A and S26B"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75423"
FT                   /db_xref="GOA:A3PGF7"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGF7"
FT                   /protein_id="ABN75423.1"
FT                   /translation="MASKAKSEGGILETIKTIVYALLIAGVFRTLFFQPFWIPSGSMKD
FT                   TLLIGDFLFVNKMAYGYSQYSCPFGICPFSGRILGSEPERGDVVVFRHPVNGSDFIKRL
FT                   IGLPGDTVQMRNGVLYLNGQEVPQAPDGTFEETYEQQGPMGNLPRCENGPVGEGGICTK
FT                   SRFTETLPGGRTHDVLNIDTNGFGDNTDVFTVPAGHYFFMGDNRDNSQDSRYGQAVGGV
FT                   GFVPAENLIGRADRIMFSSAGRSMLYFWTWRADRFFKAIE"
FT   gene            324351..325040
FT                   /locus_tag="Rsph17029_0308"
FT   CDS_pept        324351..325040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0308"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein; KEGG: rsp:RSP_1675 ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75424"
FT                   /db_xref="GOA:A3PGF8"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGF8"
FT                   /protein_id="ABN75424.1"
FT                   /translation="MKLSADLKAFEGRIGHQFREPERLLRAVTHSSLSSVTRSDNQRLE
FT                   FLGDRVLGLVMAEALLAADRAASEGQLAPRFNALVRKETCAAVAREVALGDVLKLGRSE
FT                   MMSGGRRKEALLGDALEAVIAAVYLDAGFEAARQLVLRLWGARIAQVERDARDAKTALQ
FT                   EWAQARGLPPPTYEAVDRSGPDHAPIFTVEVRLGNGETDRAAAGTKRVAEQAAARALLA
FT                   RMEARHD"
FT   gene            325033..325947
FT                   /locus_tag="Rsph17029_0309"
FT   CDS_pept        325033..325947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0309"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein, HSR1-related; KH,
FT                   type 2 domain protein; KEGG: rsp:RSP_1676 GTP-binding
FT                   protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75425"
FT                   /db_xref="GOA:A3PGF9"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGF9"
FT                   /protein_id="ABN75425.1"
FT                   /translation="MTETTRAGFVALIGEPNAGKSTLLNRMVGAKVSIVTHKVQTTRAR
FT                   IRGVAMEGQAQIVFVDTPGLFRPRRRLDRAMVAAAWGGAADADVIVLLVEAHRGLTEGT
FT                   QAIIDAMRDRIPQGQTVALAINKIDRVKAEVLLGLAQELNGAFPFAETFMISAEKGHGV
FT                   EKLRRWLAGILPEGPWFYPEDQIADVPMRAIAAEITREKLTLRLHEELPYQLTVETEAW
FT                   EDRPDGSTRIDQVVYVARDGHKGIVLGNKGETIKQIGQAARAEIATFLERPVHLFLQVR
FT                   VRPNWLEEPERYSEMGLDFKDGD"
FT   gene            325969..326304
FT                   /locus_tag="Rsph17029_0310"
FT   CDS_pept        325969..326304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0310"
FT                   /product="protein of unknown function DUF1491"
FT                   /note="PFAM: protein of unknown function DUF1491; KEGG:
FT                   rsp:RSP_1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75426"
FT                   /db_xref="InterPro:IPR009964"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGG0"
FT                   /protein_id="ABN75426.1"
FT                   /translation="MSARLTADFWVRAYLTRLRLADIPAFVTARGDATAGAVLVKCATL
FT                   DGQARAFQRSFDLMTGARAWVPLAEGPEADVDAAIARQRRFDPDLWVIELEDRQGRTLL
FT                   DEPGLSE"
FT   gene            326341..327060
FT                   /locus_tag="Rsph17029_0311"
FT   CDS_pept        326341..327060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0311"
FT                   /product="DNA repair protein RecO"
FT                   /note="TIGRFAM: DNA repair protein RecO; PFAM:
FT                   Recombination protein O, RecO; KEGG: rsp:RSP_1678 DNA
FT                   repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75427"
FT                   /db_xref="GOA:A3PGG1"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGG1"
FT                   /protein_id="ABN75427.1"
FT                   /translation="MMEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRKI
FT                   APILQPGAQLDLTWKARLDEHMGAFTVEPLRSRTALLGDRLGLAGLNAICAMLHVTLPE
FT                   REPHSTLWQESMALLDALDRPGWPPAYLRWEMRLLEETGFGLDLTRCAVTGSREDLAFV
FT                   SPKTGRAVSRGAAGGWADRLFPLPLALLGQGPASAEEVRQGLAITGHFLGRELAPLLNG
FT                   RPLPEARARLMELLARA"
FT   gene            complement(327100..328767)
FT                   /locus_tag="Rsph17029_0312"
FT   CDS_pept        complement(327100..328767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0312"
FT                   /product="Isovaleryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   rsp:RSP_1679 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75428"
FT                   /db_xref="GOA:A3PGG2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGG2"
FT                   /protein_id="ABN75428.1"
FT                   /translation="MPKDGSTMTGEPLLGDLLTLASDALPEVEALFETARSALKERVTT
FT                   DGKVSSKALEEEQFAAHALSWLATYVESLRQMRAWAGRLETEGRFGEMEALILQIAFGE
FT                   YLAQIRGGIPMSQTETARVQDIGIELGHPGEAVRRLIQAGNTPAARARLVALMRDNHGR
FT                   ATFGASGLDEELEMIRDQFRRFADERVAPHAHGWHMRDELIPMEIVEALAEMGVFGLTI
FT                   PEEFGGFGLSKASMVVVSEELSRGYIGVGSLGTRSEIAAELILCGGTDAQKAAWLPKLA
FT                   SGEILPTAVFTEPNTGSDLGSLRTRAVKDGDEWVVNGNKTWITHAARTHVMTLLARTDP
FT                   ETTDYRGLSMFLAEKMPGTDADPFPTPGMTGGEIEVLGYRGMKEYEIGFDGFRVKGENL
FT                   LGGVEGQGFKQLMQTFESARIQTAARAIGVAQNALEVGMQYAEERKQFGKALIEFPRVA
FT                   GKLAMMAVEIMVARQLTYHSAWEKDHGQRCDLEAGMAKLLGARVAWAAADNALQIHGGN
FT                   GFALEYQISRILCDARILNIFEGAAEIQAQVIARRLLD"
FT   gene            complement(329491..331089)
FT                   /locus_tag="Rsph17029_0313"
FT   CDS_pept        complement(329491..331089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0313"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP); KEGG:
FT                   rsp:RSP_1680 phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75429"
FT                   /db_xref="GOA:A3PGG3"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGG3"
FT                   /protein_id="ABN75429.1"
FT                   /translation="MNFGRVNPAQTLDAQGITGLGEVHYNLIEPALVEAAVTRGEGRLG
FT                   RGGAFLCSTGAFTGRSPKDKFVVRTPSVEDTIWWENNAPMDPAAFDRLHADMLEHMKGR
FT                   TYFVQDLFAGADPELRLDVRMVTELAWHGLFIRHMLRRPERAELDSFVPDWTVINCPSF
FT                   KADPERHGCRTDTVIVLNFERKLILIANTEYAGENKKSVFTLLNYILPGKGVMAMHCSA
FT                   NHALGDTDDAAVFFGLSGTGKTTLSADPSRTLIGDDEHGWSDRGTFNFEGGCYAKTINL
FT                   SAEAEPEIYATTSKFATVVENMVYDEETLELDFNDDSLTANTRCAYPLDYISNASESGL
FT                   GGHPKNVIMLTCDAFGVLPPIARLTPAQAMYHFLSGFTSKVAGTERGVTEPQPTFSTCF
FT                   GAPFMPRRPEVYGKLLQEKIAKHGATCWLVNTGWTGGAYGTGKRMPIKATRALLTAALD
FT                   GSLSGVQFRRDPNFGFEVPVDLHGVDAKLLDPRSTWADPAAYDQQAKKLVEMFANNFAQ
FT                   YVPFIDADVKAAAIG"
FT   gene            331428..332129
FT                   /locus_tag="Rsph17029_0314"
FT   CDS_pept        331428..332129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0314"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rsp:RSP_1681 two-component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75430"
FT                   /db_xref="GOA:A3PGG4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGG4"
FT                   /protein_id="ABN75430.1"
FT                   /translation="MSRIALVDDDRNILTSVAMTLEAEGFEVETYNDGQSALEAFNKRM
FT                   PDMAVLDIKMPRMDGMDLLQRLRQKSAMPVIFLTSKDDEIDEVLGLRMGADDYVKKPFS
FT                   QRLLVERIRALLRRQEAIAGGEADAQEESRILERGNLRMDPLRHAVSWKGRDVSLTVTE
FT                   FLLLQALAQRPGFVKSRDQLMDVAYDDQVYVDDRTIDSHIKRLRKKMRAADPDFAAIET
FT                   LYGIGYRYNEE"
FT   gene            332152..333870
FT                   /locus_tag="Rsph17029_0315"
FT   CDS_pept        332152..333870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0315"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: rsp:RSP_1682 two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75431"
FT                   /db_xref="GOA:A3PGG5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGG5"
FT                   /protein_id="ABN75431.1"
FT                   /translation="MTALRIFGRSRADDGASAHRPGDVILGEDWTAPGADGEPGLQKRR
FT                   RRGFVALNRSPLARKIILFNLLALVIQVSGVLFTNPFRENLVLQRERALVSEARLVANV
FT                   FEARLAAVPGATLDAPKGIDIPATLDAVAVDPAVDLFILDTAGVVVASDRGARQPVPED
FT                   RRSTLITDFLNGLWDTVSKTLAWGEAPQGEIDASALARQVFSGAREGRTTINTGRDRNG
FT                   GALFSVATPILDGERVMGVVAITSAAGEIDRLVRYEREQILQMFVVALFVSIGLSLVLA
FT                   STIANPLADLAAAAELGRDRDARKMAPGRVRIPDLTARPDEIGRLSIAMRGMVAALYDR
FT                   IDANEQFAADVAHEIKNPLASLRSAVGTMRLAKREDQREQLLDVIEHDVRRLDRLVSDI
FT                   SNASRLDSELVKEEEEEFDLLPTIANLGDYLGRQAAEKGVDFIADLPSEPMRIRGLEAR
FT                   LAQVFVNLISNALSFCEEGDAVRVWARRRENRVLVVVEDTGPGIPEEALTKIFGRFYSE
FT                   RPPGQFGNHSGLGLAISKQIVEAHGGVIWAENIRPTSADITSEPLGARFVVGLPV"
FT   gene            333867..334295
FT                   /locus_tag="Rsph17029_0316"
FT   CDS_pept        333867..334295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0316"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /note="KEGG: rsp:RSP_1683 putative kinase/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75432"
FT                   /db_xref="GOA:A3PGG6"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGG6"
FT                   /protein_id="ABN75432.1"
FT                   /translation="MTGADRTILHASCVALDGRGLLILGPSGSGKSALALELMALGADL
FT                   VADDRTEIVGQGPDLIARCPPAIAGLIEARGLGILRAPAIHEARVTLAVELGRSETERL
FT                   PHFHEIQVLGRPLDLVLGQEGRHFPSALLLRLRSGRVA"
FT   gene            334317..335225
FT                   /locus_tag="Rsph17029_0317"
FT   CDS_pept        334317..335225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0317"
FT                   /product="Uncharacterized P-loop ATPase protein UPF0042"
FT                   /note="PFAM: Uncharacterised P-loop ATPase protein UPF0042;
FT                   KEGG: rsp:RSP_1684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75433"
FT                   /db_xref="GOA:A3PGG7"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGG7"
FT                   /protein_id="ABN75433.1"
FT                   /translation="MVEPVQEYRLVLVTGPSGAGRTTAINALEDMGYEVIDNLPLSFVP
FT                   RLIEGPSIGRPIALGLDVRNRDFNATALIELIDRLTQDPRVALEVLYVDCSASELIRRY
FT                   NQTRRRHPLAPAETPAEGVEREIDLLAPVRVRADHLIDTSEMSPHDLKAELSRWFDRGA
FT                   ATRLAVSVQSFSYKRGVPRGVDMIFDCRFLKNPYWVESLRTLDGREASVADYISSDPRF
FT                   GPFFEKLRDLVLFLLPAQLEEGKAHLSLGFGCTGGQHRSVAVAELLGNALAEAGWPVSK
FT                   RHRELERRAAAVLPTHQGEKA"
FT   gene            335222..335620
FT                   /locus_tag="Rsph17029_0318"
FT   CDS_pept        335222..335620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0318"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: rsp:RSP_1685 PTS system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75434"
FT                   /db_xref="GOA:A3PGG8"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGG8"
FT                   /protein_id="ABN75434.1"
FT                   /translation="MIGIVIVAHGGLAREYLSAVEHVVGKQEAMAAIAIEDDHDRAAKQ
FT                   AEISAAARSVDRGAGVVVVTDMFGGSPSNLSLPACTARDRRIIYGANLPMLIKLAKSRE
FT                   LTVPEAVSLALDAGRKYINSLDLGSGME"
FT   gene            335617..335886
FT                   /locus_tag="Rsph17029_0319"
FT   CDS_pept        335617..335886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0319"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: rsp:RSP_1686 putative
FT                   phosphocarrier HPr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75435"
FT                   /db_xref="GOA:A3PGG9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGG9"
FT                   /protein_id="ABN75435.1"
FT                   /translation="MIERELLIVNEKGLHARASAKFVEVVERHDAQAEVSKDGMVVSGD
FT                   SIMGLLMLAASRGTSIRIRTMGSEATALAEALSALVADRFGEDM"
FT   gene            336030..337127
FT                   /locus_tag="Rsph17029_0320"
FT   CDS_pept        336030..337127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0320"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: rsp:RSP_1688 possible
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75436"
FT                   /db_xref="GOA:A3PGH0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGH0"
FT                   /protein_id="ABN75436.1"
FT                   /translation="MQRISRVTRVYPGFDLLRILAAGGVVFSHAFLIMELTEAGEPLKA
FT                   ATGTILGLYAVMIFFILSGFLVTDSALRSQGVLDFAAKRARRLLPGFLAANLIVALAIC
FT                   PLFATEGAMAFLGQPATWETLGRVLLLQDPSLTFPGRVSFFPAEGDAAWVAAVANGVLW
FT                   TIRIEITCYLVVGLLLLVGMLTRGAVLALICAAVFATLTPAFYVSDYLNCLIYLGPSFA
FT                   AGMALRLLLPEGHRADGRIAAASAAILGVLMLKMGGWREVEGLLFPLFAAYPLIWFGQQ
FT                   ERARLGALGRFGDPSYGMYLWGWPVQMLLRALVGPGWSGWAFAALSLPAALAAGWLSWI
FT                   LVERRFLRRRPPGASYRVGTGVSPR"
FT   gene            complement(337094..337969)
FT                   /locus_tag="Rsph17029_0321"
FT   CDS_pept        complement(337094..337969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0321"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding;
FT                   KEGG: rsp:RSP_1687 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75437"
FT                   /db_xref="GOA:A3PGH1"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGH1"
FT                   /protein_id="ABN75437.1"
FT                   /translation="MEIRKVGVVGAGQMGSGIAHVFSLAGYEVLLNDISAEGLNKALST
FT                   IERNMERQVSRGKVSAEDKAAALGRIRTTQTLTDIARSDLVIEAATERETVKQAIFEDL
FT                   VPHLLPHTILTSNTSSISITRLASRTDRPEKFMGFHFMNPVPVMQLVELIRGIATDDPT
FT                   YQALLKVVQSLGKTAASAEDFPAFIVNRILVPMINEAVYTLYEGVGSVRSIDESMKLGA
FT                   NHPMGPLELADFIGLDTCLAIMNVLHDGLADTKYRPCPLLVKYVEAGWLGRKTARGFYD
FT                   YRGETPVPTR"
FT   gene            338138..338962
FT                   /locus_tag="Rsph17029_0322"
FT   CDS_pept        338138..338962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75438"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGH2"
FT                   /protein_id="ABN75438.1"
FT                   /translation="MAFAHQGESALEYYPCRYGGSRLMFRGPRRSLDGPFCAVLGGTET
FT                   YGKFVPQPYPALVEEATGLRLVNLACMNAGIDLYLNDPSVTQVASKATLAILQVVGAAN
FT                   LTNRLYSVHPRRNDRFLAASPVLQTIYREVDFADFAFTRHMVQTLHAVSPEKFLQVEAE
FT                   LRAAWVARMRTLLGRISAPTLLLWIADHPPPEGGPLTPDLTPLLIDADMIAAVRPHASH
FT                   YLQIVTSREAQACGTDGMRFAPLDGPVAAELPGPAVHAEIAAALVPVLRELM"
FT   gene            complement(339012..339938)
FT                   /locus_tag="Rsph17029_0323"
FT   CDS_pept        complement(339012..339938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0323"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   electron transfer flavoprotein, alpha subunit; KEGG:
FT                   rsp:RSP_1690 electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75439"
FT                   /db_xref="GOA:A3PGH3"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGH3"
FT                   /protein_id="ABN75439.1"
FT                   /translation="MAVLLIAEVTGGTLGADSTAKALTAAKALGDVTVLVAGTGVDAAA
FT                   AEAATFDGVAKVLAADDAAYGNGLAEPLADLILGLAPGYSHILAPATSAAKNVLPRVAA
FT                   LLDVMVISEITAVVDADTFERPIYAGNAIQTVKSSDATKVATVRTATFEAAGKGGSAPV
FT                   ETISATAGSGLSSWVEDKVAASDRPELTSARIVVSGGRGLGSEENFAMIEQLADKLGAA
FT                   VGASRAAVDSGYAPNDWQVGQTGKVVAPQLYIAVGISGAIQHLAGMKDSKIIVAINKDE
FT                   EAPIFQVADYGLVGDLFSLVPELTGKL"
FT   gene            complement(339938..340699)
FT                   /locus_tag="Rsph17029_0324"
FT   CDS_pept        complement(339938..340699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0324"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   KEGG: rsp:RSP_1691 electron transfer flavoprotein
FT                   beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75440"
FT                   /db_xref="GOA:A3PGH4"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGH4"
FT                   /protein_id="ABN75440.1"
FT                   /translation="MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEA
FT                   AIRLREAGTATEVVVVSIGVKQAQETLRTALAMGADRAILVEAASDVHQDIEPLAVAKI
FT                   LKGVVEAEQPGLVICGKQAIDNDMNATGQMLSALLGWSQATFASDLAIEGDAAVVTREV
FT                   DGGMQTIKVKMPTVVTVDLRMNEPRYASLPNIMKAKKKPLEEKTAADFGVDVTPRLSVV
FT                   KTSEPAGRKAGVMVGSVDELIAKLKDEAGVI"
FT   gene            complement(340830..341408)
FT                   /locus_tag="Rsph17029_0325"
FT   CDS_pept        complement(340830..341408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0325"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP--cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: rsp:RSP_1692
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75441"
FT                   /db_xref="GOA:A3PGH5"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGH5"
FT                   /protein_id="ABN75441.1"
FT                   /translation="MVVLSRIYTRTGDAGETALGNGARVAKHSPRVAAYGSVDETNATV
FT                   GLARLHAQGEMQEALARISNDLFDLGADLCRPEMERDHEADYTPLRIIAAQVNRLEREI
FT                   DGMNARLEPLRSFILPGGSALAAQLHLCRTVSRRAERELVELATAESVNPEALRYLNRL
FT                   SDWFFVAGRIANDDGRADVLWVPGLTREA"
FT   gene            complement(341408..341617)
FT                   /locus_tag="Rsph17029_0326"
FT   CDS_pept        complement(341408..341617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75442"
FT                   /db_xref="GOA:A3PGH6"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGH6"
FT                   /protein_id="ABN75442.1"
FT                   /translation="MLHDPLFIVVALAVLAVLVVLMVGIGGFARGGEFNRKHANRLMRW
FT                   RIIAQAIAIALILLFMAWRQSGGF"
FT   sig_peptide     complement(341522..341617)
FT                   /locus_tag="Rsph17029_0326"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.939 at
FT                   residue 32"
FT   gene            complement(341785..342600)
FT                   /locus_tag="Rsph17029_0327"
FT   CDS_pept        complement(341785..342600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0327"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: rsp:RSP_1694 probable short-chain
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75443"
FT                   /db_xref="GOA:A3PGH7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGH7"
FT                   /protein_id="ABN75443.1"
FT                   /translation="MKSVLITGCSSGIGLDAARGLAARGWRVFATCRQEADCDRLRSEG
FT                   LESFRLDYDDPESLAAAVAETTRRTGGTLDALYNNGAFACPGAVEDLPREALRAVLETN
FT                   VVGVHDLTRRVIPIMRRQGHGRIVNCSSVLGFVAYPWRGAYVASKFAMEGLTDVLRIEM
FT                   ADTPIRVILLEPGPIASRIRENSIPHFERWIDWRASARADQYRTLLGRLYEGGEDRWQL
FT                   PPSAVTERLVQALESPRPRARYRITVPSRTAWVLRRLLPTAALDRVLGR"
FT   gene            complement(342900..343460)
FT                   /locus_tag="Rsph17029_0328"
FT   CDS_pept        complement(342900..343460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0328"
FT                   /product="SH3, type 3 domain protein"
FT                   /note="PFAM: SH3, type 3 domain protein; SMART: SH3 domain
FT                   protein domain protein; KEGG: rsp:RSP_1695 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75444"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGH8"
FT                   /protein_id="ABN75444.1"
FT                   /translation="MLRLTLLLCCTLFAVLLIGGRDTGQMRPGLAAAAKLEPHPRPVVT
FT                   PVETASLEAARTLTVAAEAQPVTMPAPTPVALPATRYRGDRVQVLPLPPRAAETRAPQP
FT                   VLAATMVAETRQPAGEVRHVTADAVNVRSGPSTAYPVVDRVLRGDAVLVDGPQEGSWAP
FT                   IRIEGDGVAGYMAARFLAPGTAF"
FT   sig_peptide     complement(343386..343460)
FT                   /locus_tag="Rsph17029_0328"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.924) with cleavage site probability 0.386 at
FT                   residue 25"
FT   gene            343594..345897
FT                   /locus_tag="Rsph17029_0329"
FT   CDS_pept        343594..345897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0329"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA topoisomerase IV, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: rsp:RSP_1696 DNA
FT                   topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75445"
FT                   /db_xref="GOA:A3PGH9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGH9"
FT                   /protein_id="ABN75445.1"
FT                   /translation="MTDTPEDPTEEPLTTSEPLRRAIGERYLTYALSTIMHRALPDARD
FT                   GLKPVHRRILFAMRELRLSPTGGFRKSAKIAGDVMGNYHPHGDAAIYDAMARLAQDFNV
FT                   RYPLVDGQGNFGNIDGDNPAASRYTEARLTPIAELLMEGLAENAVDFRPNYDGTLEEPV
FT                   VMPAAFPNLLANGASGIAVGMATNIPPHNLDELIEGCLALIRDPAIADDTLVSLIPGPD
FT                   FPTGGVIVEPKEQILEAYRTGRGAFRLRAKWQTEDLGRGTWQIVVTEIPYQVQKSKLIE
FT                   RLAELIQTKKVPALADVRDESADDVRIVLEPRARTVDPEMLMGMLFRNSDLEIRFSLNM
FT                   NVLIDGRTPRVCSLKEVLRAFLDHRRDVLIRRSQHRMEKIDHRLEVLGGLIVAFLNLDR
FT                   VIDIIRYDADPKRALMAESWGRKFKRANSEKDYVGPGPGPGDLSEVQAEAILNMRLRSL
FT                   RRLEEMELLAERDALLAERADLEALIGSERLQWDRIGHDLGEIRKLFGKWTVAGARRTQ
FT                   FAEAGEVEEVPLEAMIEREPITVICSQMGWIRAMKGHQPLDTEAKFKDGDGPRFLFHAE
FT                   TTDRLLLVGSNGRFYTLTGASLPGGRGMGEPVRLMVDLPNEAEIHDIFVWRPAEKLLLA
FT                   SSAGDGFVVPSEEVLAQTRAGKAVLSMKEGVRTAVCRPVRGDHVAVVGENRKLLVFPVS
FT                   ELPEMAKGKGVRLQKYKDGGLSDAITFEIARGLSWKDPAGRTRTETELAEWTAARAGAG
FT                   KMAPRGFPRDNRFT"
FT   gene            346055..346630
FT                   /locus_tag="Rsph17029_0330"
FT   CDS_pept        346055..346630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75446"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGI0"
FT                   /protein_id="ABN75446.1"
FT                   /translation="MILRLAALCLAALFVTACQRNDLKEPPVDLGDFALGLNIVVADHA
FT                   QKVPISREASVEEWEAVMKTAIDDRFGRYEGTKLYNLGVSIDGYALAPPGIPVVAAPKS
FT                   VIAITANIWDDAAGAKLNEKGKKMTVFESLTGGSIVGSGYTMSKDEQMEALAYNAAKRI
FT                   EGWLVAHPEWFGLPPLPPKPAPAPGKDK"
FT   sig_peptide     346055..346108
FT                   /locus_tag="Rsph17029_0330"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.810 at
FT                   residue 18"
FT   gene            346731..347906
FT                   /locus_tag="Rsph17029_0331"
FT   CDS_pept        346731..347906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0331"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   rsp:RSP_1714 elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75447"
FT                   /db_xref="GOA:A3PGI1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGI1"
FT                   /protein_id="ABN75447.1"
FT                   /translation="MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGEFRAYDQI
FT                   DGAPEERARGITISTAHVEYESDTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAA
FT                   DGPMPQTREHILLGRQVGIPYMVVYMNKVDQVDDPELIELVEMEIRELLSSYDYPGDDI
FT                   PIIKGSALAAMNGTDKEIGEDSIRALIAAVDEYIPTPARAVDQPFLMPVEDVFSISGRG
FT                   TVATGRIERGVVKVGEELEIVGIRPSKKTVCTGVEMFRKLLDQGEAGDNVGLLLRGVDR
FT                   DGIERGQVLCKPGSVKPHTKFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVQ
FT                   LPEGTEMVMPGDNLKFNVELIAPIAMEEKLRFAIREGGRTVGAGVVSKIIA"
FT   gene            348074..348718
FT                   /locus_tag="Rsph17029_0332"
FT   CDS_pept        348074..348718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0332"
FT                   /product="putative acetyltransferase"
FT                   /note="KEGG: rsp:RSP_1706 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75448"
FT                   /db_xref="GOA:A3PGI2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGI2"
FT                   /protein_id="ABN75448.1"
FT                   /translation="MPSPLLNAGLRHPMRFADGRANPSMVHLNRVIDHPNIRIGDFTYA
FT                   NDFDPPEDWAARLVPYLYPGAPERLEIGRYGQIAHGVRIITASANHPAGGLTTYPFAIF
FT                   DPASLALSKEALIDLPDTVIGHDVWIGHGALILPGVRLGHGVIVGAGAVVAGDVPDYAV
FT                   VAGNPARILRMRFPPEVVARLLALAWWDWPQERLAERLPALMAGDLEAAAR"
FT   gene            348793..348868
FT                   /locus_tag="Rsph17029_R0011"
FT                   /note="tRNA-Trp1"
FT   tRNA            348793..348868
FT                   /locus_tag="Rsph17029_R0011"
FT                   /product="tRNA-Trp"
FT   gene            348961..349155
FT                   /locus_tag="Rsph17029_0333"
FT   CDS_pept        348961..349155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0333"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: rsp:RSP_1705
FT                   putative preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75449"
FT                   /db_xref="GOA:A3PGI3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGI3"
FT                   /protein_id="ABN75449.1"
FT                   /translation="MAKANPFTFISQVRSEVGKVAWPGRREVLLTTIMVFVMAALTATF
FT                   FSLVDFAIRQGLSLLLNTF"
FT   gene            349318..349851
FT                   /locus_tag="Rsph17029_0334"
FT   CDS_pept        349318..349851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0334"
FT                   /product="NusG antitermination factor"
FT                   /note="KEGG: rsp:RSP_1704 probable transcription
FT                   antitermination protein NusG; TIGRFAM: transcription
FT                   termination/antitermination factor NusG; PFAM:
FT                   transcription antitermination protein NusG; KOW domain
FT                   protein; SMART: NGN domain protein; KOW (Kyrpides,
FT                   Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75450"
FT                   /db_xref="GOA:A3PGI4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGI4"
FT                   /protein_id="ABN75450.1"
FT                   /translation="MAKRWYSVSVLSNFEKKVAEQIRTAVADAGLEEEIDEVLVPTEEV
FT                   IEVRRGKKVTSERRFMPGYVLVHMEMSNRGYHLISSINRVTGFLGPQGKPMPMRDSEVN
FT                   TILNRVEEGEAQPRSLIRYDIGETVKVTDGPFEGFSGMVEDVDEEHSRLKVTVSIFGRA
FT                   TPVELEFTQVAKGA"
FT   gene            349944..350396
FT                   /locus_tag="Rsph17029_0335"
FT   CDS_pept        349944..350396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0335"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11; KEGG: rsp:RSP_1703
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75451"
FT                   /db_xref="GOA:A3PGI5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGI5"
FT                   /protein_id="ABN75451.1"
FT                   /translation="MAKKIIGSLKLQVKAGQANPSPPVGPALGQRGLNIMAFVKEFNAK
FT                   SADLEPGTPTPVIITYYQDKSFSLELKTPPASFMLKKAAGLAPVGKRNRPKGSTKPGRE
FT                   VAGSVTVAQIRKIAEAKMKDLNANDVEAAMQIILGSAKSCGIEVKG"
FT   gene            350400..351098
FT                   /locus_tag="Rsph17029_0336"
FT   CDS_pept        350400..351098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0336"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1; KEGG: rsp:RSP_1702 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75452"
FT                   /db_xref="GOA:A3PGI6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGI6"
FT                   /protein_id="ABN75452.1"
FT                   /translation="MAKVGKRTRSAREAFVGKDLISVEDAVALIKQAASAKFDETLEVA
FT                   MNLGVDPRHADQMVRGVVTLPNGTGKTVRVAVFARGAKADEAKAAGADIVGAEDLMETI
FT                   QSGKIEFDRCIATPDMMPLVGRLGKILGPRNLMPNPKVGTVTMDVKSAVEAAKGGEVQF
FT                   KVEKAGVIHAGVGKMSFEADKLAQNVRAFVDAVNRAKPAGAKGTYLKKVSLSSTMGPGV
FT                   SVDLTSATSH"
FT   gene            351337..351852
FT                   /locus_tag="Rsph17029_0337"
FT   CDS_pept        351337..351852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0337"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10; KEGG: rsp:RSP_1701
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75453"
FT                   /db_xref="GOA:A3PGI7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGI7"
FT                   /protein_id="ABN75453.1"
FT                   /translation="MDRAQKEKVVEELGQIFESSGVVVVAHYAGITVAQMQDLRAQMRE
FT                   VGGSVRVAKNRLAKIALAGKPSEKMGDLLTGMTVMAYSEDPVAAAKVADAYAKKNDKFV
FT                   ILGGAMGDTILDPAGVKTVAAMPSREELIAQIVSCIGAPASNIAGAIGAPASNIAGILS
FT                   TLEEREAA"
FT   gene            351922..352299
FT                   /locus_tag="Rsph17029_0338"
FT   CDS_pept        351922..352299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0338"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12-like; KEGG: rsp:RSP_1700 50S ribosomal
FT                   protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75454"
FT                   /db_xref="GOA:A3PGI8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGI8"
FT                   /protein_id="ABN75454.1"
FT                   /translation="MADLNKLAEDIVGLTLLEAQELKTILKDKYGIEPAAGGAVMMAGP
FT                   AAGAAAPAEEEKTEFDVVLTDAGANKINVIKEVRAITGLGLKEAKDLVEAGGKVKEAVA
FT                   KADAEAMKKKLEEAGAKVELK"
FT   gene            352544..356677
FT                   /locus_tag="Rsph17029_0339"
FT   CDS_pept        352544..356677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0339"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: rsp:RSP_1699 DNA-directed RNA polymerase beta
FT                   subunit; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2, domain 6; RNA
FT                   polymerase Rpb2, domain 7; RNA polymerase Rpb2, domain 2;
FT                   RNA polymerase beta subunit; RNA polymerase Rpb2, domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75455"
FT                   /db_xref="GOA:A3PGI9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGI9"
FT                   /protein_id="ABN75455.1"
FT                   /translation="MAQSYVGQKRIRRYYGKIREVLEMPNLIEVQKSSYDLFLKSGDGP
FT                   KAADGEGIQGVFQSVFPIKDFNETAVLEFVKYELEKPKYDVDECQQRDMTYAAPLKVTL
FT                   RLIVFDVDETTGARSVKDIKEQDVYMGDMPLMTANGTFIVNGTERVIVSQMHRSPGVFF
FT                   DHDKGKTHSSGKLLFACRIIPYRGSWLDFEFDAKDIVFARIDRRRKLPVTTLLYALGMD
FT                   QEGIMDAYYETVNFKHQKNRGWVTRFFPERVRGTRPTYDLVDAATGEVILKAGEKATPR
FT                   MVKKWIDEAQITELLVPFDHIVGRYVAQDIINEETGEIWVEAGDELTMEYDRDGEVKGG
FT                   TLKLLLDQGITDIPVLDIDNVNVGPYIRNTMAADKNMGRDTALMDIYRVMRPGEPPTVE
FT                   AASNLFDTLFFDSERYDLSAVGRVKMNMRLDLGKPDTQRTLDRDDIIACIKALTELRDG
FT                   KGEIDDIDHLGNRRVRSVGELMENQYRVGLLRMERAIKERMSSVEIDTIMPQDLINAKP
FT                   AAAAVREFFGSSQLSQFMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYG
FT                   RMCPIETPEGQNIGLINSLATFARVNKYGFIETPYRKVVEGAVTDDVVYMSATEEMRHT
FT                   VAQANAQLDEEGRFVSDLISSRKAGEFMLNPPDAIDLIDVSPKQLVSVAASLIPFLEND
FT                   DANRALMGSNMQRQAVPLLQSDAPFVGTGIEAVVARDSGAAIMARRAGVIDQVDATRIV
FT                   VRATEMLEPGEPGVDIYRLRKFKRSNQSSCINQRPLVKVGDVVHRGEVVADGPCTDMGE
FT                   LALGRNVIVAFMPWNGYNYEDSILISERILRDDVYTSIHIEEYEVAARDTKLGPEEITR
FT                   DIPNVGEEALRNLDEAGIVYIGAEVQPGDILVGKITPKGESPMTPEEKLLRAIFGEKAS
FT                   DVRDTSLRLPPGAYGTIVEVRVFNRHGVDKDERALQIEREEVERLARDRDDELAILERN
FT                   IYSRLRTLIMGKTAVKGPKGIRAGSEINEDLLSTLSRGQWWQLALGEEADAKEVEALHE
FT                   QFEAQKRALDHRFEDKVEKVRRGDDLPPGVMKMVKVFVAVKRKLQPGDKMAGRHGNKGV
FT                   ISKVVPIEDMPFLADGTHVDLVLNPLGVPSRMNVGQILETHMGWAARGLGIKIDEALQD
FT                   YRRSGDLTPVKEAMRLAYGDETYEGAFGDREDEDLVEMAGRVTKGVPIATPVFDGAKEP
FT                   DVNDALRRAGFDQSGQSIVFDGRTGEQFARPVTVGVKYMLKLHHLVDDKLHARSTGPYS
FT                   LVTQQPLGGKAQFGGQRLGEMEVWALEAYGAAYTLQEMLTVKSDDVAGRTKMYESIVKG
FT                   EDNFEAGVPESFNVLVKEVRGLGLNMELLDADEE"
FT   gene            356759..361006
FT                   /locus_tag="Rsph17029_0340"
FT   CDS_pept        356759..361006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0340"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: rsp:RSP_1712 DNA-directed RNA polymerase beta'
FT                   subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase, alpha subunit; RNA
FT                   polymerase Rpb1, domain 3; RNA polymerase Rpb1, domain 1;
FT                   RNA polymerase Rpb1, domain 5; RNA polymerase Rpb1, domain
FT                   4; SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75456"
FT                   /db_xref="GOA:A3PGJ0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGJ0"
FT                   /protein_id="ABN75456.1"
FT                   /translation="MNQELSTNPFNPVAPVKTFDEIKISLASPERILSWSYGEIKKPET
FT                   INYRTFKPERDGLFCARIFGPIKDYECLCGKYKRMKYRGVVCEKCGVEVTLQKVRRERM
FT                   GHIELAAPVAHIWFLKSLPSRIGLMLDMTLRDLERILYFENYVVIEPGLTDLTYGQLMT
FT                   EEEFLDAQDQYGADAFTANIGAEAIREMLSAIDLEQTAETLREELKEATGELKPKKIIK
FT                   RLKIVESFLESGNRPEWMILTVLPVIPPELRPLVPLDGGRFATSDLNDLYRRVINRNNR
FT                   LKRLIELRAPDIIVRNEKRMLQEAVDALFDNGRRGRVITGTNKRPLKSLSDMLKGKQGR
FT                   FRQNLLGKRVDFSGRSVIVTGPELKLHQCGLPKKMALELFKPFIYSRLEAKGLSSTVKQ
FT                   AKKLVEKERPEVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCS
FT                   AFNADFDGDQMAVHVPLSLEAQLEARVLMMSTNNVLSPANGAPIIVPSQDMVLGLYYTT
FT                   MERRGMKGEGMAFSSVEEVEHALAAGEVHLHATITARIKQIDEEGNEVVKRYQTTPGRL
FT                   RLGNLLPLNAKAPFELVNRLLRKKDVQNVIDTVYRYCGQKESVIFCDQIMGMGFREAFK
FT                   AGISFGKDDMLIPDTKWPIVNEVRDQVKEFEQQYMDGLITQGEKYNKVVDAWSKCSDKV
FT                   AGEMMAEISAVRYDDAGAEKEPNSVYMMSHSGARGSPAQMKQLGGMRGLMAKPNGEIIE
FT                   TPIISNFKEGLTVLEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDCIVRTHDCG
FT                   TENAITASAAVNEGEVVSPLAERVLGRVAAEDILVPGSDEVIVARGELIDERRADLVDQ
FT                   ANVASVRIRSPLTCEAEEGVCAMCYGRDLARGTLVNIGEAVGIIAAQSIGEPGTQLTMR
FT                   TFHIGGIAQGGQQSFLEASQEGRIEFRNPNLLENANGEQIVMGRNMQLAIIDEAGQERA
FT                   THKLTYGAKVHVKDGQTVKRATRLFEWDPYTLPIIAEKAGVARFVDLVSGISVREDTDE
FT                   ATGMTQKIVSDWRSTPKGGDLKPEIIIMNPETGDPMRNEAGNPISYPMSVEAILSVEDG
FT                   QTVRAGDVVARIPREGARTKDITGGLPRVAELFEARRPKDHAIIAENDGYVRFGKDYKN
FT                   KRRITIEPVDDTLNSVEYMVPKGKHIPVQEGDFVQKGDYIMDGNPAPHDILRILGVEAL
FT                   ANYMIDEVQEVYRLQGVKINDKHIEVIVRQMLQKYEILDSGETTLLKGEHVDKAELDEV
FT                   NQKAMDHGMRPAHAEPILLGITKASLQTRSFISAASFQETTRVLTEASVQGKRDKLVGL
FT                   KENVIVGRLIPAGTGGATSRVKKIAHDRDQKVIDTRRAEAESAAALAAPTDEVIDLGSE
FT                   DSGLVETVENREE"
FT   gene            361198..362124
FT                   /locus_tag="Rsph17029_0341"
FT   CDS_pept        361198..362124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0341"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rsp:RSP_1711 possible transporter,
FT                   RhaT family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75457"
FT                   /db_xref="GOA:A3PGJ1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGJ1"
FT                   /protein_id="ABN75457.1"
FT                   /translation="MRLSDNLRGALAMTVAMAAFTVNDALMKAVTQTMPLFQAIALRGL
FT                   VSLPLLFLYGWAVGGLRFRIPRRDGGLLALRAGADVLSTVAYLSALMVLPLANLVAILQ
FT                   SVPLAVTLAAALVLKEPLGWRRFSAILIGFCGVLLIVRPGAEGFSLWSLVGLAAVGCIV
FT                   ARDLATRRIGSDLPAATIALWTSGAVTLLGLAGSLPSGFGPVTGGEALYLGGAAVALMA
