(data stored in ACNUC1104 zone)

EMBL: CP000580

ID   CP000580; SV 1; circular; genomic DNA; STD; PRO; 6048425 BP.
XX
AC   CP000580; AAQC01000000-AAQC01000016;
XX
PR   Project:PRJNA16079;
XX
DT   28-FEB-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Mycobacterium sp. JLS, complete genome.
XX
KW   .
XX
OS   Mycobacterium sp. JLS
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacterium.
XX
RN   [1]
RP   1-6048425
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Miller C.D., Anderson A.J.,
RA   Sims R.C., Richardson P.;
RT   "Complete sequence of Mycobacterium sp. JLS";
RL   Unpublished.
XX
RN   [2]
RP   1-6048425
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Miller C.D., Anderson A.J.,
RA   Sims R.C., Richardson P.;
RT   ;
RL   Submitted (20-FEB-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 2b70c665cf90ac52e28316bab6180f38.
DR   BioSample; SAMN02598355.
DR   EnsemblGenomes-Gn; EBG00001456340.
DR   EnsemblGenomes-Gn; EBG00001456341.
DR   EnsemblGenomes-Gn; EBG00001456342.
DR   EnsemblGenomes-Gn; EBG00001456343.
DR   EnsemblGenomes-Gn; EBG00001456344.
DR   EnsemblGenomes-Gn; EBG00001456345.
DR   EnsemblGenomes-Gn; EBG00001456346.
DR   EnsemblGenomes-Gn; EBG00001456347.
DR   EnsemblGenomes-Gn; EBG00001456348.
DR   EnsemblGenomes-Gn; EBG00001456349.
DR   EnsemblGenomes-Gn; EBG00001456350.
DR   EnsemblGenomes-Gn; EBG00001456351.
DR   EnsemblGenomes-Gn; EBG00001456352.
DR   EnsemblGenomes-Gn; EBG00001456353.
DR   EnsemblGenomes-Gn; EBG00001456354.
DR   EnsemblGenomes-Gn; EBG00001456355.
DR   EnsemblGenomes-Gn; EBG00001456356.
DR   EnsemblGenomes-Gn; EBG00001456357.
DR   EnsemblGenomes-Gn; EBG00001456358.
DR   EnsemblGenomes-Gn; EBG00001456359.
DR   EnsemblGenomes-Gn; EBG00001456360.
DR   EnsemblGenomes-Gn; EBG00001456361.
DR   EnsemblGenomes-Gn; EBG00001456362.
DR   EnsemblGenomes-Gn; EBG00001456363.
DR   EnsemblGenomes-Gn; EBG00001456364.
DR   EnsemblGenomes-Gn; EBG00001456365.
DR   EnsemblGenomes-Gn; EBG00001456366.
DR   EnsemblGenomes-Gn; EBG00001456367.
DR   EnsemblGenomes-Gn; EBG00001456368.
DR   EnsemblGenomes-Gn; EBG00001456369.
DR   EnsemblGenomes-Gn; EBG00001456370.
DR   EnsemblGenomes-Gn; EBG00001456371.
DR   EnsemblGenomes-Gn; EBG00001456372.
DR   EnsemblGenomes-Gn; EBG00001456373.
DR   EnsemblGenomes-Gn; EBG00001456374.
DR   EnsemblGenomes-Gn; EBG00001456375.
DR   EnsemblGenomes-Gn; EBG00001456376.
DR   EnsemblGenomes-Gn; EBG00001456377.
DR   EnsemblGenomes-Gn; EBG00001456378.
DR   EnsemblGenomes-Gn; EBG00001456379.
DR   EnsemblGenomes-Gn; EBG00001456380.
DR   EnsemblGenomes-Gn; EBG00001456381.
DR   EnsemblGenomes-Gn; EBG00001456382.
DR   EnsemblGenomes-Gn; EBG00001456383.
DR   EnsemblGenomes-Gn; EBG00001456384.
DR   EnsemblGenomes-Gn; EBG00001456385.
DR   EnsemblGenomes-Gn; EBG00001456386.
DR   EnsemblGenomes-Gn; EBG00001456387.
DR   EnsemblGenomes-Gn; EBG00001456388.
DR   EnsemblGenomes-Gn; EBG00001456389.
DR   EnsemblGenomes-Gn; EBG00001456390.
DR   EnsemblGenomes-Gn; EBG00001456391.
DR   EnsemblGenomes-Gn; EBG00001456392.
DR   EnsemblGenomes-Gn; EBG00001456393.
DR   EnsemblGenomes-Gn; EBG00001456394.
DR   EnsemblGenomes-Gn; EBG00001456395.
DR   EnsemblGenomes-Gn; EBG00001456396.
DR   EnsemblGenomes-Gn; EBG00001456397.
DR   EnsemblGenomes-Gn; EBG00001456398.
DR   EnsemblGenomes-Gn; EBG00001456399.
DR   EnsemblGenomes-Gn; EBG00001456400.
DR   EnsemblGenomes-Gn; EBG00001456401.
DR   EnsemblGenomes-Gn; EBG00001456402.
DR   EnsemblGenomes-Gn; EBG00001456403.
DR   EnsemblGenomes-Gn; EBG00001456404.
DR   EnsemblGenomes-Gn; EBG00001456405.
DR   EnsemblGenomes-Gn; EBG00001456406.
DR   EnsemblGenomes-Gn; EBG00001456407.
DR   EnsemblGenomes-Gn; Mjls_R0001.
DR   EnsemblGenomes-Gn; Mjls_R0002.
DR   EnsemblGenomes-Gn; Mjls_R0003.
DR   EnsemblGenomes-Gn; Mjls_R0004.
DR   EnsemblGenomes-Gn; Mjls_R0005.
DR   EnsemblGenomes-Gn; Mjls_R0006.
DR   EnsemblGenomes-Gn; Mjls_R0007.
DR   EnsemblGenomes-Gn; Mjls_R0008.
DR   EnsemblGenomes-Gn; Mjls_R0009.
DR   EnsemblGenomes-Gn; Mjls_R0010.
DR   EnsemblGenomes-Gn; Mjls_R0011.
DR   EnsemblGenomes-Gn; Mjls_R0012.
DR   EnsemblGenomes-Gn; Mjls_R0013.
DR   EnsemblGenomes-Gn; Mjls_R0014.
DR   EnsemblGenomes-Gn; Mjls_R0015.
DR   EnsemblGenomes-Gn; Mjls_R0016.
DR   EnsemblGenomes-Gn; Mjls_R0017.
DR   EnsemblGenomes-Gn; Mjls_R0018.
DR   EnsemblGenomes-Gn; Mjls_R0019.
DR   EnsemblGenomes-Gn; Mjls_R0020.
DR   EnsemblGenomes-Gn; Mjls_R0021.
DR   EnsemblGenomes-Gn; Mjls_R0022.
DR   EnsemblGenomes-Gn; Mjls_R0023.
DR   EnsemblGenomes-Gn; Mjls_R0024.
DR   EnsemblGenomes-Gn; Mjls_R0025.
DR   EnsemblGenomes-Gn; Mjls_R0026.
DR   EnsemblGenomes-Gn; Mjls_R0027.
DR   EnsemblGenomes-Gn; Mjls_R0028.
DR   EnsemblGenomes-Gn; Mjls_R0029.
DR   EnsemblGenomes-Gn; Mjls_R0030.
DR   EnsemblGenomes-Gn; Mjls_R0031.
DR   EnsemblGenomes-Gn; Mjls_R0032.
DR   EnsemblGenomes-Gn; Mjls_R0033.
DR   EnsemblGenomes-Gn; Mjls_R0034.
DR   EnsemblGenomes-Gn; Mjls_R0035.
DR   EnsemblGenomes-Gn; Mjls_R0036.
DR   EnsemblGenomes-Gn; Mjls_R0037.
DR   EnsemblGenomes-Gn; Mjls_R0038.
DR   EnsemblGenomes-Gn; Mjls_R0039.
DR   EnsemblGenomes-Gn; Mjls_R0040.
DR   EnsemblGenomes-Gn; Mjls_R0041.
DR   EnsemblGenomes-Gn; Mjls_R0042.
DR   EnsemblGenomes-Gn; Mjls_R0043.
DR   EnsemblGenomes-Gn; Mjls_R0044.
DR   EnsemblGenomes-Gn; Mjls_R0045.
DR   EnsemblGenomes-Gn; Mjls_R0046.
DR   EnsemblGenomes-Gn; Mjls_R0047.
DR   EnsemblGenomes-Gn; Mjls_R0048.
DR   EnsemblGenomes-Gn; Mjls_R0049.
DR   EnsemblGenomes-Gn; Mjls_R0050.
DR   EnsemblGenomes-Gn; Mjls_R0052.
DR   EnsemblGenomes-Gn; Mjls_R0053.
DR   EnsemblGenomes-Gn; Mjls_R0054.
DR   EnsemblGenomes-Gn; Mjls_R0055.
DR   EnsemblGenomes-Gn; Mjls_R0056.
DR   EnsemblGenomes-Gn; Mjls_R0057.
DR   EnsemblGenomes-Tr; EBT00001610137.
DR   EnsemblGenomes-Tr; EBT00001610138.
DR   EnsemblGenomes-Tr; EBT00001610139.
DR   EnsemblGenomes-Tr; EBT00001610140.
DR   EnsemblGenomes-Tr; EBT00001610141.
DR   EnsemblGenomes-Tr; EBT00001610142.
DR   EnsemblGenomes-Tr; EBT00001610143.
DR   EnsemblGenomes-Tr; EBT00001610144.
DR   EnsemblGenomes-Tr; EBT00001610145.
DR   EnsemblGenomes-Tr; EBT00001610146.
DR   EnsemblGenomes-Tr; EBT00001610147.
DR   EnsemblGenomes-Tr; EBT00001610148.
DR   EnsemblGenomes-Tr; EBT00001610149.
DR   EnsemblGenomes-Tr; EBT00001610150.
DR   EnsemblGenomes-Tr; EBT00001610151.
DR   EnsemblGenomes-Tr; EBT00001610152.
DR   EnsemblGenomes-Tr; EBT00001610153.
DR   EnsemblGenomes-Tr; EBT00001610154.
DR   EnsemblGenomes-Tr; EBT00001610155.
DR   EnsemblGenomes-Tr; EBT00001610156.
DR   EnsemblGenomes-Tr; EBT00001610157.
DR   EnsemblGenomes-Tr; EBT00001610158.
DR   EnsemblGenomes-Tr; EBT00001610159.
DR   EnsemblGenomes-Tr; EBT00001610160.
DR   EnsemblGenomes-Tr; EBT00001610161.
DR   EnsemblGenomes-Tr; EBT00001610162.
DR   EnsemblGenomes-Tr; EBT00001610163.
DR   EnsemblGenomes-Tr; EBT00001610164.
DR   EnsemblGenomes-Tr; EBT00001610165.
DR   EnsemblGenomes-Tr; EBT00001610166.
DR   EnsemblGenomes-Tr; EBT00001610167.
DR   EnsemblGenomes-Tr; EBT00001610168.
DR   EnsemblGenomes-Tr; EBT00001610169.
DR   EnsemblGenomes-Tr; EBT00001610170.
DR   EnsemblGenomes-Tr; EBT00001610171.
DR   EnsemblGenomes-Tr; EBT00001610172.
DR   EnsemblGenomes-Tr; EBT00001610173.
DR   EnsemblGenomes-Tr; EBT00001610174.
DR   EnsemblGenomes-Tr; EBT00001610175.
DR   EnsemblGenomes-Tr; EBT00001610176.
DR   EnsemblGenomes-Tr; EBT00001610177.
DR   EnsemblGenomes-Tr; EBT00001610178.
DR   EnsemblGenomes-Tr; EBT00001610179.
DR   EnsemblGenomes-Tr; EBT00001610180.
DR   EnsemblGenomes-Tr; EBT00001610181.
DR   EnsemblGenomes-Tr; EBT00001610182.
DR   EnsemblGenomes-Tr; EBT00001610183.
DR   EnsemblGenomes-Tr; EBT00001610184.
DR   EnsemblGenomes-Tr; EBT00001610185.
DR   EnsemblGenomes-Tr; EBT00001610186.
DR   EnsemblGenomes-Tr; EBT00001610187.
DR   EnsemblGenomes-Tr; EBT00001610188.
DR   EnsemblGenomes-Tr; EBT00001610189.
DR   EnsemblGenomes-Tr; EBT00001610190.
DR   EnsemblGenomes-Tr; EBT00001610191.
DR   EnsemblGenomes-Tr; EBT00001610192.
DR   EnsemblGenomes-Tr; EBT00001610193.
DR   EnsemblGenomes-Tr; EBT00001610194.
DR   EnsemblGenomes-Tr; EBT00001610195.
DR   EnsemblGenomes-Tr; EBT00001610196.
DR   EnsemblGenomes-Tr; EBT00001610197.
DR   EnsemblGenomes-Tr; EBT00001610198.
DR   EnsemblGenomes-Tr; EBT00001610199.
DR   EnsemblGenomes-Tr; EBT00001610200.
DR   EnsemblGenomes-Tr; EBT00001610201.
DR   EnsemblGenomes-Tr; EBT00001610202.
DR   EnsemblGenomes-Tr; EBT00001610203.
DR   EnsemblGenomes-Tr; EBT00001610204.
DR   EnsemblGenomes-Tr; Mjls_R0001-1.
DR   EnsemblGenomes-Tr; Mjls_R0002-1.
DR   EnsemblGenomes-Tr; Mjls_R0003-1.
DR   EnsemblGenomes-Tr; Mjls_R0004-1.
DR   EnsemblGenomes-Tr; Mjls_R0005-1.
DR   EnsemblGenomes-Tr; Mjls_R0006-1.
DR   EnsemblGenomes-Tr; Mjls_R0007-1.
DR   EnsemblGenomes-Tr; Mjls_R0008-1.
DR   EnsemblGenomes-Tr; Mjls_R0009-1.
DR   EnsemblGenomes-Tr; Mjls_R0010-1.
DR   EnsemblGenomes-Tr; Mjls_R0011-1.
DR   EnsemblGenomes-Tr; Mjls_R0012-1.
DR   EnsemblGenomes-Tr; Mjls_R0013-1.
DR   EnsemblGenomes-Tr; Mjls_R0014-1.
DR   EnsemblGenomes-Tr; Mjls_R0015-1.
DR   EnsemblGenomes-Tr; Mjls_R0016-1.
DR   EnsemblGenomes-Tr; Mjls_R0017-1.
DR   EnsemblGenomes-Tr; Mjls_R0018-1.
DR   EnsemblGenomes-Tr; Mjls_R0019-1.
DR   EnsemblGenomes-Tr; Mjls_R0020-1.
DR   EnsemblGenomes-Tr; Mjls_R0021-1.
DR   EnsemblGenomes-Tr; Mjls_R0022-1.
DR   EnsemblGenomes-Tr; Mjls_R0023-1.
DR   EnsemblGenomes-Tr; Mjls_R0024-1.
DR   EnsemblGenomes-Tr; Mjls_R0025-1.
DR   EnsemblGenomes-Tr; Mjls_R0026-1.
DR   EnsemblGenomes-Tr; Mjls_R0027-1.
DR   EnsemblGenomes-Tr; Mjls_R0028-1.
DR   EnsemblGenomes-Tr; Mjls_R0029-1.
DR   EnsemblGenomes-Tr; Mjls_R0030-1.
DR   EnsemblGenomes-Tr; Mjls_R0031-1.
DR   EnsemblGenomes-Tr; Mjls_R0032-1.
DR   EnsemblGenomes-Tr; Mjls_R0033-1.
DR   EnsemblGenomes-Tr; Mjls_R0034-1.
DR   EnsemblGenomes-Tr; Mjls_R0035-1.
DR   EnsemblGenomes-Tr; Mjls_R0036-1.
DR   EnsemblGenomes-Tr; Mjls_R0037-1.
DR   EnsemblGenomes-Tr; Mjls_R0038-1.
DR   EnsemblGenomes-Tr; Mjls_R0039-1.
DR   EnsemblGenomes-Tr; Mjls_R0040-1.
DR   EnsemblGenomes-Tr; Mjls_R0041-1.
DR   EnsemblGenomes-Tr; Mjls_R0042-1.
DR   EnsemblGenomes-Tr; Mjls_R0043-1.
DR   EnsemblGenomes-Tr; Mjls_R0044-1.
DR   EnsemblGenomes-Tr; Mjls_R0045-1.
DR   EnsemblGenomes-Tr; Mjls_R0046-1.
DR   EnsemblGenomes-Tr; Mjls_R0047-1.
DR   EnsemblGenomes-Tr; Mjls_R0048-1.
DR   EnsemblGenomes-Tr; Mjls_R0049-1.
DR   EnsemblGenomes-Tr; Mjls_R0050-1.
DR   EnsemblGenomes-Tr; Mjls_R0052-1.
DR   EnsemblGenomes-Tr; Mjls_R0053-1.
DR   EnsemblGenomes-Tr; Mjls_R0054-1.
DR   EnsemblGenomes-Tr; Mjls_R0055-1.
DR   EnsemblGenomes-Tr; Mjls_R0056-1.
DR   EnsemblGenomes-Tr; Mjls_R0057-1.
DR   EuropePMC; PMC3271072; 22319448.
DR   EuropePMC; PMC4894912; 27375559.
DR   EuropePMC; PMC5550956; 28793878.
DR   EuropePMC; PMC5747123; 29284541.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000580.
DR   SILVA-SSU; CP000580.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000378
CC   Source DNA and bacteria available from Charles Miller
CC   (cdmiller@biology.usu.edu)
CC   Contacts: Charles Miller (cdmiller@biology.usu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Additional Note: There is a 21kb repeat at 1513668-1544927 in the
CC   final assembly that possibly sometimes inserts itself at location
CC   5440327 in the chromosome.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6048425
FT                   /organism="Mycobacterium sp. JLS"
FT                   /strain="JLS"
FT                   /mol_type="genomic DNA"
FT                   /country="USA:Champion International Superfund site in
FT                   Libby, Montana"
FT                   /isolation_source="creosote-contaminated soil"
FT                   /db_xref="taxon:164757"
FT   gene            252..1739
FT                   /locus_tag="Mjls_0001"
FT   CDS_pept        252..1739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: mmc:Mmcs_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95814"
FT                   /db_xref="GOA:A3PSD7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PSD7"
FT                   /protein_id="ABN95814.1"
FT                   /translation="MTADPDPPFVAVWNTVVAELNGDPAATGPRNGDGALPTLTPQQRA
FT                   WLKLVKPLVITEGFALLSVPTPFVQNEIERHLREPIITALSRHLGQRVELGVRIATPSP
FT                   EDDDPPPSPVIADIDEVDEDTEARVSAEETWPRYFSRPPETPAAEDPNAVSLNRRYTFD
FT                   TFVIGASNRFAHAATLAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRV
FT                   KYVSTEEFTNDFINSLRDDRKASFKRSYRDIDVLLVDDIQFIEGKEGIQEEFFHTFNTL
FT                   HNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMDRLD
FT                   VPDDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKSLAEIVLRDLISDASTMQI
FT                   STAAIMAATAEYFETTIEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDH
FT                   TTVMYAEKKIRGEMAERREVFDHVKELTTRIRQRAKR"
FT   gene            2303..3499
FT                   /locus_tag="Mjls_0002"
FT   CDS_pept        2303..3499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: mmc:Mmcs_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95815"
FT                   /protein_id="ABN95815.1"
FT                   /translation="MDVVPTTAGHTDLKFRLVREDFADAVAWVARNLPTRPTVPVLAGV
FT                   LLTGDDDGLTISGFDYEVSAEVRVAAEIASPGSVLVSGRLLSDITKALPAKPVDVSVEG
FT                   TRVSLTCGSARFSLPTMAVEDYPALPTLPDETGVIGADLFAEAIGQVAVAAGRDDTLPM
FT                   LTGIRVEITGESVVLAATDRFRLAVRELTWSTSSPDVEAAVLVPAKTLAEAAKAGTDGT
FT                   DVHLALGAGSAVGKEGLLGIRSEGKRSTTRLLDAEFPKFRQLLPSEHTAVATIGVAELT
FT                   EAIKRVALVADRGAQVRMEFADDVLRLSAGADDVGRAEEDLAVAFSGEPLTIAFNPTYL
FT                   TDGLGSLHSERVTFGFTTPSRPAVLRPAGDEDTGGGAGPFPALQTDYVYLLMPVRLPG"
FT   gene            3529..4422
FT                   /locus_tag="Mjls_0003"
FT   CDS_pept        3529..4422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0003"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase,
FT                   NAD-binding; KEGG: mmc:Mmcs_0003 6-phosphogluconate
FT                   dehydrogenase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95816"
FT                   /protein_id="ABN95816.1"
FT                   /translation="MQLGLVGLGKMGFNMRERLREGGHEVVGFDPRPEVTDVPSLAALA
FT                   DALAAPRVVWVMVPSGPVTHDTIVSLAEVLGEGDLVIDGGNSRFTEDAPHAELLKAKGI
FT                   GFIDAGVSGGVWGLAEGYGLMVGGDDADIERVMPIFDTLRPPGDRADGFVHAGPVGAGH
FT                   FAKMVHNGVEYALMTAYGEGYELLAAEELIRDPQAVYQAWTNGTVVRSWLQQLLAKALR
FT                   EDPGLAEISGYTEDSGEGRWTVEEAIRLRVPVPSIAASLFARFESRQEDSPTMKAVSAL
FT                   RNQFGGHAVQRISKSG"
FT   gene            4475..5617
FT                   /locus_tag="Mjls_0004"
FT   CDS_pept        4475..5617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: mmc:Mmcs_0004 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95817"
FT                   /db_xref="GOA:A3PSE0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PSE0"
FT                   /protein_id="ABN95817.1"
FT                   /translation="MFVRHLTLTDFRSWARADLELEPGRTVFVGPNGFGKTNLVEALWY
FT                   SATLGSHRVASDAPLIRAGAPRAVVSTIVVNEGRELAVDLEITTGRANKARLNRSPVRS
FT                   PREVLGVLRAVLFAPEDLALVRGDPGERRRYLDELATTRRPSIAGVRADYDRVIRQRTA
FT                   LLKSAAGARYRGDRSVLETLDVWDGHLAAHGALLMAARADLVHHLAPEVEKAYQLLAPG
FT                   SRPAAIRYRTSIDAEDDVSAEYYEAALLDAMTRRRDAELERGVCLVGPHRDDLELRLGD
FT                   QMAKGYASHGESWSMALSLRLAAYELLRTDGSDPVLLLDDVFAELDAARRRALAEVAAS
FT                   AEQVLVTAAVAEDIPADWDARRIVIRMQDDDDGRVSMVES"
FT   gene            5614..6186
FT                   /locus_tag="Mjls_0005"
FT   CDS_pept        5614..6186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   mmc:Mmcs_0005 protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95818"
FT                   /protein_id="ABN95818.1"
FT                   /translation="MSDDDRDGDGDPIGPPAHLSELKGMDLVRRTLEEARGAARSQGKD
FT                   VGRGRTSPARRVAGTGRRRSWSGPGPDSRDPQTLGAATRDLARTRGWSPKVAEGAVFGQ
FT                   WSTVVGEQIAEHATPSSLREGVLTVAAESTAWATQLRMVQSQLLAKIAAAVGDGVVTSL
FT                   KITGPTAPSWRKGRYHIAGRGPRDTYG"
FT   gene            6407..8434
FT                   /locus_tag="Mjls_0006"
FT   CDS_pept        6407..8434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: mmc:Mmcs_0006 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95819"
FT                   /protein_id="ABN95819.1"
FT                   /translation="MAAQKKNAPAEYGADSIKVLEGLEAVRKRPGMYIGSTGERGLHHL
FT                   VWEVVDNAVDEAMAGFATKVEVRILENGGVQVTDDGRGIPVAMHSTGIPTVDVVMTVLH
FT                   AGGKFEEGAYQVSGGLHGVGVSVVNALSTRLEADIRTDGYEWFQTYDRSVPGTLKQGEK
FT                   TKKTGTTIRFWADPDIFETTSYDFETIARRLQEMAFLNKGLTIELTDERVTAEEVVDDV
FT                   VSDHAEAPKSAEEKSAEAAKPQKVKHRVFHYPGGLVDFVKHINRTKTPIQPSVIDFDGK
FT                   GEGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRTALTSVVNKYAKDKKLLKD
FT                   KDPNLTGDDIREGLAAVISVKVSQPQFEGQTKTKLGNTEVKSFVQKICNEQLSHWFEAN
FT                   PAEAKTVVNKAVSSAQARLAARKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVV
FT                   EGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEF
FT                   DISKLRYHKIVLMADADVDGQHISTLLLTLLFRFMKPLIENGHVFLAQPPLYKLKWQRS
FT                   TPEFAYSDRERDGLLEAGRAAGKRINADDGIQRYKGLGEMDAKELWETTMDPSVRVLRQ
FT                   ITLDDAAAADELFSILMGEDVEARRSFITRNAKDVRFLDV"
FT   gene            8468..10978
FT                   /locus_tag="Mjls_0007"
FT   CDS_pept        8468..10978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0007"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: mpa:MAP0006 DNA gyrase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95820"
FT                   /protein_id="ABN95820.1"
FT                   /translation="MTDTTLPPGDEAGDRIEPVDIQQEMQRSYIDYAMSVIVGRALPEV
FT                   RDGLKPVHRRVLYAMFDSGFRPDRGHAKSARSVAETMGNYHPHGDSSIYDTLVRMAQPW
FT                   SLRYPLVDGQGNFGSPGNDPPAAMRYTEARLTPLAMEMLREIDEETVDFIPNYDGRVQE
FT                   PTVLPSRFPNLLANGSGGIAVGMATNIPPHNLRELADAVYWCLENFEADEETTLAAVME
FT                   RVKGPDFPTHGLIVGSQGIEDTYKTGRGSVKMRGVVEIEEDSRGRTGIVITELPYQVNH
FT                   DNFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVVELKRDAVAKVVLNNLYKHTQLQT
FT                   SFGANMLSIVDGVPRTLRLDQMIRYYVEHQLDVIVRRTRYRLRKANERAHILRGLVKAL
FT                   DALDEVIALIRASQTVDIARAGLIELLDIDEIQAQAILDMQLRRLAALERQRIVDDLAK
FT                   IEAEIADLEDILAKPERQRAIVRDELKEIADKYGDDRRTRIVPADGEVSDEDLIAREDV
FT                   VVTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVNHFFVCSTHDWILFFTTQGR
FT                   VYRAKAYELPEASRTARGQHVANLLAFQPNERIAQVIQIKSYEDAPYLVLATRNGLVKK
FT                   SRLTDFDSNRSGGIVAVNLRDGDELVGAVLCSSEDDLLLVSAKGQSIRFSATDEALRPM
FT                   GRATSGVQGMRFNADDELLSLNVVRPDTYLLVATSGGYAKRTSIEEYTAQGRGGKGILT
FT                   IQYDRRRGNLVGALIVDDDTELYAITSGGGVIRTAARQVRKAGRQTKGVRLMNLGEGDT
FT                   LIAIARNAEAGDSTDEVNTDPDAV"
FT   gene            10996..11868
FT                   /locus_tag="Mjls_0008"
FT   CDS_pept        10996..11868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95821"
FT                   /protein_id="ABN95821.1"
FT                   /translation="MSAPNEPGLPRGGDGPGGGNGSPAPGAGRDNGSPANAAGRVGTEG
FT                   GDVPPWQRGRPNRPPQSRAQDAPTRQEPSRGGSPTHAPGAEARNTSRFPVSGSAPTEET
FT                   KAPAAPVRTPERTEAPRPEAYASELPDLSGPVPRPPQRKPATDRPATEAPARPAARTQV
FT                   GQRPARGPVRASMQIRRVDPWSALKVSLVLSVALFFVWMIAVAFLYLVLGGMGVWSKLN
FT                   SNVGDLLTSASGSSGGELVSSSTIFGGAALVGLVNIVILTAMATAGAFIYNLTTDLVGG
FT                   VEVTLADRD"
FT   gene            11963..12036
FT                   /locus_tag="Mjls_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            11963..12036
FT                   /locus_tag="Mjls_R0001"