FT                   GYVSIVLAMRGGDIAAVSPFRYTALLWAIALGWLLFGDLPDGLALLGFAVITATGLFTI
FT                   WREARLRRLPREASVDIPPDSPYTPPT"
FT   sig_peptide     361198..361263
FT                   /locus_tag="Rsph17029_0341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.858) with cleavage site probability 0.463 at
FT                   residue 22"
FT   gene            362337..362708
FT                   /locus_tag="Rsph17029_0342"
FT   CDS_pept        362337..362708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0342"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: rsp:RSP_1710 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75458"
FT                   /db_xref="GOA:A3PGJ2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGJ2"
FT                   /protein_id="ABN75458.1"
FT                   /translation="MPTIQQLIRKPREPKRVRSKSQHLESCPQKRGVCTRVYTTTPKKP
FT                   NSAMRKVAKVRLTNGFEVISYIPGEKHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDT
FT                   QGVKDRRQRRSKYGAKRPK"
FT   gene            362721..363191
FT                   /locus_tag="Rsph17029_0343"
FT   CDS_pept        362721..363191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0343"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: rsp:RSP_1709 30S
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75459"
FT                   /db_xref="GOA:A3PGJ3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGJ3"
FT                   /protein_id="ABN75459.1"
FT                   /translation="MSRRHAAEKREILPDAKFGDTVLTKFMNNLMIDGKKSVAESIVYN
FT                   ALDRVQTRLKREPLEAFHEALDNVKPSVEVRSRRVGGATYQVPVEVRTERREALAIRWL
FT                   ITAARKRNENTMEERLAAELADACNNRGTAVKKREDTHKMADANKAFSHYRW"
FT   gene            363216..365333
FT                   /locus_tag="Rsph17029_0344"
FT   CDS_pept        363216..365333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0344"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: rsp:RSP_1708 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75460"
FT                   /db_xref="GOA:A3PGJ4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGJ4"
FT                   /protein_id="ABN75460.1"
FT                   /translation="MARDYPLELYRNFGIMAHIDAGKTTTTERILYYTGKSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWERTEDGKTPLTPKHRFNIIDTPGHVDFTIEVE
FT                   RSLAVLDGAVCLLDANAGVEPQTETVWRQADRYKVPRIVFVNKMDKIGADFFNCVKMIK
FT                   DRTGATPAPIALPIGAEDKLEGIIDLVTMQEWVYQGEDLGASWIIKDVRDELKAEAEEW
FT                   RGKLIELAVEQDDEAMEAYLEGNEPDVPTLRKLIRKGCLAMAFVPVTAGSAFKNKGVQP
FT                   VLNSVIDYLPSPLDVPAYMGFAPGDETETRNIARSADDSQPFAALAFKIMNDPFVGSLT
FT                   FTRLYSGVLKKGDQMVNSTKGKRERVGRMMMMHAINREEIDEAFAGDIIALAGLKETTT
FT                   GDTLCDPANQVVLETMTFPEPVIEIAVEPKTKADQEKMGLALARLAAEDPSFRVETDFE
FT                   SGQTIMKGMGELHLDILVDRMKREFKVEANIGAPQVAYRETISREAEIDYTHKKQTGGT
FT                   GQFARVKLVITPTEPGEGYSFESKIVGGAVPKEYIPGVEKGIKSVMDSGPLAGFPVIDF
FT                   RVALIDGAFHDVDSSVLAFEIASRAAMREGLKKAGAKLLELIMKVEVVTPEEYTGGIIG
FT                   DLTSRRGMVQGQDTRGNANVINAFVPLANMFGYINTLRSMSSGRAVFTMHFDHYDAVPQ
FT                   NISDEIQKKYA"
FT   gene            365408..366583
FT                   /locus_tag="Rsph17029_0345"
FT   CDS_pept        365408..366583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0345"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   rsp:RSP_1714 elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75461"
FT                   /db_xref="GOA:A3PGI1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGI1"
FT                   /protein_id="ABN75461.1"
FT                   /translation="MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGEFRAYDQI
FT                   DGAPEERARGITISTAHVEYESDTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAA
FT                   DGPMPQTREHILLGRQVGIPYMVVYMNKVDQVDDPELIELVEMEIRELLSSYDYPGDDI
FT                   PIIKGSALAAMNGTDKEIGEDSIRALIAAVDEYIPTPARAVDQPFLMPVEDVFSISGRG
FT                   TVATGRIERGVVKVGEELEIVGIRPSKKTVCTGVEMFRKLLDQGEAGDNVGLLLRGVDR
FT                   DGIERGQVLCKPGSVKPHTKFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVQ
FT                   LPEGTEMVMPGDNLKFNVELIAPIAMEEKLRFAIREGGRTVGAGVVSKIIA"
FT   gene            366751..367395
FT                   /locus_tag="Rsph17029_0346"
FT   CDS_pept        366751..367395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0346"
FT                   /product="putative acetyltransferase"
FT                   /note="KEGG: rsp:RSP_1706 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75462"
FT                   /db_xref="GOA:A3PGI2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGI2"
FT                   /protein_id="ABN75462.1"
FT                   /translation="MPSPLLNAGLRHPMRFADGRANPSMVHLNRVIDHPNIRIGDFTYA
FT                   NDFDPPEDWAARLVPYLYPGAPERLEIGRYGQIAHGVRIITASANHPAGGLTTYPFAIF
FT                   DPASLALSKEALIDLPDTVIGHDVWIGHGALILPGVRLGHGVIVGAGAVVAGDVPDYAV
FT                   VAGNPARILRMRFPPEVVARLLALAWWDWPQERLAERLPALMAGDLEAAAR"
FT   gene            367470..367545
FT                   /locus_tag="Rsph17029_R0012"
FT                   /note="tRNA-Trp2"
FT   tRNA            367470..367545
FT                   /locus_tag="Rsph17029_R0012"
FT                   /product="tRNA-Trp"
FT   gene            367638..367832
FT                   /locus_tag="Rsph17029_0347"
FT   CDS_pept        367638..367832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0347"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: rsp:RSP_1705
FT                   putative preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75463"
FT                   /db_xref="GOA:A3PGI3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGI3"
FT                   /protein_id="ABN75463.1"
FT                   /translation="MAKANPFTFISQVRSEVGKVAWPGRREVLLTTIMVFVMAALTATF
FT                   FSLVDFAIRQGLSLLLNTF"
FT   gene            367995..368528
FT                   /locus_tag="Rsph17029_0348"
FT   CDS_pept        367995..368528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0348"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="KEGG: rsp:RSP_1704 probable transcription
FT                   antitermination protein NusG; TIGRFAM: transcription
FT                   termination/antitermination factor NusG; PFAM:
FT                   transcription antitermination protein NusG; KOW domain
FT                   protein; SMART: NGN domain protein; KOW (Kyrpides,
FT                   Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75464"
FT                   /db_xref="GOA:A3PGI4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGI4"
FT                   /protein_id="ABN75464.1"
FT                   /translation="MAKRWYSVSVLSNFEKKVAEQIRTAVADAGLEEEIDEVLVPTEEV
FT                   IEVRRGKKVTSERRFMPGYVLVHMEMSNRGYHLISSINRVTGFLGPQGKPMPMRDSEVN
FT                   TILNRVEEGEAQPRSLIRYDIGETVKVTDGPFEGFSGMVEDVDEEHSRLKVTVSIFGRA
FT                   TPVELEFTQVAKGA"
FT   gene            368621..369073
FT                   /locus_tag="Rsph17029_0349"
FT   CDS_pept        368621..369073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0349"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11; KEGG: rsp:RSP_1703
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75465"
FT                   /db_xref="GOA:A3PGI5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGI5"
FT                   /protein_id="ABN75465.1"
FT                   /translation="MAKKIIGSLKLQVKAGQANPSPPVGPALGQRGLNIMAFVKEFNAK
FT                   SADLEPGTPTPVIITYYQDKSFSLELKTPPASFMLKKAAGLAPVGKRNRPKGSTKPGRE
FT                   VAGSVTVAQIRKIAEAKMKDLNANDVEAAMQIILGSAKSCGIEVKG"
FT   gene            369077..369775
FT                   /locus_tag="Rsph17029_0350"
FT   CDS_pept        369077..369775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0350"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1; KEGG: rsp:RSP_1702 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75466"
FT                   /db_xref="GOA:A3PGI6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGI6"
FT                   /protein_id="ABN75466.1"
FT                   /translation="MAKVGKRTRSAREAFVGKDLISVEDAVALIKQAASAKFDETLEVA
FT                   MNLGVDPRHADQMVRGVVTLPNGTGKTVRVAVFARGAKADEAKAAGADIVGAEDLMETI
FT                   QSGKIEFDRCIATPDMMPLVGRLGKILGPRNLMPNPKVGTVTMDVKSAVEAAKGGEVQF
FT                   KVEKAGVIHAGVGKMSFEADKLAQNVRAFVDAVNRAKPAGAKGTYLKKVSLSSTMGPGV
FT                   SVDLTSATSH"
FT   gene            370014..370529
FT                   /locus_tag="Rsph17029_0351"
FT   CDS_pept        370014..370529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0351"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10; KEGG: rsp:RSP_1701
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75467"
FT                   /db_xref="GOA:A3PGI7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGI7"
FT                   /protein_id="ABN75467.1"
FT                   /translation="MDRAQKEKVVEELGQIFESSGVVVVAHYAGITVAQMQDLRAQMRE
FT                   VGGSVRVAKNRLAKIALAGKPSEKMGDLLTGMTVMAYSEDPVAAAKVADAYAKKNDKFV
FT                   ILGGAMGDTILDPAGVKTVAAMPSREELIAQIVSCIGAPASNIAGAIGAPASNIAGILS
FT                   TLEEREAA"
FT   gene            370599..370976
FT                   /locus_tag="Rsph17029_0352"
FT   CDS_pept        370599..370976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0352"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12-like; KEGG: rsp:RSP_1700 50S ribosomal
FT                   protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75468"
FT                   /db_xref="GOA:A3PGI8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGI8"
FT                   /protein_id="ABN75468.1"
FT                   /translation="MADLNKLAEDIVGLTLLEAQELKTILKDKYGIEPAAGGAVMMAGP
FT                   AAGAAAPAEEEKTEFDVVLTDAGANKINVIKEVRAITGLGLKEAKDLVEAGGKVKEAVA
FT                   KADAEAMKKKLEEAGAKVELK"
FT   gene            371221..375354
FT                   /locus_tag="Rsph17029_0353"
FT   CDS_pept        371221..375354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0353"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: rsp:RSP_1699 DNA-directed RNA polymerase beta
FT                   subunit; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2, domain 6; RNA
FT                   polymerase Rpb2, domain 7; RNA polymerase Rpb2, domain 2;
FT                   RNA polymerase beta subunit; RNA polymerase Rpb2, domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75469"
FT                   /db_xref="GOA:A3PGI9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGI9"
FT                   /protein_id="ABN75469.1"
FT                   /translation="MAQSYVGQKRIRRYYGKIREVLEMPNLIEVQKSSYDLFLKSGDGP
FT                   KAADGEGIQGVFQSVFPIKDFNETAVLEFVKYELEKPKYDVDECQQRDMTYAAPLKVTL
FT                   RLIVFDVDETTGARSVKDIKEQDVYMGDMPLMTANGTFIVNGTERVIVSQMHRSPGVFF
FT                   DHDKGKTHSSGKLLFACRIIPYRGSWLDFEFDAKDIVFARIDRRRKLPVTTLLYALGMD
FT                   QEGIMDAYYETVNFKHQKNRGWVTRFFPERVRGTRPTYDLVDAATGEVILKAGEKATPR
FT                   MVKKWIDEAQITELLVPFDHIVGRYVAQDIINEETGEIWVEAGDELTMEYDRDGEVKGG
FT                   TLKLLLDQGITDIPVLDIDNVNVGPYIRNTMAADKNMGRDTALMDIYRVMRPGEPPTVE
FT                   AASNLFDTLFFDSERYDLSAVGRVKMNMRLDLGKPDTQRTLDRDDIIACIKALTELRDG
FT                   KGEIDDIDHLGNRRVRSVGELMENQYRVGLLRMERAIKERMSSVEIDTIMPQDLINAKP
FT                   AAAAVREFFGSSQLSQFMDQTNPLSEVTHKRRLSALGPGGLTRERAGFEVRDVHPTHYG
FT                   RMCPIETPEGQNIGLINSLATFARVNKYGFIETPYRKVVEGAVTDDVVYMSATEEMRHT
FT                   VAQANAQLDEEGRFVSDLISSRKAGEFMLNPPDAIDLIDVSPKQLVSVAASLIPFLEND
FT                   DANRALMGSNMQRQAVPLLQSDAPFVGTGIEAVVARDSGAAIMARRAGVIDQVDATRIV
FT                   VRATEMLEPGEPGVDIYRLRKFKRSNQSSCINQRPLVKVGDVVHRGEVVADGPCTDMGE
FT                   LALGRNVIVAFMPWNGYNYEDSILISERILRDDVYTSIHIEEYEVAARDTKLGPEEITR
FT                   DIPNVGEEALRNLDEAGIVYIGAEVQPGDILVGKITPKGESPMTPEEKLLRAIFGEKAS
FT                   DVRDTSLRLPPGAYGTIVEVRVFNRHGVDKDERALQIEREEVERLARDRDDELAILERN
FT                   IYSRLRTLIMGKTAVKGPKGIRAGSEINEDLLSTLSRGQWWQLALGEEADAKEVEALHE
FT                   QFEAQKRALDHRFEDKVEKVRRGDDLPPGVMKMVKVFVAVKRKLQPGDKMAGRHGNKGV
FT                   ISKVVPIEDMPFLADGTHVDLVLNPLGVPSRMNVGQILETHMGWAARGLGIKIDEALQD
FT                   YRRSGDLTPVKEAMRLAYGDETYEGAFGDREDEDLVEMAGRVTKGVPIATPVFDGAKEP
FT                   DVNDALRRAGFDQSGQSIVFDGRTGEQFARPVTVGVKYMLKLHHLVDDKLHARSTGPYS
FT                   LVTQQPLGGKAQFGGQRLGEMEVWALEAYGAAYTLQEMLTVKSDDVAGRTKMYESIVKG
FT                   EDNFEAGVPESFNVLVKEVRGLGLNMELLDADEE"
FT   gene            375436..379683
FT                   /locus_tag="Rsph17029_0354"
FT   CDS_pept        375436..379683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0354"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: rsp:RSP_1712 DNA-directed RNA polymerase beta'
FT                   subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase, alpha subunit; RNA
FT                   polymerase Rpb1, domain 3; RNA polymerase Rpb1, domain 1;
FT                   RNA polymerase Rpb1, domain 5; RNA polymerase Rpb1, domain
FT                   4; SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75470"
FT                   /db_xref="GOA:A3PGJ0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGJ0"
FT                   /protein_id="ABN75470.1"
FT                   /translation="MNQELSTNPFNPVAPVKTFDEIKISLASPERILSWSYGEIKKPET
FT                   INYRTFKPERDGLFCARIFGPIKDYECLCGKYKRMKYRGVVCEKCGVEVTLQKVRRERM
FT                   GHIELAAPVAHIWFLKSLPSRIGLMLDMTLRDLERILYFENYVVIEPGLTDLTYGQLMT
FT                   EEEFLDAQDQYGADAFTANIGAEAIREMLSAIDLEQTAETLREELKEATGELKPKKIIK
FT                   RLKIVESFLESGNRPEWMILTVLPVIPPELRPLVPLDGGRFATSDLNDLYRRVINRNNR
FT                   LKRLIELRAPDIIVRNEKRMLQEAVDALFDNGRRGRVITGTNKRPLKSLSDMLKGKQGR
FT                   FRQNLLGKRVDFSGRSVIVTGPELKLHQCGLPKKMALELFKPFIYSRLEAKGLSSTVKQ
FT                   AKKLVEKERPEVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCS
FT                   AFNADFDGDQMAVHVPLSLEAQLEARVLMMSTNNVLSPANGAPIIVPSQDMVLGLYYTT
FT                   MERRGMKGEGMAFSSVEEVEHALAAGEVHLHATITARIKQIDEEGNEVVKRYQTTPGRL
FT                   RLGNLLPLNAKAPFELVNRLLRKKDVQNVIDTVYRYCGQKESVIFCDQIMGMGFREAFK
FT                   AGISFGKDDMLIPDTKWPIVNEVRDQVKEFEQQYMDGLITQGEKYNKVVDAWSKCSDKV
FT                   AGEMMAEISAVRYDDAGAEKEPNSVYMMSHSGARGSPAQMKQLGGMRGLMAKPNGEIIE
FT                   TPIISNFKEGLTVLEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDCIVRTHDCG
FT                   TENAITASAAVNEGEVVSPLAERVLGRVAAEDILVPGSDEVIVARGELIDERRADLVDQ
FT                   ANVASVRIRSPLTCEAEEGVCAMCYGRDLARGTLVNIGEAVGIIAAQSIGEPGTQLTMR
FT                   TFHIGGIAQGGQQSFLEASQEGRIEFRNPNLLENANGEQIVMGRNMQLAIIDEAGQERA
FT                   THKLTYGAKVHVKDGQTVKRATRLFEWDPYTLPIIAEKAGVARFVDLVSGISVREDTDE
FT                   ATGMTQKIVSDWRSTPKGGDLKPEIIIMNPETGDPMRNEAGNPISYPMSVEAILSVEDG
FT                   QTVRAGDVVARIPREGARTKDITGGLPRVAELFEARRPKDHAIIAENDGYVRFGKDYKN
FT                   KRRITIEPVDDTLNSVEYMVPKGKHIPVQEGDFVQKGDYIMDGNPAPHDILRILGVEAL
FT                   ANYMIDEVQEVYRLQGVKINDKHIEVIVRQMLQKYEILDSGETTLLKGEHVDKAELDEV
FT                   NQKAMDHGMRPAHAEPILLGITKASLQTRSFISAASFQETTRVLTEASVQGKRDKLVGL
FT                   KENVIVGRLIPAGTGGATSRVKKIAHDRDQKVIDTRRAEAESAAALAAPTDEVIDLGSE
FT                   DSGLVETVENREE"
FT   gene            379875..380801
FT                   /locus_tag="Rsph17029_0355"
FT   CDS_pept        379875..380801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0355"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rsp:RSP_1711 possible transporter,
FT                   RhaT family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75471"
FT                   /db_xref="GOA:A3PGJ1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGJ1"
FT                   /protein_id="ABN75471.1"
FT                   /translation="MRLSDNLRGALAMTVAMAAFTVNDALMKAVTQTMPLFQAIALRGL
FT                   VSLPLLFLYGWAVGGLRFRIPRRDGGLLALRAGADVLSTVAYLSALMVLPLANLVAILQ
FT                   SVPLAVTLAAALVLKEPLGWRRFSAILIGFCGVLLIVRPGAEGFSLWSLVGLAAVGCIV
FT                   ARDLATRRIGSDLPAATIALWTSGAVTLLGLAGSLPSGFGPVTGGEALYLGGAAVALMA
FT                   GYVSIVLAMRGGDIAAVSPFRYTALLWAIALGWLLFGDLPDGLALLGFAVITATGLFTI
FT                   WREARLRRLPREASVDIPPDSPYTPPT"
FT   sig_peptide     379875..379940
FT                   /locus_tag="Rsph17029_0355"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.858) with cleavage site probability 0.463 at
FT                   residue 22"
FT   gene            381014..381385
FT                   /locus_tag="Rsph17029_0356"
FT   CDS_pept        381014..381385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0356"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: rsp:RSP_1710 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75472"
FT                   /db_xref="GOA:A3PGJ2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGJ2"
FT                   /protein_id="ABN75472.1"
FT                   /translation="MPTIQQLIRKPREPKRVRSKSQHLESCPQKRGVCTRVYTTTPKKP
FT                   NSAMRKVAKVRLTNGFEVISYIPGEKHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDT
FT                   QGVKDRRQRRSKYGAKRPK"
FT   gene            381398..381868
FT                   /locus_tag="Rsph17029_0357"
FT   CDS_pept        381398..381868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0357"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: rsp:RSP_1709 30S
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75473"
FT                   /db_xref="GOA:A3PGJ3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGJ3"
FT                   /protein_id="ABN75473.1"
FT                   /translation="MSRRHAAEKREILPDAKFGDTVLTKFMNNLMIDGKKSVAESIVYN
FT                   ALDRVQTRLKREPLEAFHEALDNVKPSVEVRSRRVGGATYQVPVEVRTERREALAIRWL
FT                   ITAARKRNENTMEERLAAELADACNNRGTAVKKREDTHKMADANKAFSHYRW"
FT   gene            381893..384010
FT                   /locus_tag="Rsph17029_0358"
FT   CDS_pept        381893..384010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0358"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: rsp:RSP_1708 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75474"
FT                   /db_xref="GOA:A3PGJ4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGJ4"
FT                   /protein_id="ABN75474.1"
FT                   /translation="MARDYPLELYRNFGIMAHIDAGKTTTTERILYYTGKSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWERTEDGKTPLTPKHRFNIIDTPGHVDFTIEVE
FT                   RSLAVLDGAVCLLDANAGVEPQTETVWRQADRYKVPRIVFVNKMDKIGADFFNCVKMIK
FT                   DRTGATPAPIALPIGAEDKLEGIIDLVTMQEWVYQGEDLGASWIIKDVRDELKAEAEEW
FT                   RGKLIELAVEQDDEAMEAYLEGNEPDVPTLRKLIRKGCLAMAFVPVTAGSAFKNKGVQP
FT                   VLNSVIDYLPSPLDVPAYMGFAPGDETETRNIARSADDSQPFAALAFKIMNDPFVGSLT
FT                   FTRLYSGVLKKGDQMVNSTKGKRERVGRMMMMHAINREEIDEAFAGDIIALAGLKETTT
FT                   GDTLCDPANQVVLETMTFPEPVIEIAVEPKTKADQEKMGLALARLAAEDPSFRVETDFE
FT                   SGQTIMKGMGELHLDILVDRMKREFKVEANIGAPQVAYRETISREAEIDYTHKKQTGGT
FT                   GQFARVKLVITPTEPGEGYSFESKIVGGAVPKEYIPGVEKGIKSVMDSGPLAGFPVIDF
FT                   RVALIDGAFHDVDSSVLAFEIASRAAMREGLKKAGAKLLELIMKVEVVTPEEYTGGIIG
FT                   DLTSRRGMVQGQDTRGNANVINAFVPLANMFGYINTLRSMSSGRAVFTMHFDHYDAVPQ
FT                   NISDEIQKKYA"
FT   gene            384085..385260
FT                   /locus_tag="Rsph17029_0359"
FT   CDS_pept        384085..385260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0359"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   rsp:RSP_1714 elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75475"
FT                   /db_xref="GOA:A3PGI1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGI1"
FT                   /protein_id="ABN75475.1"
FT                   /translation="MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGEFRAYDQI
FT                   DGAPEERARGITISTAHVEYESDTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAA
FT                   DGPMPQTREHILLGRQVGIPYMVVYMNKVDQVDDPELIELVEMEIRELLSSYDYPGDDI
FT                   PIIKGSALAAMNGTDKEIGEDSIRALIAAVDEYIPTPARAVDQPFLMPVEDVFSISGRG
FT                   TVATGRIERGVVKVGEELEIVGIRPSKKTVCTGVEMFRKLLDQGEAGDNVGLLLRGVDR
FT                   DGIERGQVLCKPGSVKPHTKFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVQ
FT                   LPEGTEMVMPGDNLKFNVELIAPIAMEEKLRFAIREGGRTVGAGVVSKIIA"
FT   gene            385333..385641
FT                   /locus_tag="Rsph17029_0360"
FT   CDS_pept        385333..385641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0360"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: rsp:RSP_1715 30S
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75476"
FT                   /db_xref="GOA:A3PGL0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGL0"
FT                   /protein_id="ABN75476.1"
FT                   /translation="MQGQTIRIRLKAFDYRVLDASTQEIVNTAKRTGAQVRGPIPLPNK
FT                   IEKFTVLRGPHIDKKSRDQWEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDIQIKV"
FT   gene            385655..386377
FT                   /locus_tag="Rsph17029_0361"
FT   CDS_pept        385655..386377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0361"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: rsp:RSP_1716 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75477"
FT                   /db_xref="GOA:A3PGL1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGL1"
FT                   /protein_id="ABN75477.1"
FT                   /translation="MRSGVIAKKLGMTRLFLEDGKQVPVTVLQLDSLQVVAQRTTEKDG
FT                   YTAVQLGAGAAKAKRVSAAQRGHFAKANVEPKRKIAEFRVTPDCLIDVGAEITADHYFA
FT                   GQFVDIAGTSIGKGFAGAMKRHNFGGLRASHGVSISHRSHGSTGQCQDPGKVFKGKKMA
FT                   GHMGAARVTTQNLQVVRTDSDRGLIMVKGAVPGSKGGWVTIKDAVKKPAPEQAIRPAAI
FT                   RAAAVAEETSTGGESNEG"
FT   gene            386367..386987
FT                   /locus_tag="Rsph17029_0362"
FT   CDS_pept        386367..386987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0362"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: rsp:RSP_1717
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75478"
FT                   /db_xref="GOA:A3PGL2"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGL2"
FT                   /protein_id="ABN75478.1"
FT                   /translation="MKAEVIKLDASPAGSIELDDAIFGLEPRADILHRVVRWQRAKAQA
FT                   GTHSVLGKSDVSYSTKKIYRQKGTGGARHGSKKAPIFRHGGVYKGPTPRSHAHDLNKKF
FT                   RALGLKHALSSKATTGNLIVLEDIALAEGKTAMLAKAVKELGWKRVLVIDGADINENFA
FT                   KAARNLEGVDVLPSIGANVYDILKRDTLVITKAGVEALEARLK"
FT   gene            386984..387280
FT                   /locus_tag="Rsph17029_0363"
FT   CDS_pept        386984..387280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0363"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: rsp:RSP_1718
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75479"
FT                   /db_xref="GOA:A3PGL3"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGL3"
FT                   /protein_id="ABN75479.1"
FT                   /translation="MTAKPEHYDVIRKPVITEKATMTSEANGVVFAVAMEATKPQIKEA
FT                   VEAIFNVKVKAVNTVVTKGKTKKFKGRPGVRSDRKKAYVTLEEGNTIDVSTGL"
FT   gene            387403..388242
FT                   /locus_tag="Rsph17029_0364"
FT   CDS_pept        387403..388242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0364"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: rsp:RSP_1719 50S
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75480"
FT                   /db_xref="GOA:A3PGL4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGL4"
FT                   /protein_id="ABN75480.1"
FT                   /translation="MALKSYKPTTPGQRGLVLIDRSELWKGRPVKTLVEGLIKTGGRNN
FT                   TGRVTMWHKGGGAKRLYRIVDFKRRKFDVPAVVERIEYDPNRTAFIALVRYEDGELAYI
FT                   LAPQRLAVGDSVVAGVKTDVKPGNAMPFSGMPIGTIVHNVELKPGKGGQLARAAGTYAQ
FT                   FVGRDGGYAQIRLSSGELRMVRQECMATVGAVSNPDNSNQNFGKAGRMRHKGVRPTVRG
FT                   VAMNPIDHPHGGGEGRTSGGRHPVTPWGKGTKGNRTRKSKASDKLIVRSRHAKKKGR"
FT   gene            388246..388524
FT                   /locus_tag="Rsph17029_0365"
FT   CDS_pept        388246..388524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0365"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: rsp:RSP_1720 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75481"
FT                   /db_xref="GOA:A3PGL5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGL5"
FT                   /protein_id="ABN75481.1"
FT                   /translation="MARSTWKGPFVDGYLLKKAEKSRESGKNEVIKIWSRRSTILPQFV
FT                   GLTFGVYNGKKHVPVNVTEEMIGQKFGEYSPTRTYYGHAADKKAKRK"
FT   gene            388528..388908
FT                   /locus_tag="Rsph17029_0366"
FT   CDS_pept        388528..388908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0366"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: rsp:RSP_1721 50S ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75482"
FT                   /db_xref="GOA:A3PGL6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGL6"
FT                   /protein_id="ABN75482.1"
FT                   /translation="MGKEKNPRRVGENEAFAKVKMLRTSPQKLNLVAALIRGKKVDKAI
FT                   ADLTFSKKRISQDVLKCLQSAIANAENNHGLDVDELVVSEAFCGKNLVMKRGRPRARGR
FT                   FGKIMKPFSELTIKVKQVGETA"
FT   gene            388908..389624
FT                   /locus_tag="Rsph17029_0367"
FT   CDS_pept        388908..389624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0367"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: rsp:RSP_1722 30S ribosomal protein S3;
FT                   TIGRFAM: ribosomal protein S3; PFAM: ribosomal protein
FT                   S3-C-terminal domain protein; KH, type 2 domain protein;
FT                   KH, type 1, domain protein; Ribosomal protein S3,
FT                   N-terminal domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75483"
FT                   /db_xref="GOA:A3PGL7"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGL7"
FT                   /protein_id="ABN75483.1"
FT                   /translation="MGQKVNPIGMRLQVNRTWDSRWFAESKDYGNLLLEDLKMREFIHD
FT                   YAKQAGVSKVIIERPHRKCRVTIHTARPGVIIGKKGADIETLRKKLSAFTKSELHLNIV
FT                   EIRKPELDAQLVAESIAQQMERRVSFRRAMKRGVQNAMRIGALGIRVNVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATSEATTPYGIIGVKVWIFKGEILEHDPQAHDRRHSEA
FT                   QEGAAPRPPRRDRERA"
FT   gene            389639..390052
FT                   /locus_tag="Rsph17029_0368"
FT   CDS_pept        389639..390052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0368"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16; KEGG: rsp:RSP_1723 50S
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75484"
FT                   /db_xref="GOA:A3PGL8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGL8"
FT                   /protein_id="ABN75484.1"
FT                   /translation="MLQPKRTKFRKQHKGRIHGEAKGGFLLNFGGFGLKATEPERVTAR
FT                   QIEAARRAITRHMKRQGRVWIRVFPDVPVTSKPTEVRMGKGKGSVDYWAAKVKPGRIMF
FT                   EIDGVSETIAREALRLGAMKLPVMTRIVVREDW"
FT   gene            390291..390497
FT                   /locus_tag="Rsph17029_0369"
FT   CDS_pept        390291..390497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0369"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: rsp:RSP_1724
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75485"
FT                   /db_xref="GOA:A3PGL9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGL9"
FT                   /protein_id="ABN75485.1"
FT                   /translation="MTTAQELRSKTPDQLRDQLVALKKEAFNLRFQQATGQLENTARMR
FT                   AVRRDVARIKTVLNEMAASAAAN"
FT   gene            390511..390753
FT                   /locus_tag="Rsph17029_0370"
FT   CDS_pept        390511..390753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0370"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: rsp:RSP_6017
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75486"
FT                   /db_xref="GOA:A3PGM0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGM0"
FT                   /protein_id="ABN75486.1"
FT                   /translation="MPKRILQGTVTSDKNEQTVTVLVERRFKHPLLKKTVRLSKKYRAH
FT                   DPENQFKVGDIVRIEECAPISKTKRWKVVTDAVVA"
FT   gene            390827..391195
FT                   /locus_tag="Rsph17029_0371"
FT   CDS_pept        390827..391195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0371"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: rsp:RSP_1725 ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75487"
FT                   /db_xref="GOA:A3PGM1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGM1"
FT                   /protein_id="ABN75487.1"
FT                   /translation="MIQMQTNLDVADNSGARRVQCIKVLGGSHRRYASVGDIIVVSVKE
FT                   AIPRGRVKKGDVRKAVVVRTAKEVRREDGTTIRFDRNAAVILNNQGEPVGTRIFGPVVR
FT                   ELRAKNFMKIISLAPEVL"
FT   gene            391195..391500
FT                   /locus_tag="Rsph17029_0372"
FT   CDS_pept        391195..391500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0372"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="KEGG: rsp:RSP_1726 ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75488"
FT                   /db_xref="GOA:A3PGM2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGM2"
FT                   /protein_id="ABN75488.1"
FT                   /translation="MAAKLKKGDRVVVLAGKDKGKQGEITAVMPKDNKAVVEGVNVAIR
FT                   HTKQTPTAQGGRLAKAMPIDLSNLALLDANGKATRVGFRFEGEKKVRYAKTTGDVI"
FT   gene            391500..392060
FT                   /locus_tag="Rsph17029_0373"
FT   CDS_pept        391500..392060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0373"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: rsp:RSP_1727
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75489"
FT                   /db_xref="GOA:A3PGM3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGM3"
FT                   /protein_id="ABN75489.1"
FT                   /translation="MLDQTNYTPRLKAAYANTVRAAMKEEFGYKNDMQIPRLDKIVLNM
FT                   GVGEAVKDTKKVKTAAEELSMIAGQKAVVTHAKKSIAGFRVREQMPLGCKVTLRGDRMY
FT                   EFLDRLITIALPRVRDFRGVKGNSFDGRGNYAMGLKEQFVFPEINFDKVDEVLGMDIII
FT                   CTTAKTDAEAKALLKQFNMPFIS"
FT   gene            392080..392385
FT                   /locus_tag="Rsph17029_0374"
FT   CDS_pept        392080..392385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0374"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: rsp:RSP_1728
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75490"
FT                   /db_xref="GOA:A3PGM4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGM4"
FT                   /protein_id="ABN75490.1"
FT                   /translation="MAKKSMIEREIKRAKMVQQYAAKRASLKEITTNADLPMEQRFKAQ
FT                   LKLAELPRNSSATRIHNRCQLTGRPHAYYRKLKLSRIMLRELASFGQIPGMVKSSW"
FT   gene            392398..392796
FT                   /locus_tag="Rsph17029_0375"
FT   CDS_pept        392398..392796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0375"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: rsp:RSP_1729
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75491"
FT                   /db_xref="GOA:A3PGM5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGM5"
FT                   /protein_id="ABN75491.1"
FT                   /translation="MSVNDPLGDMLTRIRNAQLRGKSTVSTPASRLRAWVLDVLQAEGY
FT                   IRGYEKKETENGQGELVISLKYFEGTPVIRELKRVSKPGRRVYMATKDLPSVRNGLGVS
FT                   IISTPKGVMSDASARSANVGGEVLCTVF"
FT   gene            392807..393340
FT                   /locus_tag="Rsph17029_0376"
FT   CDS_pept        392807..393340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0376"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: rsp:RSP_1730 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75492"
FT                   /db_xref="GOA:A3PGM6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGM6"
FT                   /protein_id="ABN75492.1"
FT                   /translation="MSRIGKKPVPLPKGVTASISGQSIEVKGPKGTRSFSATDDVTLAL
FT                   DEGSVKVTPRGTSKRARQQWGMVRSQVENLVTGVTSGFKKELEISGVGYRAQMAGNVLK
FT                   LSLGYSHDVNFEVPAGVTVTTPKQTEITVEGIDQQLVGQVAANIREWRRPEPYKGKGIR
FT                   YKDEFIFRKEGKKK"
FT   gene            393352..393711
FT                   /locus_tag="Rsph17029_0377"
FT   CDS_pept        393352..393711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0377"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: rsp:RSP_1731 ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75493"
FT                   /db_xref="GOA:A3PGM7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGM7"
FT                   /protein_id="ABN75493.1"
FT                   /translation="MANTKRELFLKRRLRVRNKLKASANGRLRLSVHRSSKNISAQLID
FT                   DANGVTLAAASTLEKGLGFVGKNNVEASAAVGRAIAERAKAAGIEECFFDRGGFLFHGK
FT                   IKALADAAREGGLKF"
FT   gene            393723..394286
FT                   /locus_tag="Rsph17029_0378"
FT   CDS_pept        393723..394286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0378"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like; KEGG:
FT                   rsp:RSP_1732 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75494"
FT                   /db_xref="GOA:A3PGM8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGM8"
FT                   /protein_id="ABN75494.1"
FT                   /translation="MAERENRRDRRDDRSREETPEFADRLVAINRVSKTVKGGKRFGFA
FT                   ALVVVGDQRGRVGFGKGKAKEVPEAIRKATEQAKRQMIRVALRDGRTLHHDQEGRHGAG
FT                   KVVMRAAVPGTGIIAGGPMRAVFEMLGIQDVVAKSLGSQNPYNMIRATMDGLKRESSPR
FT                   QVAQRRGKKVADILKKPEAEVAEA"
FT   gene            394299..394487
FT                   /locus_tag="Rsph17029_0379"
FT   CDS_pept        394299..394487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0379"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30; KEGG: rsp:RSP_1733
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75495"
FT                   /db_xref="GOA:A3PGM9"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGM9"
FT                   /protein_id="ABN75495.1"
FT                   /translation="MAKTIIVKQVRSAARRPAVQTAVLKGLGLNKMHRTRELEDTPSIR
FT                   GMVAKIPHLVEIIEERG"
FT   gene            394644..395129
FT                   /locus_tag="Rsph17029_0380"
FT   CDS_pept        394644..395129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0380"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15; KEGG: rsp:RSP_1734 50S
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75496"
FT                   /db_xref="GOA:A3PGN0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGN0"
FT                   /protein_id="ABN75496.1"
FT                   /translation="MKLNELRDNEGAARKKKRVARGPGSGKGKTAGRGIKGQKSRSGVA
FT                   LNGYEGGQMPLYRRLPKRGFTKPNRKEYAVVNLGLIQKFVDAGKLDASQPIDENAIVAA
FT                   GVTSHKRDGIRVLAKGEITAKLALTVSGASKSAVEAIEKAGGSITLTAPAAAAASAE"
FT   gene            395230..396588
FT                   /locus_tag="Rsph17029_0381"
FT   CDS_pept        395230..396588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0381"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: rsp:RSP_1735 preprotein translocase
FT                   SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75497"
FT                   /db_xref="GOA:A3PGN1"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGN1"
FT                   /protein_id="ABN75497.1"
FT                   /translation="MASAAEQMAANLSWGALGKATDLRQRIFFTIGLLMVYRLGTYIPV
FT                   PGIDGSALRQFMDSATAGIGGMLNMFTGGAISRMGIFALGIMPYISASIIVQLMASMVP
FT                   KLEQLKKEGEQGRKKINQYTRYGTVFLATFQAWGIAMSLEAGDLVTDPGMFFRAACVIT
FT                   LVGGTMFLMWLGEQITARGIGNGISLIIFVGIVAEIPAHLAQFLSQGRSGAISPAVIVG
FT                   VIAMVIAVITFVVFMERALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFAS
FT                   SLLLLPVTISTFSGQQTGPVMSTILAYFGPGQPLYLLFFAGMIVFFAYFYTANVAFKVD
FT                   DVAENLKNQNGFIPGIRPGKKTEEYLEYVVNRILVLGSAYLAAVCLLPEILRNQLGIPF
FT                   YFGGTSVLIVVSVTMDTINQVQSHLLAHQYEGLIERSQLRGRKRTGAKTPTRR"
FT   gene            396599..397252
FT                   /locus_tag="Rsph17029_0382"
FT   CDS_pept        396599..397252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0382"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="TIGRFAM: adenylate kinases; PFAM: adenylate kinase;
FT                   adenylate kinase, lid domain protein; KEGG: rsp:RSP_1736
FT                   adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75498"
FT                   /db_xref="GOA:A3PGN2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGN2"
FT                   /protein_id="ABN75498.1"
FT                   /translation="MVNVILLGPPGAGKGTQAKRLEESRGMVQLSTGDMLREAKTSGSE
FT                   MGRRAAEVMDRGELVTDEIVIGLIREKLQSPAAGGFIFDGFPRTLKQADALGELLAQMG
FT                   QGLDAVIEMQVDDAALVARITGRYSCGSCGAVYHDDTKPTKVEGVCDVCGSTDLRRRAD
FT                   DTAEALSKRLMEYYKKTSPLIGYYYAKGQLSSVDGLAEMDAVSAAISKVLDKRG"
FT   gene            397427..397795
FT                   /locus_tag="Rsph17029_0383"
FT   CDS_pept        397427..397795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0383"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13; KEGG: rsp:RSP_1737 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75499"
FT                   /db_xref="GOA:A3PGN3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGN3"
FT                   /protein_id="ABN75499.1"
FT                   /translation="MARIAGVNIPTAKRVPIALTYIHGIGDFVAGQICDAVGIDRARRV
FT                   NELSDAEVLSIREYIDANVTVEGDLRRETSMNIKRLMDLGCYRGLRHRRGLPVRGQRTH
FT                   TNARTRKGPAKAIAGKKK"
FT   gene            397809..398198
FT                   /locus_tag="Rsph17029_0384"
FT   CDS_pept        397809..398198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0384"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: rsp:RSP_1738 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75500"
FT                   /db_xref="GOA:A3PGN4"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGN4"
FT                   /protein_id="ABN75500.1"
FT                   /translation="MARDKTRMKRKERKNIAAGVAHVNSSFNNTKILISDVQGNAISWS
FT                   SAGTMGFKGSRKSTPYAAQMAAEDAAKKAQDHGMKTIEVEVQGPGSGRESALRALAAAG
FT                   LNITSIRDVTPMAHNGCRPPKRRRV"
FT   gene            398314..399330
FT                   /locus_tag="Rsph17029_0385"
FT   CDS_pept        398314..399330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0385"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: rsp:RSP_1739 DNA-directed RNA polymerase alpha
FT                   subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase, alpha subunit domain
FT                   protein; RNA polymerase, dimerisation; RNA polymerase,
FT                   insert; SMART: RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75501"
FT                   /db_xref="GOA:A3PGN5"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGN5"
FT                   /protein_id="ABN75501.1"
FT                   /translation="MIHKNWAELIKPTQLVVKPGADPARVATVIAEPLERGFGLTLGNA
FT                   LRRVLLSSLQGAAITSVQIDNVLHEFSSVAGVREDVTDIVLNLKGVSIKMEVEGPKRLS
FT                   ISAKGPGVVTAGDISESNGIEILNKDHVICHLDEGADVFMELTVNTGKGYVAADKNRPE
FT                   DAPIGLIPIDAIYSPVKKVSYEVTPTREGQVLDYDKLTMRIETDGGLTPDDAVAYAARI
FT                   LQDQLSIFVNFEEPESATRHDVEDGLEFNPLLLKKVDELELSVRSANCLKNDNIVYIGD
FT                   LIQKTEAEMLRTPNFGRKSLNEIKEVLSGMGLHLGMDVEDWPPENIEDLAKRFEDQF"
FT   gene            399431..399850
FT                   /locus_tag="Rsph17029_0386"
FT   CDS_pept        399431..399850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0386"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17; KEGG: rsp:RSP_1740
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75502"
FT                   /db_xref="GOA:A3PGN6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGN6"
FT                   /protein_id="ABN75502.1"
FT                   /translation="MRHARGYRRLNRTHEHRKALFANMAGSLIEHEQIKTTLPKAKELR
FT                   PIIEKLITLAKRGDLHARRQAAAQLKEDRHVARLFEILGPRYAERAGGYVRVLKAGFRY
FT                   GDMAPMAIIEFVDRDPNAKGAADKARTAAEEALEE"
FT   gene            400109..400720
FT                   /locus_tag="Rsph17029_0387"
FT   CDS_pept        400109..400720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0387"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: regulatory protein, LuxR; Autoinducer-binding
FT                   domain protein; KEGG: rsp:RSP_1741 possible LuxR family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75503"
FT                   /db_xref="GOA:A3PGN7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGN7"
FT                   /protein_id="ABN75503.1"
FT                   /translation="MTINSKIDLEISQLRRMATAGYFLGLHVRFTSPLITMQSYREDWI
FT                   EYYTEKGYVIYDPTIRWALSETGHRRWSDLAEQDSRGVFAAATQFDLRFGVTCSWGTRE
FT                   SRSLGSFARSDREFTDREVELIFSLFQRLHELTQPPQELTQPQIEALRCIAGGDRHAAA
FT                   AMKLGISESALKARIASARQRLGARTTAEAIQRAKEYRLI"
FT   gene            400776..402161
FT                   /locus_tag="Rsph17029_0388"
FT   CDS_pept        400776..402161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0388"
FT                   /product="protease Do"
FT                   /note="KEGG: rsp:RSP_1742 serine protease, trypsin family;
FT                   TIGRFAM: protease Do; PFAM: peptidase S1 and S6,
FT                   chymotrypsin/Hap; SMART: PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75504"
FT                   /db_xref="GOA:A3PGN8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGN8"
FT                   /protein_id="ABN75504.1"
FT                   /translation="MRHALLAFSLIALLSPLAAPAETRLPESAAEISLSFAPVVRSAAP
FT                   AVVNIYATRVVEQRVSPFAADPFFDQLFRDFGRRQPRVQNSLGSGVIVSGDGIVVSNYH
FT                   VVGQADAIRVVLNDRREYEAEVMLADQDSDLAVLKLKEAADLPHLGLRDSDGVEVGELV
FT                   LAIGNPFGVGQTVSQGIVSGLARSGLSIDGGRGYFIQTDAAINPGNSGGALVDTAGRLV
FT                   GINTAILTQSGGSNGIGFAIPANLVRSFLAQAEAGEARFQRPWAGVNGQAVDASMAEAM
FT                   GLERPEGVVLTELDPESPFRAAGLRAGDVVVALEGQRTDSPQEVIFRLSSLGIGARATV
FT                   SYLRDGETREAEIALVVAPDKPPRETVALRETVLAGLTVERLNPAVRAELNLPLTLEGV
FT                   VVRASEATAAQTGLRPGDILLEINGRRIERPRDVERAAQERVRWWQIDVLRDGKPLRLR
FT                   FRL"
FT   sig_peptide     400776..400832
FT                   /locus_tag="Rsph17029_0388"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.913 at
FT                   residue 19"
FT   gene            402200..403513
FT                   /locus_tag="Rsph17029_0389"
FT   CDS_pept        402200..403513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0389"
FT                   /product="Recombination protein MgsA"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5; SMART:
FT                   AAA ATPase; KEGG: rsp:RSP_1743 ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75505"
FT                   /db_xref="GOA:A3PGN9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGN9"
FT                   /protein_id="ABN75505.1"
FT                   /translation="MSDLFDREPAPPQPDAPRPLADRLRPKSLAEVIGQGKVLSPDGPL
FT                   GAMLASGSLSSLILWGPPGVGKTTIARLLAKETDLAFVQISAIFTGVPDLRKVFEAAKL
FT                   RRANGQGTLLFVDEIHRFNKAQQDGFLPHMEDGTILLVGATTENPSFELNAALMSRAQV
FT                   IVLERLSLADLERLAQRAEHETGRALPLDGPAREALLEMADGDGRALLNLVEQVMAWKV
FT                   KGPLDRDQLATRLMRRAAKYDKSGEEHYNLISALHKSVRGSDPDAALYWFARMLEGGED
FT                   PRFLARRITRMAVEDIGLADPQAQGICLEAWATYERLGSPEGELALAEALVYLALSPKS
FT                   NAVYTAYKAARAAAKQTGSEPPPKHILNAPTKMMKEIGYGSGYQYDHDAEDGFSGQNYF
FT                   PESMKRPVWYLPQERGFERELKKRTDYFSKLRAKRQGG"
FT   gene            403545..403919
FT                   /locus_tag="Rsph17029_0390"
FT   CDS_pept        403545..403919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0390"
FT                   /product="camphor resistance protein CrcB"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: rsp:RSP_1744 CrcB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75506"
FT                   /db_xref="GOA:A3PGP0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGP0"
FT                   /protein_id="ABN75506.1"
FT                   /translation="MISSLLQVALGGALGASARYLTNVGSMRLFGPAFPVGTMIVNVVG
FT                   SFLMGVLVVVLAHKGNRYAPFLMTGMLGGFTTFSAFSLDAVTLYERGQAGLAAAYVGLS
FT                   VGLSLAGLMAGMAAVRGWMA"
FT   gene            403916..404956
FT                   /locus_tag="Rsph17029_0391"
FT   CDS_pept        403916..404956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0391"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   KEGG: rsp:RSP_1745 pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75507"
FT                   /db_xref="GOA:A3PGP1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGP1"
FT                   /protein_id="ABN75507.1"
FT                   /translation="MSSVQLLKVTADEGEQRLDRWFKRRFPHVTQGAVEKMCRTGQVRV
FT                   DGARAKASDRVAEGMEIRVPPLPDPDAPRPQASRVTKSDEQMIQDCVIYRDNDIIVLNK
FT                   PPGLPSQGGSGQGERHVDGLTEALKFGYKERPKLVHRLDKDTSGVLVLARTDRVARALS
FT                   ESFRHRNTRKIYWALVAGVPSPKQGSIKYALMKAPGHGRGGEGEKMLCIHPAKVGDYPE
FT                   AKRAQTDFFTLWFLGSRCAWMALSPITGRTHQLRAHMAELGHPIVGDGKYGGSGQENLG
FT                   DGWGAQIGGEMSRKLHLHARSLTIEHPIKKDLVTFTAPLPGHMAKTWKLLDWKEGDVPE
FT                   DPFGAF"
FT   gene            404956..405663
FT                   /locus_tag="Rsph17029_0392"
FT   CDS_pept        404956..405663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0392"
FT                   /product="ATP12 ATPase"
FT                   /note="PFAM: ATP12 ATPase; KEGG: rsp:RSP_1746 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75508"
FT                   /db_xref="GOA:A3PGP2"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGP2"
FT                   /protein_id="ABN75508.1"
FT                   /translation="MAGWGAKRFWKEASVAEEPGGFAVLLDGRGVRTPAKRPLILPTCA
FT                   LAEAVASEWQAQEGEVRPETMPVTRSANSALDKVAPQFDEVTEMLAAYGGTDLLCYRAT
FT                   APEALVARQARAWDPVLAWAAERFEAPLETTAGVMHQAQPEASLTRLAEHVRGFSPFQV
FT                   AGFHDLVAISGSLILGLGVTEGHLLPEEAWELSRLDESWQIEQWGADEEAAEIEAFRRT
FT                   AFLQAARFYALCG"
FT   gene            405890..406906
FT                   /locus_tag="Rsph17029_0393"
FT   CDS_pept        405890..406906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0393"
FT                   /product="cationic amino acid ABC transporter, periplasmic
FT                   binding protein"
FT                   /note="TIGRFAM: cationic amino acid ABC transporter,
FT                   periplasmic binding protein; SMART: extracellular
FT                   solute-binding protein, family 3; KEGG: rsp:RSP_1747 ABC
FT                   glutamate/glutamine/aspartate/asparagine transporter,
FT                   periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75509"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGP3"
FT                   /protein_id="ABN75509.1"
FT                   /translation="MTKSVFLGTLTVAGLAAGLASAATLDDVKARGELNCGVSTGLTGF
FT                   SLPDANGNWTGFDVSLCRAVAAAVLGDGTKVKFVPTTGQTRFTALASGEVDMLARNSTW
FT                   TFSRDTDLKLDFVGVNYYDGQGFMVRKDLGVTSAKELDGATVCIQTGTTTELNLADWFK
FT                   VNNLSYTPVAVETNAEGEQQYAAGACDAYTTDASGLAATRAAFADPENHIILPEIISKE
FT                   PLGPAVRHGDNEWADIVRWTLNALIAAEEYGVTSANMEELAANSPNPEIQRVLGVQGDL
FT                   GKMIRLDNDWAKRAIAVGGNYGEIFAATIGEATPIGLARGLNAQWTQGGLLYAPPFR"
FT   sig_peptide     405890..405958
FT                   /locus_tag="Rsph17029_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            407055..408317
FT                   /locus_tag="Rsph17029_0394"
FT   CDS_pept        407055..408317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0394"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rsp:RSP_1748 ABC
FT                   glutamate/glutamine/aspartate/asparagine transporter, inner
FT                   membrane subunit BztB"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75510"
FT                   /db_xref="GOA:A3PGP4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGP4"
FT                   /protein_id="ABN75510.1"
FT                   /translation="MANVADAPKDSFRLSMLLYDTRYRSLTIQVFVFFLFMAGAAWLVD
FT                   NTMRNLEALGKDFDFGFLWNRAGYDISQRLVDYTNDSTHGRAMLVGLLNTLLIALLGCM
FT                   AATVIGVLVGVLRLSRNWIVGRLMTVYVEVFRNVPLLLWILLIYAVFSEATPAPNAFRP
FT                   NPETGIADRSMFLDAIAVTNRYTALPNPVFSRELGWLDLGLFYVNMDVLAVIGAIIAGW
FT                   FINRSVKARATRIQEATGERPATWWSSLLLLVGLPVAVLLALGFHLEFPELRGFNFVGG
FT                   LNVSNSFMALWLALSLYTGAFIAEIVRGGILAVSRGQSEAAFALGLRPGRTMNLVILPQ
FT                   ALRVIIPPLISQYLNLTKNSSLAIAVGYLDLRGTLGGITLNQTGRELECVLLMMLIYLA
FT                   ISLVISGVMNVYNSAVKLKER"
FT   gene            408319..409647
FT                   /locus_tag="Rsph17029_0395"
FT   CDS_pept        408319..409647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0395"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rsp:RSP_1749 ABC
FT                   glutamate/glutamine/aspartate/asparagine transporter, inner
FT                   membrane subunit BztC"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75511"
FT                   /db_xref="GOA:A3PGP5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGP5"
FT                   /protein_id="ABN75511.1"
FT                   /translation="MSDTHAQTVPFVRETMLPPVAPPANEAGVVSWMRQNLFSGPLNIA
FT                   LTLLGLVAIYYVLEGIVPWLMRSVWTADTLAQCRQIITERWGEGATGACWAVIRERWPQ
FT                   FLYGFYPNHLYWRPTLTFLLLFVALAPILFAQVPRQMLWFSLAYPFLAFWLLWGGSIFL
FT                   PLVAAAGFLFGWLAYRLAARFGTIAAVAAAALVPVLWWLFLAGDVSDDLARLTGRTFPL
FT                   WLEEVRSDKFGGFVLAVTIGVSGIALSLPLGIILALGRRSDMFLIKALSVSFIEFIRGV
FT                   PLIALLFTASLLLNYFLPPGTTFDIILRVIIMVTLFAAAYIAEVIRGGLAALPRGQYEA
FT                   ADALGLDYWKAQRLIILPQALKISIPGIVSTFIGMFKDTTLVVFVGLLDPLKGITDAVR
FT                   ASTDWKGIYWEPYIFVGLIFFAFNFAMSRYSMHLERRLKTDHR"
FT   gene            409660..410448
FT                   /locus_tag="Rsph17029_0396"
FT   CDS_pept        409660..410448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0396"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsp:RSP_1750 ABC
FT                   glutamate/glutamine/aspartate/asparagine transporter,
FT                   ATPase subunit BztD"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75512"
FT                   /db_xref="GOA:A3PGP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGP6"
FT                   /protein_id="ABN75512.1"
FT                   /translation="MSEAIERAIDRSHMQVSDEVAIQISQMNKWYGSFHVLRDVNMTVH
FT                   KGERIVICGPSGSGKSTLIRCINRLEEHQSGQIVVDGIELTSDLKNIDKVRSEVGMVFQ
FT                   HFNLFPHLTILENCTLAPIWVRKTPKKEAEEVAMHYLKKVKIPEQAHKYPGQLSGGQQQ
FT                   RVAIARSLCMKPRIMLFDEPTSALDPEMIKEVLDTMIELAEEGMTMLCVTHEMGFAQAV
FT                   ANRVIFMDQGQIVEQNEPGEFFRNPKSERTKLFLSQILGH"
FT   gene            410658..411026
FT                   /locus_tag="Rsph17029_0397"
FT   CDS_pept        410658..411026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0397"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: rsp:RSP_1751 putative 2Fe-2S
FT                   ferredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75513"
FT                   /db_xref="GOA:A3PGP7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGP7"
FT                   /protein_id="ABN75513.1"
FT                   /translation="MANITFTSPIMHGPKTVYAVAGDTKTILAVAEEHRIPIPFDCKDG
FT                   NCASCLIEVTYEEPSLRKGITLTEKEKAKLRELGKITAQEIQDAEVLDLPPRYRLACQF
FT                   IARDENVTVAFSGEPGGA"
FT   gene            411333..412538
FT                   /locus_tag="Rsph17029_0398"
FT   CDS_pept        411333..412538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0398"
FT                   /product="peptidase M24"
FT                   /note="PFAM: creatinase; peptidase M24; KEGG: rsp:RSP_1752
FT                   putative creatinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75514"
FT                   /db_xref="GOA:A3PGP8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR039394"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGP8"
FT                   /protein_id="ABN75514.1"
FT                   /translation="MERPENYRFHNGEKAALPFPPEEYEARLEGLRDLMELHSLDAVVL
FT                   TSMHNVAYYSGFLYLSFGRPYACVVTPTDCVTVSAGIDGGQPWRRSVGDNITYTDWQRD
FT                   NFWRTVAQVTGTGRAIGCEADHLTMVQAEKLNAFLRPTRGMDIAPGTMAQRMLKSPAEI
FT                   ALIRHGAQVADVGGYAIREAIREGATELEIAMVGRDAMEREIAARFPEAEYRDSWVWFQ
FT                   SGPNTDGAHNPVTNRALRRGDILSLNCFPMISGYYTALERTLFLGEVDDASLKIWEANV
FT                   AAHEYGISLLQPGASCADVTAKLNAFLEERDLLRYRTFGYGHSFGLLSHYYGREAGLEL
FT                   REDIETVLEPGMVISMEPMLTLGAGQPGAGGYREHDILVITEDGPENITGYPYGPGFNV
FT                   VG"
FT   gene            412777..414948
FT                   /locus_tag="Rsph17029_0399"
FT   CDS_pept        412777..414948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0399"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75515"
FT                   /db_xref="GOA:A3PGP9"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGP9"
FT                   /protein_id="ABN75515.1"
FT                   /translation="MSMKLAGMTSALALAAAAPVLAETSFNRIATFATTANMAAGEDTS
FT                   RPTSAEIVSVSEDGLTLIYTDSPLGVVGLIDITDPEAPKPLGTIAMGGEPTTAVIAGAR
FT                   AYVAVNTSESYTAPSGKLVTVDLESREEVASCDLGGQPDSVAKAPDGSFLAIAIENERD
FT                   EEVNDGVLPQMPAGFLVKLPLTEAGADCAALERIDLTGLAAIAPEDPEPEFVSVNEAGD
FT                   IAVTLQENNEVVIVAADGTISHFPAGTVDLDGIDTKKDGRLSFTDRQEGRLREPDGIKW
FT                   IGTDHLATANEGDWNGGARGWTIFSRDGQVVWEAGASLERAIAAIGHYPEHRSKSKGVE
FT                   VESVEVASFGGTPLAFVASERASVVAVYDLTDPSAPRLLQILPSGISPEGVVAIPGRDL
FT                   LVTANEADLREDGGAPAHVMIYRRGEGPAAYPTLTSEGSDPLIGWGALSALAADARTQG
FT                   QLWAVSDSVYSMAPKIYRIDATATPARITEAIPVTRMGQPAQKLDLEGIATDGEGGFWL
FT                   ASEGSSAKLVPHAIYHVDGKGRIDEEIPFPAGLLAGETRFGLEGIAKVGDVLWMAVQRE
FT                   WKDDPKGQVKLLAYDLKEESWGAVRYPLDAPAEGAWMGLSELTVHGDWAWLIERDNRVA
FT                   DAGAAKRLTRVALSDLKPAPLGSELPLVKKEVVRDLVPDLQRLNGYVLDKVEGFAIDAA
FT                   GTGYFVTDNDGTDDASGETLFWSVDQLPE"
FT   sig_peptide     412777..412845
FT                   /locus_tag="Rsph17029_0399"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            415323..416132
FT                   /locus_tag="Rsph17029_0400"
FT   CDS_pept        415323..416132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0400"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   rsp:RSP_1754 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75516"
FT                   /db_xref="GOA:A3PGQ0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGQ0"
FT                   /protein_id="ABN75516.1"
FT                   /translation="MRHVRSIGFPAPPDGLIVTSRILSYALMALLPFLAACAQAPAPET
FT                   PKEHPLYPGIQDGEFFIEPVPTRYLTPDTVRQEVAYNGPEKPGTIVVDTFARRLYYVTD
FT                   EGRAMRYAIAVGRAGLAFRGNAKVQRKREWPSWQPTANMIRTQPEMYAPYAAGLPGGLQ
FT                   NPLGARALYLYRGGRDTMFRIHGTVQNASIGHATSAGCIRLFNQDAIDLYGRVNLGTPV
FT                   KVRTEAESLALEGQFHDDRYGRIAPGPAEPLTEEERILLSGVPAQTR"
FT   sig_peptide     415323..415439
FT                   /locus_tag="Rsph17029_0400"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.621) with cleavage site probability 0.616 at
FT                   residue 39"
FT   gene            complement(416178..416519)
FT                   /locus_tag="Rsph17029_0401"
FT   CDS_pept        complement(416178..416519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0401"
FT                   /product="protein of unknown function DUF861, cupin_3"
FT                   /note="PFAM: protein of unknown function DUF861, cupin_3;
FT                   KEGG: rsp:RSP_1755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75517"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGQ1"
FT                   /protein_id="ABN75517.1"
FT                   /translation="MSHLIRLNREAVAPEIERPAPDRLIAGDPVHTTWNLEERDGLFCG
FT                   IWQSTPGKWRVRYEEWEYIRILEGHSILTSAAGEAVTLRAGDSWIIRPGFEGTWEVIET
FT                   TVKDYVIRL"
FT   gene            416684..417517
FT                   /locus_tag="Rsph17029_0402"
FT   CDS_pept        416684..417517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0402"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="KEGG: rsp:RSP_1756 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75518"
FT                   /db_xref="GOA:A3PGQ2"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGQ2"
FT                   /protein_id="ABN75518.1"
FT                   /translation="MSVNSPVRPVMAADILARKGGEPIVCLTAYTTPMARLVDAHCDLT
FT                   LVGDSLGMVVHGLPTTLGVTMEMMILHGQAVARGTSRSMLVVDMPFGSYEESPAQAFAN
FT                   ARRLMAETGCAAVKLEGGQHMAETIRFLVARGVPVMAHIGLTPQAVNALGGYKVQGRGA
FT                   DAERVMEDAIAVAEAGAFSVVLEKVPDGLSQRITQRIAIPTIGIGASAHCDGQVLVLDD
FT                   MLGLFADFRPKFVKRYGELGASADEAIATYAAEVRARRFPAPEHVFADELKGKAQ"
FT   gene            417517..418356
FT                   /locus_tag="Rsph17029_0403"
FT   CDS_pept        417517..418356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0403"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: rsp:RSP_1757 probable pantoate--beta-alanine
FT                   ligase; TIGRFAM: pantoate--beta-alanine ligase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75519"
FT                   /db_xref="GOA:A3PGQ3"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGQ3"
FT                   /protein_id="ABN75519.1"
FT                   /translation="MPPVLRTVAELRARVSDWKAAGETVGVVPTMGALHEGHLSLARRA
FT                   RAACDRVIVTIFVNPRQFNNPADLEKYPRTEAQDAALLASVGVDAVFAPGPEEVYPRGF
FT                   ATNVSVSGVSEPLEGAHRPGHFDGVATVVAKLFGMTRADRAFFGEKDWQQLMVVRRLVA
FT                   DLNIPVTIEGCATVREADGLALSSRNRRLSAEGRARAPALVRAMQAATEAMRGGQAVPE
FT                   ALAEARAAVLAAGFETVDYLELRTADLLLPMERLEGRGRLLAAATLDGVRLIDNIPV"
FT   gene            complement(418463..419734)
FT                   /locus_tag="Rsph17029_0404"
FT   CDS_pept        complement(418463..419734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0404"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein; KEGG:
FT                   rsp:RSP_1758 probable succinyl-diaminopimelate
FT                   desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75520"
FT                   /db_xref="GOA:A3PGQ4"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGQ4"
FT                   /protein_id="ABN75520.1"
FT                   /translation="MDDRRLIAEVEARRADLVALTQDLVRIPTLNPPGRNYRALCDMLA
FT                   ARLAPQFEVELVRAHGAPGDSETYPRWNLIARRQGARDGDCVHFNSHHDVVEVGHGWTR
FT                   DPFGAEVEGDRLYGRGACDMKGGLAASVIAAEAFLAVCPDFAGSIEISATADEESGGFG
FT                   GVAYLARQGRFAHVQHVLIPEPLHKDRICLGHRGVWWAEVETQGRIAHGSMPFLGDSAI
FT                   RHMGALLAEIEERLYPLLATRTTAMPVTPEGARQSTLNINSIHGGEPEPEPGYTGLPAP
FT                   CVADRCRIVIDRRFLIEEDLDEVKAELRALAERLAEARPGFAFEIRDLFEVRPTLTDRD
FT                   APVVRSTAAAIERVLARQAEYVVSPGTYDQKHIDRIGKLKNCIAYGPGLLHLAHQPDEW
FT                   VGIADMLDSAKVMALVLADLLAPK"
FT   gene            419865..420134
FT                   /locus_tag="Rsph17029_0405"
FT   CDS_pept        419865..420134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1759 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75521"
FT                   /db_xref="GOA:A3PGQ5"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGQ5"
FT                   /protein_id="ABN75521.1"
FT                   /translation="MILGFLKLALVGFVLLTILYVLIRIYARSLRREALENEYDEGHGD
FT                   GPREAYIEAGMRDYEHSLRKKLILLVYIVPAIIFAAVFWTLNNP"
FT   gene            420142..420798
FT                   /locus_tag="Rsph17029_0406"
FT   CDS_pept        420142..420798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0406"
FT                   /product="protein of unknown function DUF1523"
FT                   /note="PFAM: protein of unknown function DUF1523; KEGG:
FT                   rsp:RSP_1760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75522"
FT                   /db_xref="GOA:A3PGQ6"
FT                   /db_xref="InterPro:IPR011088"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGQ6"
FT                   /protein_id="ABN75522.1"
FT                   /translation="MRYLKWTVPAVAALLVISFLHYTLPRHDVVRIVGTNTQRMDLGEN
FT                   AFFFASPDAGTNTATAGNRDIKFINAVRPNGKTIVYRNEDTGWGWPPYFKVNSFDIQAK
FT                   ATDLTSTEAEPKWVVVTRYGWRNQLFTTFPNAVKLREVASPEVTVIPWFNIFFFVALGG
FT                   LAILVRGMWMQFRERTIDPALEDMGDAWDRESGLARKRTRTNVGRLKAWMRSLRS"
FT   gene            complement(420909..423326)
FT                   /locus_tag="Rsph17029_0407"
FT   CDS_pept        complement(420909..423326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0407"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   KEGG: rsp:RSP_1761 phenylalanyl-tRNA synthetase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75523"
FT                   /db_xref="GOA:A3PGQ7"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGQ7"
FT                   /protein_id="ABN75523.1"
FT                   /translation="MKFTLSWLKDHLETEAPLDEIVTALTDLGHEVEGVEDPVKVLGAF
FT                   RICRVIEAQPHPNADRLRLCRVATWPNGPDAPSEEVQVVCGAPNARTGLVGVFAPVGTH
FT                   VPGTGVDLKPGVIRGVESNGMLCSERELMLSDDHDGIIDLPEDAPMGMRFIDYKGVNDP
FT                   TIEVKITPNRPDGLGVRGLARDLAARGLGRLKPLPVEPVPGLFPSPVSVTIEAALKEKG
FT                   CPLFAGRTIRGVKNGPSPDWLQARLRAVGLRPISTLVDITNYFTIGLNRPLHVFDVAKI
FT                   TGGLRIHAAEGGEELLALDGKTYKLRPGQMLISDDAQPESLAGIMGGELSGCTEETTDV
FT                   FLESAYWDPITIAATGRALKIVSDARYRFERGVDPAFTLPGLELATRMILDLCGGEASE
FT                   VVMDGAVPDTSRAYRFDPKRVVSLVGMEIPEAEQRTTLEALGFTLEGEMAAPPSWRPDV
FT                   QGEADLVEEIARVASLTKLQGKPLPRAQAGVPKPILTPLQVREQAARRTLAALGYNECV
FT                   TYSFIDEAAAKLFGGGSEAVRVENPISSEMTHLRPDLLPGLLRAAARNQARGFADMALC
FT                   EIGPVFAGGEPGEQQLQATGLLVGASAPRDPFGSRRPVDVYDAKADAEAVLAAVGAPAK
FT                   MQISRKVPGWWHPGRSGAVGLGPNLLATFGEVHPKILREMDVKGPAVAFTILVANVPLP
FT                   KVKTPTRPALKLSDLQAVERDFAFVVDASVEALTLVNAAQGADKALIESVRVFDQFSGD
FT                   KAEAQMGAGKKSLALTVRLQPTDRTLTDKDIEAVSAKIVEKVAKATGATLRG"
FT   gene            complement(423716..424432)
FT                   /locus_tag="Rsph17029_0408"
FT   CDS_pept        complement(423716..424432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75524"
FT                   /db_xref="GOA:A3PGQ8"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGQ8"
FT                   /protein_id="ABN75524.1"
FT                   /translation="MVSVHNIVTIQNVIAATLVVWYFAAVYYLELRRQFRYPEYPAARL
FT                   YPMWRKRFQLYGQLQANAAGNVTERSPEAQEVLQSFLRKVEVRSATLVALWAVLLGADL
FT                   MLAFSIPTWQPGRLLLIGLAVCCLPFVLRLGFGLSQVDQIAAHRVLTNATDDATAARRL
FT                   QDQLIEDLYRKELAFRFSAQGFRVMLLVLAMLTVGYLSTYIDWAAVRAQLPELTLPRLS
FT                   LPELSLPALSLPKFGF"
FT   gene            complement(424466..425548)
FT                   /locus_tag="Rsph17029_0409"
FT   CDS_pept        complement(424466..425548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0409"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="KEGG: rsp:RSP_1763 phenylalanyl-tRNA synthetase
FT                   alpha subunit; TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase, class IIc;
FT                   aminoacyl tRNA synthetase, class II domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75525"
FT                   /db_xref="GOA:A3PGQ9"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGQ9"
FT                   /protein_id="ABN75525.1"
FT                   /translation="MTALDTLRGKYIEAISSAADEAALEEVRLAALGKKGEISLKMREL
FT                   GQMSPEERQTTGAALNRLRDEIDASLRARKQGLADAALDARLKTEWLDVTLPGRPRRAG
FT                   TIHPVSQVMAELTAIFADMGFAVAEGPQVESDWFNFDALNIPPEHPARQEHDTFFMARA
FT                   EGDDRPPHVLRTHTSPVQIRAMQAQGAPIRVIAPGRVYRMDMDQTHTPMFHQVEGLAID
FT                   RDISMANLKWVLEEFCRAFFEVPSVELRFRASHFPFTEPSAEVDIRCSWEGGQLRIGEG
FT                   DGWLEILGSGMVHPKVLAAAGVNPDEWQGFAFGMGIDRIAMLKYGIPDLRAFFESDLRW
FT                   LRHYGFAALDMPDLAGGLSR"
FT   gene            complement(425753..426115)
FT                   /locus_tag="Rsph17029_0410"
FT   CDS_pept        complement(425753..426115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0410"
FT                   /product="LSU ribosomal protein L20P"
FT                   /note="TIGRFAM: ribosomal protein L20; KEGG: rsp:RSP_1764
FT                   50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75526"
FT                   /db_xref="GOA:A3PGR0"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGR0"
FT                   /protein_id="ABN75526.1"
FT                   /translation="MSRVKSGKVTHARHRKVIKQAKGYYAARSTNFRTATQAVDKANQY
FT                   ATRDRKARKRNFRALWIQRINAAVRLFDIEMTYSRFINGLSKAGIEVDRKVLADLAVHE
FT                   PEAFNAIAAQAKAALA"
FT   gene            complement(426128..426328)
FT                   /locus_tag="Rsph17029_0411"
FT   CDS_pept        complement(426128..426328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0411"
FT                   /product="LSU ribosomal protein L35P"
FT                   /note="PFAM: ribosomal protein L35; KEGG: rsp:RSP_1765 50S
FT                   ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75527"
FT                   /db_xref="GOA:A3PGR1"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGR1"
FT                   /protein_id="ABN75527.1"
FT                   /translation="MPKMKTKSAAKKRFSFTATGKVKAGPAGKRHGMIKRSTKFIRDVT
FT                   GTMILSDADAKIVKKYMPYDR"
FT   gene            complement(426444..427889)
FT                   /locus_tag="Rsph17029_0412"
FT   CDS_pept        complement(426444..427889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0412"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: pyruvate kinase; KEGG: rsp:RSP_1766 pyruvate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75528"
FT                   /db_xref="GOA:A3PGR2"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGR2"
FT                   /protein_id="ABN75528.1"
FT                   /translation="MRRLRNVKIVATLGPASNDYATIRALFEAGADVFRLNMSHGSHDD
FT                   IRARHQMLRQIEADTGTPVCILADLQGPKLRVGTFANGSEELVERGRFRLDLDPAPGTA
FT                   ERVNLPHPEIFAALEPGSSLLVNDGKIRLEVADCGPDFADCIVTVGGTISNRKGVNVPD
FT                   VVLPLAALSEKDRRDLEFVCELGVDWLALSFVQRPEDVEEARSLARGRAAILSKIEKPA
FT                   AVKAYDAILAVSDGIMVARGDLGVELPVQAVPPIQKRLVRGARAAAKPVIVATQMLESM
FT                   IDSPVPTRAEVSDVATAIYEGADAVMLSAESAAGSYPIEAVMTMNNTAISVESDPVYRD
FT                   IIEASRAAKRASVADAIVAAAREIAETTPIKAICCFTQTGKTVSLVARERPRVPILALT
FT                   PLVETARRLSLTWGTHCVVTAPQERFKGAVICAARAALSDGFAQEHEQIAVVAGVPFNV
FT                   RGTTNILRVAPCDERLIYSGDPE"
FT   gene            428030..428767
FT                   /locus_tag="Rsph17029_0413"
FT   CDS_pept        428030..428767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0413"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="PFAM: N-formylglutamate amidohydrolase; KEGG:
FT                   rsp:RSP_1767 possible N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75529"
FT                   /db_xref="GOA:A3PGR3"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR011227"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGR3"
FT                   /protein_id="ABN75529.1"
FT                   /translation="MTAFEIVGADRPSRWLVTCDHASNRVPPEVAGGDLGLPAAEMGRH
FT                   IAYDVGAAGLARALADRLDGPCVLSTFSRLVIDPNRGEKDPTLVMRLYDGTIIPANRHV
FT                   DAAEVERRLETLHRPYHAALARLAARRADTVIVAIHSFTPQLQGRPPRPWHVGILHSPL
FT                   NDRFSRALIERLQGEPDLCVGDNQPYLGHLPGDSIDRHALQRDRLNTLIELRHDLIREE
FT                   GQQTAWAERLAPILEEVLAALPD"
FT   gene            complement(429102..429962)
FT                   /locus_tag="Rsph17029_0414"
FT   CDS_pept        complement(429102..429962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0414"
FT                   /product="aminotransferase, class IV"
FT                   /note="PFAM: aminotransferase, class IV; KEGG: rsp:RSP_1768
FT                   aminotransferase class IV, putative D-alanine
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75530"
FT                   /db_xref="GOA:A3PGR4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGR4"
FT                   /protein_id="ABN75530.1"
FT                   /translation="MSRTVYVNGEYLPEEEATVSIFDRGFLMADGVYEVTSVLGGKLID
FT                   FPGHAARLDRSLTELEMTAPMNAEDLLEVHRELVRRNGIDEGLIYLQITRGNPGDRDFA
FT                   FPPADTKPTVVLFTQAKPGLAANPTARVGIKVISIPDIRWGRRDIKTVQLLYPSMAKMA
FT                   AKKAHVDDAWFVEDGLVTEGTSNNAYIVKGGKIITRNLSNDILHGITRAAVVRFAREAQ
FT                   MEVEERPFTIEEAQGADEAFFTSASAFVMPVVEIDGKAVGTGAPGPVAARLREIYLDES
FT                   LKAAV"
FT   gene            complement(429965..430927)
FT                   /locus_tag="Rsph17029_0415"
FT   CDS_pept        complement(429965..430927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0415"
FT                   /product="Mandelate racemase/muconate lactonizing enzyme,
FT                   C-terminal domain protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme, N-terminal domain protein; Mandelate
FT                   racemase/muconate lactonizing enzyme, C-terminal domain
FT                   protein; KEGG: rsp:RSP_1769 mandelate racemase / muconate
FT                   lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75531"
FT                   /db_xref="GOA:A3PGR5"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGR5"
FT                   /protein_id="ABN75531.1"
FT                   /translation="MITVTPESFRLAEVFTISRGSRTESRVLTVTVTREGLSGRGECVP
FT                   YARYGETLESVADQIATLPENLTRADLQTLLPAGAARNAVDCALWDLEAKDSGKRVWQL
FT                   LGLPAPQPQVTAFTLSLDAPEKMRAAAARNAHRPLLKIKLGTPDDMARLEAVRAGAPAT
FT                   RIIVDANEGWTADIYTELAPHLLRLGVALVEQPLPAGQDELLAEIARPLPVCADEACHD
FT                   RHSLPALKGKYDVVNIKLDKTGGLTEALALREAALAEGYGLMVGCMVGSSLAMAPATLV
FT                   AQGAAYVDLDGPLLLAEDREQPLVFDEAGIHPPSAELWG"
FT   gene            complement(431037..432038)
FT                   /locus_tag="Rsph17029_0416"
FT   CDS_pept        complement(431037..432038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0416"
FT                   /product="protein of unknown function DUF1611"
FT                   /note="PFAM: protein of unknown function DUF1611; KEGG:
FT                   rsp:RSP_1770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75532"
FT                   /db_xref="InterPro:IPR011669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035086"
FT                   /db_xref="InterPro:IPR035402"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGR6"
FT                   /protein_id="ABN75532.1"
FT                   /translation="MIETPYLLFLGDAPDALAAKVAQGIKDWRPEFAVGQFRMEGCKAD
FT                   MGLPDMTLAEAKAAGCKTLVIGVANRGGVISQAWKKVLISALEEGFDLASGLHNLLRDE
FT                   EDLAAVARATGRTLHDVRVPTVDYPIANGRKRTGKRMLAVGTDCSIGKMYTALCVDREM
FT                   RERGLKSSFRATGQTGILITGDGVPLDAVIADFMAGSIEYLTPDNEADHWDLIEGQGSL
FT                   FHVSYSGVTLALIHGGQPDALVICHEPTRSHMRGLPDYKLPSIEQVRDAALAMARVANP
FT                   ACVAVGCSINTQALSDEEALAYCAEVEARTGLPTVDPFRHGAGRLVDALMAV"
FT   gene            432306..433262
FT                   /locus_tag="Rsph17029_0417"
FT   CDS_pept        432306..433262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0417"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: rsp:RSP_1771 beta
FT                   subunit of citrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75533"
FT                   /db_xref="GOA:A3PGR7"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGR7"
FT                   /protein_id="ABN75533.1"
FT                   /translation="MSFRLQPAPPARPNRCQLFGPGSRPALFEKMAASAADVINLDLED
FT                   SVAPDDKAQARANIIEAINGLDWGRKYLSVRINGLDTPFWYRDVVDLLEQAGDRLDQIM
FT                   IPKVGCAADVYAVDALVTAIERAKGRTKPLSFEVIIESAAGIAHVEEIAASSPRLQAMS
FT                   LGAADFAASMGMQTTGIGGTQENYYMLHDGQKHWSDPWHWAQAAIVAACRTHGILPVDG
FT                   PFGDFSDDEGFRAQARRSATLGMVGKWAIHPKQVALANEVFTPSETAVTEAREILAAMD
FT                   AAKARGEGATVYKGRLVDIASIKQAEVIVRQAEMISA"
FT   gene            complement(433353..433817)
FT                   /locus_tag="Rsph17029_0418"
FT   CDS_pept        complement(433353..433817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0418"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: transcription activator, effector binding;
FT                   KEGG: rsp:RSP_6018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75534"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGR8"
FT                   /protein_id="ABN75534.1"
FT                   /translation="MFPVHIRETSPRRLAALRHTGSFEEIGATFGQICQILEERSLLSQ
FT                   AGCMIGVYWDNPLLAPPGALHSHAGIDLPEAMEIAPPLEELRLSGGRHAVLQYTGPYSG
FT                   LARAYRYFFSQWLPEAREIQAEGPLIEIYRNAEMETPSDQLVTEICVPLL"
FT   gene            434038..434997
FT                   /locus_tag="Rsph17029_0419"
FT   CDS_pept        434038..434997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0419"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /note="KEGG: rsp:RSP_1772 acetyl-CoA carboxylase alpha
FT                   subunit; TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit; PFAM: acetyl-CoA carboxylase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75535"
FT                   /db_xref="GOA:A3PGR9"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGR9"
FT                   /protein_id="ABN75535.1"
FT                   /translation="MNYLEFEKPLSEIEGKAEELRALARGNREMDVEKEASALDKKAET
FT                   LLKDLYKDLTPWRKCQVARHPDRPHCKDYIEGLFTEYTPLAGDRNFADDHAIMGGLARF
FT                   NDNPVVVIGQEKGHDTKTRIERNFGMARPEGYRKAIRLMEMAHRFRLPVITLVDTPGAY
FT                   PGKGAEERGQAEAIARATQKCLEIGVPLVAVVIGEGGSGGAVALATANRIAMLEHSVYS
FT                   VISPEGCASILWKDAEKMREAAEALRLTAQDLHKLGVIDRIIKEPLGGAQRGRRETVDA
FT                   VGKAIEMMLKELVGRKPEWLVKDRRNKFLDMGSKGLAA"
FT   gene            434994..435308
FT                   /locus_tag="Rsph17029_0420"
FT   CDS_pept        434994..435308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0420"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   rsp:RSP_1773 multidrug efflux pump, SMR family, DMT
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75536"
FT                   /db_xref="GOA:A3PGS0"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGS0"
FT                   /protein_id="ABN75536.1"
FT                   /translation="MTPWLLVLVAGLMETGWALGLKYSDGFTRPVPSVLTLVGAVASFW
FT                   LLSLAMKSLPVGTAYAVWVGIGAVGTALLAMALFGEPASPLRIAGIGLILAGIIALKLA
FT                   "
FT   gene            435458..436636
FT                   /locus_tag="Rsph17029_0421"
FT   CDS_pept        435458..436636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0421"
FT                   /product="glucose sorbosone dehydrogenase"
FT                   /note="PFAM: glucose sorbosone dehydrogenase; KEGG:
FT                   rsp:RSP_1774 putative glucose dehydrogenase B"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75537"
FT                   /db_xref="GOA:A3PGS1"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGS1"
FT                   /protein_id="ABN75537.1"
FT                   /translation="MIRRSPLVLLLLPAGAIAQPVEQGPPATDYEPAFETQTRAPALEA
FT                   TGATAEPFVQGLEHPWGIAALPEGGWLVTERPGRLRMVSEDGTLSDPIKGLPEVDARKQ
FT                   GGLLDVAAGPTFAEDRMIYWTYAKAVEGGTITAAARGVLSEDGTEVSAVEDIFRQEPPS
FT                   QAPMHYGSRILFDGEGHAIITTGEHSIEAERDRAQDLGTSYGKVIRVALDGRTPEDNPF
FT                   AESEGLGTIWSYGHRNIQSAAFDAEGQLWIVEHGPKGGDELNLIQPGANYGWPEVSYGV
FT                   NYDGSPVGTGEPRGEGFTEPTYYWDPVIAPGDMTFYRGTAFEGWQGDLLVGSMKPGGLV
FT                   RLTLEEGRVAGEERLLGDVGRVRDVEETGEGHLLLLIDAPDGGILRVTPEAG"
FT   sig_peptide     435458..435514
FT                   /locus_tag="Rsph17029_0421"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.928 at
FT                   residue 19"
FT   gene            complement(436661..437620)
FT                   /locus_tag="Rsph17029_0422"
FT   CDS_pept        complement(436661..437620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75538"
FT                   /db_xref="GOA:A3PGS2"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGS2"
FT                   /protein_id="ABN75538.1"
FT                   /translation="MTEPQDKSVDLGFYARERLAALSPLEAGVAGAGLLWTLSVALHLI
FT                   FRSDGGIFAHVMAILAVVLPLTLTVSMVLFLRTIRHLKAENERMASAVDAMRKAHLVSQ
FT                   QGGAARVALEKRVEELAAAQHQTETRLAELFAVPTEPAPAGRAPEDQPALALGGPRQRA
FT                   PLTVGDLVRAMNFPESAEDRAGFRALRRALEDPSSAKLIRAAQDVLTLLSQLGLFMEDF
FT                   PPDRARPDIWRRFAEGERGRPISDLGGIHDKEALASVAAKMREDAVFRDASHHFLRAFD
FT                   RTVSHFAGQASDAEIVDMSETRTARAFMLIGRASGTFD"
FT   gene            complement(437631..438101)
FT                   /locus_tag="Rsph17029_0423"
FT   CDS_pept        complement(437631..438101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0423"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: rsp:RSP_1776 transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75539"
FT                   /db_xref="GOA:A3PGS3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGS3"
FT                   /protein_id="ABN75539.1"
FT                   /translation="MDKIPMTRAGFTALDDELKTLKTVERPAVIRSIAEAREHGDLSEN
FT                   AEYHAAREKQSFIEGRIKELEAILSLAEVIDPAKLSGSIKFGATVTILDEETEEERTYQ
FT                   IVGEAEADIEAGLLNIKSPLARALIGKDEGDSIEVKTPGGERGYEVVSVRFV"
FT   gene            438374..440029
FT                   /locus_tag="Rsph17029_0424"
FT   CDS_pept        438374..440029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0424"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; electron
FT                   transfer flavoprotein-ubiquinone oxidoreductase; KEGG:
FT                   rsp:RSP_1777 putative electron transfer
FT                   flavoprotein-ubiquinone oxidoreductase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75540"
FT                   /db_xref="GOA:A3PGS4"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGS4"
FT                   /protein_id="ABN75540.1"
FT                   /translation="MTEQTPREQMEYDVVIVGAGPSGLSAAIRLKQLDPDLSVVLLEKG
FT                   SEVGAHILSGAVLDPAGLNALIPDWKEKGAPLNTPVTEDHFFVLTPAGQTMLPSWPVPK
FT                   LMDNHGNYVVSMGNVCRWLATQAEELGVEIFPGMSCSELVYGENGEVRGVVAGEFGKNA
FT                   DGTPGPSYEPGMELLGKYVMLAEGVRGSLSKQVMEKFDLRKGYGPQKYGLGMKEIWEID
FT                   PAKHKPGRIWHTMGWPLGKNAGGGSFIYHAENNQVFIGLVVHLNYENPHLYPYQEFQRF
FT                   KHHPMVAELLKGGKRVAYGARAISEGGYQSLPKMVFPGGALLGCSAGMVNVPRIKGNHN
FT                   AMLSGKAAAEAAHAAIKAGRQSDELSDYEQSVRKGPIGQDLWKVRNVKPIWSHLGLYAS
FT                   MALGGLDMWTNSLFNFSFFGTMKHHQTDAADTKPARDFAPIDYPKPDGVLSFDRLTNVA
FT                   FSFTNHEESQPAHLRLKDPAIPIAVNLPKYAEPAQRYCPAGVYEVVSEAGRDPRFVINF
FT                   QNCVHCKTCDIKDPSENIDWTTPQGGDGPNYPNM"
FT   gene            440129..441829
FT                   /locus_tag="Rsph17029_0425"
FT   CDS_pept        440129..441829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0425"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: rsp:RSP_1778 TPR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75541"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGS5"
FT                   /protein_id="ABN75541.1"
FT                   /translation="MANILMRPVLALALAALLPAAAGAQQEDAGAYLAARVAAAGSDYR
FT                   AAADWFTRALAADPSNTSLIEGALISDFSLGEIEKAVPLATRLTESGNGAQAAALVLLA
FT                   DRAKRQEYQAILTAEPTGLGPLVDRLSFAWAAFGAGRMSEALEAFDQLATTQGLEPFGL
FT                   YHKALALAAAGDFEGADEILSGRDGNALRVMRRGSIAHAQILSQLDRNADAVAMLEKSF
FT                   GTDADAGIDALKERLAAGETLPYDVARNATDGMAEIFFTLAGALSGEVDDGSTLLYART
FT                   ATHLRPDHTEALLLSAQILDNQGQHQLASETYARIPTADPMFFVAEIGRADALRADGKI
FT                   EASLEVLQGLARSKPELMQVHLALGDALRREERYADAVKAYDAAIARVPAPERQHWPLF
FT                   YSRGICHERLSHWKEAEADFRRALELNPDEPQVLNYLGYSFVDRGQNLEEALSMIERAV
FT                   AARPESGYIIDSLAWAYFRLGRYQDAVEPMEKASLLEPVDPIVTDHLGDVYWAVGRKLE
FT                   ARFQWHRALSFDPEEKEAQRIRRKLEVGLDALLAEEGAKPLSVAVRAND"
FT   sig_peptide     440129..440203
FT                   /locus_tag="Rsph17029_0425"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.901 at
FT                   residue 25"
FT   gene            441822..442658
FT                   /locus_tag="Rsph17029_0426"
FT   CDS_pept        441822..442658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0426"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: rsp:RSP_1779 putative
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase, C terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75542"
FT                   /db_xref="GOA:A3PGS6"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGS6"
FT                   /protein_id="ABN75542.1"
FT                   /translation="MTEAFARAKINLTLHVTGQRPDGYHLLDSLVVFADVGDRVRAEPA
FT                   EALSLAITGPQAANLPVADDNLVLRAARTLGGQGARLTLEKHLPVASGIGGGSADAAAA
FT                   LVALARLWQVPLPDPAAVLKLGADVPVCLEGRAVRMAGVGEILTPLAAPLPEAWLVLAN
FT                   PGVSVPTPPVFKALARRDNPPMPDDLPGWPTVESLAAFLATQRNDLEPPAIALAPEIAR
FT                   TRAALAAQPGCLLARMSGSGATCFGLFAAEEAARAAAEAIGAEHPGWWVAPARMVG"
FT   gene            442804..443313
FT                   /locus_tag="Rsph17029_0427"
FT   CDS_pept        442804..443313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75543"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGS7"
FT                   /protein_id="ABN75543.1"
FT                   /translation="MIWIRLLLLPLCLAPTLALAQVDATPATDPARFLALESVARTDAT
FT                   AQDLARRIEARAIAEAEAGSGEPVEVEGLLVDFADGRRLLHVALCGGAWFGNLGCHSSL
FT                   FTMPAGGTGFVRVLDLIGSGPIWFDSREGVGGWPDLILGGTRPNHPPYIRWRWTGQTFD
FT                   KVWPPG"
FT   sig_peptide     442804..442866
FT                   /locus_tag="Rsph17029_0427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 21"
FT   gene            complement(443321..444778)
FT                   /locus_tag="Rsph17029_0428"
FT   CDS_pept        complement(443321..444778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0428"
FT                   /product="putative membrane-anchored oxidoreductase"
FT                   /note="KEGG: rsp:RSP_1781 putative membrane-anchored
FT                   oxidoreductase; similar to L-sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75544"
FT                   /db_xref="GOA:A3PGS8"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGS8"
FT                   /protein_id="ABN75544.1"
FT                   /translation="MTRIRLLPLALLVAAPAFAADGFDVSTQIGPDPVLPAPEMSLLPD
FT                   LTVAEVVGWQEGETPTVPEGLSIAAYATGLANPRTVHTLPNGDVLVVQSRGPAGEPVSR
FT                   PKDLIRGWIMAMAHGGGGDQPPSNRITLLRDADRDGTVDERHDLLTDLNSPFGVAWIDD
FT                   RLYVAATDAILVYPYTLGQTEIVAKPEVLTPLPGGPINHHWTKDLALSPDGASLFVSVG
FT                   SNSNIVENGIEAEKGRAAIWQVDRETGAARVYASGLRNPNGLTFHPETGSLWTVVNERD
FT                   ELGPNLVPDYMTSVQEGAFYGWPWSYYGQHVDPRVHPERPDMVQAAIPPDYALSSHVAA
FT                   LGLTFSYGSALPEAWRSGAFVGEHGSWNRDAFNGYKVVYVPFVDGRPAETAQDVVTGFL
FT                   DGDRAHGRPVGVGIDGTGALLVADDAGNTVWRVAAADGTISDAPVGTDQVETEQSGAAA
FT                   APQEEAPRPTGTPAQTQIAPATEPLRP"
FT   sig_peptide     complement(444719..444778)
FT                   /locus_tag="Rsph17029_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 20"
FT   gene            complement(444771..445226)
FT                   /locus_tag="Rsph17029_0429"
FT   CDS_pept        complement(444771..445226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0429"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="KEGG: rsp:RSP_1782 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75545"
FT                   /db_xref="GOA:A3PGS9"
FT                   /db_xref="InterPro:IPR016923"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGS9"
FT                   /protein_id="ABN75545.1"
FT                   /translation="MPHAPAPSVAAIGGRPLHAMLVPFPIACLTLTLGADIAYWATGNL
FT                   MWQHFAEWLLLIAVVTGAVAALLGAIDLLVRRPLRRLRMGWIHGIGNLVALGLAVVNSF
FT                   VHARDGWTGVVPWGIVLSALTVAVMAVTVWLGLSMVFRHGAGVTRHD"
FT   gene            445374..446468
FT                   /locus_tag="Rsph17029_0430"
FT   CDS_pept        445374..446468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0430"
FT                   /product="membrane protein"
FT                   /note="KEGG: rsp:RSP_1783 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75546"
FT                   /db_xref="GOA:A3PGT0"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGT0"
FT                   /protein_id="ABN75546.1"
FT                   /translation="MPKERIVFQFAAYRIMSSRRHALRVAVQTAVATLAVHLLMRPLAP
FT                   DLESWAVIAALFTIGTSVDATLGAGISRIAGTVLGAGLGLAVTGLLGGSSLPALLLAAV
FT                   LSNSLAAIWPGLTYAAVMAAIVALDPSPDGRSALALSGAVVLGTIFGTAASFLVWPEFG
FT                   RNRAVLSLREAMDDCREFLGLIHKGVTTDDRRNRYFLHQRFRGHLFALYDRIAETHFTP
FT                   QVRSGAGLREAADAVEALWYALVILDRGVISGRARLPDSTVERVRPVLAAVQTEACRVL
FT                   ESASIAAGPGRATPTDPTELKRVLAEARELTLTVAAEGRDIAPAQEQALQALSFALDEM
FT                   ERSLMALMRVIEPECEAPDKVRAA"
FT   gene            complement(446496..446870)
FT                   /locus_tag="Rsph17029_0431"
FT   CDS_pept        complement(446496..446870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0431"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rsp:RSP_1784 response regulator receiver domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75547"
FT                   /db_xref="GOA:A3PGT1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGT1"
FT                   /protein_id="ABN75547.1"
FT                   /translation="MNTGMTGRALSGRSVLIVEDDFFLAHDLAAILEAEGAEVLGPAGT
FT                   LTEALDLASSSACDAAVLDVNLRHLTVQPVIEVLERRGVPLVLLTGASPETLPPDMRAL
FT                   PLMMKPVEAAALVAHLAACG"
FT   gene            complement(447242..448246)
FT                   /locus_tag="Rsph17029_0432"
FT   CDS_pept        complement(447242..448246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0432"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: rsp:RSP_1785
FT                   putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75548"
FT                   /db_xref="GOA:A3PGT2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGT2"
FT                   /protein_id="ABN75548.1"
FT                   /translation="MTVSIKDVARAAGVAPSTVSRALGKGPVSAEVRAQVEAAVRATGY
FT                   QPNLSARRLRSQVPATVGLVLADIRNPFFTRLSFGVEDAAYRAGLRVFLCNTDEDPARE
FT                   AMHLEMMAGERVSGLILAPTRELRPEALRRLQMPVVLVDRDPEGAGCDAVTLDNEGAMR
FT                   TLVDHVVASGRQRIAGLFGANSFTGEARARGFVAALARHGLPALVHRAPPNAVAGYAAL
FT                   ADWLEAERPEALIVSNGLFLEAAVRFCHDRGLVIPRDLAVAGVDDDPWTGIVNPGLTVL
FT                   RQPAETMGREALTLLLARLEMPDRPRRKLVLESELVPRDSTAPRLLSRDEPAA"
FT   gene            448414..450930
FT                   /locus_tag="Rsph17029_0433"
FT   CDS_pept        448414..450930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0433"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="TIGRFAM: phosphocarrier, HPr family;
FT                   phosphoenolpyruvate-protein phosphotransferase; PFAM:
FT                   phosphocarrier HPr protein; PEP-utilizing enzyme;
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2; PEP-utilising enzyme, mobile region;
FT                   PEP-utilising enzyme domain protein; KEGG: rsp:RSP_1786
FT                   multi-component fructose specific PTS system protein,
FT                   (PtsI, HPr, and IIA domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75549"
FT                   /db_xref="GOA:A3PGT3"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGT3"
FT                   /protein_id="ABN75549.1"
FT                   /translation="MTSLTRQGEIPRELIQLDARASSKEEAIAQAAAALVAAGCVRPGF
FT                   EASMLRREAVSNTYLGKGIAIPHGTVEDRDLIQKDAIAVLQVRDGVEWNAGERARLVVA
FT                   IAARSDGHIEILRRLTRLLQDEDRLAALAATDDRQALSDALNGVAAGAAATAEPAGDFA
FT                   QSFDWVLDYPTGLHARPATEWAEAARRFPCRIRIRHGAETADARNMISLLSLGLKSGDA
FT                   ITVSAEGQGAAEALATLKVTMTGLSAREKADAARAEEKRRATAAAGGWVPPSSPRAIEG
FT                   VPAAPGVAIGRITRIATDGMEIPDEPVELARAADLLHAALGQTAEQLHSLADDTARRLG
FT                   ESDAAIFRAQAGLLADPDLITLASQWLVDGHGLAWSWHRAYEDMAARLSALRNPVLAAR
FT                   AADLRDVGQRVLAHIDPRFARSRLADLPEDTILVAEDISPSDAAGLDPAKVAGLVTALG
FT                   GPTSHTAILARTLGLPAVVGTGAVVERLEDGACAIVDGHGGRLYLDPSEADLASARDWI
FT                   AAEEARRARAAETRALPATTRDGHRIDIGANINLAEQAAFALGQGAEGVGLMRTEFLFL
FT                   ERSESPTEDEQAEAYAAMARALEGRPLVIRALDIGGDKQVAHLDLPREENPFLGVRGAR
FT                   LLLRRPDLLVPQLRALYRAAAGGAQISVMFPMVTSLGELLELRATCERIRQELDAPVVP
FT                   LGIMVEVPSAALLAAEFAAHADFFSIGTNDLTQYALAIDRQNPELAPEADSLHPAVLRL
FT                   IDLTVKGAAVHGRWVGVCGGIAGDPFGAALLAGLGVDELSMTPRDIPAVKERLRQSDRA
FT                   GLRALAERALACSDAEAVRALAAEAP"
FT   gene            450927..451913
FT                   /locus_tag="Rsph17029_0434"
FT   CDS_pept        450927..451913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0434"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="PFAM: PfkB domain protein; KEGG: rsp:RSP_1787
FT                   probable 1-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75550"
FT                   /db_xref="GOA:A3PGT4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGT4"
FT                   /protein_id="ABN75550.1"
FT                   /translation="MSRVHTVTLNPAIDQTVSLPRLAVGEVNRATAVRHDPGGKGINVA
FT                   SVLADWGVSVAAHGLLGRANAAPFEALFAQKSIADRMLRVAGETRTNVKILEEDGRTTD
FT                   LNLPGFPADEGHLAALAEGLGSVAAGELVVISGSQPAGLPASATARLAARVQERGARVL
FT                   CDVSGAPLAEVLAAPLLPDAIKPNRHELEGWVGRSLADRADLAAAASALAARGIALVVV
FT                   SLGTEGALFVSSDGAVVARPVQLSRGSTVGAGDAMVAGLASALVEGLPLRATAARATAF
FT                   AAAKLQNPGPHLPGVDQVRALEARVERMAAADWIRAAGRTADQGERT"
FT   gene            451910..453655
FT                   /locus_tag="Rsph17029_0435"
FT   CDS_pept        451910..453655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0435"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   subunnit; PTS system, fructose subfamily, IIC subunit;
FT                   PFAM: phosphotransferase system, EIIC; phosphotransferase
FT                   system PTS, fructose-specific IIB subunit; KEGG:
FT                   rsp:RSP_1788 PTS system, fructose-specificIIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75551"
FT                   /db_xref="GOA:A3PGT5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGT5"
FT                   /protein_id="ABN75551.1"
FT                   /translation="MTGIVAVISTGSFGPHAALAREALRKAAQGLGRAIAVELRTQETV
FT                   TDALPPEAVSGASQVLLVTEPGGAAADEARFAGRPTIHATLAEVLEDAPGVLARTGSGA
FT                   AAAPAADPAAAEGALKIVAITSCPTGIAHTFMAAEGLVEGARAQGHQIRVETQGSVGAQ
FT                   DELTAAEIAAADLVIIAADKQVDLGRFGGKRLFLSPTKPAITDGAGLIRKAQAEARMQA
FT                   GSASSEAAQPEAKKVGVYKHLMTGVSFMLPFVVAGGLLIAIAFALGGIYVYEDQYAGTL
FT                   GHTLFQIGAKGAFTLMVPALAGYIAWSIADRPGLAPGMTGGVIAGTIGAGFLGGIVAGF
FT                   IAGYGVLWLNRAIKLPKTLQGLKPVLILPLLGTALTGLLMYYVVGEPTARLLATITAFL
FT                   QGMQGTSAALLGLLLGGMMAVDMGGPVNKAAYAFATTLIAANVLEPMAAVMCAGMVPPI
FT                   ALAVACRLLPARFTPEEREAGNAAFVLGLAFVTEGAIPFAARDPLRVIPSLIAGSAVAG
FT                   AICMALGVAQRVPHGGIFVLPIPNAVTNLTGFGIALVAGTVVSVVALALVKRRIVVPAA
FT                   VPSAV"
FT   sig_peptide     451910..451972
FT                   /locus_tag="Rsph17029_0435"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.974 at
FT                   residue 21"
FT   gene            complement(453763..454089)
FT                   /locus_tag="Rsph17029_0436"
FT   CDS_pept        complement(453763..454089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0436"
FT                   /product="protein of unknown function UPF0060"
FT                   /note="PFAM: protein of unknown function UPF0060; KEGG:
FT                   rsp:RSP_1789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75552"
FT                   /db_xref="GOA:A3PGT6"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGT6"
FT                   /protein_id="ABN75552.1"
FT                   /translation="MGLSLAAYAGAALAEIAGCFAVWAWWRLGASALWLVPGALSLGAF
FT                   AWLLALTPVEAAGRSYAVYGGVYVAASLLWLWAVEGVRPDRWDMGGAALVLAGAAVILW
FT                   APRG"
FT   sig_peptide     complement(454015..454089)
FT                   /locus_tag="Rsph17029_0436"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.818) with cleavage site probability 0.420 at
FT                   residue 25"
FT   gene            complement(454089..454574)
FT                   /locus_tag="Rsph17029_0437"
FT   CDS_pept        complement(454089..454574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0437"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: rsp:RSP_1790
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75553"
FT                   /db_xref="GOA:A3PGT7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGT7"
FT                   /protein_id="ABN75553.1"
FT                   /translation="MSSTTQEPNVSSNYRFKGFLMLTIGKLAEAAGVKVPTIRYYEQIG
FT                   LLPPPERSAGNQRLYGHRAEERLAFIRHARDLGFPLEAIRDLLSLSDRPDQSCEAADAI
FT                   ARAQLSAVRARIGRLRALEAELERMIGQCAHSTIADCRVIEVLGDHAHCVHEHRKEP"
FT   gene            454598..456820
FT                   /locus_tag="Rsph17029_0438"
FT   CDS_pept        454598..456820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0438"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: rsp:RSP_1791 heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75554"
FT                   /db_xref="GOA:A3PGT8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGT8"
FT                   /protein_id="ABN75554.1"
FT                   /translation="MTNDTSGAVREWRVTGMDCASCAGRIRDAVGRLPGVSGVEVAIMS
FT                   ERLKLTLDEGQGAPEAVEATVRKLGFGIAPRAEARPFVLPEAAEAACGCGACGTDAPHA
FT                   HSHSHDHEAAEPGVWYRTAKGRLVLLTGVLLACAWTVEALVPGPVGPVAFALACLIGLV
FT                   PIARRAFAALRLGQPFTIEGLMTVAAAGALFIGAAEEAALVIFLFAVGEVLEGVAASRA
FT                   RDGIRALSRLVPETARLERDGRTVEVPAAGLQPGQIVRVRPGERIPADGEILEGQGGLD
FT                   ESPVTGESIPVTRGPGEAVFAGAVATDAALRIRVTRAAKDNTIARIVRLVEEAEEARAP
FT                   TERFIDRFSRWYMPLIVGLAVAVAVLPPLAAGADWSTWIYRGLALLLIGCPCALVISVP
FT                   AAIASTLASGARRGLLMKGGAVIEAAAAVRQVAFDKTGTLTRGRPEVTDVVTLSGEPEV
FT                   RVLALAAAVERGSAHPLAQAILARAEAAGAPDLLAEAARSLAGRGAEARVEGEDLWVAS
FT                   PSFAAERGVLDAGTRARAEALEAEGKTVTVLFREGRTLGLLALRDEPRGDAAEAVRQLG
FT                   RMGVSATILTGDNARTAEAIAARLGTGFRAQMRPEDKLAAIREMAGQGGVMMIGDGIND
FT                   APALKAASVGVAMGSGTDVALETADAAILRDRVTDVPATIRLARAAMRNIRQNIAVALG
FT                   LKGVFLVTSVLGITGLWIAILADTGATVLVTLNALRLLRFDPEARG"
FT   gene            complement(456944..457465)
FT                   /locus_tag="Rsph17029_0439"
FT   CDS_pept        complement(456944..457465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0439"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: rsp:RSP_1793 single-strand DNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75555"
FT                   /db_xref="GOA:A3PGT9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGT9"
FT                   /protein_id="ABN75555.1"
FT                   /translation="MAGSVNKVIIIGNLGRDPEVRSFQNGGKVVNLRIATSEQWRDRAS
FT                   GERKERTEWHSVAIFDENLARVAEQYLRKGSTVYIEGQLETRKWQDQSGQDRYSTEVVL
FT                   RPFRSSLTMLGGRGEGAGAGGGMGGGGYEDRGGPDSYDNYGSSPRGGASSGGAPSGGGR
FT                   RNDLDDEIPF"
FT   gene            457679..458293
FT                   /locus_tag="Rsph17029_0440"
FT   CDS_pept        457679..458293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0440"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   rsp:RSP_1794 putative lytic transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75556"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGU0"
FT                   /protein_id="ABN75556.1"
FT                   /translation="MRRLIGALGAAVVGLGLASGPTEGLADGLKIQRSTMNRAGIFKSQ
FT                   TRLLDGRLSQQYESSTRLKPKVETLAAALPTARYNGRYKGEFLESAKSAARKHGVPEDL
FT                   YLRLVQQESGWNPGAVSVKGATGLAQLMPGTAQLLRVNINDPHQNLEGGARYLKMMYNK
FT                   FGTWQLALAAYNAGPQAVEKHSGIPPYRETQNYVKVIWGNG"
FT   sig_peptide     457679..457735
FT                   /locus_tag="Rsph17029_0440"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.417 at
FT                   residue 19"
FT   gene            complement(458417..459709)
FT                   /locus_tag="Rsph17029_0441"
FT   CDS_pept        complement(458417..459709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0441"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: rsp:RSP_1795 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase, class II (G,
FT                   H, P and S); seryl-tRNA synthetase, class IIa"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75557"
FT                   /db_xref="GOA:A3PGU1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGU1"
FT                   /protein_id="ABN75557.1"
FT                   /translation="MHDIRIIREFPDRFDTALSRRGLSALSGEILAIDEARRSKILAAE
FT                   TAQAEQNRASKEVGAAKARGDEAEFERLRALVAEKKAEVARLNEEAAAEDARLRDMLVA
FT                   IPNLPLDEVPEGPDESANVEIRRWGTPRGFNFAPKEHFEIAGVKPGMDFATAAKLSGSR
FT                   FVMLKGAVIRVHRALAQFMLDTHVTEHGLTETWTPVLVKDEAMFGTGQLPKFSEDSYQT
FT                   TNGWWLIPTSEVTLTNTVSGEILDEAQLPVRMTAHTQCFRSEAGSAGKDTSGMLRQHQF
FT                   EKVEMVSITTPETSLAEHERMTGCAEAILQKLGLPYRTIVLCTGDMGFGATKTHDLEVW
FT                   LPGQNTYREISSVSVCGDFQARRMNARFRPAGGGKPEFVHTLNGSGLAVGRCLIAVLEN
FT                   GQQEDGSVELPEALHPYLGGKTRISADGTLE"
FT   gene            complement(459816..460373)
FT                   /locus_tag="Rsph17029_0442"
FT   CDS_pept        complement(459816..460373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0442"
FT                   /product="superoxide dismutase, copper/zinc binding"
FT                   /note="PFAM: superoxide dismutase, copper/zinc binding;
FT                   KEGG: rsp:RSP_1796 putative copper/zinc superoxide
FT                   dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75558"
FT                   /db_xref="GOA:A3PGU2"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGU2"
FT                   /protein_id="ABN75558.1"
FT                   /translation="MSRTIAIAAAALLAAPALAQDVPARAENATAAPGQPGHPERTATF
FT                   MSVEGTPLGKATIAPLPHGVLFTLDLQGLPPESWLGFHIHETGECDAGTGFKSAGGHFS
FT                   IAETEHGLMVEAGPHAGDMPNQYVGADGILRAQVFNTFVQLGGENASDLTGRALMLHSG
FT                   PDDYVSQPAGDAGDRLACAVIE"
FT   sig_peptide     complement(460314..460373)
FT                   /locus_tag="Rsph17029_0442"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            460657..460983
FT                   /locus_tag="Rsph17029_0443"
FT   CDS_pept        460657..460983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0443"
FT                   /product="protein translocase subunit yajC"
FT                   /note="TIGRFAM: preprotein translocase, YajC subunit; PFAM:
FT                   YajC family protein; KEGG: rsp:RSP_1797 putative preprotein
FT                   translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75559"
FT                   /db_xref="GOA:A3PGU3"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGU3"
FT                   /protein_id="ABN75559.1"
FT                   /translation="MFVTPAFAQAASGGAAGAFTSFVPLILIFVIMYFLLIRPQQKKLK
FT                   EHKAMVEALRRGDQVLTGGGIVGKVVKVHEDGIVDVEIADGVKVRVMKSTIVQVMSKTE
FT                   PAAA"
FT   gene            460999..462663
FT                   /locus_tag="Rsph17029_0444"
FT   CDS_pept        460999..462663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0444"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecD; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: rsp:RSP_1798
FT                   protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75560"
FT                   /db_xref="GOA:A3PGU4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGU4"
FT                   /protein_id="ABN75560.1"
FT                   /translation="MLHFPVWKRVLIWGICALAILYAAPNFFYSRVESHNDAVAAIEKA
FT                   GGTATPEQTAAVGLWPEWLPSNIVNLGLDLRGGAHLLAEVRVEDVYAARMDGLWPEVRD
FT                   ALRGLRDQVGSIRRQTAPAGELRVAISRPEGMQAALEAARRLAQPVVSFTGMGQNDIEI
FT                   SSQGDVLVIRLTDAEKTAMDSRTVQQSLEIIRRRVDEVGTREPTIQRQGEDRILIQVPG
FT                   IGSAAELKSLIGTTAKLTFHPVLGRTADAQSSASGDLVLPAANEQGIFYVLDRSPVVTG
FT                   EELVDAQPSFDQNNRPAVSFRFNPSGARAFGDYTAQNIGKPFAIVLDNEVISAPVIQAH
FT                   IAGGSGIITGNFSVEESTELAVLLRAGALPAEMTFLEERTIGPELGQDSIDAGRTAAIV
FT                   GMIAVVAFMIASYGWFGVLANIALAINMLAIIALLSVVGATLTLPGIAGIVLTIGVAVD
FT                   ANVLIYERIREELRQGKQPGRAIELGFEKALSAIVDANVTTFLVALIMFLVGAGPVRGF
FT                   AVTLTIGIFTSVFTAVYVTRILIATWFAWRRPRTIVV"
FT   gene            462673..463647
FT                   /locus_tag="Rsph17029_0445"
FT   CDS_pept        462673..463647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0445"
FT                   /product="protein translocase subunit secF"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecF; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: rsp:RSP_1799
FT                   protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75561"
FT                   /db_xref="GOA:A3PGU5"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGU5"
FT                   /protein_id="ABN75561.1"
FT                   /translation="MAFRLKLCPEKTNIDFFWAAPVTFGFSVFLMAASLVAWLTLGLNF
FT                   GIDFRGGTTIRTESTQAVDVAAYRAALEGQDLGDISITEVFDPGFRADQHVAMVRIGAQ
FT                   DATQSITPEQIGQVEEALKTVDPSITFPSVESVGPKVSGELIRSAILAVAAACAGIAVY
FT                   IWLRFEWQFALGSVAALIHDVLVTIGVFALFQIKFDLTTVAALLTVLGYSINDTVVVFD
FT                   RLRENLVKYKTMPLRDVMNLSVNETLSRTIMTLMTTLIALVSLLVFGGDVIRGFVFAIT
FT                   FGVVIGTYSSVYMAKNIVLYLGVDRGGPKKDSKAGTQFANNDA"
FT   sig_peptide     462673..462771
FT                   /locus_tag="Rsph17029_0445"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.900) with cleavage site probability 0.620 at
FT                   residue 33"
FT   gene            463823..464176
FT                   /locus_tag="Rsph17029_0446"
FT   CDS_pept        463823..464176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0446"
FT                   /product="protein of unknown function DUF498"
FT                   /note="PFAM: protein of unknown function DUF498; KEGG:
FT                   rsp:RSP_1800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75562"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGU6"
FT                   /protein_id="ABN75562.1"
FT                   /translation="MRLTEITYDSAQPVEGYGPGYFRIGGEVLEGACLISPWGAGPWGG
FT                   LEDMAGPLALIDRIDVLFVGMGADVAHVPQAFRAALEEAGIGVEAMSSPAACRTYNVLL
FT                   SEGRRVAIALLPV"
FT   gene            464244..464876
FT                   /locus_tag="Rsph17029_0447"
FT   CDS_pept        464244..464876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0447"
FT                   /product="heme exporter protein CcmA"
FT                   /note="KEGG: rsp:RSP_1801 ABC heme exporter, ATPase subunt
FT                   CcmA; TIGRFAM: heme exporter protein CcmA; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75563"
FT                   /db_xref="GOA:A3PGU7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGU7"
FT                   /protein_id="ABN75563.1"
FT                   /translation="MDLTVTNLACARGGVTVLERVSFRLSRGAALILRGPNGIGKTTLL
FT                   RTVAGLQPAVAGEISMPPEAVAYAAHADGLKATLTVAENLAFWAAIYGTDRAARAIERM
FT                   NLAALADRQAQNLSAGQKRRLGLARLLVTGRPLWVLDEPTVSLDAASVALFGEVVRAHL
FT                   AEGGAALMATHIDLGLAEAEVLDLAPYRAETPAGGEAADDPFAGVTA"
FT   gene            464873..465529
FT                   /locus_tag="Rsph17029_0448"
FT   CDS_pept        464873..465529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0448"
FT                   /product="heme exporter protein CcmB"
FT                   /note="TIGRFAM: heme exporter protein CcmB; PFAM:
FT                   cytochrome c-type biogenesis protein CcmB; KEGG:
FT                   rsp:RSP_1802 ABC heme exporter, inner membrane subunit
FT                   CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75564"
FT                   /db_xref="GOA:A3PGU8"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGU8"
FT                   /protein_id="ABN75564.1"
FT                   /translation="MIALLLRDLRLALRAGGGFGLGLAFFLLVAVLVPLGVGPEPATLA
FT                   KIAPGILWVGALLACLLSLDRIFALDHEDGSLDLLATAPIPLEGVVAVKACAHWLVTGL
FT                   PLTLVSPLLGLLMNLPAEGYPLLLASLAIGTPALSVIGTFGAALTVGLKRGGLLLSLLV
FT                   LPLYVPTLVFGAEAVRRGALGMDVATPFLLLGGITAGVAALLPFASAAAVRINLR"
FT   gene            465572..466306
FT                   /locus_tag="Rsph17029_0449"
FT   CDS_pept        465572..466306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0449"
FT                   /product="heme exporter protein CcmC"
FT                   /note="TIGRFAM: heme exporter protein CcmC; PFAM:
FT                   cytochrome c assembly protein; KEGG: rsp:RSP_1803 ABC heme
FT                   exporter, inner membrane subunit CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75565"
FT                   /db_xref="GOA:A3PGU9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGU9"
FT                   /protein_id="ABN75565.1"
FT                   /translation="MAMSIWEYANPKKFMETSSIALPWATGGALLCLIVGLVWGFFFTP
FT                   DDFKQGSTVKIIYLHVPSALMAINAWLMMLAASLIWLVRRHHVSALAAKAAGPVGLTFT