FT                   /product="tRNA-Ile"
FT   gene            12198..12273
FT                   /locus_tag="Mjls_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            12198..12273
FT                   /locus_tag="Mjls_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(12295..12708)
FT                   /locus_tag="Mjls_0009"
FT   CDS_pept        complement(12295..12708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95822"
FT                   /protein_id="ABN95822.1"
FT                   /translation="MTLTPLTPRQRLARGLKYTAVGPVDVTRGVLGVGVDSAQATAAEL
FT                   RRRYQSGQLRRELAAARETLVAELVAAQEAVSGLPEALTGARARNRRRKRLLMVGVGAG
FT                   VLAVGAVTFSIVRRSMKPEPSPLPPSVEVTPKP"
FT   gene            12806..13333
FT                   /locus_tag="Mjls_0010"
FT   CDS_pept        12806..13333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0010"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: mmc:Mmcs_0010 peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95823"
FT                   /protein_id="ABN95823.1"
FT                   /translation="MTSPIQTATATLHTNRGDIKIALFGNHAPKTVSNFVGLAQGTKDY
FT                   KGENASGSTSGPFYDGAVFHRVIDGFMIQGGDPTGTGRGGPGYQFADEFHPELQFDKPY
FT                   LLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVVDPESQKVVDAIATTATDRNDRP
FT                   TDPVVIESVTIS"
FT   gene            complement(13347..13766)
FT                   /locus_tag="Mjls_0011"
FT   CDS_pept        complement(13347..13766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95824"
FT                   /protein_id="ABN95824.1"
FT                   /translation="MQQTEWSPPAAGIAGCGFAGLLMAIAAVTVVTDPPGRLLAGIAAV
FT                   GLITFAIMSWRARPKLAITPEGVAVRGWWHTRVLRQADIKIVRITEFRRLARKMRLLEI
FT                   DTADDRLHVFTRWDLGTDPVDVLDALTAAGYTGTQ"
FT   sig_peptide     complement(13686..13766)
FT                   /locus_tag="Mjls_0011"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.845) with cleavage site probability 0.422 at
FT                   residue 27"
FT   gene            complement(13922..14206)
FT                   /locus_tag="Mjls_0012"
FT   CDS_pept        complement(13922..14206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0012"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   mmc:Mmcs_0012 protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95825"
FT                   /db_xref="GOA:A3PSE8"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PSE8"
FT                   /protein_id="ABN95825.1"
FT                   /translation="MPKSKVRKKNDFTISPVSRTPVKVKAGPSSVWFVALFVGLMLIGL
FT                   IWLLVFQLAATNPVDAPGMLQWMADLGPWNYAIAFAFMITGLLLTMRWR"
FT   sig_peptide     complement(14021..14206)
FT                   /locus_tag="Mjls_0012"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.937) with cleavage site probability 0.719 at
FT                   residue 62"
FT   gene            14272..15108
FT                   /locus_tag="Mjls_0013"
FT   CDS_pept        14272..15108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0013"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   mmc:Mmcs_0013 protein of unknown function DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95826"
FT                   /protein_id="ABN95826.1"
FT                   /translation="MVQMPPEPNAVPDRETPPTTSAAPAAPARAGAGRRSGWRFGVPLV
FT                   CLAAGLLLAATHGVSGGDEIRRSDAPRLVDLVREAQQSVDRLGAERDTLSAQVDGHHGG
FT                   SPGTDAALSAITNRSAALAAEAGLNPVKGPGLVVTLNDAQRDAEGRFPRDASPDDLVVH
FT                   QQDIQAVLNALWSAGAEGVQMQDQRIIATSAPRCVGNTLLLNGRTYSPPYVITAIGDAG
FT                   AMQAALSASPLVTLYKQYVVRFGLGYTEEPRAEVELVGHTEPVRMKHAQPIGPVGY"
FT   gene            15132..15806
FT                   /locus_tag="Mjls_0014"
FT   CDS_pept        15132..15806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0014"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   mmc:Mmcs_0014 glutamine amidotransferase of anthranilate
FT                   synthase or para-aminobenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95827"
FT                   /protein_id="ABN95827.1"
FT                   /translation="MQFLVVDNYDSFVFNLVQYLGQLGVDVTVWRNDDNRLSTDADIAK
FT                   AAEDFDGVLLSPGPGTPERAGASIPLVHACAAAGTPLLGVCLGHQAIGVAFGGTVDRAP
FT                   ELLHGKTSIVHHTNRGVLKGLPDPFTATRYHSLTILPETMPDELEVTARTPGGVIMGVR
FT                   HVDLPIHGVQFHPESILTEGGHRMLANWLGYCGSAPDEALVRRLEDEVASTVAAATTRS
FT                   SA"
FT   gene            complement(15784..17658)
FT                   /locus_tag="Mjls_0015"
FT   CDS_pept        complement(15784..17658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0015"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: mmc:Mmcs_0015 serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95828"
FT                   /protein_id="ABN95828.1"
FT                   /translation="MTTPQHLSDRYELGEILGFGGMSEVHLARDNRLHRDVAIKVLRAD
FT                   LARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIV
FT                   HSEGPMPPKRALEVIADACQALNFSHQHGIIHRDVKPANIMISKTGAVKVMDFGIARAL
FT                   ADSSSVTQTAAVIGTAQYLSPEQARGEKVDARSDVYSLGCVLYEILTGEPPFVGDSPVA
FT                   VAYQHVREDPVPPSQRHEGVSRDLDAVVLKALAKNPDNRYQTAAELRSDLVRVHSGEPP
FT                   EAPKVFTDAERTSMLSAAPHPGRTEPMTHMPRPEPRLVERNRGGSIGRWIAAVAVLAVL
FT                   TVVVAVAINTYGGETRAVQVPDVRGEVSAEAIAQLQNAGFTVRTQNEPNSEVAPDHVIS
FT                   TSPEANTEADAGEEITLNVSTGPEQREVPDVKSLTYAEAVRTLTDAGFGRFRQQASPST
FT                   PELKDRVMATNPPANQTSAITNEVTIIIGSGPQTRAVPEVVGQTVESAQQILTASGFRN
FT                   SVPAEVDSTEPAGQVLGTSPTAGENVPVDTLIQLQVSRGNQFVMPDLTGQFWTDAEPRL
FT                   RALGWTGVLDKGGDVQNSGQRTNAVVRQTPPPGTGVNFDSRITLNFAS"
FT   gene            complement(17655..18986)
FT                   /locus_tag="Mjls_0016"
FT   CDS_pept        complement(17655..18986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0016"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   mmc:Mmcs_0016 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95829"
FT                   /protein_id="ABN95829.1"
FT                   /translation="MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDSRLGRRVAIKVLK
FT                   AEYSTDPEFVERFRAEARTVAMLNHPGIASVYDYGETDMDGEGRTAYLVMELVNGEPLN
FT                   SVLKRTGRLSLRHALDMLEQTGRALQVAHTAGLVHRDVKPGNILITPTGQVKLTDFGIA
FT                   KAVDAAPVTQTGMVMGTAQYIAPEQALGHDATAASDVYALGVVGYESVSGKRPFTGDGA
FT                   LTVAMKHIKETPPPLPADLPPNVRELIEITLVKNPGMRYRSGGPFADAVAAVRSGRRPP
FT                   RPNQAPSIGRATPAAVPSAAQARAAADLTGRAPVTAARARPTGAIHRPPPPRRTFSSGQ
FT                   RALLWAAGVLGALAIVIAILIVLNAQDRKDRQLPPPTVTNTITETTPYQSPAAMPEWMP
FT                   DWTSSAVIGHGGDTSGAVRPDAVAASAHLRALPAPAQTWLRTQT"
FT   gene            complement(19018..20493)
FT                   /locus_tag="Mjls_0017"
FT   CDS_pept        complement(19018..20493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0017"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   KEGG: mmc:Mmcs_0017 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95830"
FT                   /protein_id="ABN95830.1"
FT                   /translation="MNTSLRRIAVTIMVLIVLLLGNATVTQVFTADGLRTDPRNQRVLL
FT                   DEYSRQRGQITAGGQLLAYSVSTPGRFRFLRVYPNAQAYAPVTGFYSLTYSSTGLERAE
FT                   DTILNGSDERLFGRRLADFFTGRDPRGGNVVTTINPRVQQAAWEAMEQGCNGPCKGSVV
FT                   ALEPSTGKILAMVSAPSYDPNLLATHDVEEQTAAWQQLRDNPDNPLVNRAISETYPPGS
FT                   TFKVITTAAALQNGATPDTQLTAAPRIPLPNSSVTLENFGGSACGGGPTAPLREAFARS
FT                   CNTAFVELGTDTGTEALKNTASAFGLDTPPAPIPLQVAESTVGPIGDAAALGMSSIGQR
FT                   DVALTPLQNAMVAATVANEGVTMRPYLVDSLRGPDLANITTTEPVEERRAVTPEVAATL
FT                   TDLMVGAEQQTQQKGAIAGVQIASKTGTAEHGTDPRNTPPHAWYIAFAPAQAPKVAVAV
FT                   LVENGGNRLSATGGQVAAPIGRATIAAALREGS"
FT   sig_peptide     complement(20401..20493)
FT                   /locus_tag="Mjls_0017"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.955) with cleavage site probability 0.797 at
FT                   residue 31"
FT   gene            complement(20490..21902)
FT                   /locus_tag="Mjls_0018"
FT   CDS_pept        complement(20490..21902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0018"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /note="PFAM: cell cycle protein; KEGG: mmc:Mmcs_0018 cell
FT                   cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95831"
FT                   /protein_id="ABN95831.1"
FT                   /translation="MTTQPQSPVTVTPPLPNRRNAELLLLAFAAVITTVALLMVEANQE
FT                   QGISWDLAQYAAGYLALFAGAHLAVRRYAPYADPLLLPVVALLNGLGLVMIHRLDLAQG
FT                   ELTGRGLGGTANQQMLWTLVGVIGFACVITFLSDHRMLARYGYVCGLTGLVLLAIPAVL
FT                   PASMSEQNGAKIWIELPGFSIQPAEFSKILLLIFFAAVLVDKRELFTSAGKHFLWMDLP
FT                   RPRDLAPLLAAWIASIAVMIFEKDLGTSLLLYASFLILLYVATDRISWVAIGLSLFAAG
FT                   SVVAYHLFGHVRVRVQTWLDPFADPEGAGYQMVQSMFSFATGGIFGTGLGNGQPGTVPA
FT                   ASTDFIIAAVGEELGLVGFSAVLMLYTILVIRGLRTAIAVRDSFGKLLAAGLASTLAIQ
FT                   LFIVVGGVTRLIPLTGLTTPWMSYGGSSLLANYLLLAILLRISHAARRPISTKPVTQTP
FT                   IAAASTEVIDKV"
FT   sig_peptide     complement(21774..21902)
FT                   /locus_tag="Mjls_0018"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.849) with cleavage site probability 0.761 at
FT                   residue 43"
FT   gene            complement(21899..23374)
FT                   /locus_tag="Mjls_0019"
FT   CDS_pept        complement(21899..23374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0019"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /note="PFAM: protein phosphatase 2C domain protein; KEGG:
FT                   mmc:Mmcs_0019 protein serine/threonine phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95832"
FT                   /protein_id="ABN95832.1"
FT                   /translation="MTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAAGEV
FT                   ASQLVIAALAHLDDDEPGGDLLSKLDNAVREGNSAIAAHVEADPELEGMGTTLTAILFA
FT                   GNRLGLVHIGDSRGYLMRDGELTQITKDDTFVQTLVDEGRITAEEAHSHPQRSLIMRAL
FT                   TGHEVEPTLIMREARAGDRYLLCSDGLSDPVSHDTIAEAMQIPDVAESADRLIELALRG
FT                   GGPDNVTVVVADVVDYDYGQTAPILAGAVSGDDDQPPPNTAAGRASAFNPKRNAPKRVV
FT                   AQPEEPVKKPRSKRRMIIAATLVVLVVLAGLAIAREIVRNNYYVTAHEGTVSIMRGVDG
FT                   SLLGYSLQEPYLLGCLNARNELSLISAGQSGENRGCQLLDVQDMRESERAQVVAGLPGG
FT                   SLDEAIAQIEELARSSVLPICPPPATTSRRPPPPPPPSPTESAATSAVPRPGTSPAPET
FT                   PTTVTPPPPPPSPTVTALPPPPPQPGTTCRAAS"
FT   gene            complement(23371..23835)
FT                   /locus_tag="Mjls_0020"
FT   CDS_pept        complement(23371..23835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0020"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   mmc:Mmcs_0020 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95833"
FT                   /protein_id="ABN95833.1"
FT                   /translation="MQGLVLQLTRVGFLLLLWLFIWSVLRILRTDIYAPTGAVMVRRGL
FT                   ALRGSLLPNRQRSVARQLVVTEGALTGTRITLGSQPVLIGRADDSTLVLTDDYASTRHA
FT                   RLSPRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPMGTPVRIGKTVIELRP"
FT   gene            complement(23979..25388)
FT                   /locus_tag="Mjls_0021"
FT   CDS_pept        complement(23979..25388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0021"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   mmc:Mmcs_0021 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95834"
FT                   /protein_id="ABN95834.1"
FT                   /translation="MGLVDRFERKLESTVGDAFARVFGGSIVPQEVEALLRREAEAGIR
FT                   ELGRGRILAPNEYVITLSVPDHKKVSADPDLTATTFAKHLEGYIREQGWQTYGDVVVKF
FT                   EQAPNLHTGQFRARGAVNPDSTTGEPAPAHRDHAFPAEPGVPPMSDNPTYRGGGQGQGR
FT                   PGDEYYDDGYGRPQEEPRGQEPRAPYPPEQGGYPPRGGYPEQGGYPDRGGYPDQGGYPD
FT                   QGGYGGGYEQRGPGGYGPPGGGYDQGYRQGPGGYAPPPPPGGQPGYGAPGADYDYGRPP
FT                   GGPGRHEDGGYGRPGYPDQGGYPDQGGYGGGYGAPAGGRQDYGQDYGRGYAEPAGGYGD
FT                   PGYGEPAGRDYDYGQGAGGYGGGYGQADYPAAGVGTTVTLQLDDGSGRTYQLREGANVI
FT                   GRGQDAQFRLPDTGVSRRHLEIRWDGQVALLSDLNSTNGTTVNNAPVQEWQLADGDVIR
FT                   LGHSEIIVRVH"
FT   gene            25626..25708
FT                   /locus_tag="Mjls_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            25626..25708
FT                   /locus_tag="Mjls_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(25750..26070)
FT                   /locus_tag="Mjls_0022"
FT   CDS_pept        complement(25750..26070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95835"
FT                   /protein_id="ABN95835.1"
FT                   /translation="MDPKLDRHSLVVVGPDGPGKSDVVDAIDFALTDTVAAEAVRAGGV
FT                   NLIEHRLHVHALQLLGAPRGRPPAGSDALQRLWRPTRRRPQRSVESYCRPTLAKHRGHE
FT                   PV"
FT   gene            complement(26325..27344)
FT                   /locus_tag="Mjls_0023"
FT   CDS_pept        complement(26325..27344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0023"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mmc:Mmcs_0033
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95836"
FT                   /protein_id="ABN95836.1"
FT                   /translation="MRYRTLGRTGIQVSAIGLGAMMFATRMGNSKQESVDVIHRALDAG
FT                   INLIDTADAYEDSEDIVGHALKGRRDDVVLATKFGRPVDDNPNHRGASRRWIVAAVENS
FT                   LRRLQTDYIDIYQLHRSDPDTDLEETLSALTDLVRSGKIRAFGTSTLPASNLVQAQWIA
FT                   ERHGYERPHTEQPPYSILNRGIEREVLPIAQQYGLGVLVWGPLGQGMLTGRVRRGHDND
FT                   VIRAQLLSSFHDQRRLDAVERLIPVAAQAGLSMPHLAMAFTIAHPGVTGALLGARTMSH
FT                   LDDLLTGTDTVLGDDVLDEIDDIVPPGTDAGPLDQDHTPPAIQKAALRRRPLAERAAA"
FT   gene            27429..28034
FT                   /locus_tag="Mjls_0024"
FT   CDS_pept        27429..28034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0024"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0034
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95837"
FT                   /protein_id="ABN95837.1"
FT                   /translation="MAGRPERAGVTNASINTGRRQRLDAQRNVLSILEAAKTTFADSGV
FT                   DVPARTITDLAGVGVGTLYRHFPRRSDLILAVIEREIDDCIEAAHELTARMEPRDALVA
FT                   WVSRFAEFVRTKHGLANALHSGDPAYTGLADTLLDRLEPVLDSLLERVPLNVRNRDTVS
FT                   ARDVLTTIALMCQPVPGETSSFNERMTKIFLEGLLASG"
FT   gene            28178..29167
FT                   /locus_tag="Mjls_0025"
FT   CDS_pept        28178..29167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95838"
FT                   /protein_id="ABN95838.1"
FT                   /translation="MSENLCVKAPFSDLRYLVDCLGPLTRRDSGPCSLVRRRRHEAISL
FT                   SVPVARMGQRSEWGLGMGSKRSSDGSGAIGGAIFFVIVLIAMVPKPVWIAIGIGVAVIV
FT                   LGWVAYRIFEAVEKSRAEAAERERAEQAARAAAAKREREERARTEKQRRIDTLGKANAA
FT                   LVESALRAVKQIAGSEAARAGWLGDVDFTADIRGITENFQKAHALRGVAGKLSALDKPS
FT                   AEDRVILAEAKTTAANLERTAIERVELVGKCAVEAQLIDKSLRTEREDARVAEQRAELH
FT                   AKLSAMLYGIEAAPNTTPEDSAVDAVMARVQAYREIKYQIEQARDGQS"
FT   gene            complement(29192..30220)
FT                   /locus_tag="Mjls_0026"
FT   CDS_pept        complement(29192..30220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0026"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0036
FT                   homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95839"
FT                   /protein_id="ABN95839.1"
FT                   /translation="MDEFPQDYEIFDLGDVTLQHGATLRDAKLAYKTYGELNADKTNAI
FT                   VYPTWYSGRHWDNEWLIGEGMALDPTKYFIIVPNMLGNGLSSSPSNTPPPYDAARFPHV
FT                   TFYDQVEQQHKLVTSFGIETLPLVTGWSMGAGQTYQWAVSYPDMVQRALPFCGSSKTSE
FT                   HNIVFLEGVKSALTADAAFKEGWYTEKPTKGLRAAARVYAGWGFSQAFYWQQEYKKMGY
FT                   SSLEDFLVGFWEGFFLDRRDPNNLLAMLWTWQNGNVGATPGRGFDGDQVAALKTIKAKM
FT                   IVAPAEKDLYFPPEDEEFAVSHIPNAELRVIPGIYGHFAGGDANPADNQFIDAALKDLL
FT                   AR"
FT   gene            complement(30325..32196)
FT                   /locus_tag="Mjls_0027"
FT   CDS_pept        complement(30325..32196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95840"
FT                   /protein_id="ABN95840.1"
FT                   /translation="MAAHAVPSAATHGGGWFTKLPVLPNAAGASAIALAATPANNAGAA
FT                   ALLNLFRMTKALPPSLIFKPPRLVTRSTSPRSAGYGLAQARRGYARPEDGCVELTRCWT
FT                   VTTIEHQDPGASAERPTQPLPAPGRALNPATTQVPGCIVGGRYRLLVCHGTSGVLEFWQ
FT                   AVDLAAGRAVAVTLVDPRSNLPIEWVNEILSLTVRLRGVDAPGIATILDVLHTGQCGVV
FT                   VADWVAGGSLREVADTDPAPEAAAAALESLAMAAEASHRAGMHLSIDDPARVRISSDAR
FT                   AVLAFPATLPDGAPHTDLRGIGGCLYALLAKCWPEDVSEPAQLAELRPGTPYLVSATAS
FT                   GLVRPEPGITSAATVLTMLRQAARDGRDDGADIRVLPPLDPPPPGAYAAFRNFGPDEQA
FT                   QEARKSVLRATIGAAAAVVTAGVVMLGSSVNEVLQAPDETPAMDAGQLGLQDGPTSVAP
FT                   KVPEETVKAAAADAPVKPVRAEVFSTDGRPDNPGEAGRVIDGDPATAWSTDRYYDADPF
FT                   PEFKEGLGLMLELPAPTTLGSVEVDLGSTGTVVQVRSAPGQSPAALGDTTEISAPTPMQ
FT                   PGRNTIAVRSREPVKHVLVWVSTLGSTDGRNQAAVSEITLHPPAPPA"
FT   gene            complement(32527..33102)
FT                   /locus_tag="Mjls_0028"
FT   CDS_pept        complement(32527..33102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0028"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0038
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95841"
FT                   /protein_id="ABN95841.1"
FT                   /translation="MPDGVTAAPRRRSEKSRVAIIAATRELLLQRGFDGLSIEAVAARA
FT                   GVGKQTIYRWWPSRPALVADVLLEDAHEILLPVRDSGNLVADVVSWIGKLAATLTSPRG
FT                   NAMLRILTVASMEHEDTAARLRAGFGDPLHVSVRDRLLAAGVDAPTAESAAEAIVGGVV
FT                   YAIQREGCAYSRSRAQRTARLVVENLAN"
FT   gene            33176..34183
FT                   /locus_tag="Mjls_0029"
FT   CDS_pept        33176..34183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0029"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   C-terminal domain; KEGG: mmc:Mmcs_0039 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95842"
FT                   /protein_id="ABN95842.1"
FT                   /translation="MGKKLVIGASGFLGSHVTRRLVERGDDVRVLIRHTSSTRGIDGLP
FT                   VERHYGDIFDDDAVRAAVAGCDVVCYCVVDARAWLRDPAPLWRTNVEGLQRVLDVVADA
FT                   DLYRFVFTSSIATIGIADSGPATEELSHNWLDRAGEYVRTRVAAENLVLRYHRERALPA
FT                   VAMCVSNTYGPDDWLPTPHGGLVAAAVRGKLPFYIDGAQAEVVGVRDAADALILAGERG
FT                   RPGERYIVSERFMTAREIYQTACAAVGVTPPQRGVPIRALAAAAVPSAWLARLRRRDTR
FT                   LTPLTIRLMHIMSPMDHSKAERELGWRPAPTTDALAEAAEFFVGNRRRPAEDRR"
FT   gene            34183..36399
FT                   /locus_tag="Mjls_0030"
FT   CDS_pept        34183..36399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0030"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0040 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95843"
FT                   /protein_id="ABN95843.1"
FT                   /translation="MPIALTPEQRALSDAVREFAARHAPVEKTRQAFDDLAAGNVPTWW
FT                   DDLVSAGFHAVHLPERVGGQGGDLVDTACVVEAAAQAMLPGPLLSTVATGAVALLADTA
FT                   TSESLLRDLAGGTTAAVILPNDAALQAVSTPDGWEVSGVSPVVLGLRAARLLLAAAHTE
FT                   DGGLIWFVADADAAVTECERGTDLTTDVARVRFDGHRVASGARLTGIDTERARCTVAAL
FT                   TASASAGTIRWCVDAVTEHLRTREQFGKPIGTFQALQHRAADLLISSELATAAAWDAVR
FT                   SADEPAEQHVIAAATAVLMAAAPAPDLVLDTLTMFGAIGFTWEHDLHLYWRRATALAAS
FT                   LGPATRWSRRLGELTRTTARDVTVRLGDADPEFRARVSDVLDRASTLPNDGPRPQGDYD
FT                   QFATGPQRTAIAEAGLIAPHYPAPWGLDATPLQQLIIDEEFAARPALTRPSLGIAEWIV
FT                   PSLISAAGQEVRDRLIPPTLRGETAWCQLFSEPSAGSDLASLTTRATRVDGGWKINGHK
FT                   IWTSSAQHAHFGALLARTDPDARKHRGIGYFVVDMSSEGVEVQPIRQVTGDAHFNEVFL
FT                   TDVFVPDEMLLGEPTGGWNLAIATMAQERVAIGNYVHNDRAVALRALARTPGPDQDAAL
FT                   RALGDIDAYAGSIKALGVRETLRLLDGQHAGPASSIAKVATAAMLRRTFEATLRLTGET
FT                   ALLEDTDPPVVQPYLHLPAELVGGGTREIQLNIIAQMVLGLPRG"
FT   gene            36413..37621
FT                   /locus_tag="Mjls_0031"
FT   CDS_pept        36413..37621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95844"
FT                   /protein_id="ABN95844.1"
FT                   /translation="MGLRGEAAIVGYVELPPERLNKAGPAPFLLEQWAELSAAALEDAG
FT                   LPAESVNGIVTSHIGESEIFVPSTVAEYLGVDANFAEILDLGGASAAGMVWRAAAAIEL
FT                   GLCDVVLCALPARYLTPTSDKKPAPLVDAMFFGSSSNRFGSPQAEFEIPYGNLGQNGPY
FT                   GQVAQRYAAVYGYDERAMAKIVVDQRVNANHTEGAVWKDKPLTIEDVLASPVIADPLHM
FT                   LEIVMPCVGGAAVVVASADIARRAKRRPVWIKGFGEHVPFKTPTYARDLLQTPITKAAD
FT                   TAFAMTGLGRADMDMVSIYDCYTITVLLSLEDAGFCEKGKGMAFVSDHDLTFRGDFPLN
FT                   TAGGQLGFGQAGLAGGMHHVCDATRQIMGRAGAAQVADCNRAFVSGNGGILSEQTTLIL
FT                   EGD"
FT   gene            37626..38042
FT                   /locus_tag="Mjls_0032"
FT   CDS_pept        37626..38042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0032"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   mmc:Mmcs_0042 protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95845"
FT                   /protein_id="ABN95845.1"
FT                   /translation="MTTFERPMPVKTPTSAPFWDALAEHKIRIQYSPSSDAYVFYPRVR
FT                   APRTLADDLEWREISGLGTLYSYTVARRPVGPHFADAVPLLTAVVEWDEGPRFSTELVN
FT                   VAPEDIRVGMRVRPVFFDYPDHDVTMLRYEPDVA"
FT   gene            38039..38446
FT                   /locus_tag="Mjls_0033"
FT   CDS_pept        38039..38446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95846"
FT                   /protein_id="ABN95846.1"
FT                   /translation="MTDRDDIADVLIRYATGIDRRDWPLFRTVFTDDCALDYGDIGTFD
FT                   GVDAVTEFMDQAHAMAGHTLHRLTNFAIDVDGDSARARAYVDALIFAPDNASGVNAVGF
FT                   YDDELVRTPAGWRIARRRFTTVRVSPVGGQS"
FT   gene            38443..39255
FT                   /locus_tag="Mjls_0034"