FT                   LVALVTGAVWGQPMWGTWWAWDPRLTSFLILALFYLGYIALWQAVENPDTAADLTSVLC
FT                   IVGSVFAVLSRYAVNFWNQGLHQGASLSLDKEENVADVFYFPLLVCIAGFVLLFLTLVL
FT                   LRTRTEIRVRRVQALLARERMA"
FT   gene            466303..466464
FT                   /locus_tag="Rsph17029_0450"
FT   CDS_pept        466303..466464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0450"
FT                   /product="Heme exporter protein D (CcmD)"
FT                   /note="PFAM: Heme exporter protein D (CcmD); KEGG:
FT                   rsp:RSP_1804 heme exporter protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75566"
FT                   /db_xref="GOA:A3PGV0"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGV0"
FT                   /protein_id="ABN75566.1"
FT                   /translation="MIPDLGKYAVSVLTAYGASIALLAGLVALSLWRGARVRRMLREVE
FT                   QRQGRIDG"
FT   gene            466457..466996
FT                   /locus_tag="Rsph17029_0451"
FT   CDS_pept        466457..466996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0451"
FT                   /product="periplasmic protein thiol--disulfide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE; PFAM: alkyl hydroperoxide reductase/
FT                   Thiol specific antioxidant/ Mal allergen; Redoxin domain
FT                   protein; Thioredoxin domain; KEGG: rsp:RSP_1805 probable
FT                   thiol-disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75567"
FT                   /db_xref="GOA:A3PGV1"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGV1"
FT                   /protein_id="ABN75567.1"
FT                   /translation="MAKVLMFVPPVLFAGLAAMFFVGMQRENPDELPSALAGKPAPAVR
FT                   TEPLGDHPPFEDAILRAPGVKLVNYWASWCAPCRVEAPTLEALAADGVEIHGVNYKDKP
FT                   ENAEAFLAELGNPYATLGADASGRMALDWGVYGVPETYVIDGKGRIVLRFPGPVTERVL
FT                   EETIRPAMEKAAAAAR"
FT   gene            complement(467196..469880)
FT                   /locus_tag="Rsph17029_0452"
FT   CDS_pept        complement(467196..469880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0452"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="TIGRFAM: aconitate hydratase 1; PFAM: aconitate
FT                   hydratase domain protein; KEGG: rsp:RSP_1806 aconitate
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75568"
FT                   /db_xref="GOA:A3PGV2"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGV2"
FT                   /protein_id="ABN75568.1"
FT                   /translation="MTVTVGHDSQKTRKTLSVGGSSYAYYSIPAAEEAGLGQFARLPAA
FT                   LKVVLENMLRFEDGKTVSVDDIRAFSEWGANGGRNPREIAYRPARVLMQDFTGVPAVVD
FT                   LAAMRDGILGLGGDAQKINPLNPVDLVIDHSVMIDEFGNPRAFQMNVDREYERNMERYT
FT                   FLKWGQKAFNNFRVVPPGTGICHQVNLEYLAQTVWTDRDQDGMEVAYPDTLVGTDSHTT
FT                   MVNGLAVLGWGVGGIEAEAAMLGQPVSMLIPEVVGFKLTGQMIEGTTATDLVLKVVQML
FT                   RKKGVVGKFVEFYGEGLDHLPLADRATIANMAPEYGATCGFFPIDNETLRYLRQTGRDE
FT                   ARIALVEAYAKANGLWRDASYEPIYTDTLHLDMGEIVPAISGPKRPQDYLPLTDAKASF
FT                   AREMETSFKRPVGKEVPVAGEDYTMSSGKVVIASITSCTNTSNPYVLIGAGLVARKARA
FT                   LGLNRKPWVKTSLAPGSQVVSEYLEAAGLQEDLDAVGFNLVGYGCTTCIGNSGPLQPEI
FT                   SAAINEGDLVAAAVLSGNRNFEGRISPDVRANYLASPPLVVAYALAGDMNIDLTSEPLG
FT                   MGTNGPVYLKDIWPTNAEIAELVEKTVTREAFQKKYADVFKGDAKWQAVSTTDSQTYDW
FT                   PASSTYIQNPPYFQNMSKEPGVITDITGARILALLGDMITTDHISPAGSFKESTPAGKY
FT                   LVERQVSPREFNSYGSRRGNHEVMMRGTFANIRIKNEMLDGVEGGYTLGPDGQQTSIFD
FT                   ASMAYQAAGIPLVLFGGIEYGAGSSRDWAAKGTALLGVKAVIAESFERIHRSNLVGMGV
FT                   IPFEFTEGQNRKSLGLKGDETVSIQGLSGDLKPLSLVPCTITYGDGTVKTIQLKCRIDT
FT                   EIEIEYVEHGGVLHYVLRDLASV"
FT   gene            470102..470809
FT                   /locus_tag="Rsph17029_0453"
FT   CDS_pept        470102..470809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0453"
FT                   /product="protein of unknown function DUF1223"
FT                   /note="PFAM: protein of unknown function DUF1223; KEGG:
FT                   rsp:RSP_1807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75569"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGV3"
FT                   /protein_id="ABN75569.1"
FT                   /translation="MQMRWTLGAACALSLGIAGVAHGQSQAGVVVELFTSQGCSACPPA
FT                   DAFLAALAADPRVIPLALHVDYWDYIGWEDQFADARFTQRQKSYARAIGSRTIYTPQMI
FT                   VGGTDRVEGNAPEKVAALILKHMQAAERVGLWLERDGDVLRIHAEADPPLDEAVRVQLV
FT                   RYRPEETVAIEHGENEGRTVTYRNIVTSWEVVGDWGGQAPLSIEAKAAGAEPLAVILQN
FT                   EGPGAILAAASLR"
FT   sig_peptide     470102..470173
FT                   /locus_tag="Rsph17029_0453"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.974 at
FT                   residue 24"
FT   gene            complement(470988..472046)
FT                   /locus_tag="Rsph17029_0454"
FT   CDS_pept        complement(470988..472046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75570"
FT                   /db_xref="GOA:A3PGV4"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGV4"
FT                   /protein_id="ABN75570.1"
FT                   /translation="MIRRLARAVLGLALMGSLAATGLTAARIARDPALTPFTEAAADEI
FT                   RAASDRAMARHAPPEAILARLAKRLAEEPPNPVTVEALAELAAEQGLTLPPDTAARLEE
FT                   LREETLWEDAAGCLACLWDAASCSLSAELLCQAPMVLTPAGDVAGLARAGQAWASGAEV
FT                   DRVDLTLSTVGLGATAAVLVSGGSSATVKVGAGLLRMAHRMRLLSPPLARLVTRTAATA
FT                   VDWARLPAVRSTGDMAGLLRPEALRPMAEVAEGLGRIGARLPPAQTLHLLRHVDDAADA
FT                   RRFAAAAEALGPRTVARVEMLGKARFLRATLRWSDATRALMASLAALLASATALLMGAA
FT                   QSLGLRLLRRLA"
FT   sig_peptide     complement(471969..472046)
FT                   /locus_tag="Rsph17029_0454"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.440 at
FT                   residue 26"
FT   gene            complement(472043..473116)
FT                   /locus_tag="Rsph17029_0455"
FT   CDS_pept        complement(472043..473116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0455"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: rsp:RSP_1808 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75571"
FT                   /db_xref="GOA:A3PGV5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGV5"
FT                   /protein_id="ABN75571.1"
FT                   /translation="MAPFYQTEPTMTEPVQTPQVFPTRVFSGIQPSGGLTLGNYLGALK
FT                   RFAEMQKDGVETIYCVVDMHAITVWQDPAKLRQQTREIAAAFLAAGVDPVRSILFNQSQ
FT                   VTAHAELAWIFNCVARMGWMNRMTQWKDKAGKNAEAASLGLFAYPALMAADILAYRATH
FT                   VPVGEDQKQHVELTRDIAIKFNNDFGVNFFPVTEPVIEGVATRVMSLRDGTKKMSKSDP
FT                   SDQSRINMTDDADTITQKIRKAKTDPEPLPDSIEGLKERPEARNLVNIYAALSRSTPEA
FT                   VVAEFAGAQFGSFKPKLAELAVSVMAPISDEMNRLMADPAEIDRILGDGADRAEALARP
FT                   VLDEVYDIVGMIRSRRR"
FT   gene            473178..473864
FT                   /locus_tag="Rsph17029_0456"
FT   CDS_pept        473178..473864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0456"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: sil:SPO0393
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75572"
FT                   /db_xref="GOA:A3PGV6"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGV6"
FT                   /protein_id="ABN75572.1"
FT                   /translation="MRDNYNASPVNPMPAVVWLLALPIVAMEAVVALGASGIVGGGAGA
FT                   GWRLDAWQRFAFSPDLMRAMLETHTYPWQGMIRLVSYPLVHATFLHALMAVVILLALGK
FT                   MVGEVFRPWAVAAVFLGAAVVGALAYAAIPGVRAPLIGAYPADYGLVGAFTFLIWTRLA
FT                   ATGGNQYRAFSLIGMLLGIQLLFGLFFGGGYEWVADLAGFATGFLLSFAVSPGGWARVK
FT                   EKLRRR"
FT   gene            complement(473897..475438)
FT                   /locus_tag="Rsph17029_0457"
FT   CDS_pept        complement(473897..475438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0457"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein; KEGG: rsp:RSP_1810
FT                   putative virulence factor, MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75573"
FT                   /db_xref="GOA:A3PGV7"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGV7"
FT                   /protein_id="ABN75573.1"
FT                   /translation="MKPISLARGFLTVGGWTLLSRGAGFARDVMMAAYLGAGPVAEAFV
FT                   VAFALPNMFRRFFAEGAFNMAFVPMFAKKLEGHEDAKAFARDAFSGLAGILVVFTLLGT
FT                   LLMPWLVLAMASGFAGDARFDLAVEFGRIAFSYIFFISLVALLSGVLNAFGRFTEASFV
FT                   PVLMNLMFIAAMLIADRQGWDMGLTLAWTVPVTGVAQFLFTWFAARRLGFTLWPHLPRL
FT                   TPDLKRLAVIAAPAVLAGGVVQVNLLVGRQVASFTEGAVAWLSYADRLYQLPLGVVGIA
FT                   IGTVLLPDLSRRLRAGDEAGSRASFNRGTEFALMLTVPAAVALVVIALPLTQVLFQRGA
FT                   FGADDAWNTALALGAYGLGLPAFVLHKVLQPLYYAREDTRRPFHYAVVSMVVNLAFAIG
FT                   LMPVMGFLAAALATTVSGWVMVWQLWAGSRGMGAASRLDERLRARLPRIVVAALFMGLV
FT                   LYGVTGLLEPLLSEPGWRYPGLAALVAAGIASYFGAGAAIGAFRLSDLRSLRRRA"
FT   sig_peptide     complement(475358..475438)
FT                   /locus_tag="Rsph17029_0457"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.653) with cleavage site probability 0.540 at
FT                   residue 27"
FT   gene            complement(475435..478227)
FT                   /locus_tag="Rsph17029_0458"
FT   CDS_pept        complement(475435..478227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0458"
FT                   /product="metal dependent phosphohydrolase"
FT                   /EC_number="2.7.7.59"
FT                   /note="KEGG: rsp:RSP_1811 PII uridylyl-transferase;
FT                   TIGRFAM: protein-P-II uridylyltransferase; PFAM: amino
FT                   acid-binding ACT domain protein; metal-dependent
FT                   phosphohydrolase, HD sub domain; GlnD
FT                   PII-uridylyltransferase; SMART: metal-dependent
FT                   phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75574"
FT                   /db_xref="GOA:A3PGV8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGV8"
FT                   /protein_id="ABN75574.1"
FT                   /translation="MAPASEAGPAQDPLFSGLILPRSRILDAEALTRSILAEIDAAGPL
FT                   DPKSARAIAVRQMTEAKAAGNRALSETFEARPREARGLIRAQAALTDGLVTTALRVACE
FT                   RLHPLANPTEAERIAVLAVGGYGRAEMAPHSDVDLLFLTPWKITPWAEMVIESMLYMLW
FT                   DLRLKVGHSSRTVKDCLRLGREDITIRTALLEHRFLAGHAPLAAELDETLWNDLFRGTG
FT                   AEFIDAKLEERGQRHKRQGGQRYVLEPNVKEGKGGLRDLQTLYWIGKYLNRVPSPSGLV
FT                   AAGLLTRDEFETFERAESFLWAVRCHLHYATGRATDQLTFDLQVEVAARMGYADTRGRR
FT                   GVEVFMQDYFRHATRVGELTRVFLAQLEARHEKREPKIMGLFRRKKRLKPEYSLVNGRI
FT                   DVLDPKAFLADKLNLLRIFEEALRTGFLIHPGAMRLIAANLHLIDEEMQHDREANRIFL
FT                   DMLLRHGNPERALRRMNELGVLGAFIPEFERIVAMMQFNVYHHYTVDEHTIQCISTLAQ
FT                   IERHELDEELPIANRILTDGISRRVIYVALLLHDIGKGRPEDHSILGAQIARRVAPRFG
FT                   LTAEECETVEWLVRYHLLMSDMAQKRDIGDPRTVRDFAKAVRSKKRLDLLTVLTVCDIR
FT                   GVGPGTWNNWKAQLLRKLYRDTVTALDAGLESLNRENRADEAKRALRELLEEWDPKDLR
FT                   AELARHYPPYWQALSNATHAVFARMLRGLGETEIRIDLDPDPDRDATRACFALADHPGI
FT                   FSRLAGALALVGANVVDARTYTTKDGYATAVFWIQDSEGSPYEISRLPRLTSMIDKTLK
FT                   GEVVAREALKDRDKLKKREAQFRFPTHIAFDNEGSDIYTIIEVDTRDRPGLLYDLTRTL
FT                   AANNIYIASAVIATYGAQVVDSFYVKDMFGLKLHQKNRQETLEKKLRQAIVEGAERAKQ
FT                   "
FT   gene            complement(478211..479386)
FT                   /locus_tag="Rsph17029_0459"
FT   CDS_pept        complement(478211..479386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75575"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGV9"
FT                   /protein_id="ABN75575.1"
FT                   /translation="MLSVLSRARKSLGRAALALAALGVAACEPVAMTGGGPAVDSSKPV
FT                   PVALLVPAGSGQASDELLARSLQNAARLAAADLGNVQIDLRVYNTAGQPSQAASVASQA
FT                   VADGAKIILGPVFAQEANAVGAAVAPSGVNVLSFSNNPDIAGGNVFVLGPTFQNTANRL
FT                   AGYAVRQGNGRIMAVSDRTPAGQSGRAAIERGVAQSGGTLVASMDYEFSQNGIVSAAPG
FT                   IVERAQVTNAQALFLTADTAGALPLVTQVLRENGLPQETARFIGLTRWDIPSATLSLPG
FT                   VQGGWFALPDPGVYGQYEQRYRAAYGEAPHPISGLAYDGVAAVGALLKRGASDGLSGRA
FT                   LTQGSGFVGVNGIFRLRSDGTNERGLAVAQIRNNQVVVIDPAPRSFGGAGF"
FT   sig_peptide     complement(479306..479386)
FT                   /locus_tag="Rsph17029_0459"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.939 at
FT                   residue 27"
FT   gene            479469..480356
FT                   /locus_tag="Rsph17029_0460"
FT   CDS_pept        479469..480356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0460"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: rsp:RSP_1813
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75576"
FT                   /db_xref="GOA:A3PGW0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGW0"
FT                   /protein_id="ABN75576.1"
FT                   /translation="MTIGEAEPESGPGGARPLAPGLHFIATPIGAARDITLRALDILRA
FT                   ADVLAAEDTRTLRHLMEIHGIPLGGRPLVAYHDHNGEAARPRLLRALAEGRSVAYASEA
FT                   GTPLVADPGFQLGRAAIAAGHPVLAAPGPSAVLAALTVSGLPTDRFLFAGFPPATASAR
FT                   RKFLAELAPVPATLVLYESPKRIHKTLEDMAVVLGDRQAAVCRELTKRFEEVSRGPLDL
FT                   LAREFGDRSVKGEIVVVVDRAPPVQAGPEDLEAALIAALGTMSVKEAAAAVAGQLGLPR
FT                   RDVYQAALRLAEER"
FT   gene            480353..480706
FT                   /locus_tag="Rsph17029_0461"
FT   CDS_pept        480353..480706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0461"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   rsp:RSP_1814 putative endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75577"
FT                   /db_xref="GOA:A3PGW1"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGW1"
FT                   /protein_id="ABN75577.1"
FT                   /translation="MSGEVSYYAGQTAEEAVARIYDRSGRPVAARRWRGVSGEIDLIAR
FT                   EGAEVIFIEVKKSKSHAAAAARLSRRQMDRIYGAASEFLAGEPRGQLTASRFDVALVDA
FT                   LGRVEIIENAFAA"
FT   gene            480765..481709
FT                   /locus_tag="Rsph17029_0462"
FT   CDS_pept        480765..481709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0462"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: rsp:RSP_1815 glutathione synthetase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase domain
FT                   protein; glutathione synthetase, ATP-binding; RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75578"
FT                   /db_xref="GOA:A3PGW2"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGW2"
FT                   /protein_id="ABN75578.1"
FT                   /translation="MSLNVALQMDPIGSVNIDADSTFRIALEAQARGHRLFFYTPDHLA
FT                   YDDGRVTARGAWIELRREKGNHVSYGETTTVDLGDFDVVWLRQDPPFDMGYITTTHILE
FT                   LLMPEVLVVNDPFWVRNAPEKLLVLRFPDLIPPTTIARDLATIRAFKERHGDIILKPLY
FT                   GNGGAGVFRLDPNDRNLSSLHELFTSMSREPLIAQKFLPAVEKGDKRIILVDGEPIGAI
FT                   NRVPQAGETRSNMHVGGRAEKVNLTDRDREICAALGPVLREKGQIFVGIDVIGDWLTEI
FT                   NVTSPTGLQELERFDGTNGSARIWEVIEARRRG"
FT   gene            complement(482073..483611)
FT                   /locus_tag="Rsph17029_0463"
FT   CDS_pept        complement(482073..483611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0463"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: rsp:RSP_1816 Mg chelatase-related protein;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase, ChlI subunit; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75579"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGW3"
FT                   /protein_id="ABN75579.1"
FT                   /translation="MIARAFTVAFEGIDPRSVEVQCAVSPGLPAFAIVGLPDKAVSEAR
FT                   ERVRTALASMSIALPSRRITVNLSPADLPKEGSHFDLAIALALLAALEIVPAEEIERIL
FT                   AIGELSLDGRLVPVAGALPAAVAAAEQDRALLCPRGSGAEAAWVGATEVLAAASLDQVV
FT                   RHFTGQASIPPAEAGEVIDRPAVSVDLASVSGQERARRALEIAAAGRHHLLMIGAPGSG
FT                   KSLLARCMPGLLPPMTPAEALETSMIQSLAGKLSDGGISRARPFSSPHHTASPASIVGG
FT                   GRRAGPGEASLAHNGVLFLDELPEFPPRVLDTLRQPLETGEIMVPRADARHRYPCRFLL
FT                   IAAANPCRCGHLADASKACSRAPICGEEYLGRISGPLMDRLDLRIEVPPVDWVDGRLPP
FT                   ATEGSATVAARVAAARALQTRRYEGSAGVRVNADAEGPLLEQVAAPDAEGRALLARVAE
FT                   RFGLSARAYHRILRVARTIADLDGAPEVRHPHLAEAVSYRLTATRPRNASATSG"
FT   gene            complement(483700..483936)
FT                   /locus_tag="Rsph17029_0464"
FT   CDS_pept        complement(483700..483936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75580"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGW4"
FT                   /protein_id="ABN75580.1"
FT                   /translation="MLLIAVRDYLRERHQASLGDLAHRFRCDPAAMRGMVEHWVGKGKA
FT                   RELPCAPLACGKSCCGCTKAPEAIYEWVEGLPH"
FT   gene            complement(483943..486255)
FT                   /locus_tag="Rsph17029_0465"
FT   CDS_pept        complement(483943..486255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0465"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein,
FT                   HSR1-related; Ferrous iron transport protein B domain
FT                   protein; Ferrous iron transport B domain protein;
FT                   nucleoside recognition domain protein; KEGG: rsp:RSP_1818
FT                   Fe2+ transport system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75581"
FT                   /db_xref="GOA:A3PGW5"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGW5"
FT                   /protein_id="ABN75581.1"
FT                   /translation="MSGATIALLGNPNCGKTTLFNALTGTRQMVGNWPGVTVEKKTGEI
FT                   RFAGRTAALVDLPGTYSLGSGHTVSTDERIARDFALSGEAQLVVNIVDASNIERNLYLT
FT                   LQILEMGVPVVVALNMMDIAASQRIEIDLETLAARLGCPVVPIVAATGRGIEELKAALV
FT                   QALDTGVPAVKPLSYVPEIEAAVADLVPAIEAAGETRAPRWLALELLEGSRTLIARVPA
FT                   LAPEVARARQALEEALGYDPDTAIASGRYDAVAEATAASVRRTSELGRTLSDRIDRVVL
FT                   NRVLGIPIFLFVMYLMFLFTINVGSAFIDFFDVAAATIFVEGTAELLGRAGSPDWLTTV
FT                   LASGVGGGVQTVATFIPVIACLFLFLSVLEDSGYMARAAFVMDRFMRIVGLPGKSFVPL
FT                   IVGFGCNVPAVMATRTLENERDRTMTIAMAPFMSCGARLPVYALFAAAFFPANGQNLVF
FT                   LLYLIGILAAVFTGLVLKNTLLPGSTTPFVMELPPYHIPTLRAVLLRTWDRLKSFVIRA
FT                   GRVLVPVVAVIAVLNSWGRDGSFGNEDTDNSVLAAIGQTIAPAFEPMGLRPENWPATVG
FT                   IFTGLLAKEAVVGTLNALYSGMGETEEAQEEAAPYSLTAGLSAAVATIGENFGDLAGSL
FT                   TDPLGIEIGDLSSTDAAAEELEVSTGTFGAMRALFDGQAGAFAYLLMVLLYVPCTAAIA
FT                   AVWREAGPAWTGFVSVWTLMMGWGTATVFYQAATFARHPEASALWIGGVLAAFALVILV
FT                   MKRIGGTGASRSAPAGA"
FT   gene            complement(486252..486491)
FT                   /locus_tag="Rsph17029_0466"
FT   CDS_pept        complement(486252..486491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0466"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: rsp:RSP_1819
FT                   ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75582"
FT                   /db_xref="GOA:A3PGW6"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGW6"
FT                   /protein_id="ABN75582.1"
FT                   /translation="MVLSLKDMAAGATARVTGYAPGGAAYRQKLLSMGLTPGTALRVLR
FT                   VAPLGDPVVIEVRGYQLSLRKAEASALSIEETAA"
FT   gene            complement(486498..486746)
FT                   /locus_tag="Rsph17029_0467"
FT   CDS_pept        complement(486498..486746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0467"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: rsp:RSP_6020
FT                   ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75583"
FT                   /db_xref="GOA:A3PGW7"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGW7"
FT                   /protein_id="ABN75583.1"
FT                   /translation="MMNARQMPLAFAPEEARLAVTGLAGCKEMQKRLSEMGLHVGGEVK
FT                   VIRGCVTGPLLLAVGKSRLALGQEMSRKIFVTPLQDR"
FT   gene            complement(487348..487845)
FT                   /locus_tag="Rsph17029_0468"
FT   CDS_pept        complement(487348..487845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0468"
FT                   /product="protein of unknown function DUF892"
FT                   /note="PFAM: protein of unknown function DUF892; KEGG:
FT                   rsp:RSP_1820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75584"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGW8"
FT                   /protein_id="ABN75584.1"
FT                   /translation="MKTKELDTAFHDMLKDVYYAERQILKALPKMARAAKSEQLKEAFK
FT                   THREETEGQKERLEKVFELLGKRAQGKTCPAIDGIIEEGSEVMDEYKDSPALDAALLAA
FT                   AQAVEHYEMARYGTLVAWARTLGMEDAAKLLAETLEEEKKTDGLLNDLAGAEVNQNALA
FT                   AA"
FT   gene            complement(488040..490340)
FT                   /locus_tag="Rsph17029_0469"
FT   CDS_pept        complement(488040..490340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0469"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="KEGG: rsp:RSP_1821 molybdopterin-containing
FT                   oxidoreductase, probable formate dehydrogenase; TIGRFAM:
FT                   oxidoreductase alpha (molybdopterin) subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75585"
FT                   /db_xref="GOA:A3PGW9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGW9"
FT                   /protein_id="ABN75585.1"
FT                   /translation="MDRPKEKRQRKDTPFYEAASGSWGSVRGIARVLLDQKPGPGVVRT
FT                   LMRQNKPGGHMCTSCAWAKPAKPNLFEFCENGAKATVWDLTTDRCGPDFFAAHSVSELR
FT                   TWSDHDLEKTGRLTHPMRYDAASDHYLPVTWEEAFREIGGRLRGIDPKQTVFYTSGKAS
FT                   LETAFLWQLFARAYGHNNLPDSSNMCHETTSVGLKKVIGSPVGTCVLEDFTHCDMILFF
FT                   GQNTGTNSPRFLHELQRAVQRGCKIVTFNPVRERGLVEFVNPQNPSQMTLGSPTRISDI
FT                   YLQVRPGGDIAALAGICKHLFALEDQRGSVIDRAFVAEHTSDFEAFEARIRDTSWEEIE
FT                   RNSMLRRADLEQVAEIYARSEKVIGIYGMGLTQHVHGWLNIGMLVNLLLMRGNIGRKGA
FT                   GISPVRGHSNVQGQRTVGISEKPSLVPIDKMEELFGLSILRDEGWNTAVATEKLLDGTM
FT                   KAFLSLGGNFARAIPDQGRTDAAWAGLDLNVQVATKLNRSHTLVSRESWLLPCLVRAEE
FT                   DRQASGPQAVSMEDSLSHIHGSVGKRPPASAWLLSEAAIVAGLAEATLPANPKLRWRNW
FT                   VGDYRHIRDLIEACWPEQFAAFNARLFTPGGFYRGNAARERQWKTESGKAQFTAPDKLC
FT                   ALGEPPEGKEMTLVTLRSNDQFNTTIYGFSDRLRGLEGPRNVLLMNPEEIARHGLHEGQ
FT                   RVTLECAWSDGVDRRVSGLRVTAYDLPDSCVGAYYPETNPLVPLAARDELSGTPAYKGT
FT                   PVRIRAEGSAGPL"
FT   gene            490589..492133
FT                   /locus_tag="Rsph17029_0470"
FT   CDS_pept        490589..492133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0470"
FT                   /product="NAD+ synthetase"
FT                   /note="TIGRFAM: NAD+ synthetase; PFAM: NAD+ synthase; CinA
FT                   domain protein; KEGG: rsp:RSP_1822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75586"
FT                   /db_xref="GOA:A3PGX0"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGX0"
FT                   /protein_id="ABN75586.1"
FT                   /translation="MSGQVAAARQETLVEEILDLSRQRQAGPLSPWFAARLEEQVEKGL
FT                   FLSPEDLEATGARLVEELVEYRTRTQVSTAVIGMSGGVDSALTAALFKAAGWHVVGHTL
FT                   PIEQDPNETDRGIEACAALGIEHRPLDLSGAYEAALVHLGELDPDLLSSDETPARTRRG
FT                   NLRARLRMMTLYDQAHRLGGLVAGTDNFSELTAGFWTLHGDVGDLAPVQSLLKSWEVPW
FT                   LARAHRVPEATWRAMPTDGLGIGGGDEAQIGATYLEWDILQFALAEALGDDPGLATRHL
FT                   AFALRMDADRHAQEVLGTLIARMRATWHKRLNPIRLNHPKADRYEPLERMEARLFRPQG
FT                   VKSDEALMGFPAEMQDLAAHLVRALKAADCRLVTAESCTAGLIAACVSGVPGRSGVLEG
FT                   SFVAYRPTMKFAALGVPEALIAEETVYDPKVARRMAEGALASAPEADLALAVTGVAGPG
FT                   EDEGHPPGYVCVAAALRGQETRVSEHYFPGSPRQVLAATLRRALQEGLTVLQEAHR"
FT   gene            complement(492156..492701)
FT                   /locus_tag="Rsph17029_0471"
FT   CDS_pept        complement(492156..492701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0471"
FT                   /product="molybdopterin adenylyltransferase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: rsp:RSP_1823 molybdenum
FT                   cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75587"
FT                   /db_xref="GOA:A3PGX1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGX1"
FT                   /protein_id="ABN75587.1"
FT                   /translation="MKIAIVTASDRASRGDYEDLSGPAIADWLATAVTSPYEIVRRIVP
FT                   DGVETVRTALIELCDTEGAALVFTTGGTGPAPRDLTPEAMVGVIEKELPGFGELLRSIG
FT                   LQQTPTAILSRQTAGVRGRSLIVNLPGQPAAISLSLQGVFGAIPKCLDLIGAGRMTVSD
FT                   RWGVEGRAAPTLPDYLRS"
FT   gene            492993..494117
FT                   /locus_tag="Rsph17029_0472"
FT   CDS_pept        492993..494117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0472"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rsp:RSP_1824 zinc-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75588"
FT                   /db_xref="GOA:A3PGX2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGX2"
FT                   /protein_id="ABN75588.1"
FT                   /translation="MKITAAVLERDGIAGNYAEERPLAIRELDLAEPGPGEVLIRVAAA
FT                   GICHSDLSVINGTRRRPLPMVLGHEASGHVEALGEGVEDLEPGDHVVCIFAPGCGRCTP
FT                   CAEGRPALCEKAARHHAVGELMTGHRRLSLGGRSVHHHLGISGFATHAVVARPSLVRVP
FT                   REVPPHVSALFSCAMLTGAGAVFNTAQIRPGSKVAVVGLGGVGLSAILGAAAAGAAEIV
FT                   AIDPFPAKMEAARAMGATLSVPADGDTVAAVRDLTAGGVDYAFELAGSVRALETAFAVT
FT                   RRGGMTVTAGLPHPDDRMSLEALKLVAEERTLKGSYIGSCVPQRDLPRMLALHRRGLLP
FT                   VEKMLTHRLKLDEINLAMDRLAEGSAIRQVVDLG"
FT   gene            complement(494157..495578)
FT                   /locus_tag="Rsph17029_0473"
FT   CDS_pept        complement(494157..495578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0473"
FT                   /product="microcin-processing peptidase 2. Unknown type
FT                   peptidase. MEROPS family U62"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   rsp:RSP_1825 probable modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75589"
FT                   /db_xref="GOA:A3PGX3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGX3"
FT                   /protein_id="ABN75589.1"
FT                   /translation="MTDSAFRPFETHLDVETASAILREATRGADDGELFLERSRSESLV
FT                   LDDGRVKTASYDASEGFGLRAVRGEVAGYAHSTQISEQALKRACETARLAVGDGGGAMA
FT                   APPAGTNRRLYADLDPMADAAFPVKIELLREIDAFVRDLDPRVIQVSATVGAGLQEVEI
FT                   LRPEGTRLADVRPMVRMNVSVIVEENGRRESGSFGGGGRFGLSKLMEPDWWQAAAREAV
FT                   RIATVNLQAVPAPAGVMDVVLGAGWPGILLHEAIGHGLEADFNRKKTSAFAGLMGERIA
FT                   APGVTVLDDGTIPDRRGSISVDDEGTPSNRTVLIEDGILVGYMQDRQNARLMGTASTGN
FT                   GRRESYAHIPMPRMTNTYMLGGDADPAGIVADLKDGIYAVGFGGGQVDITNGKFVFSCT
FT                   EAYLVKDGKVGAPVKGATLIGDGATALRQIRAIGNDMKLDPGIGNCGKQGQWVPVGVGQ
FT                   PTLMIGGLTVGGSKA"
FT   gene            495748..496659
FT                   /locus_tag="Rsph17029_0474"
FT   CDS_pept        495748..496659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0474"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit II; cytochrome C
FT                   oxidase subunit II, transmembrane region; KEGG:
FT                   rsp:RSP_1826 cytochrome c oxidase polypeptide II precursor
FT                   (cytochrome AA3 subunit 2)"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75590"
FT                   /db_xref="GOA:A3PGX4"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGX4"
FT                   /protein_id="ABN75590.1"
FT                   /translation="MRHSTTLTGCATGAAGLLAATAAAAQQQSLEIIGRPQPGGTGFQP
FT                   SASPVATQIHWLDGFILVIIAAITIFVTLLILYAVWRFHEKRNKVPARFTHNSPLEIAW
FT                   TIVPIVILVAIGAFSLPVLFNQQEIPEADVTVKVTGYQWYWGYEYPDEEISFESYMIGS
FT                   PATGGDNRMSPEVEQQLIEAGYSRDEFLLATDTAMVVPVNKTVVVQVTGADVIHSWTVP
FT                   AFGVKQDAVPGRLAQLWFRAEREGIFFGQCSELCGISHAYMPITVKVVSEEAYAAWLEQ
FT                   ARGGTYELSAVLPATPAGVSVE"
FT   sig_peptide     495748..495822
FT                   /locus_tag="Rsph17029_0474"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.495 at
FT                   residue 25"
FT   gene            496730..497662
FT                   /locus_tag="Rsph17029_0475"
FT   CDS_pept        496730..497662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0475"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: rsp:RSP_1827 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75591"
FT                   /db_xref="GOA:A3PGX5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGX5"
FT                   /protein_id="ABN75591.1"
FT                   /translation="MTDIRITGIPKEAGFGDYVALLKPRVMSLVVFTALVGLLVAPVTV
FT                   HPMIALTGILFIALGAGASGALNMWWDEDIDRVMKRTRNRPVPSGTVAPGEALGIGLAL
FT                   SGIAVVMLGLATNLFAAGLLAFTIFFYAVVYSMWLKRTTPQNIVIGGAAGAFPPMIGWA
FT                   VATGGVSVESLFMFALIFMWTPPHFWSLALFMKSDYSDAGVPMLTVTHGRRVTRAHVLV
FT                   YSLLLAPLAVAGAFTGIGGPLYLATALALNGWLLVGAVRIWRRDEAQAEADRYRVEKGF
FT                   FRFSLYYLFLHFGAILAEAALKPYGLGGW"
FT   gene            497664..497840
FT                   /locus_tag="Rsph17029_0476"
FT   CDS_pept        497664..497840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0476"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75592"
FT                   /db_xref="GOA:A3PGX6"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGX6"
FT                   /protein_id="ABN75592.1"
FT                   /translation="MTIRAEHEIHRRRLGRNLGVGLTLAAFILVVFGLTVAKVSQLGEQ
FT                   GAFAHAPPGAMGQ"
FT   sig_peptide     497664..497777
FT                   /locus_tag="Rsph17029_0476"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.769) with cleavage site probability 0.484 at
FT                   residue 38"
FT   gene            497837..498412
FT                   /locus_tag="Rsph17029_0477"
FT   CDS_pept        497837..498412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0477"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: rsp:RSP_1828 cytochrome c oxidase
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75593"
FT                   /db_xref="GOA:A3PGX7"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGX7"
FT                   /protein_id="ABN75593.1"
FT                   /translation="MSLSPHQKTAGGLVLVVAVMGAASFAAVPFYNWFCRVTGFAGTTA
FT                   VATEAPAEVLDRTVKVRFDASREAGMPWEFRPLQREMELKIGETGLAFYEAYNPTDRTV
FT                   AGTASYNVTPDAAGGYFAKIACFCFTEQVLAPGERVEMPVTFYVDPAIIDDPDGRYVRQ
FT                   ITLSYTFHETALTEEQAALAAESATDVN"
FT   sig_peptide     497837..497917
FT                   /locus_tag="Rsph17029_0477"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            498440..499240
FT                   /locus_tag="Rsph17029_0478"
FT   CDS_pept        498440..499240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0478"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="PFAM: cytochrome c oxidase, subunit III; KEGG:
FT                   rsp:RSP_1829 cytochrome c oxidase, aa3-type, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75594"
FT                   /db_xref="GOA:A3PGX8"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGX8"
FT                   /protein_id="ABN75594.1"
FT                   /translation="MAHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGL
FT                   IGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKH
FT                   ALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRD
FT                   VAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLV
FT                   CLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ"
FT   gene            499427..500098
FT                   /locus_tag="Rsph17029_0479"
FT   CDS_pept        499427..500098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0479"
FT                   /product="SURF1 protein"
FT                   /note="KEGG: rsp:RSP_1830 SURF1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75595"
FT                   /db_xref="GOA:A3PGX9"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGX9"
FT                   /protein_id="ABN75595.1"
FT                   /translation="MIRRMILPLLFGLIGAAILVSLGLWQVQRLQWKEGVLADIEARVA
FT                   APPVTLPEAPEAARDRYLPVTVSGRFTGEHIDVLTSRKDRGAGYRVISVFETDEGRRIL
FT                   IDRGFLPQEDRGLPRTAVGAGLTGNLAWPAEVDSFTPSPDPVSGIWFARDVPAMAEALS
FT                   TEPVLVVAATPTGDGIDPWPIGTEGIPNDHLGYAVTWFSLAVLWLGMTVLLLWRIRRRM
FT                   E"
FT   sig_peptide     499427..499498
FT                   /locus_tag="Rsph17029_0479"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.621 at
FT                   residue 24"
FT   gene            500110..501495
FT                   /locus_tag="Rsph17029_0480"
FT   CDS_pept        500110..501495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0480"
FT                   /product="L-threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="KEGG: rsp:RSP_1831 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75596"
FT                   /db_xref="GOA:A3PGY0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGY0"
FT                   /protein_id="ABN75596.1"
FT                   /translation="MQYISTRGTAPVLGFGEAMLTGLARDGGLYVPETVPALSESEIAA
FT                   LAGLSYEEVAFRIMRPFVGETFGDDEFRGLIAAAYEGFGHAARAPLVQLGPNHFLLELF
FT                   HGPTLAFKDFAMQLIGQLFQAALAKNGQRITIVGATSGDTGSAAIEAFRGLSNVDVFIL
FT                   FPHGRVSEVQRRQMTTPSEANVHALAVDGDFDDCQARLKDMFNDFAFRDAVGLAGVNSI
FT                   NWARVLAQVVYYFTSAVALGAPHREVSFTVPTGNFGDIFAGYIARRMGLPIARLVVATN
FT                   QNDILHRALSTGAYETEGVTPSISPSMDIQVSSNFERALFDAYGRDGAAVAALMAELKQ
FT                   GGFRISENALGTLRATFASGRASEEETLATIRATHAATGELLCPHSAVGVKVAEEALGP
FT                   EPMITLATAHPAKFPDAVEAATGLRPPLPARMADLFDRPERVTRVPNDLSALETLIRER
FT                   TGR"
FT   gene            501492..502751
FT                   /locus_tag="Rsph17029_0481"
FT   CDS_pept        501492..502751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0481"
FT                   /product="processing peptidase"
FT                   /EC_number="3.4.24.64"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   rsp:RSP_1832 peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75597"
FT                   /db_xref="GOA:A3PGY1"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGY1"
FT                   /protein_id="ABN75597.1"
FT                   /translation="MTVLLDTLPNGFRIVTEHMPGLHSASIGIWIAAGGRHERPEQNGI
FT                   AHFLEHMAFKGTNTRTALRIAEEIEDVGGYINAYTSREMTAYYARVLEADTGLALDVIA
FT                   DIVLNPVFDPKEIEIERHVILQEIGQALDTPDDIIFDWLQEASYPGQAFGRTILGPEER
FT                   VSTFGRADLTRFVGEHYGPDHMILAAAGGVDHDRIVAQAQALFGHLKPVGQRPMQPADF
FT                   LGGERRELKSLEQVHFAMAFEAPNYRAPDVYAAQVYAMALGGGMSSRLFQKVREERGLC
FT                   YSIFAQSGAYEDTGQITIYAGTSGEEVADLAGLTVDELKRATEDMSEAEVARARAQLKA
FT                   GLLMGLESPSNRAERLARLLAIWGRVPGVDEAVEKIDAVTVGAVRDYAERMAQARSALA
FT                   LYGPAEAAPALAQIRERLAA"
FT   gene            502751..503335
FT                   /locus_tag="Rsph17029_0482"
FT   CDS_pept        502751..503335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0482"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rsp:RSP_1833 putative ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75598"
FT                   /db_xref="GOA:A3PGY2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGY2"