FT   CDS_pept        38443..39255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0034"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0044 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95847"
FT                   /protein_id="ABN95847.1"
FT                   /translation="MTFAQKYGPWAVVAGASDGLGAAFAERIAENGVNVVLLARRQSVL
FT                   DDVAAGIRDRTGVETRTLAIDLTDPAATGAVADATDDLEIGFLVYCAGADPAFEPFLAQ
FT                   PIEAAEAMVQRNCVAPMRLCHHFAPAMAARGRGGIVIFGSGAGLAGGPNMVAYAATKAF
FT                   DMVFAEALWAELHDTGVDVLGLILGKTDTPALRTLEHRRGQIASTEQTPPGAVPVADVV
FT                   SEAFDNLANGPTWIVGEDLRAATQMMGSISRSDAVRFIVEASRDAMGP"
FT   gene            complement(39279..40019)
FT                   /locus_tag="Mjls_0035"
FT   CDS_pept        complement(39279..40019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0035"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein, family 1; KEGG: mmc:Mmcs_0045
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95848"
FT                   /protein_id="ABN95848.1"
FT                   /translation="MTRFALTLLLVVVLGGCGAQRDPSTLTVFAAASLRTSFAEIAEQF
FT                   ERGHPGMDVEFSFAGSSDLVTQLTQGAYADVFASADHRNMDRAAEAGLLDGAPVDFAAN
FT                   TLTIAVTPGNPKGIRSLRDLSDPEVRVVLCAPQVPCGHAASAVEEAAGVDLRPVSEESS
FT                   VTDVLNKVTSGQADAGLVYVTDARDAGERVTAVPFPESARAVNTYPIAVLKESQNATGA
FT                   RQFLAAVTGTAGQTVLRRNGFAAP"
FT   sig_peptide     complement(39927..40019)
FT                   /locus_tag="Mjls_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 31"
FT   gene            complement(40016..40420)
FT                   /locus_tag="Mjls_0036"
FT   CDS_pept        complement(40016..40420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0036"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   PFAM: regulatory protein, MerR; TOBE domain protein; KEGG:
FT                   mmc:Mmcs_0046 molybdenum-pterin binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95849"
FT                   /protein_id="ABN95849.1"
FT                   /translation="MPKIRVRQAAELLGVSDDTVRRWIDDGSLAASADASGRKVVDGAE
FT                   LAAFARGNPATAPKDPLGTPSSARNRFAGLVTDVVSDTVMSQVEMQCGPFTVVSLMSTA
FT                   AVRELGLEPGSVAVAVVKATTVIVETPAQP"
FT   gene            40613..42613
FT                   /locus_tag="Mjls_0037"
FT   CDS_pept        40613..42613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95850"
FT                   /protein_id="ABN95850.1"
FT                   /translation="MTEHPQADDDPRLGALLEWRQRLIDSGAVSARSFKEAHLRLVLRS
FT                   GRTDVEQIRAMLPGSVAEHADDMARVLAELPARPGGSEEEITPAGRHRGDDPVGEPLYE
FT                   SATQGDHFAPYEGDGPGAAAHSVTLHRRRDTGALELRWPPIDAAGQTVVYRVVSGEDAA
FT                   PRSPDTGDPLTVTTTTSATDDRPPVAAVRHFQVWANLGATRAEALAAQPVLHAAGVLIG
FT                   RITDLALQEDSGRVVGRYTVPPGISAVYVYRMPAGEAHRDGPQYRILAGQDNLAGFVDI
FT                   DVERGYRYVYRVRCAAPVGGVLRLSEAAESGVDVSAVLAPVTDLTITGSTADATVLDLA
FT                   WTTPPGGRVVVYRTPTGPSAGAEADELPEDALDQVGLPPELRLAQPVTEERDEDGRVRT
FT                   AMPGVAWPDQWSRAYFTPVTLIGGRAMLGKTFSTVRTGVIRDIELAEYCNKQVLTFDWP
FT                   DGAASVVVYLAPPGHDPRNGLGGHTYEITLEEYEKYGGLQLSGPLPVHGCSLHLAPIAF
FT                   TGGRRVMGAIASIDYQGLLRLQYAVRVGRDADGRPFTATIAVRSEYDLPGSPAFVLVNN
FT                   PTRIPLSVHDGELVDVAPLNEQGQLAAPPAKELRWSQLTTTGGSELWAANVRNRQGWIR
FT                   LFVSTPSPASLRLIALLDPPVEHLRLTPAVT"
FT   gene            42610..45099
FT                   /locus_tag="Mjls_0038"
FT   CDS_pept        42610..45099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95851"
FT                   /protein_id="ABN95851.1"
FT                   /translation="MTGRYGQLTYTSFDTAAHMGGWQVKETSADLSPDEVHALTSGVRT
FT                   VFRPAQPLPAYPTPEQLDRGPRRLAYGRLDRRRAGYWHTVPSGSDSTGRPGNVFAHALL
FT                   DRAAGDGADRPIQWWRSDGWLCPYGPLAVGAAALPGTPPAPGTAVTKDSVVRFALDPDA
FT                   WRLATLFGLLDAVAAALDGGPPVVLGVESADSAAQWIGLVSFLMSAGTAARLHFSTFDR
FT                   ADQLTLARQSGQHLTAVPVDDLEHVPDDVVAISEHATLSLGELDHEPHRTADGRAITVT
FT                   PWSAMAQVVLLDAEGARSVLDDIDHYAAQVADAGLHPAWPLAMSVAHRDEFADALTEAY
FT                   AVIAAHSPRAASDSVTARTVAEVMRNALGTSTADAWKAVQDTVDGPAADLADVTYLCRA
FT                   VADEDWLSRPGRIPARERDSERRPPPRELRESLGPALAAAQAGGAHRVARLADLLLRSG
FT                   IDDDRVSAALRTEVAPKLMDSEAAPALLEALRESLGAPTRLALAATLLQDGDATAVNGD
FT                   VFDWLAEGVRAPAPHDLREARPGDPVWTAAALRGARTVQRGAVDQADRWASLWWLRVSG
FT                   SERFEEVAGSSVWHPDELLAAVGDSALPGAAAVRTLAGAPPSAALERLAQTVLRANNDD
FT                   VAVACAAVRIFDPRGWIEQGYAASHQSAYAPLWERALESTGTDAVHRDFAVRLVTFAAI
FT                   ALAAGQPYPPSSALLTAEPRVAADAFGQLAALLDGYVLNAMSVLAVAALRFAHNGDDPA
FT                   AVTDGIEELIWQGARHVMATRRPESIDIGVVAATMARLTGEPNDGAVRRHRKTVLKLLA
FT                   RRPEAPTAPIARTRWSR"
FT   gene            45101..46258
FT                   /locus_tag="Mjls_0039"
FT   CDS_pept        45101..46258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95852"
FT                   /protein_id="ABN95852.1"
FT                   /translation="MTKCPRCFSVLDPNQYLWTLPPHAGGTRYRDDLASSYLGAPADSG
FT                   ALYTWARPPGYTGPPPPLSEASQALQGPAVEICLACHFILPDDWRNGHAVCIAMAGARA
FT                   TGKSLYIGVLVKQLELLCEHLGVSMQPATRATAVAYTMNYETPLYVQRGLVPPTPTVQT
FT                   QASHQREPLIYGIGVWHGVRRYLVLRDVAGEDLESGDLYTPPFRFFANADAVFFMFDPL
FT                   RIKGIRDQLHDLLPAQAFSGGDPRAVLNNVLHAVGAAQPKLAVIVSKFDALRVLRDVEG
FT                   SEWSLIMSNAGAAYLRDPSDTPQYDESDGQLLHEEVRSLLTRLHGGAIVAAVENPSTGM
FT                   RLPHRYFAVSALGAPPSGNRLHSRGIAPFRTVDPVRWVTAPYGVL"
FT   gene            46361..47392
FT                   /locus_tag="Mjls_0040"
FT   CDS_pept        46361..47392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0040"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   mmc:Mmcs_0050 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95853"
FT                   /protein_id="ABN95853.1"
FT                   /translation="MVQGAGETVPALRIRCGDVLCTVTPGDAPVLIGRDLLAQIRADDP
FT                   RVSPVHAQIAVDGDHWVIGDAGGTTGVFVDGERVESVGVRDTVTVRLGHAEGLVVTLAV
FT                   DHATDPEEIEAGVARAGAAVEDRREELGFTRRRLSAEGVIDPQTLADFEAGRVWPPDDA
FT                   RARLEVHLGWEPGTIAAVRAGSPAPEDESTEILSDTVQMAVMVDAASIGLGNVKARIDR
FT                   APAPHDAAYDEYVETVLFDLRGLEKMVRNAGKTTRRPDGAVVLRDIRRTYNGVMTRAAQ
FT                   APGAPLSRRLYAARRSAELTVEEAADAAGVSVEAVTDAEDGQFVADADAAALEALVRRL
FT                   AAG"
FT   gene            47453..47962
FT                   /locus_tag="Mjls_0041"
FT   CDS_pept        47453..47962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0041"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mmc:Mmcs_0051 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95854"
FT                   /protein_id="ABN95854.1"
FT                   /translation="MGKNERAKIVMSDPEIAEFIDHSRTATLATLLPSGRPHLVAMWYA
FT                   VLDGEIWFETKAKSQKAVNLRRDPTVTVMIEDGLTYNTLRGVSIDGRAEIVDSDPDLLL
FT                   RVGISVWERYTGPYSDDMKPFVDQMMHNRIAVRVVPERTRSWDHRKLGMPDMPLSGSTA
FT                   QYLGEQ"
FT   gene            47959..48438
FT                   /locus_tag="Mjls_0042"
FT   CDS_pept        47959..48438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95855"
FT                   /protein_id="ABN95855.1"
FT                   /translation="MTAPDRPKQLDSPLLPTIFKYVGKAHVWVYRRTGGRIGGKWRVGA
FT                   GFRKPVPTMLLEHRGRKSGKVFVTPLLYLRDGADVVIVASQGGRKEHPQWYRNLIAGPD
FT                   VFAEIGSERRPVKAVVADAEQRARLWPALVELYADFDTYQSWTEREIPVIILQPR"
FT   gene            complement(48419..49249)
FT                   /locus_tag="Mjls_0043"
FT   CDS_pept        complement(48419..49249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95856"
FT                   /protein_id="ABN95856.1"
FT                   /translation="MSTTRPSAPAFFVPEGDTFIPTGIARGPWGETVSGTYVGGLLGHV
FT                   VERDTDADPEVAPARLTVDLLRPVAMAPVHTRSTVVRRGRRLWLADAELVQAGTVVARA
FT                   SALLLRRGPEPPDDAWTSPVNMPPLPPDPTEIGTRTTVLWVFGGADPSTPTADLSGWQQ
FT                   SGPKSVWVREITPLIDGVTLTPFVRAAIAGDYASSLTNFGSTGLPFINADYTVSLSRLP
FT                   DGPHLGLAALTHHACDGVSTGVATLFDHRGPIGNATVTALANPGFTPGLSAAAG"
FT   gene            complement(49301..49606)
FT                   /locus_tag="Mjls_0044"
FT   CDS_pept        complement(49301..49606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95857"
FT                   /protein_id="ABN95857.1"
FT                   /translation="MTTDKTGASTTVKAEADRFTIGVEGQTVGFAEFTDRDGQRVFTHT
FT                   EVDGEFEGRGLATILVGEALDQTRSAGKRIVPECKLVASYIDKHDEYADIVDPVGH"
FT   gene            complement(49619..50113)
FT                   /locus_tag="Mjls_0045"
FT   CDS_pept        complement(49619..50113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0045"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   mmc:Mmcs_0055 protein of unknown function DUF55"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95858"
FT                   /protein_id="ABN95858.1"
FT                   /translation="MTNWINTVSRDHVERAVRGRFTQANHGKPQALRRMARGDWIIFYS
FT                   PRVTYPDGAQLQAFTAIGQVVDDEPYQASTEDEVWRRNVDFLDCAETPIRPLIDALDFI
FT                   ENKQRWGYKFRFGVFRIDDHDFETIRSAMTRSPELIGASTVSDAAGGVPGQTAAPPNDT
FT                   D"
FT   gene            50168..50518
FT                   /locus_tag="Mjls_0046"
FT   CDS_pept        50168..50518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95859"
FT                   /protein_id="ABN95859.1"
FT                   /translation="MDRRRIGDGRSAARTRSVRLRSQSMSEPSGGLTADAVRSATFSKP
FT                   PLGKRGYDPKSVRDFLALTARRLEGRGHLCAADVRSIRFPKPPLGRRGYHDGEVDEYMV
FT                   TVAAAIAALDGQ"
FT   gene            complement(50652..50945)
FT                   /locus_tag="Mjls_0047"
FT   CDS_pept        complement(50652..50945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0047"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB; KEGG: mmc:Mmcs_0057
FT                   transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95860"
FT                   /protein_id="ABN95860.1"
FT                   /translation="MSNVTFLEVPVGACTRDPERWTTTADEEAKAICRGCPRRWMCARD
FT                   AVELPRAEGLWAGIVIPEAGRGRTFALKQLRSLAERNGYPVRAIRRVFPESA"
FT   gene            51304..52035
FT                   /locus_tag="Mjls_0048"
FT   CDS_pept        51304..52035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0048"
FT                   /product="conserved hypothetical alanine rich protein"
FT                   /note="KEGG: mmc:Mmcs_0058 conserved hypothetical alanine
FT                   rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95861"
FT                   /protein_id="ABN95861.1"
FT                   /translation="MTNAESIDEATGVLDPGVARAGAAAAARRRELDISQRSLAADGII
FT                   NAGALIAFEKGRSWPRERTRAKLEEVLRWPTGTIAKLRRGEPTATVPAVPAAADGAEAP
FT                   LIAQAVEAAVHTLGATADVLPALDDREFTPRVTTILSDLRQLEAVAARAARIGKVTPAL
FT                   IKALSAVRGRIDELTMLAATAPNATLGQRLYAVRRRANLTISETAQAAGVPDDDIAGAE
FT                   AERPISAESAAAIEALIGVLK"
FT   gene            52157..53107