FT                   /protein_id="ABN75598.1"
FT                   /translation="MLGLRRKVRIETERMTLRLPAHSDWRDWAALRAESATFLTPWEPV
FT                   WSSDHLSRKAFTNRVYWAARAESQGTALPVLLIRREDQALLGAITLDNIRRGPAQSGTL
FT                   GYWIGRPHARQGYMREAIQGIVHHAFTAMDVSRIEAACLPENAASRGVLEKCGFKYEGV
FT                   AQSYLQIAGRWRNHVLYANLRGDRRGRTDAG"
FT   gene            503667..504473
FT                   /locus_tag="Rsph17029_0483"
FT   CDS_pept        503667..504473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75599"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGY3"
FT                   /protein_id="ABN75599.1"
FT                   /translation="MIRTALATLALAVPVAAPAQERTPSHCIALAQGPERVVPAAFGDP
FT                   LAEDRVRIRYVHHATFLIETPGGLVAATDYTGLLGQRDVVPDVATMNNAHSTHWTDLPD
FT                   PRIPHLLPGWQEGGRADHHLDLGEMLVRNVPTDVRSRWGEGIRKDGNSIFVFEVAGLCI
FT                   GHLGHLHHEPDAAQYAALGRLDVLMVPVDGGYTVGLETMQKVVRRLRSSVVLPMHWFSG
FT                   RSLESFLGEMEPEFEVVRLEGPEIELSLTSLPRRPTVMVLDPAWVD"
FT   sig_peptide     503667..503732
FT                   /locus_tag="Rsph17029_0483"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.964) with cleavage site probability 0.764 at
FT                   residue 22"
FT   gene            504512..505927
FT                   /locus_tag="Rsph17029_0484"
FT   CDS_pept        504512..505927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0484"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   rsp:RSP_1835 putative FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75600"
FT                   /db_xref="GOA:A3PGY4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGY4"
FT                   /protein_id="ABN75600.1"
FT                   /translation="MLNPADDAFLARLAGRLPPGTLTAPEPRHLTEPRGRRQGQAGALA
FT                   LPRDTAEVAAIVAACAAARVGIVPLGGGTGLVGGQVMEAGPLPLLLSLERMNRVRGIFP
FT                   EENVILVEAGAILAEVQAAAEAAGRMFPLWLASEGSCRIGGNLASNAGGTAVLRYGNAR
FT                   DLCLGLEAVLPDGSVFHGLKRLRKDNTGYDLRNLLIGAEGTLGIITAASLKLVRPPAAE
FT                   GAALLAVRDPAAALELLGRAQRRLGPLVTGFELMHRQGFAFLAETMPERRLPFADLPDW
FT                   TVLVDLGLTEGMDPAAELEALFAEAAEAGLVSDGALAQSLAQRADFWALRESIPEANRR
FT                   IGAIASHDISLPLSEIARFVTEAGAAIGRLGDLRVNCFGHLGDGNLHYNVFPAAGRRRE
FT                   AYDDLRGEITRTVHDLVAAAGGSISAEHGIGRLKVEDLERYGDPAKLRAMRALKAALDP
FT                   FGIMNPGAVLRAE"
FT   gene            complement(506056..506592)
FT                   /locus_tag="Rsph17029_0485"
FT   CDS_pept        complement(506056..506592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0485"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="KEGG: rsp:RSP_1836 adenine
FT                   phosphoribosyltransferase; TIGRFAM: adenine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75601"
FT                   /db_xref="GOA:A3PGY5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGY5"
FT                   /protein_id="ABN75601.1"
FT                   /translation="MTHKSVRDYIRTIVDFPHEGILFRDVTTLFADPRGFRIAIDQLLA
FT                   PYAGMRFDKVAGLEARGFILGGAVAHQLSTGFVPIRKKGKLPGRTISVSYQLEYGEAVV
FT                   EVHDDAIQAGEKVLLVDDLLATGGTAEAGIKLIEQLGDQVVGCAFVVDLPDLGGRRRLE
FT                   AMGMEVHALCAFEGL"
FT   gene            complement(506597..507469)
FT                   /locus_tag="Rsph17029_0486"
FT   CDS_pept        complement(506597..507469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0486"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="KEGG: rsp:RSP_1837 5'-methylthioadenosine
FT                   phosphorylase; TIGRFAM: methylthioadenosine phosphorylase;
FT                   PFAM: purine phosphorylase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75602"
FT                   /db_xref="GOA:A3PGY6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGY6"
FT                   /protein_id="ABN75602.1"
FT                   /translation="MKTMIGVIGGSGVYEIDGLEDAVWTKVETPWGDPSDEILTGRLDG
FT                   VPMAFLPRHGRGHVHSPTTVPYRANIDALKRLGVTDLVSVSACGSFRGEMAPGDFVIVD
FT                   QFIDRSFARAKSFFGSGCVAHVSLAHPTCGRLSALCAEAARGTGVTVHEGGTYLCMEGP
FT                   QFSTLAESLLYKSWGCHVIGMTNMPEAKLAREAEICYASVAMVTDYDSWHPHHGEVDIT
FT                   AIIATLGANADHARGLVAGLPARLGTERDLCPHGCDRALDHALMTAPAKRDPELLAKLD
FT                   AVAGRVLKG"
FT   gene            complement(507774..508358)
FT                   /locus_tag="Rsph17029_0487"
FT   CDS_pept        complement(507774..508358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0487"
FT                   /product="flavin reductase domain protein, FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: rsp:RSP_1838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75603"
FT                   /db_xref="GOA:A3PGY7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGY7"
FT                   /protein_id="ABN75603.1"
FT                   /translation="MFYRPEDGHGLPHNPFNAIVSPRPIGWISTRGPEGDNLAPYSFFN
FT                   AVAYVPPQVMFASTGAKDSLAALRASGFFCVNIVEEAALARMNATSAAFPRGTDEFLAA
FT                   EVPKEECRTIPCPRVADAPASLECRVTQVVELLGRDNFLILGEVTGVHLRDDCLRDGRF
FT                   DVTAFRPMARLGYRDYAVVREVIELSRPGEG"
FT   gene            508439..508924
FT                   /locus_tag="Rsph17029_0488"
FT   CDS_pept        508439..508924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0488"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rsp:RSP_1839 putative acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75604"
FT                   /db_xref="GOA:A3PGY8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGY8"
FT                   /protein_id="ABN75604.1"
FT                   /translation="MYRLEQEREADWWEVEALYDLCFAPGRTALSSYRLRDGVPTVADL
FT                   CALLRDEDGTLAAAIRYWPVMVGDKPVLLLGPVAVHPTRQGEGLGALLIAETLAEARRI
FT                   GWERVMLVGDAPYYRRFGFRKLEKVVMPPPTNPERVLGMPLVIGAWEGVEGLVTKAT"
FT   gene            509056..509907
FT                   /locus_tag="Rsph17029_0489"
FT   CDS_pept        509056..509907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75605"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGY9"
FT                   /protein_id="ABN75605.1"
FT                   /translation="MRRLTGIGGPARSGGRAIARRGSRSYFCAMTQKTRLPALHTGPEA
FT                   EIAALALRFDRAHGPLMSLMNRLGGSVEERMALLPAPVLRQIEAVTRRALEQSHRVAAA
FT                   GRAAPDLGRRGAPALVALTGAAGGAGGIATSIAELPVTITVIMHAIRNAAEAEGFDPDD
FT                   PAIRVECLRIFGAGSPLQRDDGVNTSFIGARIAMSGAAVSKVVASVAPKLATALGQKLM
FT                   AQAVPVLGAVAGAALNTAYLTYYREIAEIRFALLRLAQTHGPERVLSEFQSAVKPIPLY
FT                   RA"
FT   gene            complement(509955..510557)
FT                   /locus_tag="Rsph17029_0490"
FT   CDS_pept        complement(509955..510557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0490"
FT                   /product="Intracellular septation protein A"
FT                   /note="PFAM: Intracellular septation protein A; KEGG:
FT                   rsp:RSP_1841 probable intracellular septation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75606"
FT                   /db_xref="GOA:A3PGZ0"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGZ0"
FT                   /protein_id="ABN75606.1"
FT                   /translation="MAERINPVVKAVLEWGPIAAFFLGYVKLKDETFTVAGTDYQGFII
FT                   VTAAFIPLMVICTGLLWWLSGKLSKMQVATVVLVVVFGGLSVWLNDDRFFKMKPTMIYL
FT                   LFGVLLGIGLLRGQSWLRLVLEEAIPLQDEGWMILTRRVMAFFFALAIANEAVWRLMST
FT                   DAWVNFKTFGLPLAIFVFFMTQSGLFKRYNPERKDEA"
FT   gene            complement(510569..511474)
FT                   /locus_tag="Rsph17029_0491"
FT   CDS_pept        complement(510569..511474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0491"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rsp:RSP_1842 possible transporter, DME
FT                   family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75607"
FT                   /db_xref="GOA:A3PGZ1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGZ1"
FT                   /protein_id="ABN75607.1"
FT                   /translation="MTAWILSLEGTPEGARIALLLALTSAFAHACFGALQKGRHDPWLS
FT                   RGAIDSFMLLLSAPVAVFLVPWPRGVEWLVMAGVMAIHLAYKIAMARAYSRAAYTVVYP
FT                   VVRGVGPLATLAFAALFLGEHYVAIQWLGVAILSAAILALARLNFTASPQIGRMDLKAG
FT                   LVWAFAGGLMVAIYTTFDAWAIRLMPDPFTFLAWFFLMTSLDFPLLLGYRLLKARQMPE
FT                   AAAALALRGFVGALVAFVSFGGVMLGTRLGKVAEVSSLRETSTLFAAAIGWLLLGERSG
FT                   PAKILLMGLIALGAILVQLA"
FT   sig_peptide     complement(511373..511474)
FT                   /locus_tag="Rsph17029_0491"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.819) with cleavage site probability 0.483 at
FT                   residue 34"
FT   gene            complement(511590..512729)
FT                   /locus_tag="Rsph17029_0492"
FT   CDS_pept        complement(511590..512729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0492"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: rsp:RSP_1843 signal recognition
FT                   particle-docking protein FtsY; TIGRFAM: signal recognition
FT                   particle-docking protein FtsY; PFAM: GTP-binding signal
FT                   recognition particle SRP54, G- domain; GTP-binding signal
FT                   recognition particle SRP54, helical bundle; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75608"
FT                   /db_xref="GOA:A3PGZ2"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGZ2"
FT                   /protein_id="ABN75608.1"
FT                   /translation="MSFFKKMREKMFRSSDRLSEDLDALVEDKASEAPAPEVPTPGPLP
FT                   DPEKDAPLILDRPVPQAPDPQPAPVPPAAPLPGLPPEPEPERRPGLFGRMFGQTEEPRR
FT                   ILDDAMLESLEEVLIQADMGVETALRVTANIAEGRYGRRVSAREIKEALAAEIARILEP
FT                   VARPMPLYPSRPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQL
FT                   QVWGRRAGVPVLTAPEGSDPASLAFDAMTKAQAEGADLLMIDTAGRLQNRADLMEELSK
FT                   IVRVIHKKDPDAPHNTLLVLDATTGQNALNQVEIFRKLADVSGLVMTKLDGTAKGGVLV
FT                   ALADRFGLPIHAIGVGEQIDDLAPFDPEEFARALMGLDD"
FT   gene            512921..513319
FT                   /locus_tag="Rsph17029_0493"
FT   CDS_pept        512921..513319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75609"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGZ3"
FT                   /protein_id="ABN75609.1"
FT                   /translation="MHRIWAAALTLALAAPALAAEPMSAEEFETYSTGKTLSYAVGGEI
FT                   YGAEQYLPGRRVVWAFRGQECAHGQWYEQAGQICFVYEHDATPQCWSFYREASGVRAQF
FT                   EGDPTGTELSEVSQTRTPLICAGPDVGV"
FT   sig_peptide     512921..512980
FT                   /locus_tag="Rsph17029_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 20"
FT   gene            complement(513440..514999)
FT                   /locus_tag="Rsph17029_0494"
FT   CDS_pept        complement(513440..514999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0494"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="KEGG: rsp:RSP_1845 exonuclease VII, large subunit;
FT                   TIGRFAM: exodeoxyribonuclease VII, large subunit; PFAM:
FT                   Exonuclease VII, large subunit; nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75610"
FT                   /db_xref="GOA:A3PGZ4"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PGZ4"
FT                   /protein_id="ABN75610.1"
FT                   /translation="MSDLFEDPAPSRNTPEFTVSELSGAVKRVIEGEFGLVRVRGEIGR
FT                   VSRPASGHLYFDLKDDRAVMAAICWKGQAGRLSVRPEEGMEVVATGRMTTFPGQSKYQI
FT                   IVEDMAPAGAGALMAMLEKRRAALAAEGLFDAGRKRPLPFLPRVIGVVTSPSGAVIRDI
FT                   LHRLRDRFPSHVLIWPVAVQGEKCAPEVAAAIRGFNTLPEGGPIPRPDLLIVARGGGSL
FT                   EDLWGFNEEIVVRAAAESRIPLISAVGHETDTTLIDHAADRRAPTPTAAAEMAVPVRLE
FT                   LLAGLDGQGARLSRCAAETIRRRDQRLRDLARALPRLESLVAGPSQRFDLWSGRLSGAL
FT                   GQSVAARRARLEPLGAHLRPRLLADLVARQKDRLGDRTRSLETCLGRRAERARDRFDAL
FT                   SARLAPAFARLIAETERASRRDAATLGTLAARLDAAPEARLARLSDRLEALDRLRQTLG
FT                   YRETLKRGYAVVRADGAVLTTKAEAGAAAMLEIEFQDGRLSVGRGKTRKPKEEPPAQGS
FT                   LL"
FT   gene            complement(515230..515583)
FT                   /locus_tag="Rsph17029_0495"
FT   CDS_pept        complement(515230..515583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75611"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGZ5"
FT                   /protein_id="ABN75611.1"
FT                   /translation="MDLRTLLLPAALLAATPLLADEATIARLEAAFAALTPEERVAVQE
FT                   ELEIAGLYVGPVDGSTGPGDGRTLEDAATFIEENSAGMVAVPLATDEEARAFAKSLAER
FT                   GYSSWLYGEGDEG"
FT   sig_peptide     complement(515521..515583)
FT                   /locus_tag="Rsph17029_0495"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            515743..517005
FT                   /locus_tag="Rsph17029_0496"
FT   CDS_pept        515743..517005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0496"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: rsp:RSP_1847 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75612"
FT                   /db_xref="GOA:A3PGZ6"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGZ6"
FT                   /protein_id="ABN75612.1"
FT                   /translation="MNILILGGGGREHALAWAIKQNPKCDRLIVAPGNAGIAQIAECAD
FT                   LDILDGAAVVAFCEANSVDFVVVGPEAPLAAGVADATRAAGLLTFGPSQAAARLEASKG
FT                   FTKEVCDACGAPTAGYARFTEAEAARAHVRAAGAPIVIKADGLAAGKGVVVAMTEAEAL
FT                   AAIDDMFGGSFGAAGAEVVIEEFMTGEEASFFVLTDGRTVLPIGTAQDHKRAFDGDEGP
FT                   NTGGMGAYSPAPVLTTAVQRQALDEIVKPTIAEMGRRGAPYSGVLYAGLMIEEGRARLV
FT                   EYNVRFGDPECQVLMLRLGAQALDLLLACAEGRLDQVQVNWAEDHALTVVMAAQGYPGS
FT                   YRKGTEIRGLEALPETSRQVVFHAGTAAEEGRILATGGRVLTATARGATLAEAQAAAYA
FT                   MVDAIDWPEGFCRRDIGWRAL"
FT   gene            complement(517210..518736)
FT                   /locus_tag="Rsph17029_0497"
FT   CDS_pept        complement(517210..518736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0497"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: pyruvate kinase; KEGG: rsp:RSP_1848 pyruvate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75613"
FT                   /db_xref="GOA:A3PGZ7"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGZ7"
FT                   /protein_id="ABN75613.1"
FT                   /translation="MDGVAERQMTGEDAPPSGDDPRAEARALLAELTALRADLFRRADA
FT                   RMADWATRVRRLEFLPSVANMADWLALREADLTTLQPRLSRLGLSTLGRLDGHVRPSLE
FT                   AVIAALSAIACLKGPAFPDPQGFDPELRSLHARRDALFGARDTAPGTRILVTLPSEAAS
FT                   DPAIVRELVAAGADAFRINCAHDGPEAWAAMIGHIRKSERMTGRKLPISMDLGGPKFRV
FT                   TKAGGPLPKRLQAGDRFAFVEKPSMAPEGRGWAMLGHPALLAALAPGVQVSVDDGKLWA
FT                   TVIQTGRGHALLEVDRVGERGLKLKPGRGVNLPGSHLDVAALTEEDLAALDVVVAEADL
FT                   VAFSFVQTPGDVRALIAAMEARACHPRPLPAILLKIETPMGLHLLPELIVEAGGSLPVG
FT                   VMIARGDLAVEIGFDRLSEIQEEILWLCESAQVPVVWATQVLEGMVKEGQASRAEVTDA
FT                   AMSQRADCVMLNKGPHVAAAIEFLRDILIRMDRHQTKKSARLGPLRVWAG"
FT   gene            518946..520205
FT                   /locus_tag="Rsph17029_0498"
FT   CDS_pept        518946..520205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0498"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: rsp:RSP_1849 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class;
FT                   PFAM: aspartate/glutamate/uridylate kinase; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75614"
FT                   /db_xref="GOA:A3PGZ8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGZ8"
FT                   /protein_id="ABN75614.1"
FT                   /translation="MPLLVMKFGGTSVADLARIKNAAQKVKREVERGYDVIVIVSAMSG
FT                   KTNELVGWVEQTSPLFDAREYDAVVSSGENVTAGLMALTLQEMEVPARSWQGWQVPIRT
FT                   TSQHSAARFLEIPRENLDAKFAEGFKVAVVAGFQGVSPEGRITTLGRGGSDTTAVAFAA
FT                   AFAAERCDIYTDVDGVYTTDPRIASKARKLEKIAYEEMLELASLGAKVLQTRSVELAMR
FT                   YKVKLRVLSSFEDTDETSGTLVCDEEDIMESKVVSGVAYSRDEAKMTLVTVEDRPGVAA
FT                   AIFGPLAEAGVNVDMIVQNISEKDYGSHPGSVTDMTFSCPINQVARARKALEDAKAEGT
FT                   IVYDDLVVDTEVAKVSVVGIGMRSHAGVAATMFKALAADGVNIKVIATSEIKISVLIDR
FT                   KYMELAVQALHDAFALETAN"
FT   gene            520230..522473
FT                   /locus_tag="Rsph17029_0499"
FT   CDS_pept        520230..522473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0499"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing enzyme; GAF domain
FT                   protein; PEP-utilising enzyme, mobile region; PEP-utilising
FT                   enzyme domain protein; KEGG: rsp:RSP_1850
FT                   phosphoenolpyruvate-protein phosphotransferase, PtsI(Ntr)"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75615"
FT                   /db_xref="GOA:A3PGZ9"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3PGZ9"
FT                   /protein_id="ABN75615.1"
FT                   /translation="MPERSESESRKLLRRLRDSLARSGKGQDRLDRITSLIADSMRTEV
FT                   CSIYLFRDPDTLELCATQGLNPEAVHQTRLKMGEGLVGRVARMASPINTGNAPSERGFR
FT                   FMPETGEEIYSAFLGVPIQRVGEKLGVLVVQSREAREYSEDEVYALEVVAMVLAEMAEL
FT                   GVFVGEGEALSAKHTQPVLMRGSTGQEGAAEGHVWLHEARVVVTNPVGDDPVHETERIR
FT                   AAVAQLRVSVDDLLSASTLDKDQRQVLEAYRLFAHSRGWLRRMEEDIMAGLSAEAAVQK
FT                   EQSAARARLEQVPDAYLRDRLHDLDDLSHRLLRILTGQGRDTGAEMPENPVLVARNIGP
FT                   AELLEYGRKLRGIVLEEGSVGSHAAVVARALAIPLVIHAERITTEALNGDHIMVDGDNG
FT                   LVHLRPEASIAAAFRDKMAMQAKAQERYASLRNLPAQSKCGTVTGLMMNAGLMADLPSL
FT                   DSSGAEGVGLFRTELQFLIRNQMPKRDELARLYARVMDAARGHRVVFRTLDIGSDKVLP
FT                   YLKPQDEPNPAMGWRAIRVGLDKPGVLRMQLQALIRASAGRDLSIMFPFVSEHHEFMMA
FT                   RSHLLRELHRERSLGHPVPVNIRVGTMLETPSLAYAPRAFFETTDFISIGGNDLRQFFF
FT                   AADRENERVRRRYDVLNVSFLTFLEHIVNRCAETATPLSFCGEDAGRPVEALCFAAMGI
FT                   QTLSMRPASIGPVKALLRRVDLIEARKVIEMARASGAETVRPAILEWLATQVD"
FT   gene            522651..523832
FT                   /locus_tag="Rsph17029_0500"
FT   CDS_pept        522651..523832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0500"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: rsp:RSP_1851 O-succinylhomoserine
FT                   sulfhydrylase; TIGRFAM: O-succinylhomoserine sulfhydrylase;
FT                   PFAM: aminotransferase, class V; Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75616"
FT                   /db_xref="GOA:A3PH00"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH00"
FT                   /protein_id="ABN75616.1"
FT                   /translation="MTKDWKTRTQLVHGGSRRSQYGEMAEAIFLTQGFVYDSAEQAEAR
FT                   FIETGADEFIYARYGNPTTRMFEERIAAVEGTEDAFATASGMAAIHGVLTSIVRAGDHL
FT                   VAARALFGSCIYILEEVLGRFGVEVTFVDGTDLDQWRAAVRPGTKAVFFESVSNPTLEV
FT                   ADIGAIAEIAHAVGALVIVDNVFATPVFSTAVRQGADVVIYSATKHIDGQGRALGGVVC
FT                   ASQAFIRKVLEPFMKHTGGSMSPFNAWLMLNGMATLDLRCRAMADTAEKIARALEGHPQ
FT                   LGRVIHPALESHPQHDMAKAQMERPGTMIALDLAGGKEAAFRFLDALKIVKISNNLGDA
FT                   RSIATHPATTTHQRLSDAQKAHLGITPGLVRLSVGLEDADDLIADLKQALAVI"
FT   gene            523928..525007
FT                   /locus_tag="Rsph17029_0501"
FT   CDS_pept        523928..525007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0501"
FT                   /product="GTP cyclohydrolase"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   rsp:RSP_1852 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75617"
FT                   /db_xref="GOA:A3PH01"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PH01"
FT                   /protein_id="ABN75617.1"
FT                   /translation="MNILTPVAERLPSREEAEEALAVLRRWATHTPASDVAALAPEAPA
FT                   LVYPDLSRAYPRTFTVDEAYKASLPDLQNGPASLIVGAKAVIQHVGISNFRLPIRYHTR
FT                   DNGDLQLETSVTGTVSLEAEKKGINMSRIMRSFYAHAEQAFSFEVIERALEDYKRDLES
FT                   FDARIQMRFSFPVKVPSLRSGLTGWQYYDIALELVDRGGVRKEIMHLDFVYSSTCPCSL
FT                   ELSEHARRERGQLATPHSQRSVARISVEVRQGKCLWFEDLLDLVRSAVPTETQVMVKRE
FT                   DEQAFAELNAANPIFVEDAARSFCQALQSDPRIGDFRVVASHQESLHSHDAVSVLTEGP
FT                   TFAAESLDPRLFSSLYHVG"
FT   gene            525058..526506
FT                   /locus_tag="Rsph17029_0502"
FT   CDS_pept        525058..526506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0502"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter; KEGG: rsp:RSP_1853
FT                   potassium uptake transporter, transmembrane component,
FT                   TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75618"
FT                   /db_xref="GOA:A3PH02"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH02"
FT                   /protein_id="ABN75618.1"
FT                   /translation="MLDLRPVGFIIGLLVVALGAAMLLPASVDLLLGDGNGPAILQAAM
FT                   LTMFTGGAVALACANAPTKQLGIRQAFVLTAAIWFALPAFGSLPLILGEPDLTFTDAMF
FT                   EAVSGITTTGSTVIVGLDHLPAGTNLWRGMLNWLGGLGIAFIAMIFLPVMRVGGMQFFR
FT                   TEGFDTLGKVLPRATDIARALLGVYTGLTALCIATYLLIGMEPLDAVVNGVATIATGGF
FT                   SPSDASFGKYPGAGEYAGTVFMILGAMPYIRFVQLVSGAPQAFFGDSQIRAMLRWMVYG
FT                   VGIVTLWRVLTSDQGLEPAFREASFNLVSVFTGTGFFSGSFANWGGFGMVVAFCVGMIG
FT                   GCSSSSSGALSVFRVQVVLTAIRVQIERIGMPDRMASVRYEGRRVEDDVMNALILYVTG
FT                   YILAIGTLSVALTLTGVDPTSALFGVWTSIGNIGYGYGPLVARTGTFIDFPELAKWVLI
FT                   LAMLMGRLALLALVVLVLPRFWRQ"
FT   sig_peptide     525058..525144
FT                   /locus_tag="Rsph17029_0502"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.782) with cleavage site probability 0.630 at
FT                   residue 29"
FT   gene            526549..528003
FT                   /locus_tag="Rsph17029_0503"
FT   CDS_pept        526549..528003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0503"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter; KEGG: rsp:RSP_1854
FT                   potassium uptake transporter, transmembrane component,
FT                   TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75619"
FT                   /db_xref="GOA:A3PH03"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH03"
FT                   /protein_id="ABN75619.1"
FT                   /translation="MIDPRPVGYILGLLVATLGALMLVPMALDLASGDRHWLSFAETAT
FT                   ITTVAGSMLALACANGRGQGTGLSLQQSFLLTTGSWVLLPVFGALPFMMGRPDASFTDA
FT                   VFEAMSGFTTTGTTVFVGLDALPLGTNLWRGMLQWLGGLGIVIVAMIFLPVMKVGGMQF
FT                   FRSEGFDTLGKILPRALDISTALIQIYLVLTMACVMTFLALGIPLFEAVVHALTTVSTG
FT                   GFSSSDRSFGLFQGPAEYACAFFMVLASLPFVRFVQLAQGTFLPLWRDPQVRAYLRWNG
FT                   YAIGLIVAYEVVTRNAPVLPTLRETTFNVISTFSGTGFSSVDLGLWGTFPFVLLIVVGL
FT                   IGGCTSSTGCSVKVFRYLILLEAIKVQIRRLQSPSAVIFVDYEGRRVGEDVINSVILFF
FT                   TMFILSFGVLAVLLSLTGLQTKTAITAAWTAIANVGPAFGPEVSATGAVDRFPAVAKWL
FT                   MIGGMLVGRLELLSVFVLLTPRFWRS"
FT   sig_peptide     526549..526632
FT                   /locus_tag="Rsph17029_0503"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.811) with cleavage site probability 0.700 at
FT                   residue 28"
FT   gene            complement(528073..529854)
FT                   /locus_tag="Rsph17029_0504"
FT   CDS_pept        complement(528073..529854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0504"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   Sporulation domain protein; KEGG: rsp:RSP_1855 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75620"
FT                   /db_xref="GOA:A3PH04"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH04"
FT                   /protein_id="ABN75620.1"
FT                   /translation="MMKQAIFLLWLGAALPAAAPVWAQEQSETRVWVQIEARPTEAEAD
FT                   ERARAYAEVFPDVAGYRLSSGWYAIVLGPYGTDVARLRLQDLLAAGMIPRDSFIADGRA
FT                   FREPFLAPGELPPAPDAEALAVPGPEMLPEDEPLDAPPALEAAPAPLPDETPAEARRSE
FT                   ALLIASERQELQAALQWFGFYGAAIDGAFGPGTRASMAAWQEAEGAEATGILTARQRAE
FT                   LLDRYGRAQAELGLETVTEDEAGIRITLPTALVAFDRYDPPFVHYAPKDGSGVQVMLIS
FT                   EPGDRGALYGLYDILQTLEVVPPEGTRSRTETGFTIEGRSADLASYTHVELAGGLLKGY
FT                   MLVWHPGDDERMARVLTAMQSSFRPFGDRALDPGMVEMTEEQRRGMLAGLEVRKPRQSR
FT                   SGIFVDPKGAVLTTAEAVAGCGRVTIDREHEAKVVATDTALGMALLRPVHPMAPRVTAS
FT                   FRSTEARLGSPVAVAGYPYGEALPAPTLTFGALDALTGLEGEADLRRLRLASRPGDAGG
FT                   PVLDGSGAVLGMLVAPETGERRLPDEVSFALAPAALTARLSEAGIEPRRAEGSGALAPE
FT                   DLVRLGDGMTALVSCWD"
FT   sig_peptide     complement(529783..529854)
FT                   /locus_tag="Rsph17029_0504"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            529979..530902
FT                   /locus_tag="Rsph17029_0505"
FT   CDS_pept        529979..530902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0505"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: glycyl-tRNA synthetase, alpha subunit; KEGG:
FT                   rsp:RSP_1856 glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75621"
FT                   /db_xref="GOA:A3PH05"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH05"
FT                   /protein_id="ABN75621.1"
FT                   /translation="MTGKPVPPRSFQEIILRLMTYWGAKGCAVLQPYDMEVGAGTFHPA
FT                   TTLRSLGARPWAAAYVQPSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPDLQKLYLGSL
FT                   EAIGIDMDLHDIRFVEDDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCRPVSG
FT                   ELTYGLERLAMYVLGIDHVMDMPFNDPDGPTPLTYGDVFRQTEQEYSRWNFDQADTDML
FT                   LQHFRDAEAECERILAAPETDKAGRRIVMAHPAYDQCIKASHLFNLLDARGVISVTERQ
FT                   AYIGRVRALAKKCADAFVTTEAGAAA"
FT   gene            530899..531369
FT                   /locus_tag="Rsph17029_0506"
FT   CDS_pept        530899..531369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0506"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1857 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75622"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH06"
FT                   /protein_id="ABN75622.1"
FT                   /translation="MNGKLLVGGIVLSALAAGAVMWWAQLYAYYEEASFAPGEEIRLTP
FT                   ILGDAPEAIVANEVTGIDSGSSPLRFRACFTTPLSQAMLTETYRVYPDPTPLNAPPWFD
FT                   CFDAERIDMALQKGEAIAFLSEHDIAPGVDRVVAVFPDGHAFAWHQLNAEEQ"
FT   sig_peptide     530899..530958
FT                   /locus_tag="Rsph17029_0506"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.493 at
FT                   residue 20"
FT   gene            531373..533466
FT                   /locus_tag="Rsph17029_0507"
FT   CDS_pept        531373..533466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0507"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: rsp:RSP_1858 glycyl-tRNA synthetase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75623"
FT                   /db_xref="GOA:A3PH07"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PH07"
FT                   /protein_id="ABN75623.1"
FT                   /translation="MPDLLIELFSEEIPARMQARAREDLKKLVTDGLVEAGLTYASAGA
FT                   FSTPRRLVLSVEGLSAESPTLREERKGPKADAPAAAIEGFLRSTGLTRDRLETREDKKG
FT                   AVLFAVVEKPGRPAPEIVAEVLERTIRTFPWPKSMRWGTGSLRWVRPLQSILCLLSDEG
FT                   GAEVVPMTLDGLTAGNSTEGHRFMAPARFAVSGFEDYRAKLGRAFVMLDASEREQAIWH
FT                   EATTQAFAQGLEVVPDAALLSEVAGLVEWPVVLMGAIGEDFLGLPPEVLQTSMREHQKF
FT                   FSVTNPATGRIEKFVTVANRETADHGETILKGNGKVLSARLSDARFFWENDLRTVKTAG
FT                   LEGMAEGLKQVTFHNRLGSQADRIARIEALAREIAPLVGASPDLAAEAARVAKADLQSA
FT                   MVGEFPELQGTMGSYYARAAGLPEAVAQACKAHYQPLGPSDAVPTDPVSVAVALADKID
FT                   TLAGFWRIGEKPTGSKDPFALRRAALGVIRLLLTNNSRAGLMGIMLPAMNRHLEPFDTS
FT                   DFTPYERELLSFFHDRLKVHLREQGIRHDVIDACLAMPGNDDLTLLVKRAEALSAFLKT
FT                   DDGTNLLQGFKRANNILTQAEAKDGVEYSFGADPKFAETDAERALFAALETAEAAIGPA
FT                   LQAEDFAAAMSAMAALRAPIDAFFETVQVNADNAVLRRNRLNMLHSIRATCARVADLTR
FT                   IEG"
FT   gene            533585..536131
FT                   /locus_tag="Rsph17029_0508"
FT   CDS_pept        533585..536131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0508"
FT                   /product="pyruvate phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="PFAM: PEP-utilizing enzyme; pyruvate phosphate
FT                   dikinase, PEP/pyruvate-binding; PEP-utilising enzyme,
FT                   mobile region; KEGG: rsp:RSP_1859 pyruvate phosphate
FT                   dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75624"
FT                   /db_xref="GOA:A3PH08"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH08"
FT                   /protein_id="ABN75624.1"
FT                   /translation="MQKIEPISDFDRITPTAAISLKTHGFRAKCLQRLVRLDLPVPVTV
FT                   ALPATTVRAIAAGHPVDCPAILADFGPTPLVSVRPSPENPDWGGPATVLNIGMNAARHA
FT                   ALARIHGEEAADAIYLGFIQSYAIHVARLDPEMFETGGSSSEALRAALHAWAEEMDEPF
FT                   PQDPAQQLSEVLRSMARAWEGTTARLLRQAKGAPAEARLGLVVQEMAQDLGQGISGSGV
FT                   IQFVDPATGVPQVTGRFFNRSRAWHGKAETLYLTQDPRGPSLEERAPEIFAALCRHGSV
FT                   CRARLREEMQIEFTIEDSHLSVLDAVKVQRSSRAGLRIAVALADDQVITRSEALLRVEP
FT                   RALSELLHPQVDPRGRRDRFARGIAASPGAAVGRIVFSSQAAQASAARGEPCILVRRET
FT                   SPEDIRGMNCAAGVLTERGGVTSHAAVIARGLGLPCVVGASEIRLDARERRLVAPDGRV
FT                   FREGDLITVDGTAGEALAGEAAMLAPALDSCFRKLLSWADEMRDIGVRANADTPADALV
FT                   ARQFEAQGIGLCRTEHMFFTDDRLVVMREMIFADSATDRAAALARLLPMQRADFVQLFE
FT                   IMQGHPVCIRLLDPPLHEFLPHSREGLLELAEALDRPLSEVTRRVEAMAEFNPMLGMRG
FT                   VRLGVAIPEIYDMQAQAIFEATLEVAGRGDPVVPEIMIPLVSARREVELVKTRIDAVAA
FT                   AVHTKYGREFAYRLGVMVETPRAALRAGEIAQHAAFLSFGTNDLTQMTYGLSRDDAGRF
FT                   MNTYVQSGVFPEDPFHILDVDGVGELLLIGAERGRATRPDLVVSICGEHGGDPESIEFC
FT                   RRAGFDYVSCSPYRVPLARLAAAHLAIRSREQPNAS"
FT   gene            536349..537071
FT                   /locus_tag="Rsph17029_0509"
FT   CDS_pept        536349..537071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0509"
FT                   /product="cell wall hydrolase, SleB"
FT                   /note="PFAM: cell wall hydrolase, SleB; KEGG: rsp:RSP_1860
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75625"
FT                   /db_xref="GOA:A3PH09"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH09"
FT                   /protein_id="ABN75625.1"
FT                   /translation="MRLLDIWMRSAAALMLLSGAAFADVTVSQSNDPSVSLGGQLSALL
FT                   GAERNALGTLPAQRLEQVAAAVARPEAKPEAPVRAVATKGNRGAKAADDAPAPRYDEAW
FT                   LASQPATAKDSDEWKCLATALYFEARGESIQGQFAVAEVIMNRVDRPGYPGSICGVVRQ
FT                   GGQFSFMFDGKPETIREKAAFQRAGKIAALMLAGAPRQLTQGATHFHTRAVRPGWAHRF
FT                   PRTAAIGAHLFYRQPGGS"
FT   sig_peptide     536349..536420
FT                   /locus_tag="Rsph17029_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            537171..538073
FT                   /locus_tag="Rsph17029_0510"
FT   CDS_pept        537171..538073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0510"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG: rsp:RSP_1861
FT                   probable dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75626"
FT                   /db_xref="GOA:A3PH10"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH10"
FT                   /protein_id="ABN75626.1"
FT                   /translation="MTNDIRLAFAHPEERAEASAGAAPRDRISLRDHVAEVEIGAFQQE
FT                   RGTRQRVRFNVVVEVRPHPAPLQDDVDRILSYDRITESIADELSAERLNLLETLAERIA
FT                   ERILAEPQAMRVFVRIEKLDRGPGALGVEIVRSRAEAPLRRTGEGGEAVHPLVAFLDNA
FT                   AIAAPDLPARLDALEARGLPLVLAVGLPDAPRPETHHRPTQRRIDLLAIEQNAWALAAR
FT                   DPRCVVVATRTEIDWAMRRGQTIVWAPSKLVLDAVDGPNSRDPVALALWLAEMLAAERL
FT                   VVHGDVTLPAGSRVPLERA"
FT   gene            538119..539156
FT                   /locus_tag="Rsph17029_0511"
FT   CDS_pept        538119..539156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0511"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: rsp:RSP_1862 dihydropteroate synthase, DhpS;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase, DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75627"
FT                   /db_xref="GOA:A3PH11"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH11"
FT                   /protein_id="ABN75627.1"
FT                   /translation="MIYVRPIPLADAARPEGALPLAGGPLFFDRVEILERGRAPALLPA
FT                   AELDPATLAPLTAPRPPVAGLAMDRPQIMGILNVTPDSFSDGGRFAALPEALAQAEALV
FT                   AAGADILDIGGESTRPGAAEVEPAEEIRRTAPVIERLRGQGIAVPVSIDTRKAPVAEAA
FT                   LIAGADLVNDVAALTWDAGLAAVAARREAPVCLMHAQGTPQTMQADPRYDDVLLDVYDW
FT                   LAERIRAAEAAGIPRARIVTDPGIGFGKTLEHNLALLRRLSLFHGLGCPILLGASRKRF
FT                   IGTLAAEPSADRRMAGSVAVALAGAAQGAQILRVHDVRETRQALILWQAVTREAAETAA
FT                   ERRQA"
FT   gene            539153..540496
FT                   /locus_tag="Rsph17029_0512"
FT   CDS_pept        539153..540496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0512"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase C terminal;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: rsp:RSP_1863
FT                   phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75628"
FT                   /db_xref="GOA:A3PH12"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PH12"
FT                   /protein_id="ABN75628.1"
FT                   /translation="MTRKLFGTDGVRGTANTHPMTAEMALRLGAAAGRYFRPVGAGSPR
FT                   VVIGKDTRLSGYMLENALTAGLTSTGMNVLLLGPVPTPAVGFLTRSMRAALGVMISASH
FT                   NPHEDNGIKFFGPDGFKLSDEAEAEIEAILAGEIQPAQPGNIGRAKRIEDGRGRYQEYC
FT                   KTTFPSGLRLDGLKVVIDCANGAAYRAAPEVLWELGAEVIPVGVEPNGKNINLRCGSTH
FT                   PEAAAEAVRAHGADVGICLDGDADRVIILDETGKEADGDQIMALFAARWADEGRLRDGT
FT                   LVATVMSNLGLERFLGARGLRLERTPVGDRYVVEAMRRGGWNLGGEQSGHIVMTDFATT
FT                   GDGLLAGLQFLAAMAQTGRRASDLARSFETVPQLLQNVRYAAGQEPLKAPGVQAVIRDA
FT                   EVRLNGAGRLLIRKSGTEPLIRVMAECEDEALLRDVVEEIVAAVRDAA"
FT   gene            540595..540813
FT                   /locus_tag="Rsph17029_0513"
FT   CDS_pept        540595..540813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75629"
FT                   /db_xref="GOA:A3PH13"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH13"
FT                   /protein_id="ABN75629.1"
FT                   /translation="MDFAWIIPFLSLITLLAGIMFAIASKDRVEARRHDPNAPKSTLAK
FT                   DGPQGGVAFLRKDGPTARKPDAEPVLE"
FT   sig_peptide     540595..540669
FT                   /locus_tag="Rsph17029_0513"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.790) with cleavage site probability 0.639 at
FT                   residue 25"
FT   gene            complement(540886..541908)
FT                   /locus_tag="Rsph17029_0514"
FT   CDS_pept        complement(540886..541908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0514"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: rsp:RSP_1865 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: acetohydroxy
FT                   acid isomeroreductase; Acetohydroxy acid isomeroreductase,
FT                   catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75630"
FT                   /db_xref="GOA:A3PH14"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PH14"
FT                   /protein_id="ABN75630.1"
FT                   /translation="MRVYYDRDCDINLIKDKKVAILGYGSQGHAHALNLRDSGAKNVVV
FT                   ALREGSPSAKKAEAEGLKVMGIAEAAAWCDLIMFTMPDELQAETYKKYVHDNLREGSAI