FT                   /locus_tag="Mjls_0049"
FT   CDS_pept        52157..53107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95862"
FT                   /protein_id="ABN95862.1"
FT                   /translation="MTWPPPPPSSDPWATGPAPDSDADRDDGAPAADPVAEPLWEPLAD
FT                   PVADSGPDELSEPVEQPVEPPTARPVDQPIVHPEAATPVPQGEFVPPPAPASEPPPPDG
FT                   GWSAAGYGAPPPVVPRAQVAPPQQKKPVWLIAAAVLGVVVFGVVVWLLVPSGDGGSTAA
FT                   SPTTPSPTRTADPRAEADLRGLLPRGYAADACEMRTPPEGALAEAACGANLDPGGPPSA
FT                   TYTITADDTALDAAFNDVVEASSIVTCPGNIQSPGPWRRNATPQKVSGVLFCGLQADRP
FT                   VVAWTNTDEALVAVVKSGPRGPGLDQLYTWWSSHS"
FT   gene            complement(53177..54208)
FT                   /locus_tag="Mjls_0050"
FT   CDS_pept        complement(53177..54208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0050"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: protein of unknown function GLTT; KEGG:
FT                   mmc:Mmcs_0060 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95863"
FT                   /protein_id="ABN95863.1"
FT                   /translation="MKITTVFAATAAAAAVAAAGAVIAAPIAGAESGAPAGPAVHEIGQ
FT                   QADLVNGSVVQGWTVTDLKASTDTIPYAVRGTLWEATATDEAIQGAATPIVSNFNARAR
FT                   NGETYRALWQVATAQGVNPSTLGQGQETTGKLYFDVTGAQPDSVVYNDGGQDLLLWVQP
FT                   PPSSTSSSTPRSSSSPSGSATSATPQATPQGSEASPPAAEAVEPGTPGAAPASTELVPA
FT                   PAGSSGTPLPAGSSGTPLPATSSGTPLPAGSSGTPLPATSSGTPLPAGSSGTPLPATSA
FT                   GTPALAPGAPAPAPAAPAVPAQPAPQPASSGPAPVPVSTGDQAPVPHGQGVPTPTPTPV
FT                   PVP"
FT   sig_peptide     complement(54116..54208)
FT                   /locus_tag="Mjls_0050"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.840 at
FT                   residue 31"
FT   gene            complement(54326..55285)
FT                   /locus_tag="Mjls_0051"
FT   CDS_pept        complement(54326..55285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95864"
FT                   /protein_id="ABN95864.1"
FT                   /translation="MAQPGSYADWIRVDELVPPRRTPPAHGWRRWVYRLSFGRINPGQS
FT                   PEELRQLELENKVRGVLRGHYKVGVMGKGGVGKTTVSASIGSVFAELRQDDRVVAIDAD
FT                   TAFGKLGSRVDPNAQGSYWELASDQHLESFADVRSRVGNNAAGLFVLAGEGSPARRRVL
FT                   DPAIYREAASRLDRYFSISIVDCSSTMDSPVTQEVLRDLDALIVVSSPWVDGAAAAGQT
FT                   LDWLAARGMTGLLQRTVVVLNDSDGHADKRTRSILAQQFAGHGQRVIEIPFDGHLRPGG
FT                   VISGTREMSPAARRKFLELAAALADHFPSTDDRSRERG"
FT   gene            56157..57005
FT                   /locus_tag="Mjls_0052"
FT   CDS_pept        56157..57005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95865"
FT                   /protein_id="ABN95865.1"
FT                   /translation="MMAGAPAASSGTHYDDVVAVEVTIDGMLVIADRMSASDFPPSLGI
FT                   RLNIPQPDLRKIVWDQVARDLTEQGVLNFYGDPHPEVAAMVDTLSRSDRVLEGRWWRRD
FT                   LGGKMVRFVVCRKGDRHVVAARDDEMLVLQRIAPQIGLANMVTTVLGTAPPADVEPLTG
FT                   VAAKLAQCRTANELQAYGIALTSARAYADIISEPASWVELTATERHPGGTQTTTDVAAG
FT                   VLDSPHGRIVSIPRRVSGELYGSFLPGTQENLQRALDGLVDFLPSKTWFDHSDADAFHG
FT                   E"
FT   gene            57018..57518
FT                   /locus_tag="Mjls_0053"
FT   CDS_pept        57018..57518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95866"
FT                   /protein_id="ABN95866.1"
FT                   /translation="MAGDFSTRDPDDDADDLSALDFYRPVPVEDDGEVDGGDLAALDAF
FT                   AGYGLSDEPEPEPLFTVTNPPGTVTVTSYLDGRVQHIDLSPRAVHMSETELAEEIVVIA
FT                   GLAAQDAKSAQYEFMLDGMREQGHDDPATRDFLQRDLELPTPEEARAHRAEVFTTRYAG
FT                   SHE"
FT   gene            57511..59232
FT                   /locus_tag="Mjls_0054"
FT   CDS_pept        57511..59232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0054"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; KEGG: mmc:Mmcs_0064 AAA ATPase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95867"
FT                   /protein_id="ABN95867.1"
FT                   /translation="MSDHLASLFGSAVGMLPNAPARSYELFTDITNYDETACDAWVGRI
FT                   RCGDMDRVTLFRAWYSRGNFGQLAGAAEISMNTLAARIPIGGLFGEITYPITSPLAITM
FT                   GFAVNEAKEGNFTDAMEALENVPPGGADHLIAWVKTVVYGAAERWTDVIDQVRGANSWP
FT                   DKFLAAAAGVAHGVAAANLGLFTEAERRLTEMNSSPAGQACAQTIAWYLAMTYRSQGNE
FT                   EGARALLEWLQATHPEPKVTAVLRDPSYRLVTTTAEKIAARTDPWDPASAVADTSGRER
FT                   LLEEAQAELDRQIGLSRVKEQIEAYRAATQMAKIRAARGMKVAQTSKHMIFAGPPGTGK
FT                   TTIARVVANILAGLGVISEPKLVETSRKDFVAEYEGQSAVKTARTIDRAVGGVLFIDEA
FT                   YTLVQERDGRADPFGTEALDTLLARMENDRDRLVVIIAGYSADIDRLLETNDGLRSRFA
FT                   TRIEFDSYSPDEIVEIAKVIAAANDSSVNEDAAKLVLEAATLLGQRTLGGKPALDIAGN
FT                   GRYARQLVEAGEQSRDMRLARSLDFDSLGVEQLSEINGEDMASAIAAVHSRLNISG"
FT   gene            59236..60711
FT                   /locus_tag="Mjls_0055"
FT   CDS_pept        59236..60711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0055"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690; KEGG:
FT                   mmc:Mmcs_0065 protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95868"
FT                   /protein_id="ABN95868.1"
FT                   /translation="MASFRLTTKVQVSGWRFLLRRVEHAIVRRDTRMFDDPLQFYSRAV
FT                   GAGIIIAVLICLGAALMAYFKPLGKRGGDQLLVDRSTNQLYVVMPGGGELRPVYNLTSA
FT                   RLVLGNPGTPVAVKSEELNRMSKGQPIGIPGAPYATPVSGAAESMWTLCDTVTKPESVV
FT                   PRVETSVLVRPLVVDSTVGPLRPDQGMLVSFKGANWLVTEGGRHSIDLADRAVTSAVGI
FT                   PVTARATPISEGLFNALPNAGPWQLPQVARAGEPNTVGLPANLVIGSVFETVTESDDQQ
FT                   HYVVLADGVARVNDPTAAALRATNSYGLIEPPMVEASVVARIPEQVYVSPLPDKALDIL
FT                   LRQDDPTLCWSWQRVAGDQAPRTTVIAGRRLPIAASALNTGIRQITGDSTVYIDGGQFI
FT                   RLQSPDPRYGESLYYIDPQGVRYGVTDEETAKNLGLVGPLTAPWQVVSLLVDGPVLSKQ
FT                   AALLEHDTLPANPNPRKVGEDGPVAGARPGGSR"
FT   gene            60725..62962
FT                   /locus_tag="Mjls_0056"
FT   CDS_pept        60725..62962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0056"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: mmc:Mmcs_0066
FT                   cell division FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95869"
FT                   /protein_id="ABN95869.1"
FT                   /translation="MTTKKFTPIIKRGPRLTPGEITVTPPDDLGVEIPPSGIQRALPWV
FT                   MGGCMLGMISIMIFTGVRQLSPYMLMMPLMMVMATVGFMAGGGSGAKRVPEINADRKEY
FT                   LRYLSGLRTRVTSSAAAQVTFFNYHAPHPEDLLSIIGTNRQWSRQANSEFFAATRIGLG
FT                   SEPAVDRLLKPSIGDVNGLAGPQAAPQPHLEPVSHMWVTKFLRTHGLIHDCPKLLQLRS
FT                   FPTIAIGGDPDGSAALLAAMICHLAVFHPPDLLQLRVLTDNPEDPNWSWLKWLPHVQHQ
FT                   SDVDAAGPTRMVFTRPDGLSDLTARGPHTADSAPSGPYVVVVDLTGGRAGFPADGRAGV
FT                   TVLTLGNHNGSAYRIRVAADGTADDRMPNSSFRLVTNSSDRLTPGQAGRIARKLAGWSI
FT                   TGAIIDKNVRVQKKVATEWHQLVGAQTVEEVTPARWRMFADTDRDRLKIPFGHELRTGD
FT                   IMYLDIKEGAEFGAGPHGMLIGTTGSGKSEFLRTLILSLAATHHPDQVNLLLTDFKGGS
FT                   TFLGMEKLPHTAAVVTNMEEEAELVSRMGEVLTGELDRRQSILRQAGMQVGAAGALSGV
FT                   AEYEKHRERGADLPPLPTLFVVVDEFAELLQNHPDFIALFDRICRVGRSLRVHLLLATQ
FT                   SLNTGGVRIDKLEPNLTYRIALRTTSSAESKAVIGTPEAQYITNKESGVGFLRVGMEDP
FT                   VKFQSVYTGNPYVPATTVQEDGEVKPRQSTRNRVRIHKFTATPIFDTAVTS"
FT   gene            62959..64761
FT                   /locus_tag="Mjls_0057"
FT   CDS_pept        62959..64761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0057"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: mmc:Mmcs_0067 cell division FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95870"
FT                   /protein_id="ABN95870.1"
FT                   /translation="MTASRQAAEQKVLREVVLDQLTTGEIRAYRMWLPPLTDPTPVDEL
FT                   VERDHQRRPLRFGLGIMDEPRRHRQDIWGVDVSAAGGNIAIGGAPQTGKSTFLQTLILS
FT                   AAATHSPRDVQFYCVDLGGGGLMYLEDLPHVGGVATRAEPDRVNRVVAEVKAVQRQRER
FT                   TFKELRVGSIAGYRQMREDPNNPAAADPFGDVFLVIDGWPAFVAEFPDLEPVVQDLAGQ
FT                   GLAFGVHVIISTPRWTELKSRVRDYLGTKIEFRLGDVNETQIDRITREIPANRPGRAIS
FT                   MEKHHLMMGVPRLDGQHSAANLVPAITSAVAQIAARHTVRAPQVRVLPERVHLDELDPN
FT                   PPGPDADYRTRWRIPLGVRESDLSVAYNEMQMTPHLLIFGAPKSGKTTIAHAVAQAICR
FT                   RNSPQQVRFMLADYRSALLDAVPQSHLLDAGAVNRNHASLEAAIKALATNLQKRLPPPD
FT                   LTTAQLRSRSWWSGPDVVLLVDDWHMIVAASGMVPPMAPLAPLLPAAADIGLHIIVTCQ
FT                   MSQAHRATMDKFVGAAYGAGTPTLFLSGEKTEFPSSEIKLRKRPPGQALLVSPDGKEVV
FT                   QAAYVDPPADPLEEEVLAPPPQGG"
FT   gene            64909..65202
FT                   /locus_tag="Mjls_0058"
FT   CDS_pept        64909..65202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0058"
FT                   /product="PE domain protein"
FT                   /note="PFAM: PE domain protein; KEGG: mmc:Mmcs_0068 PE-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95871"
FT                   /protein_id="ABN95871.1"
FT                   /translation="MQPLEHNPGAAGIGGQVVANGARGLAGGTAATAAVTALVPAGADE
FT                   VSAMAAATFAAEGAETLALNTFAQEELSRAGAAFTEISGIYAAVDAANASTF"
FT   gene            65253..66584
FT                   /locus_tag="Mjls_0059"
FT   CDS_pept        65253..66584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0059"
FT                   /product="PPE protein"
FT                   /note="PFAM: PPE protein; KEGG: mmc:Mmcs_0069 PPE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95872"
FT                   /protein_id="ABN95872.1"
FT                   /translation="MALTGIPLPPTWTALPPEVNTGRLMAGAGPAPMLQAAAGWEALAV
FT                   LLETQADELAASLANLSSMWTGTASERAVAATMPMVLWLRTTSAQAMKRALQAANQANS
FT                   YTLAMATTPPLPEIEQNHITHAVLEATNFLGVNTVPIGVNEFDYFVRMWNQAAGAMDVY
FT                   QAETQMNLLFEPIPPMTPIVIPGVGESTGAAAVAQAGARAPMGVARNGLIAKASATAKM
FT                   ESVGLNAGRAMAQGNMAAQRAQGAVQKGEQAAHQQPQDQVLQQGVQMGVQMAGQVGSMV
FT                   AQVPQQFGQMVQTPMQMLTQPLQQVSSIFGQMGGGLGGEKAQIGLIGAAPFSNHPLAGG
FT                   SGASSGAGLVRAASLPGAGGTAARTPLMANLVGDKMAAAPVPVGAGAAAGATVGGLAPV
FT                   GGAGGGMGPMGMAGQGAKSGGSKPGLTAPAPLVHDLDEDDGDDW"
FT   gene            66678..66977
FT                   /locus_tag="Mjls_0060"
FT   CDS_pept        66678..66977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0060"
FT                   /product="10 kDa culture filtrate antigen LHP (CFP10)"
FT                   /note="KEGG: mmc:Mmcs_0070 10 kDa culture filtrate antigen
FT                   LHP (CFP10)"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95873"
FT                   /protein_id="ABN95873.1"
FT                   /translation="MAMNTDIAVLAKEAGNFERISGELQGVMRSVDATANSLLPQWRGQ
FT                   AGEAAQAALVRYQEAAQAQIQTLTEISSNIHTSGTQYGSTDEDQAGTLASSMNL"
FT   gene            67008..67295
FT                   /locus_tag="Mjls_0061"
FT   CDS_pept        67008..67295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0061"
FT                   /product="6 kDa early secretory antigenic target EsaT6