FT                   AFAHGLNVHFGLIEPKPGVDVIMMAPKGPGHTVRGEYVKGGGVPCLVAVHNDATGKAME
FT                   IGLSYCSAIGGGRSGIIETNFRQECETDLFGEQAVLCGGLVELIRMGFETLVEAGYEPE
FT                   MAYFECLHEVKLIVDLIYEGGIANMNYSISNTAEYGEYVSGPRILPYEETKARMKAVLT
FT                   DIQTGKFVRDFMQENAVGQPFFKATRRINDEHQIEQVGEKLRGMMPWISKGKMVDRARN
FT                   "
FT   gene            542038..542493
FT                   /locus_tag="Rsph17029_0515"
FT   CDS_pept        542038..542493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0515"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   rsp:RSP_1866 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75631"
FT                   /db_xref="GOA:A3PH15"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH15"
FT                   /protein_id="ABN75631.1"
FT                   /translation="MLDDTDRRLLRHLLAEPALGTAELAARAGLTTATCWRRLERLTER
FT                   GVIGARQSVIDWRRLGYEVEVSLRFTLDKTDPRAFDEFLAAARTVPEVIGIETFLGRVD
FT                   VRLNVIARDMKHYQELYRSRILSLPHITDIEALMLVATIREAEALPL"
FT   gene            542490..542948
FT                   /locus_tag="Rsph17029_0516"
FT   CDS_pept        542490..542948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0516"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   rsp:RSP_1867 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75632"
FT                   /db_xref="GOA:A3PH16"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH16"
FT                   /protein_id="ABN75632.1"
FT                   /translation="MIDLDDIDRALLRALAEDATQGAGALGRRFGLSQPAAWRRIRRLE
FT                   EAGIIAGRRVVVDREALGFGVTVFLGVKLATKGRISLEDFERAVTAIPEVQVVQHVLGL
FT                   FDYRLRVVARDIADFERVLRRRIMTLPGVGQVEANVLLTEEKRPGPLG"
FT   gene            543133..544260
FT                   /locus_tag="Rsph17029_0517"
FT   CDS_pept        543133..544260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0517"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   rsp:RSP_1868 serine-pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75633"
FT                   /db_xref="GOA:A3PH17"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH17"
FT                   /protein_id="ABN75633.1"
FT                   /translation="MPALRPDVDPDGLMEFSVVFTDRSLNHMSAKFQQVMRDISGMLRE
FT                   VYGAEAVAVVPGGGTFAMEAVARQFATGAQALVVRNGWFSYRWTQILEAGGFAAGQTVV
FT                   MARPSGNGARAPFAPPPIEEVEAKIAEAKPDVVFAPHVETSAGIILPDDYIARMAEAAH
FT                   AAGALMVLDCIASGCIWVDMAATGVDVLISAPQKGWSASPAAGLVMLSGRAVERLEATA
FT                   SNSFALDLKKWRAIMAAYEAGGHAYHTTMPTDALLGFRDAMAETKAMGFEAAKAAQWRL
FT                   GQEVRAMLAEKGVVSVAAEGFAAPGVVVSYTDDPEVQTGRKFLAEGLQIAAGVPLQVGE
FT                   GAEFRTFRLGLFGLDKLADVEGTVARLRRAVEAVL"
FT   gene            complement(544265..545464)
FT                   /locus_tag="Rsph17029_0518"
FT   CDS_pept        complement(544265..545464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0518"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase,
FT                   FAD-binding; KEGG: rsp:RSP_1869
FT                   2-octaprenyl-6-methoxyphenyl hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75634"
FT                   /db_xref="GOA:A3PH18"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH18"
FT                   /protein_id="ABN75634.1"
FT                   /translation="MARIATDILVSGGGVAGLTAAAAFASAGWSVICVDPQPPVTSAEA
FT                   EGADLRSTALLQPSIPLLQAAGLWPRLAPHAAPLQVMRIVDAGGPVAEPRVIKDFDAAD
FT                   ISEQPFGWNLPNWLLRRETVAHLKTLKRVDFRPGIATKSVLTRESEALVTLSDGTRVAT
FT                   RLLVAADGRNSPVREALGISVRTTRYGQKALAFTVTHPIPHENVSTEIHRSGGPFTLVP
FT                   LPDAGGKPASAIVWMERGEEALRLKALPREAFEAEMTARSCGILGPLTLASQVNVWPII
FT                   SQVAARMSGERTALMAEAAHVMPPIGAQGLNMSLADLGALLELLADHRDDPGSAALLEA
FT                   YHRRRHWEVQARILGIDLLNRASMAGDPAWRDLRAKLLDALYGSAPVRRTLMRAGLGVA
FT                   "
FT   sig_peptide     complement(545387..545464)
FT                   /locus_tag="Rsph17029_0518"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.701 at
FT                   residue 26"
FT   gene            complement(545516..545746)
FT                   /locus_tag="Rsph17029_0519"
FT   CDS_pept        complement(545516..545746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75635"
FT                   /db_xref="GOA:A3PH19"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH19"
FT                   /protein_id="ABN75635.1"
FT                   /translation="MNAYADVTDLPNHIIPPMERHTRKTTREDLVLFAFAAALVSIVAL
FT                   GTWAFGPVMLGMTALFFVPVMMVVIIMITLG"
FT   gene            complement(545827..546474)
FT                   /locus_tag="Rsph17029_0520"
FT   CDS_pept        complement(545827..546474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0520"
FT                   /product="pyrimidine 5'-nucleotidase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; pyrimidine 5'-nucleotidase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: rsp:RSP_1870
FT                   predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75636"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH20"
FT                   /protein_id="ABN75636.1"
FT                   /translation="MVADRFSHVRGWVFDLDNTLYPPSARLFDQIERRMTDWVMTELRV
FT                   VREEADRLRRHYWSTYGTTLAGLMAEHGVDPAPYLSHVHDISLDHLERDMILAARIRAL
FT                   PGRKIVYTNGCAPYAERVLEARGLANLFDAVYGVEHAGFRPKPERAAFETVFAADRLAP
FT                   GTAAMFEDDSRNLLAPHEMGMRTVHVAPEALPAPHIHHHTLDLSEFLALLQP"
FT   gene            546590..547225
FT                   /locus_tag="Rsph17029_0521"
FT   CDS_pept        546590..547225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0521"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: rsp:RSP_1871 transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75637"
FT                   /db_xref="GOA:A3PH21"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH21"
FT                   /protein_id="ABN75637.1"
FT                   /translation="MQKDAYTLILEAIEGGTYKPGDRLVESELAERLGVSRTPVREALQ
FT                   RLETQSMLTRDGRSLIVASLDHNQLAELYAVRTELEGLAARLAARHATEEEIRVLRGMV
FT                   EDDRALLGGDPRALSRANKRFHKQIHLASHNRFLVQQLDLVHRSMALMATTSFAAEGRD
FT                   EVAMAEHEQIVQAIEARDGEAAYAALRNHISKAFETRLRVDAGELRMR"
FT   gene            complement(547233..549143)
FT                   /locus_tag="Rsph17029_0522"
FT   CDS_pept        complement(547233..549143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0522"
FT                   /product="General secretory system II, protein E domain
FT                   protein"
FT                   /note="PFAM: glycosyl transferase, family 2; General
FT                   secretory system II, protein E domain protein; KEGG:
FT                   rsp:RSP_1872 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75638"
FT                   /db_xref="GOA:A3PH22"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH22"
FT                   /protein_id="ABN75638.1"
FT                   /translation="MPALPDSLPQIRPGRAPAAPRPLPSPAEAAEPLGVMLLREGHLAP
FT                   HRIMAALSHGGRPSAPLADVLLAEGALSEDEILAMMARRSGLPVLDPAAERPDPRLIDR
FT                   LGVRDCLREGLLPLRDTGSAVLLAAAAPESFRRHRPRLEELFGTVIPALATRSSIEAAL
FT                   QEVRADAIGTAAELRVAPEESCRDWRTGQMTRFAALAGLALAAGLALAPGLVLLALTAW
FT                   ALLALACGTALRLATAVASLRRPPPEPESPPLLHLPMVSIIVALYREEDIAGRLVARLG
FT                   RLDYPHDRLEILLVVEEADRRTRRALLEARLPPWMRIVVSPKGAIRTKPRALNVALDHC
FT                   RGSIVGVYDAEDAPEPDQIRRVVEGFSRRGSHVACLQGRLDYYNPRTNWLSRCFTIEYA
FT                   AWFRLMLPGLDRLGLVVPLGGTTLFFRRAALEELGAWDAHNVTEDADLGIRLARHGYRT
FT                   DLIDTVTAEEANCRAIPWIKQRSRWIKGFMMTWAVHMRAPRLLWRQLGPWRFAGFQVMF
FT                   LGSISQTLLAPVLWSFWLLALGLPHPVAPLVPEPLLWSMIGLLIGSEGTAIAMGILALR
FT                   QTRHRLNPLWVPTLHLYNPLATFAAYKALWELLRAPFYWDKTCHGVFDAQTRGRPLLQP
FT                   A"
FT   gene            complement(549281..550063)
FT                   /locus_tag="Rsph17029_0523"
FT   CDS_pept        complement(549281..550063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0523"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   rsp:RSP_1873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75639"
FT                   /db_xref="GOA:A3PH23"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH23"
FT                   /protein_id="ABN75639.1"
FT                   /translation="MTGSLPRRLLPALAALALLAACAPEPPPTRSATPMGLSPQIAALY
FT                   GPVADGERIIPAVPPQYLSADKVRREVDYFTDQPPGTIVVDPYARYLYLVQPGQRALRY
FT                   AIAVGREGRGFSGEAVIPIKREWPRWIPTKSMIAEDPEQYGPWKDGMDGGLSNPLGARA
FT                   LYLHRDGKDTYYRIHGTNDVSSIGKATSAGCIRLWNQDILDLYARVSLGTQVVVLTEAE
FT                   SGKGTVPAGQALPPRVAGLNSVAPPGETAATMFFTESF"
FT   sig_peptide     complement(549968..550063)
FT                   /locus_tag="Rsph17029_0523"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.827 at
FT                   residue 32"
FT   gene            complement(550245..551408)
FT                   /locus_tag="Rsph17029_0524"
FT   CDS_pept        complement(550245..551408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0524"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase, small chain; KEGG:
FT                   rsp:RSP_1874 carbamoyl-phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75640"
FT                   /db_xref="GOA:A3PH24"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH24"
FT                   /protein_id="ABN75640.1"
FT                   /translation="MAAASPTDKPTACLALADGTIFYGRGFGARGETVAELVFNTAMTG
FT                   YQEIMTDPSYAGQIVTFTFPHVGNVGVTPEDDETAEPVAAGMVVKWDPTEPSNWRATSE
FT                   LTQWLEAKGRIGVGGIDTRRLTRAIRQQGAPHVALAHDPEGRFDIGALVAKARGWRGLV
FT                   GLDLAKDVTCAQSYRWDEMRWAWPEGYRSRSEPGLKVVAIDYGAKRNILRCLASAGCDV
FT                   TVLPATATAEDVLALNPDGVFLSNGPGDPAATGAYAVPMIQGVLARDMPLFGICLGHQM
FT                   LALALGAKTVKMNHGHHGANHPVKDLETGKVEITSMNHGFTVDSQTLPAGVKETHVSLF
FT                   DGSNCGIRVEDRPVFSVQYHPEASPGPQDSYYLFDRFAAAMRARRAA"
FT   gene            551586..552044
FT                   /locus_tag="Rsph17029_0525"
FT   CDS_pept        551586..552044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0525"
FT                   /product="GatB/Yqey domain protein"
FT                   /note="PFAM: GatB/Yqey domain protein; KEGG: rsp:RSP_1875
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75641"
FT                   /db_xref="GOA:A3PH25"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH25"
FT                   /protein_id="ABN75641.1"
FT                   /translation="MTLRERLQDAMKEAMRAKQPDRLSTLRLINAAIKDRDIAARVDGA
FT                   DGMVSDEEITAILGRMVRQRIESARAYEEGGRLELAEKERAEIGVIEDFLPRQLDPEEV
FT                   EAAISAAIAEVEATTIRDMGKVMAELKTRYTGQMDFSAVGPMVKDRLG"
FT   gene            complement(552353..552883)
FT                   /locus_tag="Rsph17029_0526"
FT   CDS_pept        complement(552353..552883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75642"
FT                   /db_xref="GOA:A3PH26"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH26"
FT                   /protein_id="ABN75642.1"
FT                   /translation="MPYEWVIAPKAPETSGAFPCSGEEDPLGRLHLWPYRSLPRRGFAA
FT                   FIGITCLLLALPLIGLLGSPVLWALLPFLVAVVTGMWLALNRSYGDGEILEELTLWPDR
FT                   VTLERHGPRGRRQSWQANPHWVRVTLHRSGGPVPHYLTLGGGPREVEIGAFLGEEERLA
FT                   LWPELERALSRAR"
FT   gene            complement(552897..554597)
FT                   /locus_tag="Rsph17029_0527"
FT   CDS_pept        complement(552897..554597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0527"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   rsp:RSP_1877 cytochrome c oxidase, aa3 type, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75643"
FT                   /db_xref="GOA:A3PH27"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH27"
FT                   /protein_id="ABN75643.1"
FT                   /translation="MADAAIHGHEHDRRGFFTRWFMSTNHKDIGVLYLFTGGLVGLISV
FT                   AFTVYMRMELMAPGVQFMCAEHLESGLVKGFFQSLWPSAVENCTPNGHLWNVMITGHGI
FT                   LMMFFVVIPALFGGFGNYFMPLHIGAPDMAFPRMNNLSYWLYVAGTSLAVASLFAPGGN
FT                   GQLGSGIGWVLYPPLSTSESGYSTDLAIFAVHLSGASSILGAINMITTFLNMRAPGMTM
FT                   HKVPLFAWSIFVTAWLILLALPVLAGAITMLLTDRNFGTTFFQPSGGGDPVLYQHILWF
FT                   FGHPEVYIIVLPAFGIVSHVIATFARKPIFGYLPMVYAMVAIGVLGFVVWAHHMYTAGL
FT                   SLTQQSYFMMATMVIAVPTGIKIFSWIATMWGGSIELKTPMLWALGFLFLFTVGGVTGI
FT                   VLSQASVDRYYHDTYYVVAHFHYVMSLGAVFGIFAGIYFWIGKMSGRQYPEWAGKLHFW
FT                   MMFVGANLTFFPQHFLGRQGMPRRYIDYPEAFATWNFVSSLGAFLSFASFLFFLGVIFY
FT                   TLTRGARVTANNYWNEHADTLEWTLTSPPPEHTFEQLPKREDWERAPAH"
FT   gene            complement(555012..555668)
FT                   /locus_tag="Rsph17029_0528"
FT   CDS_pept        complement(555012..555668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0528"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: rsp:RSP_1878
FT                   lipoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75644"
FT                   /db_xref="GOA:A3PH28"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PH28"
FT                   /protein_id="ABN75644.1"
FT                   /translation="MSAVEWSILPGLSPYRETLEAMENRVAAIRAGEAAEAIWLLEHPP
FT                   LYTAGTSARPEDLVEPERFPVHVAGRGGQYTYHGPGQRVAYVMLDLDRRGRDVRRFVTA
FT                   LEDWVIATLAEFNVRGERREGRVGVWVVRPDRPAGLDGSPREDKIAAIGVKLRRWVSFH
FT                   GLSINLEPDLTHFEGIVPCGIREHGVTSLVDLGLPVTMQDLDAALLRTFPQHFPD"
FT   gene            555765..557324
FT                   /locus_tag="Rsph17029_0529"
FT   CDS_pept        555765..557324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0529"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   rsp:RSP_1880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75645"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH29"
FT                   /protein_id="ABN75645.1"
FT                   /translation="MYGKYLVTASLAALIGLAPAEPVKADAGDAIAGALVGGIIGHAIA
FT                   NDQNRRRAQQQQVYRRAPAKATMSSAQREQNKEVQTALNYFGYPVGTVDGVLGSRSRSA
FT                   VSQFQVLMGYQPTGQLTDYERTILTTAYHRGIAGGPMVQQAIATHPQGMRGLLLMQRDE
FT                   MAGLPAAQSAMALMPQAPAPQMPMAVTAPVLPVAPAAAAAGAAAAVLPELPAPVAEPAP
FT                   AAPELPSFLGSGATMASLASHCNTIGLQTNANGGYTTSAGMTDASFALGEQFCLARSYA
FT                   ISASEELTKQVQGFTPQQIADQCQALGPALKDQVSALSLEPRDDVLKDVSAFVLASGRP
FT                   PAQLAGSARICLGTGYAQDRMDVAVASALLLTALGQKGYAELLGHHLAQGFGASQRPDL
FT                   ALDWYQMGLDAAQSGTAVFGQGMPDRTEVIRKAAYTVGGRADLIVPQTPAPLPVFAPVT
FT                   PPPVEVAAPAPAPVAAPTVEAAASAPAPALALAAQPSGEMAEAGAKAVSAAARLPFLLL
FT                   GQ"
FT   sig_peptide     555765..555842
FT                   /locus_tag="Rsph17029_0529"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.911 at
FT                   residue 26"
FT   gene            557446..557532
FT                   /locus_tag="Rsph17029_R0013"
FT                   /note="tRNA-Leu1"
FT   tRNA            557446..557532
FT                   /locus_tag="Rsph17029_R0013"
FT                   /product="tRNA-Leu"
FT   gene            557822..558925
FT                   /locus_tag="Rsph17029_0530"
FT   CDS_pept        557822..558925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0530"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: rsp:RSP_1882 ABC polyamine/opine transporter,
FT                   ATPase subunit; TIGRFAM: spermidine/putrescine ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75646"
FT                   /db_xref="GOA:A3PH30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH30"
FT                   /protein_id="ABN75646.1"
FT                   /translation="MVASTQDDGFVVFEHVQKSYDGETLVVKDLNLTIGQGEFLTMLGP
FT                   SGSGKTTCLMMLAGFETATHGEIRLDGRPINTVPPHKRGIGMVFQNYALFPHMTVGENL
FT                   SFPLEVRGMSKSDRERKIKRALDMVQMGAFANRRPAQLSGGQQQRIALARALVFDPQLV
FT                   LMDEPLGALDKQLREHMQFEIKHLHESLGITVVYVTHDQGEALTMSDRIAVFNDGRIQQ
FT                   LAPPSELYERPKNSFVASFIGENNRLPGTVEEIADGRALVRLETGELIDATPVNVARKG
FT                   QQTLVSIRPERVEFKPEMLPPNAHLIDAEVLEFIYMGDIFRTRLRVAGSEDFVIKCRNT
FT                   LGQRVMQPGEKVRIGWAPQDARALDPL"
FT   gene            558995..560071
FT                   /locus_tag="Rsph17029_0531"
FT   CDS_pept        558995..560071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0531"
FT                   /product="ABC polyamine/opine transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="KEGG: rsp:RSP_1883 ABC polyamine/opine transporter,
FT                   periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75647"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH31"
FT                   /protein_id="ABN75647.1"
FT                   /translation="MKKALILSTALSAVAFAASAEQITVMSWGGAYTTSQVEAFHKPFT
FT                   AETGIGVVSVDADNPATPLKAMVEANNVSVDVVDVNTSDAVRLCDEGQLEEIDPAMLPA
FT                   APDGTPATEDFLPGALSDCAVGNIVYSMIVAYDESKFPNEKPKTIGDFFDTEKFPGKRA
FT                   MWKSAKTTLEMALMGDGVPAAEVYDVMGTPEGVDRAFAKLDAIKGDLIWWEAGAQPVQL
FT                   LADGEVAMTTAYNGRIFAAAVSENKPFVPIWDGQVYEYDLFVIPKGAPNLEAAKKFVAF
FT                   ATGTQPLADQAKWISYGPARKSSAPLVGLYQDGKTEMGPNMPTAEANLTNALPSSYEFW
FT                   VDHDTELEERFNAWLASN"
FT   sig_peptide     558995..559057
FT                   /locus_tag="Rsph17029_0531"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.863 at
FT                   residue 21"
FT   gene            560123..561397
FT                   /locus_tag="Rsph17029_0532"
FT   CDS_pept        560123..561397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0532"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsp:RSP_1884 ABC
FT                   polyamine/opine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75648"
FT                   /db_xref="GOA:A3PH32"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH32"
FT                   /protein_id="ABN75648.1"
FT                   /translation="MADATAQIAAAGTERLTTADGRPLKSALARAQARARRRAFLLVLP
FT                   LLLFVVVTFIVPIGQMLHRSIHNDGFAANMPQLTQWFAETEPGTEPDEAAYAALAADLK
FT                   AAAAAKTIGVVGTRVNYEMAGTRSLFTSTGRKARNFEPPYRAAILEADEKWANPDLWGT
FT                   MRQVSRAYSPNFFLAAVDLARDNEGNIVRAPAERRVYVMLFERTFLIAGLITFLCLLLG
FT                   YPVAHLLATLPLRTSNLLMILVLLPFWTSLLVRTTSWIVLLQGQGVVNNTLVATGLISD
FT                   SSRIQMIYNQAGTIIAMTHILLPFMILPLYSVMRPIPPSYVRAARSLGASSWTAFRRVY
FT                   LPQTLPGIGAGALLVFILGVGYYITPALVGGASGQLISNLIAFHMQDSLNWSLAAALAA
FT                   VLLGAVLVLYWLYDRLVGIDNLKLG"
FT   gene            561476..562384
FT                   /locus_tag="Rsph17029_0533"
FT   CDS_pept        561476..562384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0533"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsp:RSP_1886 ABC
FT                   polyamine/opine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75649"
FT                   /db_xref="GOA:A3PH33"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH33"
FT                   /protein_id="ABN75649.1"
FT                   /translation="MALPVYASPLERLWYYSYRVLCGLIFLFLIAPILIVIPLSFNVEP
FT                   YFTFTEKMLSLDPDGYSLRWYDTLLTFGMANPEAPRDSSWWMDVWNNAAWVRAAKNSVI
FT                   IGVSSTVVATVLGTVAALGLSRPEMPYRRAIMAILISPMIVPIIITATGLFFFYSATGL
FT                   AGSYVGVVLAHATLGIPFVIITVTATLVGFDRSLTRAAASLGASPTTTFFKVTMPLILP
FT                   GVISGALFAFVTSFDEVVVVLFVAAHDQQTIPRQMWNGIREQISPAILSVATILVIVSV
FT                   LLLATVELLRRRSERLRGISG"
FT   gene            562564..562731
FT                   /locus_tag="Rsph17029_0534"
FT   CDS_pept        562564..562731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0534"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="PFAM: ribosomal protein L33; KEGG: rsp:RSP_1887 50S
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75650"
FT                   /db_xref="GOA:A3PH34"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PH34"
FT                   /protein_id="ABN75650.1"
FT                   /translation="MAKPTTIKIRLNSTAGTGHFYVTKKNARTMTDKMVVRKYDPVKRE
FT                   HVEYKEGKIK"
FT   gene            562806..563291
FT                   /locus_tag="Rsph17029_0535"
FT   CDS_pept        562806..563291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0535"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rsp:RSP_1888 possible acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75651"
FT                   /db_xref="GOA:A3PH35"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH35"
FT                   /protein_id="ABN75651.1"
FT                   /translation="MTVAGLHLRLARPGDLATVDALFAHSYARLIRADYPPSVLVTAVP
FT                   LLARAQPALLASGRYWLAETEEGILAAGGWSPRGAADGEIRHLVTRASHVRQGIASALL
FT                   SRSIAQAAAEGILRLHCLATRTAVPFYERMGFRRLGEVSVPLGPGVAFPSERMLRAP"
FT   gene            complement(563342..564082)
FT                   /locus_tag="Rsph17029_0536"
FT   CDS_pept        complement(563342..564082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0536"
FT                   /product="protein of unknown function UPF0005"
FT                   /note="PFAM: protein of unknown function UPF0005; KEGG:
FT                   rsp:RSP_1889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75652"
FT                   /db_xref="GOA:A3PH36"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH36"
FT                   /protein_id="ABN75652.1"
FT                   /translation="MADYQTVRSVGAGARAARIDEGLRAHMNKVYGLMSVGMLLTGGVA
FT                   WAFGTSEQLFSLLRDPVTMSPNILGWIVMFAPLIMVFAFGAVLNRLSQAAAQLFFYAYA
FT                   AVMGLSLSWIFVAFTGVSIAQTFLITAIAFASLSLFGYTTKKDLSGFGTFLIMGVVGLL
FT                   VAMVVNIFLASSALAFAISVIGVLIFAGLTAYDTQNIKNTYLQHAHTGDAEWLGKAAIM
FT                   GALQLYLDFINLFMFLLQFMGNRE"
FT   gene            complement(564213..564443)
FT                   /locus_tag="Rsph17029_0537"
FT   CDS_pept        complement(564213..564443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75653"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH37"
FT                   /protein_id="ABN75653.1"
FT                   /translation="MFASLHTARLATRGVQAGGSLQRLVARAHLALAAHRQRRALAHLD
FT                   PHLLADVGLTVDEARAEAARPLWDVPSNWRR"
FT   gene            564561..565496
FT                   /locus_tag="Rsph17029_0538"
FT   CDS_pept        564561..565496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0538"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rsp:RSP_1890 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75654"
FT                   /db_xref="GOA:A3PH38"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH38"
FT                   /protein_id="ABN75654.1"
FT                   /translation="MPRNLDLTALRSFVAVADAGGVTRAAGFLNLTQSAVSMQIKRLEE
FT                   TLDLALLDRSARRVALTAAGEQLLGYARRMLALNDEVFGRLTHDDFEGEVVLGVPHDIV
FT                   YPAIPQVLQRFSAEFPRMRVTLLSSYTRKLKSQFARGECDVIMTTEDTVEPGGETLVEL
FT                   PLVWVGAPGGQAWKQRPLRLAFEPNCIFRMGVQSALDAAGIPWTMAVESDSSRTIEASV
FT                   SADLAVHVSLAGAEPRYMERIPHGGTLPDLETSKVNLYVADPVHSPAVEGMAELIRRAY
FT                   AAQAAGAAAPRPLAPVEGAAGEGPRFALRA"
FT   gene            complement(565504..566463)
FT                   /locus_tag="Rsph17029_0539"
FT   CDS_pept        complement(565504..566463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0539"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rsp:RSP_1891 zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75655"
FT                   /db_xref="GOA:A3PH39"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH39"
FT                   /protein_id="ABN75655.1"
FT                   /translation="MRAFRLRETGLAPDLTEEPLPEPGPGEIRLRIAACALNFADLLMI
FT                   QGRYQERPPLPLTLGMEVAGIVDALGEGVSGPATGTRVAAFGSCGGLAEFGCWPAGRCL
FT                   PLPDSVSFRDAAAFQIAYGTGHLALDHRARLQPGERLLVTGAAGGVGLAAVEIGRRMGA
FT                   HVIATARGEERLAVARAAGAHEAIDSETEDLKGVLKALGGIDVTYDTVGGAGFDAALRA
FT                   SRPEGRLLAIGFAGGDVPQVPANLLLVKNLSVIGLYWGGYMTFAPQVLIRSLETLLGWL
FT                   ADGSLRPHVSHELPLERAAEGLELLRTRQATGKVVITP"
FT   gene            566824..567186
FT                   /locus_tag="Rsph17029_0540"
FT   CDS_pept        566824..567186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0540"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   rsp:RSP_1892 putative Cro/CI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75656"
FT                   /db_xref="GOA:A3PH40"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH40"
FT                   /protein_id="ABN75656.1"
FT                   /translation="MKHPVDAHVGKRIRHRRWMVGMTQQQLADCVGIKFQQIQKYETGM
FT                   NRVSASRLWDIAEALGVSISFFFEGLEGAGDQARQAEGDRITDKEALELVRSYYAIPEA
FT                   QRRRLFDLARVLSEAA"
FT   gene            567275..568075
FT                   /locus_tag="Rsph17029_0541"
FT   CDS_pept        567275..568075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0541"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: rsp:RSP_1893
FT                   inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75657"
FT                   /db_xref="GOA:A3PH41"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH41"
FT                   /protein_id="ABN75657.1"
FT                   /translation="MQMLTDRETADIIDTAAEMAAAARDATLLHFRSRGLSADTKEADR
FT                   FDPVTVADRLCEERMRAILARRRPRDGIFGEEMGVQAGDSGLTWVLDPIDGTRSYLCGT
FT                   PTWGVLISVADASGPIYGLIDQPYIGERFEGGFGLARVRGPRGEDRLATRAARALSEAI
FT                   LMSTFPEVGTAVEEAAFRRLSRQVRLTRYGTDCYAYALLAAGQIDLVVEAGLQPYDVQA
FT                   PMAVIEAAGGLMTDWEGRRNPQGGRVIAASCPEVHAAALEILRG"
FT   gene            568072..568341
FT                   /locus_tag="Rsph17029_0542"
FT   CDS_pept        568072..568341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75658"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH42"
FT                   /protein_id="ABN75658.1"
FT                   /translation="MTPAAPLERAQVSQTGSVSGCTVRSREDRGRKAPSLRLRHPRPTA
FT                   TPFAHVTAACSAAGGKAAVRASDQIHPQGLDLGPGVLHPRPDPP"
FT   gene            568404..568913
FT                   /locus_tag="Rsph17029_0543"
FT   CDS_pept        568404..568913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0543"
FT                   /product="cell wall hydrolase, SleB"
FT                   /note="PFAM: cell wall hydrolase, SleB; KEGG: rsp:RSP_1894
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75659"
FT                   /db_xref="GOA:A3PH43"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH43"
FT                   /protein_id="ABN75659.1"
FT                   /translation="MATRLLRTSIRLVLCTAPALLLLGCGLFHRPSELECMERAMYFES
FT                   HRSSRDGMVAVGTVVMNRVNSGQFPNTVCGVVGQRNQFAPGVMSKRMDSRSLPRVREAA
FT                   RAVLRGERHPFVGNAMFFHTAGHRFPYDNMHYTLVTGGNAFYEKRRSELVTQPVPPPPV
FT                   DGLTGW"
FT   gene            569213..571576
FT                   /locus_tag="Rsph17029_0544"
FT   CDS_pept        569213..571576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0544"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   rsp:RSP_1895 small-conductance mechanosensitive ion
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75660"
FT                   /db_xref="GOA:A3PH44"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH44"
FT                   /protein_id="ABN75660.1"
FT                   /translation="MTRLFRTLAAPLLLALTLFLGSTTAFLPAHAQTALLPGSGAEEPA
FT                   APTSAATLLDLLRNDQARAELIAELERVAAAGEPATPAVSAPSDEILSFGRSAALFTQQ
FT                   AAESVATSVRGLWDALKASPELFAGLSRLDLGVLGDALIELLLLIVATAAIFNLLRRAV
FT                   IPTYRRMGQRARSAGVVKRILLYVGALALDVLIVVGAWAIGYVLAIAVIGNAGQIGLRQ
FT                   TLYLNAFLAVELLRTAMRFVLSPSTGDLRIVALRDRPARYLSAAMSFSIALLGYGQLLI
FT                   VPIVEESTSRAAGRGVSALISVIGVLFVAFLVVRNRKAVAEWLLRETQPVSARHVAAEP
FT                   PAPPVVTTQEIDPDLAADIAAGTADAPPPPEAEPVEVTPEPHPRVRRSPALVALAQSWH
FT                   WFALAYLAVILVLSLVSPGGDAMGPTFASLRIAAVFVVGFFLSGALARAITRGVRLPAT
FT                   ANERLPLLERRLNRFVPQALLVLRLLIVAAVLFFTLHTIGLIDVSTWLESQLGRRLIGT
FT                   LIAVSAILAVAFAIWIALSSWIDYRLNPAFGHVATSREQTLLSLLRNAATIALVVITLM
FT                   FCLSEIGLNIGPLLASAGVLGLAIGFGAQKLVQDIITGIFIQFENAINVGDVVTVAGTS
FT                   GVVERLTVRSVSLRDLNGVFHIIPFSSVDMVSNFMRDFSFFVCDMGVAYREDVTQVRAA
FT                   MFDAFEELRRRPEHAAVILADLEWLGLDSFGDSAVILRARIKTLPGKQWGVGRAYNEIL
FT                   KRIFDERDIEIPFPHQTIYFGQPKQGQIPPQPES"
FT   sig_peptide     569213..569308
FT                   /locus_tag="Rsph17029_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 32"
FT   gene            complement(571620..572906)
FT                   /locus_tag="Rsph17029_0545"
FT   CDS_pept        complement(571620..572906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0545"
FT                   /product="guanine deaminase"
FT                   /EC_number="3.5.4.3"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   rsp:RSP_1896 guanine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75661"
FT                   /db_xref="GOA:A3PH45"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH45"
FT                   /protein_id="ABN75661.1"
FT                   /translation="MTDLLLGQVLSFTANPFLEGEAAARHESHGAVLVEDGRIAAVGPA
FT                   EALRAAHPEARVTDYGQALISAGFIDAHVHYPQTAIIASWGKRLIDWLETYTFPEEMRF
FT                   GDPAYAAEISGRYLDLTLAHGTTTVCSYATIHPESVDAFFEAASARGLRAYAGKTCMDR
FT                   NAPEGLRDTAESAYADSKRLLERWHGRGRLSYVITPRFSPTSTPEQLAALGALWREHPD
FT                   CLMQTHLSEQLDEIEWVKTLHPQARDYLDTYEAQGLLREGAVFGHAIHLAPRERARLAE
FT                   AGASLVHCPTSNTFIGSGLFDMGLVAEGVRVGLATDTGGGSSFSMLRTMAAAYEIGQLR
FT                   GQALHPAQLWWLATAGSARALRAEDRIGNLAPGMEADLVVVDLASTPAIAQATGRAETI
FT                   WQALFPTIMMGDDRAIRAVWVNGAPAPRG"
FT   gene            573038..574417
FT                   /locus_tag="Rsph17029_0546"
FT   CDS_pept        573038..574417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0546"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: CBS domain
FT                   containing protein; MgtE integral membrane region; MgtE
FT                   intracellular region; KEGG: rsp:RSP_1897 Mg/Co/Ni
FT                   transporter, MgtE"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75662"
FT                   /db_xref="GOA:A3PH46"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH46"
FT                   /protein_id="ABN75662.1"
FT                   /translation="MQVETGDTREEERSGVPDRVVDSVLEAVEERDEARLSDLLEPLHA
FT                   ADIADVLEQIGSAERRELLTLWSGGIDGEILSEISDSIREEVIEHLPPEVIAEAVRELD
FT                   TDDVVDILEDLEEPQQEAILGALDRADRVAVEQAMAYPEYSAGRLMQREVVVAPVHWTV
FT                   GETIDFLRETEELPDQFYHVILVDPRMKPAGYVTLGRLLSSRRDVKLTAIEEESFRTIR
FT                   ATMAESEVAYIFNQYHLISCPVVDENDRLVGIVTIDDAMNVLDEEHEEDILRLAGVGDE
FT                   SSLSDGPFATARQRLPWLAANLFTASLSALVISAFESTIAQLVTLAALMPIVASTGGIA
FT                   GTQSLAVAVRALATRDLTSANAPRVVRRELFAGLLNGIGLALILGLAGFVIFGDPVLGA
FT                   VLGMAMICNQVVAALGGVLVPLGLNRLGLDPALASGTFVTTLTDVMGFFAFLGLASLVL
FT                   I"
FT   gene            574414..574968
FT                   /locus_tag="Rsph17029_0547"
FT   CDS_pept        574414..574968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0547"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   rsp:RSP_1898 putative 5-formyltetrahydrofolate
FT                   cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75663"
FT                   /db_xref="GOA:A3PH47"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH47"
FT                   /protein_id="ABN75663.1"
FT                   /translation="MTVAALKAEARRAAGAARALAHKAGQGQAAELLADWLVPHRGRVL
FT                   SGYMPIRSEIDPLPAMAAHDGPVCVPVIVAPGEPLRFREWSPGCPMVDGPFGARVPEDG
FT                   AWLEPEVLIVPLLAFDRRGFRLGYGGGFYDRTLERLRARHPLTAVGFAFTAQELPEVPV
FT                   DATDQPLDAILTEIGPIPLRR"
FT   gene            complement(574970..576280)
FT                   /locus_tag="Rsph17029_0548"
FT   CDS_pept        complement(574970..576280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0548"
FT                   /product="ATPase"
FT                   /note="KEGG: rsp:RSP_1899 predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75664"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH48"
FT                   /protein_id="ABN75664.1"
FT                   /translation="MTVQSSDVIAPPAPRTLPDTGLSLVMLRDILLKTMFRMNLELVSQ
FT                   IAPVICLPAPLAQELVDLARSQRLVEATGTLHATSGNEMGYQLTDQGKARALDALSQSE
FT                   YYGAMPVPLDRYRLQVERQSVRHIKLTRAQLTAAMGHLILPDELLDHLGPAVTSGRSIL
FT                   MYGPPGNGKSSISNGIRDALGDRIYVPRALEYSGQVITVYDPIVHRSAESAVDDPTSLR
FT                   RTSNRFDNRYVWCERPTVITGGELTLDMLDLTYNPVARTYQAPLQLKATGGIFIVDDLG
FT                   RQAEPPQKLVNRWIVPLEENRDILALQSGEKFTVPFDTLVIFSTNFHPNEIFDGAALRR
FT                   IFFKIKVDGPSQENFLKIFAMVAKKRKMPLDETALVHLMKAKFPTIDNRYANYMPVYLI
FT                   DQMISVCDFEGLPYQMTPALIDRAWSNMFVRDEVIAK"
FT   gene            complement(576296..576799)
FT                   /locus_tag="Rsph17029_0549"
FT   CDS_pept        complement(576296..576799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0549"
FT                   /product="peptidase A24A, prepilin type IV"
FT                   /note="PFAM: peptidase A24A, prepilin type IV; KEGG:
FT                   rsp:RSP_1900 putative prepilin peptidase CpaA"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75665"
FT                   /db_xref="GOA:A3PH49"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH49"
FT                   /protein_id="ABN75665.1"
FT                   /translation="MADLIATPAPAAAVFLPLVLPIALWVAWSDMKFMKIPNKAVLALA
FT                   AVFLVAGPVVLPLDDWLWRWLHLLVVLVAGFLMNMGRLIGAGDAKFAAAMAPFVALEDL
FT                   RLALALFAASLLGAFASHRGLGLLEPFRRATADWESWRRRDFPMGLALAGMLILYLLAA
FT                   LFGR"
FT   gene            complement(576802..577710)
FT                   /locus_tag="Rsph17029_0550"
FT   CDS_pept        complement(576802..577710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0550"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1901 hypothetical protein with TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75666"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH50"
FT                   /protein_id="ABN75666.1"
FT                   /translation="MCCCRSSEHDRDRAARGRRTMRHPVLTALCLVGTALLSGCGGGRD
FT                   AEVDRALKSLSAADESNLNEIMLTVGAPDEAVAYFRGAVEKAPDRIDLKRSLAKSLVRA
FT                   QRPAEAATVWSQVVNSHEGTNADRVAFADTLIRSNDWSRAEAELSRIPPTYETFERYRL
FT                   EAMVADSKKQWTKADSFYETATGMTTQPAGVLNNWGFSKLSRGDAAAAERLFYEALTYD
FT                   PTSFTAKNNLVLARGAQRKYDLPVIQMTQTERAQLIYTLALAAVKKGDVTVGKGLLQSA
FT                   IDTHPQYFEAAVRSLEALDAG"
FT   gene            complement(577688..578254)
FT                   /locus_tag="Rsph17029_0551"
FT   CDS_pept        complement(577688..578254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0551"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: rsp:RSP_1902
FT                   conserved hypothetical protein with TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75667"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH51"
FT                   /protein_id="ABN75667.1"
FT                   /translation="MTRGLVFLLLCATLAACGGPDALSRQASERNAPFGVDPGRNGIDG
FT                   LLVGHRLLAAGESELALRAYLRAASEQGMTADVLSALGSANLRLGRLNQAEHLLRRAIE