FT                   (EsaT-6)"
FT                   /note="KEGG: mmc:Mmcs_0071 6 kDa early secretory antigenic
FT                   target EsaT6 (EsaT-6)"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95874"
FT                   /protein_id="ABN95874.1"
FT                   /translation="MSEQVWNFAGIEGGAGEINGAVSTTQGLLDEGKASLGALAAVWGG
FT                   SGSEAYQAVQARWDNTSAELNAALQNLAQTISEAGSTMAQTEAGVTGMFA"
FT   gene            67401..68828
FT                   /locus_tag="Mjls_0062"
FT   CDS_pept        67401..68828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0062"
FT                   /product="conserved hypothetical proline and alanine rich
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0072 conserved hypothetical proline
FT                   and alanine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95875"
FT                   /protein_id="ABN95875.1"
FT                   /translation="MSADYDRLFHSPDAAQTPDEATVHVDRDALMQGTAPASAPAGGSN
FT                   NADGSAPPPLPITPPRTQAAPAPPPRHAEITTQMPPTTQAPTPQGQVPQRPPNGMMRTP
FT                   QTNLPGGARFEAPRQASAPAPRPAPAPPPSAHFAEAPPAEVAWPQSQPPAQPAPTSAAA
FT                   MGNHRAIDALSHVGVKSAVKMPSQRGWRHVLYLLTRINLGLSPDEMYEMDLHARIRRNA
FT                   RDSYQIGVLGLKGGVGKTAVTVALGSTLAKVRGDRILAIDADPDAGNLADRAGRQSAAT
FT                   IADLLSDKELDRYNDIRAYTSMNGANLEVLSSEEYSQARREFNDDDWKGATDVVSRYYN
FT                   LVLADCGAGLFQPASRAVLSTVSGLVIVASASIDGARQAAVTMDWMRQNGYQDLLGRSC
FT                   VVINHVVPGKPNIDVDDLVQQFERHVAPGRVIVLPWDKHIAAGTEIQLDLLDKVFQRRI
FT                   TELAAALSDDFDRLERR"
FT   gene            68891..70354
FT                   /locus_tag="Mjls_0063"
FT   CDS_pept        68891..70354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0063"
FT                   /product="protein of unknown function DUF571"
FT                   /note="PFAM: protein of unknown function DUF571; KEGG:
FT                   mmc:Mmcs_0073 protein of unknown function DUF571"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95876"
FT                   /protein_id="ABN95876.1"
FT                   /translation="MTILTGRRMTDLVLPAAAPVETYIDETVAVLAEILEDTPKDVLAG
FT                   FDFTAQGVWAFARPGAPPLKADESLDDAGVVDGSLLTLVSVSRTERYRPLVEDVIDAIA
FT                   VLDESPEFDRAALNRFVGVSIPLVSVAITLMSLVSWDRTGQSLWWALALAVLGLGLLGG
FT                   SLLAQNRYANLNMAESLLIASIPALAGGAALAVPLPNGVGSLGAPQLAGAGAVVLLLTL
FT                   ATRGGPRKRAEVAAFLAIATAALTAAAVGYGYGWQYWVPAGAVAFGLIVLTNAAKLTVA
FT                   VARIALPPIPAPGETVTNDELLDPVTSREGVDEESPTWQAIIASVPESAARLQERSVLA
FT                   KKLLIGFLTAGALILAVGAIAVVVQGHFFVHSLIVAGLVAAICGFRSRLYAERWCAWAL
FT                   LAVTVIVPTGVMVRLCQWYPDDAWLVLAIYTALGAVALVVIGATDGVRRVSPVTKRILE
FT                   LVDGAAIAAVIPLLLWIASVYDVLRNLRF"
FT   gene            70364..70675
FT                   /locus_tag="Mjls_0064"
FT   CDS_pept        70364..70675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95877"
FT                   /protein_id="ABN95877.1"
FT                   /translation="MSGEVLQVNPPALAGAGTAFGQAASGVAGLHADAPLGEAASAVAA
FT                   LQTAAACQQAQADIGALTAAAATAAEEYGENLRSAAARYESVDQAGRDAIEQVALPGG"
FT   gene            complement(70681..71001)
FT                   /locus_tag="Mjls_0065"
FT   CDS_pept        complement(70681..71001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95878"
FT                   /protein_id="ABN95878.1"
FT                   /translation="MHPQVAAVLAQAQQLQSIMDEQLHKMKHQTFTASDQTETVEVTLD
FT                   GHQQLTSVHIEDGLLRQGAHVVEQRLNEALQNATEAASAAIEADRERIDARVAELTESW
FT                   RP"
FT   gene            complement(71010..72614)
FT                   /locus_tag="Mjls_0066"
FT   CDS_pept        complement(71010..72614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95879"
FT                   /protein_id="ABN95879.1"
FT                   /translation="MAGDEVRVEPADLRARATTLDEEITDESQRPTPPCGLPFVTASAA
FT                   GIAAGSDTLRSHLISGNREAERLAAVLSEAADVYQQIDNRAAQALEYPDGPRSVEPVPV
FT                   NPTLPPSVPPIEFPATVPAVPGGQTDAGFMDVKAAAQIIHSGDSGPMRTYGEQAKKFAG
FT                   TLRDRAASFNLDGINWDGTAAEKAGDAVRQHKEWLEKLAESYEFLGTEAIDMADAHDKW
FT                   SGQHPTVAEVEAVEARVAQAGQAGDKDALARAMMDYLALQRKSEDVRTSYSADVAGKSL
FT                   PKVLDPPPGAAPVPPISSNGDPRKGKTQPAGEGAPGEPGSGGGGAQPGGRPGGQPGGQA
FT                   AAAPMGGGSPAGQGGAQPAGASSGGGGSPSGGGGSPAGGGGAPAAPAAGGGLPGGLPGG
FT                   GPDGLPPLDDPALKPAAASGGGAGGGSGGGAGGGGGGVPPSPLQPAVGAETVAPGAAGT
FT                   GRAGAAAAGPAGAMGAMGGMGGMPMGGHGAGRGQGGGEKKRTPGLAPDEDLYVEDRPFT
FT                   ESVIGYTPKPRDRKDSK"
FT   gene            complement(72665..74062)
FT                   /locus_tag="Mjls_0067"
FT   CDS_pept        complement(72665..74062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0067"
FT                   /product="putative conserved membrane protein"
FT                   /note="KEGG: mmc:Mmcs_0077 putative conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95880"
FT                   /protein_id="ABN95880.1"
FT                   /translation="MRSFVTQFGLRLTTGHLMWAAVLIPACIAIFVPLDLLWVGVTVSV
FT                   LIALIAVVTVRGRRLTGWVAALFSWRRRHLSTPPAPSEPAVGSTVMPGDHVAVRWQGDH
FT                   LMSAIELVPRPFTPTVVVNGQSFTDDVLDTAMVENLIAAHCPELEADVVAAGYRVGKTA
FT                   PASLVALYEQVVGPYPAPANRRTWIVLRADPELTRKPAQRRDSGVAGLARYLVASTTRL
FT                   ADQLAGNGIDARPSRSFDDFDRATEVSFERETWSAIKGRSTFTAAYSAPGGPDVWWSAR
FT                   ADHTITRMRIRPGIAPTTTVLLTTLANPATPRGFSCLFGGQRAALQGISPVSDKHYELP
FT                   IGSAGILIGETADRYPVYMPFDDVDVSINLGDARLFTQFVVRSAAAGAVVTLGPQFREF
FT                   AGFVNGRIGQEAKLSWPNATTYLSPHPGVGRVILRHNFIDTPRHRQLPIRLINPREESR
FT                   YQMALEQ"
FT   gene            complement(74059..75405)
FT                   /locus_tag="Mjls_0068"
FT   CDS_pept        complement(74059..75405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0068"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: mmc:Mmcs_0078 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95881"
FT                   /protein_id="ABN95881.1"
FT                   /translation="MQRVGVILLALLLALLSAPPVGAIEPPSIDPAALPPDQTGPDSPT
FT                   EQRRVCSAPTVLPNSNFADKPWPNDYLQLAEAQKFATGAGVTVAVIDTGVNGSPRVPAE
FT                   PGGDFVDQAGNGMSDCDSHGTLTASIIAGRGSPTDGFIGVAPDARILSLRQTSEAFQPV
FT                   GARQDPNDPNTTQTAGSLRSLARAVVHAANLGAQVINISEAACYKITRPIDETGLGAAV
FT                   NYAVNVKNAVVVVAAGNTGQDCSQNPPPDPAVPTDPRGWQQVQTVVSPAWYSPLVLTVG
FT                   SINDNGQPSNFSMSGPWVGAAAPGANITALGYDGQPVNALQGQDGPIPIGGTSFSAAYV
FT                   SGLAALLKQRFPELTPAQIMNRITATARHPGGGVDNYVGAGVIDPVAALTWEVPEGPTA
FT                   IPYRVKQLPPPVHVPPPDRGPITWVVVIGAGLTLVLGIAALTRRALRRR"
FT   sig_peptide     complement(75334..75405)
FT                   /locus_tag="Mjls_0068"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.971 at
FT                   residue 24"
FT   gene            complement(75596..75853)
FT                   /locus_tag="Mjls_0069"
FT   CDS_pept        complement(75596..75853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0069"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: mmc:Mmcs_0079
FT                   phosphotransferase system, HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95882"
FT                   /protein_id="ABN95882.1"
FT                   /translation="MPARTVTVGSAIGLHARPAAIIAEAVVNAGVPVTLAVAGGEPVDA
FT                   GSALMIMTLGAGNGAEVTVESDDAAALDTVAGLVEQDLDA"
FT   gene            complement(75884..77899)
FT                   /locus_tag="Mjls_0070"
FT   CDS_pept        complement(75884..77899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0070"
FT                   /product="PTS system D-fructose-specific IIC component
FT                   (F1P-forming), Frc family / PTS system D-fructose-specific
FT                   IIA component (F1P-forming), Frc family / PTS system
FT                   D-fructose-specific IIB component (F1P-forming), Frc
FT                   family"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   subunnit; PTS system, fructose subfamily, IIA subunit; PTS
FT                   system, fructose subfamily, IIC subunit; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2; phosphotransferase system, EIIC;
FT                   phosphotransferase system PTS, fructose-specific IIB
FT                   subunit; KEGG: mmc:Mmcs_0080 phosphotransferase system,
FT                   fructose IIC component; TC 4.A.2.1.4; TC 4.A.2.1.4; TC
FT                   4.A.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95883"
FT                   /protein_id="ABN95883.1"
FT                   /translation="MSSPTASPIITTDLVLLDVDAGGDKEAVIGRLVNRLADAGRSTDA
FT                   DGLTRAALAREEQSATGLPGGIAIPHCRSPYVDTATIGFARLTPGVDFGAPDGPADLVF
FT                   LIAAPDSGGAEHMKLLSSLARALVRKEFVASLRAAETSEDVVSLVEDVVNPQPAAPPPP
FT                   AAEPEPARQRSLVAVTACPTGIAHTYMAADSLAAAAKNAGVTLHVETQGSSGSTPLSDA
FT                   TIAEADAVIFATDVGVKDRQRFAGKPVVASGVKRAINEPDKMVADALAAADNPDAARVE
FT                   GSAGAPSAAAPAGDVGWGTRTRQILLTGVSYMIPFVAAGGLLIALGFLFAGYDIANTPD
FT                   GQTDSLGKIIATTNSLTNLPSGGLIQYLGAVLFTIGNLAFFFLVPALAGYIAFAIADRP
FT                   GIAPGFVAGYIATTVGAGFIGGIVGGLIAGFAALWISRIGVPHWARGLMPVVIIPLFAS
FT                   LVVGLLMFLLLGRPLAWLTTSLTDWLNGLSGSSVIVLGVILGLMMCFDLGGPVNKAAYA
FT                   FATTGLNVADPASLRIMAAVMAAGMVPPLAMALASTVRPGLFTEPERENGRAAWLLGAS
FT                   FISEGAIPFAAADPLRVIPSMMFGGAITGALVMAFDVTSKAPHGGIFVFFAIGNLAWFL
FT                   VALAVGTAAGAGAVVAAKQFAKPETPADASPALANA"
FT   gene            complement(77920..78897)
FT                   /locus_tag="Mjls_0071"
FT   CDS_pept        complement(77920..78897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0071"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: mmc:Mmcs_0081 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95884"
FT                   /protein_id="ABN95884.1"
FT                   /translation="MIVTVTPNPSIDRTVALPAPLTRGAVQRVTSVTSEPGGKGVNVAR
FT                   ALTLARLDAVALLPAADGDPMVTALRAIGVPFRCVPIAEPVRTNLAITESDGTTTKLNE
FT                   RGAALDAAARDALTRGIIDAAEQASWVVLSGSLPPGLPDDWYAEVVARLVPLRCRVAVD
FT                   TSERPLAALAAAFEHAAPDVIKPNAEELAGLVGASADELESAAAQGDPEPVAAAARQLV
FT                   DRGVGAVLATLGAAGAVLVDRTGAWMATPPPIVPRSTVGAGDASLAGYVRAAVAGAEPP
FT                   RRLRMAVAYGSAAAALPGSALPSPAQLDLDGVAVSTIAPTPASS"
FT   gene            complement(78894..79661)
FT                   /locus_tag="Mjls_0072"
FT   CDS_pept        complement(78894..79661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0072"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; Helix-turn-helix,
FT                   type 11 domain protein; KEGG: mmc:Mmcs_0082 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95885"
FT                   /protein_id="ABN95885.1"
FT                   /translation="MYAEERQQAIASLVMQKGRASVAELAEAYDVTTETVRRDLAALDR
FT                   AGLLRRVHGGAVPARTLHLVEAGVGEREATRAEYKDAIAAAALEYLPGSGASVLLDAGT