FT                   LDPAFVPAVNNLGVVLMERGRAPEARLVFQQAFALDSGATDSIRENLRRAIAKSEASLY
FT                   VEPEERHAFSLVRRGQGQYVLLSQL"
FT   sig_peptide     complement(578198..578254)
FT                   /locus_tag="Rsph17029_0551"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.422 at
FT                   residue 19"
FT   gene            complement(578261..579241)
FT                   /locus_tag="Rsph17029_0552"
FT   CDS_pept        complement(578261..579241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0552"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   rsp:RSP_1903 putative Flp pilus assembly protein TadC"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75668"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH52"
FT                   /protein_id="ABN75668.1"
FT                   /translation="MELLSLLETYLTDRLGPLGPLIAVGSLGILLIALTLPVMLKKRVE
FT                   PFDRIRAQRTAAVAAPVQKGQALRRASGSEKLDRFANLLEPKTAEEMSASRLKMMRAGY
FT                   RSKGAVRAFHAAQFALGVGFLAAGLLYAMVASAAAPLTMQQMVLYTILPGAIGYYLPVY
FT                   WIKRRAQERYDQIVSGFPDALDMMLVCVEAGQSLDQSILRVARESAAGYPALAEEFEMV
FT                   AHEVKAGKERVAVLKDMSERVGIPDVSSFVTTLIQSATFGTSIAEALRVYSSEMRDKRV
FT                   MRAEEKANTLPTKLTLGTMLLTVPPLMLILIGPSVYGIATQLGGQ"
FT   gene            complement(579245..580213)
FT                   /locus_tag="Rsph17029_0553"
FT   CDS_pept        complement(579245..580213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0553"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   rsp:RSP_1904 putative Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75669"
FT                   /db_xref="GOA:A3PH53"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH53"
FT                   /protein_id="ABN75669.1"
FT                   /translation="MQLSAAPIIYILIFVAVLLLVEGIYLTVFGKTISLNSRVSRRLAL
FT                   LEKNQNREQVLEQLRKEMSQHMNARGIPLYAILASKAQKANIAFSPKALVGIMVLLSAV
FT                   AYLGLTIGTSAAPLVRGAVAVVMGVGAVYVWVNGKAKKRMALIEEQLPDAVELMVRSLR
FT                   VGHPFSSAIQIVAKEVPDPLGTEFGVIADEAAYGRDVAECIRAFAERMESQDLRFLAVA
FT                   VTIQQQSGGNLAEILEGLAKVIRSRFKLFRRVKAITAEAKWSGTFLSAFPIVALVAISI
FT                   LKPDYYDGVKETPLFIPAALVVGAFLIANVIFMKIMVNIKV"
FT   gene            complement(580221..581678)
FT                   /locus_tag="Rsph17029_0554"
FT   CDS_pept        complement(580221..581678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0554"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   rsp:RSP_1905 putative Flp pilus assembly protein ATPase
FT                   CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75670"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH54"
FT                   /protein_id="ABN75670.1"
FT                   /translation="MFSRYRKSPDGPKTAPSAAVGAATPSVTAPAAPAPARPAAPPRPG
FT                   PAAPRTGAEAIASDKEKKRKERLMELKVELHRRLLDDLNLAALETASESSLRSEIAAIC
FT                   GEALEEMSVVLNKDERAILNQELYDEVMGLGPLEPLLKDETINDILVNGPYRIFVERGG
FT                   KLELTDTTFKDERHLLRIIDKIVSAVGRRVDESTPYVDARLADGSRFNAMVPPIAVDGS
FT                   LVSIRKFKKDKLGIADLVRFGAFTEEMAAYLQAAVATRLNIIVSGGTGSGKTTTLNALS
FT                   SFIDDSERILTIEDTAELQLQQAHVGRMESRPPNVEGKGAVTQRDCLRNALRMRPDRII
FT                   VGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMVAMAGIEMPIKAVRAQI
FT                   ASAVNLIVQASRLQDGSRRMVSITEITGMEGDVISMQEIFRYERLGVEPSGKIIGRFNA
FT                   TGVRSHYSDRFRQWGYILPATIYDPIP"
FT   sig_peptide     complement(581592..581678)
FT                   /locus_tag="Rsph17029_0554"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.849) with cleavage site probability 0.849 at
FT                   residue 29"
FT   gene            complement(581699..582970)
FT                   /locus_tag="Rsph17029_0555"
FT   CDS_pept        complement(581699..582970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0555"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: rsp:RSP_1907 putative Flp pilus assembly
FT                   protein ATPase CpaE"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75671"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH55"
FT                   /protein_id="ABN75671.1"
FT                   /translation="MSSLATLQPEPAPIVACTISRDVQNFEILINDMESELGESWGDLS
FT                   FEDAGLFLRQPEARTLEFVALAVDGEDEGDLARLTDIIRTAKEKAIKVILIANQVSPIA
FT                   LHQLLRLGADDFVPYPLPEGALHEAIDRIRKAPPPPAAADHTPPVSPGLPHAPAFKARG
FT                   DRDAIVLPVHGMAGGVGASTFACNLAWELATVARTEGPRVCLIDLDLQFGAVSTYLDLP
FT                   RRESVFDILSDTEAADSDGFLQAMLTFNDRLHVFTAPPDMLPLDIMTAEDIGRLLDMAQ
FT                   ANFDFVVLDMPTTVVSWTEAVLTRSQAYFAMMELDLRSAQNVLRLVRALKAESLPHDKL
FT                   RFVLNRAPRFTDLSARGRVKRMAESLDIEFELQLPDGGVAVTQANDHGLPLSESAAKNP
FT                   LRRELQKLAKSLYDHSRAVEAAKT"
FT   gene            complement(583317..583958)
FT                   /locus_tag="Rsph17029_0556"
FT   CDS_pept        complement(583317..583958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0556"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: rsp:RSP_1908
FT                   outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75672"
FT                   /db_xref="GOA:A3PH56"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH56"
FT                   /protein_id="ABN75672.1"
FT                   /translation="MRMRCAPLLALPLALALAACGDRPVSTEINDGTFGNATMNNSLLQ
FT                   MGAVSATQALGQRFASEVDPTITFPFDSAALTPEAQATLRRQADWIRQFPEVRFRVYGH
FT                   TDLVGSEAYNKRLGLRRAKAVVAYLASQGISPARLEALVSYGETRPVIPVAAPEERNRR
FT                   TVTEVSGFVTGRGGQMNGKYAAVVFREYVAGATREHPRNRVIATQVTPEG"
FT   sig_peptide     complement(583893..583958)
FT                   /locus_tag="Rsph17029_0556"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.483 at
FT                   residue 22"
FT   gene            complement(583964..585349)
FT                   /locus_tag="Rsph17029_0557"
FT   CDS_pept        complement(583964..585349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0557"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   transport-associated; KEGG: rsp:RSP_1909 outer membrane
FT                   general secretion pathway protein, secretin"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75673"
FT                   /db_xref="GOA:A3PH57"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH57"
FT                   /protein_id="ABN75673.1"
FT                   /translation="MSTKDIFRAGLAVLALAAGMALTPAAAQTLRVMEGSASGALNVPM
FT                   NRAVVVESDRPFAELSIANPGIADISTLSETSIYVLGKAPGRTTLTLLGADGRLISNVD
FT                   VHVTPDVAEFKERLRQILPGENIEVRTANDGIVLSGTVTSTAKLDRALDLASRYAPDRV
FT                   SNLMSVGGTQQVMLKVRFAEMQRSVAKSLGSSIYARNGSGSVIGGTGTLLQNGIPPSGA
FT                   PISTSGNGALSLGFSVGALEFQVLLEALESKGVVRTLAEPNLTALSGQEAKFLAGGEYP
FT                   IPVASGDEKISIEYKPFGVELNFTPVVVDGNQINLMINAAVSSIDNTVTLESSGFTINA
FT                   FKRRETSTTVEMRDGESFAIAGLLQDDFRNLNGQVPWLGDIPILGALFRSAEYQRSQSE
FT                   LVIIVTPHLVTPTRGEALALPTDRVKLPSEKDLFLFGRVTGRGAAAEVARQDFSGSYGY
FT                   VME"
FT   sig_peptide     complement(585266..585349)
FT                   /locus_tag="Rsph17029_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.889 at
FT                   residue 28"
FT   gene            complement(585602..586426)
FT                   /locus_tag="Rsph17029_0558"
FT   CDS_pept        complement(585602..586426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0558"
FT                   /product="putative Flp pilus assembly protein CpaB"
FT                   /note="KEGG: rsp:RSP_1910 putative Flp pilus assembly
FT                   protein CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75674"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH58"
FT                   /protein_id="ABN75674.1"
FT                   /translation="MRLVFAFVLLIGIALAGFAVYMAQGYISQTQIALEKERAARKKLG
FT                   PMVEVFVTNKPLNYGAPLTRADVRTIMWPANALPETIFQKESDLFPDPAKPRYVLRQME
FT                   KFEPVLGVKVTAPGIEAGIRLASGMRAFAIKVDVASGVSGFLQPGDRVDVYWTGSASSG
FT                   ETTRLIEKTIPIVAVDQTANADLATSAIIARTVTVEVSPQQVARLAQAQATGRLSLSLV
FT                   GRDDTTEATATPVDTRNLIGEPDKVVEVEEKPACTVRTRRGAEVMESIPCTN"
FT   sig_peptide     complement(586355..586426)
FT                   /locus_tag="Rsph17029_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.781 at
FT                   residue 24"
FT   gene            complement(586493..586714)
FT                   /locus_tag="Rsph17029_0559"
FT   CDS_pept        complement(586493..586714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0559"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75675"
FT                   /db_xref="GOA:A3PH59"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH59"
FT                   /protein_id="ABN75675.1"
FT                   /translation="MWKAWHMLGWALELLNPFVKAEDGAVTVDWIVLTAAIIGLCLLVT
FT                   IPAYTSSSGVAQALAARLVATVTSLSVR"
FT   gene            complement(586888..587220)
FT                   /locus_tag="Rsph17029_0560"
FT   CDS_pept        complement(586888..587220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75676"
FT                   /db_xref="GOA:A3PH60"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH60"
FT                   /protein_id="ABN75676.1"
FT                   /translation="MPKRSSDRTTRKDHPAPPAIGFIQAKAAAMKLLNIFKTFRTDEDG
FT                   AVTVDWVVLTAAIVGLGIAVVTTVSGGLRTAATTLTTDLAATMGDAATATDADTGTGDG
FT                   DSGSGN"
FT   gene            587480..588370
FT                   /locus_tag="Rsph17029_0561"
FT   CDS_pept        587480..588370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0561"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   rsp:RSP_1911 possible soluble lytic murein
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75677"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH61"
FT                   /protein_id="ABN75677.1"
FT                   /translation="MRTWTGVLILALACAPGIAVAELGPGKDFTFRRVKPPGSGAGKRI
FT                   TVQIDPAEQARWLAALPKVEPRKPDAPDPAVPAPTVPALPGALWPEPGPAPQGASYGWF
FT                   WERVPVALAAVQGRFPLALASLSQGPNGAAVRAPRMQHLQQIAERHGLEILKATLGTRV
FT                   SPALVLAVIGIESGGRVDAVSTAGARGLMQLIPATAQRFGVTDVLDPAQNIRGGVAYLD
FT                   WLMGEFGGDPLMVLAAYNAGEGAVKANGGVPPYAETRDYVPKVLAAWQVAQGLCLTPPE
FT                   LVSDPCVFRILSAGL"
FT   sig_peptide     587480..587545
FT                   /locus_tag="Rsph17029_0561"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            complement(588429..588719)
FT                   /locus_tag="Rsph17029_0562"
FT   CDS_pept        complement(588429..588719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75678"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH62"
FT                   /protein_id="ABN75678.1"
FT                   /translation="MTEFVIERESGPARGRYVIRRGGEEAELTWSVLSPTRIIADHTGV
FT                   PDSFRGTGAGRALVERLVADARAEGFTIVPLCPFVNAQRQRHPEWADVFAV"
FT   gene            complement(588712..589341)
FT                   /locus_tag="Rsph17029_0563"
FT   CDS_pept        complement(588712..589341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0563"
FT                   /product="butyryl-CoA:acetate CoA transferase"
FT                   /EC_number="2.8.3.8"
FT                   /note="KEGG: rsp:RSP_1913 3-oxoadipate CoA-transferase,
FT                   beta subunit; TIGRFAM: 3-oxoacid CoA-transferase, B
FT                   subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75679"
FT                   /db_xref="GOA:A3PH63"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH63"
FT                   /protein_id="ABN75679.1"
FT                   /translation="MAWDRNQMAARAAQELQDGWYVNLGIGIPTLVANYIPEGIEVTLQ
FT                   SENGMLGMGPFPFEGEEDADLINAGKQTITELPKTAYFDSAQSFAMIRGGKIAMAILGA
FT                   MEVAENGDLANWMIPGKLVKGMGGAMDLVAGVQRVVVVMDHTSKHGESKVLKHCTLPLT
FT                   GQGVVNRIVTNLGVLDVVSGGLRIVECAEGVTEAELRAATEATIVD"
FT   gene            complement(589356..590054)
FT                   /locus_tag="Rsph17029_0564"
FT   CDS_pept        complement(589356..590054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0564"
FT                   /product="3-oxoacid CoA-transferase, A subunit"
FT                   /EC_number="2.8.3.5"
FT                   /note="KEGG: rsp:RSP_1914 3-ketoacid CoA transferase alpha
FT                   subunit; TIGRFAM: 3-oxoacid CoA-transferase, A subunit;
FT                   PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75680"
FT                   /db_xref="GOA:A3PH64"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH64"
FT                   /protein_id="ABN75680.1"
FT                   /translation="MKKVYDSAAAALDGLLFDGMLIAAGGFGLCGIPELLIRAIREAGT
FT                   RDLTVASNNAGVDGFGLGVLLESRQVRKMISSYVGENAEFMRQYLSGELELEFNPQGTL
FT                   AERMRAGGAGIPGFYTRTGVGTVIAEGKEHKEFDGETYILERGIVADLSIVKAWKADPS
FT                   GNLVFRKTARNFNPPAATCGKVCVAEVEEIVPLGSLEPDSIHLPGIYVHRLIQGTHEKR
FT                   IEQRTVRKRA"
FT   gene            590248..590331
FT                   /locus_tag="Rsph17029_R0014"
FT                   /note="tRNA-Leu2"
FT   tRNA            590248..590331
FT                   /locus_tag="Rsph17029_R0014"
FT                   /product="tRNA-Leu"
FT   gene            590598..591521
FT                   /locus_tag="Rsph17029_0565"
FT   CDS_pept        590598..591521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0565"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rsp:RSP_1915 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75681"
FT                   /db_xref="GOA:A3PH65"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH65"
FT                   /protein_id="ABN75681.1"
FT                   /translation="MDRQVPHRLTVPLNALRAFEAVARHLSIKEAALELGVTPSAVSHQ
FT                   LRGLEEALGLTLLRRVGPALELTEAGARLAPDLSEGFSRISAAVGGLRQDRSAGPLRLS
FT                   MLPTFAAHWFSPRLTRYPFERNGFDLLISTTQEAVDLSAGVADAAVRHGQGRWEGLQAD
FT                   LLFDETVSLFGAPPLGRPDPDDMRAQIARRTLFLSQHRKENYARWNATLPGGPIRPAAV
FT                   MMVDSAGLALRAAMDGAGVALAGVEIAASDVGAGRLAQFFAHRAPTGGGYFLVYPDALA
FT                   RDRRVRNLSRWMVEASAGERALAQSG"
FT   gene            complement(591660..592181)
FT                   /locus_tag="Rsph17029_0566"
FT   CDS_pept        complement(591660..592181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0566"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rsp:RSP_6026 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75682"
FT                   /db_xref="GOA:A3PH66"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH66"
FT                   /protein_id="ABN75682.1"
FT                   /translation="MVSVPKIRALAAADAPRLADLTTAYRRAMSGPAEAMTPDEASPLI
FT                   ERAIAGPDLLLLGADCGGALAGFALAFELPEIISGGRAGQLDDLFVMPEARGSGLARAL
FT                   IRQLTEIGTARGWPHLRWLVPQDNAAAIHLYRSIAEPAPWDSFRIDLSRCADEGPSARN
FT                   RRPTASVEKR"
FT   gene            complement(592175..592774)
FT                   /locus_tag="Rsph17029_0567"
FT   CDS_pept        complement(592175..592774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0567"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: rsp:RSP_1916
FT                   possible 2-hydroxychromene-2-carboxylate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75683"
FT                   /db_xref="GOA:A3PH67"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH67"
FT                   /protein_id="ABN75683.1"
FT                   /translation="MSPIEFWFDFSSGYAFLAAQRIEALAAELGRSVLWRPYMLGAAFS
FT                   VTGARGLSSTPLKRDYAQRDWARIARQRGLTFRPPADHPHVALAATRAFYWIEAQSPDA
FT                   ATAFAQRVFDLYFSDRLDTASPEAVARLGPEVGLEPEALLAGIAEPALKETVRKIGEDA
FT                   VARGIFGSPFFLVDGEPFWGWDRMEMMAEWVRTGGW"
FT   gene            complement(592771..593289)
FT                   /locus_tag="Rsph17029_0568"
FT   CDS_pept        complement(592771..593289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0568"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: rsp:RSP_1917 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75684"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH68"
FT                   /protein_id="ABN75684.1"
FT                   /translation="MSQDRTPRSPVVTLDDLKLSPQSQGTRFHAAMAAIAAPLGAAHLG
FT                   ARLVEVPPGKAAWPFHAHHANDELFVILSGNGELRFGPDRYPVAAGMVAVCPAGGAETA
FT                   HQLIATGPDPLRYVAVSTMREPDVMTYPDSGKLTVFAGAAPGGDKAKRRVAASFRTTDA
FT                   VDYWEGEET"
FT   gene            593429..594406
FT                   /locus_tag="Rsph17029_0569"
FT   CDS_pept        593429..594406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0569"
FT                   /product="alpha/beta hydrolase"
FT                   /note="KEGG: rsp:RSP_1918 predicted alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75685"
FT                   /db_xref="GOA:A3PH69"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH69"
FT                   /protein_id="ABN75685.1"
FT                   /translation="MWTSPLYRWRPEAAPLRPIPERPASAMPDERFEVAAEDGYPIRGG
FT                   IWHADTGPVVVIHAATAVRARYYARFAAWLSGQGATVLTFDYRGIGESRSVPVKDLQAG
FT                   WIDWGALDAEAVLAYAGRRWPDRPLCAVGHSIGGFALGLARSAARLDRIVTVGAQFAYW
FT                   RDYDARRRRAMVLRWHLFMPAVTRLFGYFPGARLGWLEDVPRGVVRDWSRMGPRFETSV
FT                   CSDLDPAELAARHGATRARLLAIGLTDDPFCTEAAAQRLLGYYSAADRTHLRIAPSDIA
FT                   VPEIGHFAFFHARFEQTLWPLAAAWLLSGRLPEEVPGRIVSPAG"
FT   gene            594434..594979
FT                   /locus_tag="Rsph17029_0570"
FT   CDS_pept        594434..594979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1919 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75686"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH70"
FT                   /protein_id="ABN75686.1"
FT                   /translation="MNDRLFVITGGPGSGKTTLLSALARHGLATMPEAGRAIIQDQTTI
FT                   GGPGWHGQDRQLFAELMLGWEMRSWHEAQGLRGPVIFDRGIPDVIGYLQLYEGEAPAHV
FT                   HAAAELFRYRPTVFLAPPWPEIFGQDAQRGQDFDEAVATAEAMEQAYAMAGYDLLPLPL
FT                   TTVEARVDVVLEVLERSA"
FT   gene            complement(595024..595893)
FT                   /locus_tag="Rsph17029_0571"
FT   CDS_pept        complement(595024..595893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0571"
FT                   /product="Pyridoxal kinase"
FT                   /EC_number="2.7.1.35"
FT                   /note="TIGRFAM: pyridoxal kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: rsp:RSP_1920
FT                   pyridoxal/pyridoxine/pyridoxamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75687"
FT                   /db_xref="GOA:A3PH71"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH71"
FT                   /protein_id="ABN75687.1"
FT                   /translation="MTRPPFVISIQSQVVFGHVGNSAALFPMQAAGLEVAAIPTVVFSN
FT                   TPDYPTLRGRALPPEFFSDLLQGARERGLPERADFILTGYIGSLDVAEMVADFVAEAKA
FT                   ANPRLRYICDPVMGDTGPGLYVPEAIAGVMRDRLLPMADIATPNPFELAWLTGRQIRTL
FT                   DDLQAARAALSLAEAAHLIATGCVLDDTGPGRLETVLMGPEGLSRHPAERLPIALPGTG
FT                   DLFAGLVVAGLGWGLVLPRAIETAQTLTARALRHAEALGAGEVVLSEPEFRRALLALGT
FT                   GEAEPPRP"
FT   gene            complement(595890..596570)
FT                   /locus_tag="Rsph17029_0572"
FT   CDS_pept        complement(595890..596570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0572"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: 3-alpha; MOSC domain containing protein; KEGG:
FT                   rsp:RSP_1921 MOSC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75688"
FT                   /db_xref="GOA:A3PH72"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH72"
FT                   /protein_id="ABN75688.1"
FT                   /translation="MILITLLTGRAAPLSGSDVLSGIGKTPVAGPLTLGREGFEGDEQA
FT                   DRRVHGGPEKAVHHYPSDHYESWRAELGDLPALLAPGGFGENLSTAGLTEAEVAVGDIF
FT                   RLGSALIQVSQGRQPCWKLNHRFGVPDMARRVQLTGRTGWYYRVLEPGTVAPGDRLELI
FT                   DRRAPDWTLRRLWQALYVDRMNLAELDGMAALDVLAESWRNHAVRRLESRRVEDWSKRL
FT                   DGTA"
FT   gene            596962..598374
FT                   /locus_tag="Rsph17029_0573"
FT   CDS_pept        596962..598374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0573"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: rsp:RSP_1922
FT                   transcriptional regulator, GntR family, with
FT                   aminotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75689"
FT                   /db_xref="GOA:A3PH73"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH73"
FT                   /protein_id="ABN75689.1"
FT                   /translation="MREPLALEIDPGHGGPLFLAIAEAITLDITRGRLKPGARLPGTRA
FT                   LARALGVHRNTVDAAYQELLTQGWLQAEPARGTFVAQDLPQGMLVRRPAPAPVEPVAMR
FT                   AGLAFSDGAPDPELVPDKALARAFRRALLSPAFRAGADYGDARGTSSLREALAAYLASD
FT                   RGVVADPARLLIARGSQMALFLAARAALAPGEAIAVEEPGYPLAWEAFRAAGAEVRGVP
FT                   VDGGGLRIDALEAALARDPRLRAVYVTPHHQYPTTVTMGAARRLQLLELAERHGLALIE
FT                   DDYDHEYRFEGRPVLPLAARAPEGLPLIYVGSLSKLLSPGIRLGYALAPEPLLTRMAAA
FT                   RAAIDRQGDAPLEAALAELIRDGDLGRHARKARRVYRARRDLLAERLTAQLAGRAAFDL
FT                   PAGGLALWLRCAGVSAETWAEAAGQAGLALLPGTRFALESPAPQAFRLGYAALDEGQIA
FT                   RAVEILARSFPG"
FT   gene            complement(598376..599362)
FT                   /locus_tag="Rsph17029_0574"
FT   CDS_pept        complement(598376..599362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0574"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: rsp:RSP_1923 biotin synthase; TIGRFAM: biotin
FT                   synthase; PFAM: Radical SAM domain protein; biotin and
FT                   thiamin synthesis associated; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75690"
FT                   /db_xref="GOA:A3PH74"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PH74"
FT                   /protein_id="ABN75690.1"
FT                   /translation="MIRPALRTDWTVEEARAIHALPFPELMHRAQTLHRAHFDPTAIET
FT                   ASLLSIKTGGCPEDCGYCSQSAHHDTGVKATKLMAEEEVLAAARRAKAAGAQRFCMGAA
FT                   WRSPKDRDMDQLCDMVRGVADLGLETCMTLGMLSPGQVARLKAAGLDFYNHNIDTSPAY
FT                   YAQIASTRTMEDRLETVEQVRRGGIKVCCGGILGMGEAEEDRIALLVTLATLPAHPDSV
FT                   PVNLWNEIEGVPVQGRARAVDPFALVRIVALARILMPASVVRLSAGRTEMSDELQALCF
FT                   LAGANSIFVGDQLLTTGNPAAWKDRDLLSRLGLHIAPARARPPVAAD"
FT   gene            complement(599359..599916)
FT                   /locus_tag="Rsph17029_0575"
FT   CDS_pept        complement(599359..599916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0575"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: rsp:RSP_1924 BioY family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75691"
FT                   /db_xref="GOA:A3PH75"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH75"
FT                   /protein_id="ABN75691.1"
FT                   /translation="MALLTPSLARPAALGRGLALALGGAALITLGAKIQIPFWPVPMTL
FT                   HSLAVFFLAAALGPRLGFAAMATYLAAGALGMPVFSGTPERGIGLVYMAGPTGGYLAGY
FT                   LLGAGLAGWLAEGRGAIGRFLAMLAGLTVVYATGLAWLAHFVPAASLLAAGFLPFILGD
FT                   LVKLALASGLVGALARFKGRGQ"
FT   gene            complement(600000..600668)
FT                   /locus_tag="Rsph17029_0576"
FT   CDS_pept        complement(600000..600668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0576"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: rsp:RSP_1925 transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75692"
FT                   /db_xref="GOA:A3PH76"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH76"
FT                   /protein_id="ABN75692.1"
FT                   /translation="MQHSPEETQSARIARILADRIISGEIPPGARLRQDHVATEFGASH
FT                   VPVREAFRELQTRGLAESEPRRGFRVTEFDVAELREVAEMRSSLESLALRHAAPNLTRA
FT                   VLLQAEEITRRGDSASTVREWEEANRHFHRLILSPCRMPRLLRTIDDLQAASARFLFAA
FT                   WRRDWEARTDHDHRAILDALRKGQTDLACSTLARHVGWVGRRRPSANNGDRPGAYDIHD
FT                   "
FT   gene            601144..602139
FT                   /locus_tag="Rsph17029_0577"
FT   CDS_pept        601144..602139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0577"
FT                   /product="TIM-barrel protein, yjbN family"
FT                   /note="TIGRFAM: TIM-barrel protein, yjbN family; PFAM:
FT                   dihydrouridine synthase, DuS; KEGG: rsp:RSP_1926
FT                   tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75693"
FT                   /db_xref="GOA:A3PH77"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH77"
FT                   /protein_id="ABN75693.1"
FT                   /translation="MTELKQPSSTACRLSVAPMLDWTDRHCRFFHRLMTRRAMLYTEMV
FT                   TAPAVIHGPRDRLLGFSEAEHPVALQLGGSDPAELAQAVRLAEPYGYDEINLNVGCPSD
FT                   RVQSGCFGAVLMERPSLVADCVAAMIAESPVPVTVKCRIGVDEQEPSEVLPAFLETVAA
FT                   AGVRHFVIHARKAWLQGLSPRENREIPPLDYPLVIAMKRRFPELTICLNGGVGSLTQAE
FT                   ALLAQGLDGIMIGRAAYNEPELLLEADRLWGEEPPRDLAAVLADMRPYISAHLEGGGRL
FT                   HQITRHMLGLFAGRPGARHWRRILSEGASRPGAGLALFDEALEAVQPRAA"
FT   gene            602220..603038
FT                   /locus_tag="Rsph17029_0578"
FT   CDS_pept        602220..603038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0578"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rsp:RSP_1927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75694"
FT                   /db_xref="GOA:A3PH78"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH78"
FT                   /protein_id="ABN75694.1"
FT                   /translation="MTDLSLLLPMLALLLAIGAFAGIIAGLLGVGGGLVLVPAYLYAFE
FT                   AMGYGGPSLMRVCLATSLATIIVTSLRSVHAHHRKGAVDLEILRRWGPWIALGAVAGTF
FT                   LASSMKSVVLQGIFGGVGVAVGLYMAFGRTSWRLGESLPQGAARAATGTGVGLLSVLMG
FT                   IGGGTFGVPLMSLFNVPIHRAVATAAGFGVIIALPSAALFLFTPTDAAPPLTVGAVNLP
FT                   AFGITIAMTLLTTPLGVKLAHAMDPKPLKRVFAVFIMIVALNMLRKAFLA"
FT   sig_peptide     602220..602285
FT                   /locus_tag="Rsph17029_0578"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 22"
FT   gene            complement(603353..604843)
FT                   /locus_tag="Rsph17029_0579"
FT   CDS_pept        complement(603353..604843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0579"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase, N-terminal domain protein; DnaB domain
FT                   protein helicase, C-terminal domain protein; KEGG:
FT                   rsp:RSP_1928 replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75695"
FT                   /db_xref="GOA:A3PH79"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH79"
FT                   /protein_id="ABN75695.1"
FT                   /translation="MNEVRALREPQAEKSPEVLPHNIEAEQQLLGAILTNNDIFDRIAS
FT                   VIRAEHFFDPVHQRIFEIAAARIQKNALASPVTLKAFLEEDAGLKELGGPAYLVRLAGA
FT                   AISAFAARDYAQMIYDLAVRRELIGLGRDIAAKAARIDVASEPKEQIVEAEQKLYRLGE
FT                   QGQAERGFQSFLKAVTDAVNVANAAYQRDGGLAGISTGLADLDKKLGGLHPSDLLILAG
FT                   RPSMGKTSLATNIAFNIAKAYRRGRLPDGAEGAIEGGVVGFFSLEMSAEQLAARILSEA
FT                   AEVPSEQIRRGDMTEAEFRRFVEAAKALEACPLYIDDTPALPISQVAARARRLKRTHGL
FT                   DVLMVDYLQLLKGSGGSRDNRVQEVSEITQGLKAIAKELNIPVVALSQLSRSVESRDDK
FT                   RPQLSDLRESGSIEQDADVVMFVFREEYYREREKPGDHEMEKMAQWQAIMEQVHGKAEV
FT                   IIGKQRHGPIGSVELSFEGRFTRFGNLVRPWQQGIESY"
FT   gene            complement(605112..605810)
FT                   /locus_tag="Rsph17029_0580"
FT   CDS_pept        complement(605112..605810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0580"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: rsp:RSP_1929 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75696"
FT                   /db_xref="GOA:A3PH80"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PH80"
FT                   /protein_id="ABN75696.1"
FT                   /translation="MIPTSFPPREEIARLTARMLLEIEAVHFRPQEPFTLASGLPSPTY
FT                   IDCRKLISYPRIRSTLMDFMAVTLLRDAGFEAFDNIAGGETAGIPFAALVAERLGLPMT
FT                   YVRKKPKGYGRNARIEGVMTEGQRVLLVEDLTTDGGSKLSFVDAIRETGASCAHTAVIF
FT                   YYGIFPETIGRLQAHGVTLHHLCTWWDVLAEARASGAFDAGTLAEVESFLSNPRDWQDA
FT                   RKPADPTKSL"
FT   gene            complement(605853..606893)
FT                   /locus_tag="Rsph17029_0581"
FT   CDS_pept        complement(605853..606893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0581"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: rsp:RSP_1930 dihydroorotase; TIGRFAM:
FT                   dihydroorotase, homodimeric type; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75697"
FT                   /db_xref="GOA:A3PH81"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH81"
FT                   /protein_id="ABN75697.1"
FT                   /translation="MTQSLTLRRPDDWHLHLRDGAMLEGVLPETTRHFARAIVMPNLVP
FT                   PVVTAAEARAYRDRILHALPEGARFEPLMVLYLTETTDPADVRAAAASGLVTAVKLYPA
FT                   GATTNSASGVRDFDRVRGVLETMAEIGLPLCVHGEVTDPAVDIFDREAVFLDRVLDPIR
FT                   RATPGLRVVLEHVTTREGLDYVRGGGPDMAGTLTTHHLIINRNHILAGGIRPHYYCLPV
FT                   AKRETHRLALRAAATGGEACFFLGTDSAPHVDAAKESGCGCAGCFTATNTLSILAHVFE
FT                   EEGALDRLEGFVSLHGPAFYRLPPNEERITLRKGAALALPGKIETGAGPVTVFDPGFPL
FT                   LWHVEP"
FT   gene            607038..607952
FT                   /locus_tag="Rsph17029_0582"
FT   CDS_pept        607038..607952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0582"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG: rsp:RSP_1931
FT                   probable ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75698"
FT                   /db_xref="GOA:A3PH82"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH82"
FT                   /protein_id="ABN75698.1"
FT                   /translation="MTQSLPASIDAAAALLAGRGYVSDRALSTVVFLSLKLGRPLFLEG
FT                   EAGTGKTEIAKALAAALGRRLIRLQCYEGLDAASAVADWNFAAQMIAIRTAESSGGADR
FT                   SALRTELFTEDYLIERPLLQAMRPQPGGAPVLLIDELDRTDEPFEAFLLEALSDFQVTI
FT                   PELGTIRAPEPPLVILTSNRTREVHDALKRRCLYHWVDYPDFPREARILAARVPEAQEG
FT                   LSREIVAFVQRLRREDLFKRPGVAETIDWAKCLLALDVIELSPELIADTLGALLKYQDD
FT                   IQKIQGSEARRLLDEARRDLAPA"
FT   gene            608057..609253
FT                   /locus_tag="Rsph17029_0583"
FT   CDS_pept        608057..609253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0583"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="PFAM: VWA containing CoxE family protein; SMART: von
FT                   Willebrand factor, type A; KEGG: rsp:RSP_1932 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75699"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH83"
FT                   /protein_id="ABN75699.1"
FT                   /translation="MELEAPADGSLARNILWFARALRKAGLPIGSGRIADAVRAVEAAG
FT                   FTSRGDFYWTLHACFVSRPEHRAVFAQVFRLFWRDPQFLEQMMSLLLPQLRGVQEDRPP
FT                   EPAEKRAAQALLDGAERPERAAPDPEGSLIEIDASDTASGEERLRRLDFEQMSADEIAA
FT                   ARRMLARLSLPVPPIRSRRLVAAAGGPRVDLRRTLARALRQGGEIPALARRRPALRWPN
FT                   LVVLCDISGSMSLYSRLVLQFIHAVANRKGQGWARVHAFTFGTRLTNITRHLRRRDVDA
FT                   ALAAAGAEAQDWSGGTRIGECLHIFNRDWSRRVLGQGAVVLLITDGLDRGDPAALSREM
FT                   ERLHLSARRLIWLNPLLRWEGFAPRAGGIRAMLPHVDSLRAAHSVASLEALSEALSRP"
FT   gene            609383..609802
FT                   /locus_tag="Rsph17029_0584"
FT   CDS_pept        609383..609802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0584"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75700"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH84"
FT                   /protein_id="ABN75700.1"
FT                   /translation="MTFKLLQTTAALSLGLFALQPLAAAAQTTTEDCIPSASVTCPPGA
FT                   SSVPGTESPGGTDDSTAAAPVDSTSTGGGASGSTSTTPMVPGAEAPDGTDDSTAAAPVD
FT                   PSSTGGGLTTEGMAPSVPGTESPDGTDDSNAAVPQ"
FT   sig_peptide     609383..609463
FT                   /locus_tag="Rsph17029_0584"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.825 at
FT                   residue 27"
FT   gene            610017..612122
FT                   /locus_tag="Rsph17029_0585"
FT   CDS_pept        610017..612122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0585"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: rsp:RSP_1933
FT                   outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75701"
FT                   /db_xref="GOA:A3PH85"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH85"
FT                   /protein_id="ABN75701.1"
FT                   /translation="MKSRLMTTTAALSVALSTFQPLPLMAQDANKAVCAQNPDLCPPKQ
FT                   KRGEGAQKRKEQEQAKEKRKEERPAARAAQEEEGAAARARRANREQVEEGGQARRPAAE
FT                   QDAPARGDKARARARDNEDGAARAQAEGNAADDTRLLQEGNGQGDAARPAKRARPAEEE
FT                   RPADRERAGERARAAEEGGAARDAVRAGDERPAAGAEGRKAQTREASPDGDGPDAEELR
FT                   RRLQGEAPAKDRQARGDRDGGAAADEEGGRNAEARGDGQAREAEGRDAERPRNRDAEGR
FT                   DADRERNRNAEDRTRPADAQARDGQGRQQAGDEARRARQQQPEREEARKSLARILESED
FT                   QGEESAAAAAASAEDASEAAREARRQANRAERITEENSRSSNEEFRTLLNGNRDKKNDD
FT                   DDDEGGLSNFEKFGLLALGGLAVGTLLNNNRGEVVSNSGDRVVVQRSDGTYSVLKDDDT
FT                   LLRRPGSEVVTQSFDDGSTRSVVTRADGTQIVTIRDASGRVLRRTAVDGQGREVMLIDD
FT                   LESYQAVDVSRLPEPAPVYSFVQTRDERDLRQALEQTRTRDLDRTYSLRQIREYREVRA
FT                   LAPAIDVDQITFDTGSAAIDPDEAEKLASLGQTIADMIAERPEEVFLIEGHTDAVGDAA
FT                   SNLALSDRRAESVALALTEYFDVPPENMVVQGYGEEDLRVDSDGPEQRNRRVAVRLITP
FT                   LMQTASN"
FT   sig_peptide     610017..610097
FT                   /locus_tag="Rsph17029_0585"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            612238..613209
FT                   /locus_tag="Rsph17029_0586"
FT   CDS_pept        612238..613209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0586"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   sil:SPO2640 XdhC/CoxI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75702"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH86"
FT                   /protein_id="ABN75702.1"
FT                   /translation="MAGHDDIPELALDWHRAGRAPVIATVLETWGSAPRPAGSQLVIAD
FT                   DGEMMGSVSGGCVEGAVIAEAAEARADGRPRVLTFGVSDDEAFAVGLACGGTIRVLVEP
FT                   VGSALPEAVLADLVAARAGRRPVALVFHPERGGHRLAGPEEAAVAARLRSDRSGLEEDG
FT                   RFIGIHNPPLRLVVVGAVHIAQPLVAMARIAGYGPTLIDPRSAFGSEARFPGETILDAW
FT                   PDEALAGLAPDARTAVVTLTHDPKLDDPAILAAFDTPAFYIGCLGSPRTHAKRLDRLRT
FT                   AGVPEAQIARIHAPVGLDIGARSPAEIALSILAQVTERLRRG"
FT   gene            613209..614213
FT                   /locus_tag="Rsph17029_0587"
FT   CDS_pept        613209..614213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rsph17029_0587"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: molybdopterin binding domain; KEGG:
FT                   rsp:RSP_1936 molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rsph17029_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABN75703"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A3PH87"
FT                   /protein_id="ABN75703.1"
FT                   /translation="MRFGAVPLDEAQGAVLAHSVALPGGRLRKGLVLGDTEIADLAAAG
FT                   HREVMAARLDPGDVPEDAAAARLAQALVPDERAALLARSSAFTGRVNLNATVPGLVMLD
FT                   AGRIHALNRIDPAITLATLAPLARVEPGMLVGTVKIIAYAVEETALAQAEALARGALRV
FT                   LPVVRRSAGLLLTEVPGQEAKLAAKGRRAVEKRLAALGMELAGVEVT