FT                   TTARIAGQLPSDRELVVVTNSVPIAARLAGMPSVNLQLLGGRVRGLTQAAVGEQALRVL
FT                   DSLRVDVAFIGTNGISVRHGLSTPDSEEAAVKRAMVRAAGYVVVAADSSKVGREEFVSF
FT                   APISSVDTLITDGEISDNYRGQFAERGVEVVVA"
FT   gene            79704..81458
FT                   /locus_tag="Mjls_0073"
FT   CDS_pept        79704..81458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0073"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing enzyme;
FT                   PEP-utilising enzyme, mobile region; PEP-utilising enzyme
FT                   domain protein; KEGG: mmc:Mmcs_0083
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95886"
FT                   /protein_id="ABN95886.1"
FT                   /translation="MFGFTPVRVDLSILFSNLVHMTASSAPTSHATAGTVLRGVPVVPG
FT                   VQYAPVVRPGRLPVVEDTAAEIADADRPAEAARFSAAATAVATRLRDRAAHSTGAASEV
FT                   LAATATLAQDRAWLGAAEKRIAGGTPAVRAVREAVAQFVDLFTKMGGLMAERVTDLQDI
FT                   RDRVLAELSGLPEPGVPLPMVPSVLCAEDLAPADTAGLDPTLIVALATTLGGPTSHTAI
FT                   IARQLGIPCVVAVDGLDAVPAGAFVLVDGTAGTVTVGPDEVAAAEAVAAARHEAERAAH
FT                   WAGPGATADGHAVAILANVQDGAAARAARETPAEGVGLFRTELCFLNRDTEPTVDEQAE
FT                   IYGEVLDAFAGHKVVVRTLDAGSDKPLKFAGHRDEANPALGVRGIRIAHGNPGILERQL
FT                   AGIAAAAARTGTRPWVMAPMIATAGEAKDFAAAARRHGLTPGVMIEVPAAALLADRILE
FT                   HVDFLSIGTNDLAQYTMAADRMSADLALLTDPWQPAVLALVAMTVRAGAAAGKPVGVCG
FT                   EAAADPTLACVLAGLGVTSLSAASAAVPGVGARLAQVTLQQCRDAAEAVLATATAAEAR
FT                   AAALAALG"
FT   gene            81495..82481
FT                   /locus_tag="Mjls_0074"
FT   CDS_pept        81495..82481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0074"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; Pirin
FT                   domain protein; KEGG: mmc:Mmcs_0084 pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95887"
FT                   /protein_id="ABN95887.1"
FT                   /translation="MPAITADTLTLPRVTAPAPSDTERPVRSITTGPRGYEGEGFPVVR
FT                   AFAGVSAADLDPFIHMDQMGEVEYEPGEPRGTDWHPHRGFETVTYMIDGRFAHQDSHGG
FT                   GGLITDGATQWMTAGSGILHIETPPAELVESGGLFHGIQLWVNLPRKDKFATPRYQAIE
FT                   GGQVKMLASEDGGALIRIIAGDVDSQDGPARGPGATHTPITMAHATVEPGARLNIPWNR
FT                   DFNALVYVLSGRGAVGPVGHPIRQGQLAVFGPGDRLSVAAEPTQDSHRPALEVLILGGR
FT                   PIREPVFHYGPFVMNSKSELIRAVEDYQAGKFGTIPPNALMPHTSGR"
FT   gene            complement(82484..84640)
FT                   /locus_tag="Mjls_0075"
FT   CDS_pept        complement(82484..84640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0075"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: mmc:Mmcs_0085 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95888"
FT                   /protein_id="ABN95888.1"
FT                   /translation="MLTPAVLWRRAADRIQRRDPERDALRRAGRAAIVLPVAAAASFTL
FT                   AGGTQAPMFTIFGSVALLILADFPGNRAARALAYAGLGFNGAILITLGTLTAPHPWLGV
FT                   ALMFVLGVVVTFSGVLSEVIAAGQRATLMTFVLPACTAPGPIDERLTGWLIALALCVPA
FT                   ALFLFPPRHHDDLRRHAATVCRSLADCLDGDASTRDVHRAMNALWENFVNADFRPVALT
FT                   AGSRALVRVVDDLGWLSDRVTDDTAALLGDMKPPIVRVLRDAAAVVRIHDRQVRAARNA
FT                   DLDAALDELRSIAHGRYREDIEQILAVPDDATAVAVSRTLLGRRTFSATVGVTGRIIRN
FT                   AALADARPVWARVLGRRLPRTGAADWVMPETTAVAAITKGFVATRAVVLRNSLRTGLGL
FT                   ALAVTVTQVFPVEHGFWVVLGAMSVLRSSALTTGTRVLRAVAGTAIGFLLGVALIEVVG
FT                   VEPAVMWLLLPVVAFGSAYVPEIASFIAGQAAFTMMVLIIFNVIAPTGWSVGLIRVEDV
FT                   VLGALVGATVSLLMWPRGASATVTAAVRDACEAGAALLRAAVLRVTRGSSEQAADRVTA
FT                   LSHAALEASRTLDDAVRQYLSENGGKTDVRAPVVRAANRAVRLRAAAELIADVVPPPLG
FT                   VYPQTRRVLEAHAELVCRRLVGPAPEAVHTPPISDDVALALRPEAEENDLAISAALPLV
FT                   TVAAHLGELELLYPRAEQPLTTGR"
FT   gene            complement(84672..85289)
FT                   /locus_tag="Mjls_0076"
FT   CDS_pept        complement(84672..85289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0076"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0086
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95889"
FT                   /protein_id="ABN95889.1"
FT                   /translation="MWRRRPHNQSQQLMFRLMGAVVTREGYFETGLAVLADQGYGGLKL
FT                   AEVCHRLGVTTGSFYHYFANWSAYTRELVEYWRQQATVRIVEAVRAEKDPHRRIETLIE
FT                   EALALPHGAEAAIRVWSSIDPDVHAVRAAVDRQRYDIMRESSLEVVGDERQAEVFAACC
FT                   VYILVGYEQATIPPDNVALRWLAAEMLHTLDSGRLNSLPDAR"
FT   gene            85404..86039
FT                   /locus_tag="Mjls_0077"
FT   CDS_pept        85404..86039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0077"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0087
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95890"
FT                   /protein_id="ABN95890.1"
FT                   /translation="MPHTASRGPGRPPAAKAAETRERILRAAREVFSELGYDAATFQAI
FT                   AIRADLTRPAINHYFASKRVLYREVVEQTNAWVISAGMERAHGEGTLLGRLSAFFSAAM
FT                   HAESEDRSAAAFLVTSVLESQRHPDLRSDEHDALRMSRSFVSWAVNDAIERGELSTDTD
FT                   IPSIVEMLVAVMWGMGFYAGYVGGQQELEVIVEKFELLMANKLWQLNT"
FT   gene            86148..87086
FT                   /locus_tag="Mjls_0078"
FT   CDS_pept        86148..87086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0078"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: mmc:Mmcs_0088
FT                   protein of unknown function Mtu_121"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95891"
FT                   /db_xref="GOA:A3PSL4"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PSL4"
FT                   /protein_id="ABN95891.1"
FT                   /translation="MSSLRTADDTWDIATSVGSTAVMVAASRAAETERDEALIRDPYAR
FT                   LLVTGAGTGIWESVLDAKFVETVAAADAEAAAIFEHMNSYQAVRTHFFDAFFTAAAEAG
FT                   IRQIVILASGLDSRAYRLDWPSGTTVYEIDQPKVLEYKSATLAEHGVEPVATRREVGID
FT                   LRHDWPAALRGAGFDPSRPTAWLAEGLLMYLPADAQDRLFEQITELSAPGSRVAAETAG
FT                   VQAEDRRQQMRERFERIAEKFDMTASLDIQQLIYEDPDRADVADWLDAHGWTATAVSSQ
FT                   QEMRRLDRWALPADLTDDDAFSNFVTAEKLS"
FT   gene            87083..87874
FT                   /locus_tag="Mjls_0079"
FT   CDS_pept        87083..87874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0079"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: mmc:Mmcs_0089
FT                   protein of unknown function Mtu_121"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95892"
FT                   /db_xref="GOA:A3PSL5"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PSL5"
FT                   /protein_id="ABN95892.1"
FT                   /translation="MRRQEAGTSSLATRVGPEVLTTAAVASVTGCDDPLAAVLLGRPKV
FT                   IEVLQRSAELIDRVPALAAAHHQIADYHAMRSRFFDAYLADAAAEGIRQCVVLAAGLDT
FT                   RAFRLPWPDGMTVFEIDQPTVLRYKENALTAHGARPAAAWHPVGVESDMPWPRRLWESG
FT                   FNHNEPTIWLAEGLLPLPDATQDALISEIDGLSAAGSRIAFDDVLGMCSGRSDAPGWLT
FT                   SRGWWTDVVEARHLPGLSGRRDDDAQSYTAHAALVTAEKIA"
FT   gene            87946..89358
FT                   /locus_tag="Mjls_0080"
FT   CDS_pept        87946..89358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0080"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0090
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95893"
FT                   /protein_id="ABN95893.1"
FT                   /translation="MTTDSAAQATQAAQANTDIPATVARLRRTFATGRTRDIEWRKRQL
FT                   RALERLMVENETEIAAALEQDLGRKPFEAWLADIASVAGEAKDAAKNVRKWTRRRYRML
FT                   ELSQLPGLGWVEYEPFGTVLIIGAWNFPFALTLGPAVGAIAAGNTVVLKPSEVAPACSA
FT                   LMAELVPRYLDNEAIVVVEGDGSVSQELIAQGFDYLLYTGGTEIGRKVYEGAAPHLTPV
FT                   TLELGGKSPVIVTADADIDVAAKRIAWTKLINSGQICIAPDYVLADAKIRDQLVDKIKA
FT                   AVQTFESENPDGKRIVNERHFDRLTTALAATKGDVVIGGGSDASKISIQPTVVVDPDPA
FT                   EPLMTDEIFGPILPIVTVQSLDQAIDFVNARPKPLAAYLFTKTKAIRERVVKDVSSGGM
FT                   VVNHLLFHFATHKLPFGGVGPSGMGAYHGRFGFETFSHHKTVMTKPTRPDVGAFIYPPY
FT                   TEKAWKLARRLF"
FT   gene            89433..90299
FT                   /locus_tag="Mjls_0081"
FT   CDS_pept        89433..90299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0081"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0091 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95894"
FT                   /protein_id="ABN95894.1"
FT                   /translation="MPGVQDRVIVVTGAGGGLGREYALTLAREGAAVVVNDLGGARDGT
FT                   GAGSAMADQVVDEIKAAGGRAAANYDSVAEPEGAENIIKTAIDEFGKIDGVVSNAGILR
FT                   DGTFHKMTFENWDAVLKVHLYGGYNVIRAAWPHFREQSFGRVVVATSTSGLFGNFGQAN
FT                   YGAAKLGLVGLINTLAQEGAKYNIKTNAVAPIAATRMTQDILPPEVFEKLTPEYVAPVV
FT                   AHLMTEELTDTDSIFIVGGGKVQRTALFQNEGVTFSDGVPTLDDVASRWGEITDLSAAQ
FT                   QASFKLG"
FT   gene            90308..91273
FT                   /locus_tag="Mjls_0082"
FT   CDS_pept        90308..91273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0082"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_0092 alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95895"
FT                   /protein_id="ABN95895.1"
FT                   /translation="MKALLAQELSGPSGLVYTDVDDPVSDEAVIIDVGAAGVCFPDLLL
FT                   LRGEYQLKLEPPFIPGMEVAGTVRSAPDSSGFVPGQRVSAFTLMGGFAERVAALPDSVI
FT                   PTPDGVDDASAAALLGNYYTMQFALARRGGLTPGETVLVLGSAGGVGTAAIQLAKAQGA
FT                   KVIAMVHRPGAEEFIRGLGADVVLPLTDGWRQAVLDATDGRGVDIVVDPIGGPAFDDAV
FT                   RVLAPEGRLLVIGFAAGGGIPTVKVNRLLLRNVSVVGVGWGEFVRRNPSAQAAVGAELA
FT                   ALVEAGLRPPPPVCYPLAEGPAALQALADGEIKGKLVLQP"
FT   gene            91270..91974
FT                   /locus_tag="Mjls_0083"
FT   CDS_pept        91270..91974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0083"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="TIGRFAM: haloacid dehalogenase, type II;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 2
FT                   (HAD-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: mmc:Mmcs_0093 haloacid dehalogenase, type
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95896"
FT                   /protein_id="ABN95896.1"
FT                   /translation="MTSVSALAFDVFGTVVDWRSSVIAQLEEFGRAHGVDADWAAFADA
FT                   WRAGYVPSMDRVRRGELPWTRLDDLHRMTLVDLLAAEHISVGDEAVDELTRAWHRLDPW
FT                   PDSVAGLTRLRRRYVITPLSNGNVSLLTNMAKRAGLPWDCVLSAELFRHYKPDPEAYLG
FT                   CADLLDVAPDELMLVAAHRSDLRAAREAGLRTAYVSRPLEYGPGRQVRMPAEGEFDVLA
FT                   SDFLDLADQLGA"
FT   gene            91997..92704
FT                   /locus_tag="Mjls_0084"
FT   CDS_pept        91997..92704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0084"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: mmc:Mmcs_0094
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95897"
FT                   /protein_id="ABN95897.1"
FT                   /translation="MDTALTMAQRLLADPPEHPDVSKGYLDLLTDGGDRNTGTIQAVWS
FT                   SRLGSLLYDNSQTVIRRVSAAWQLPLEWLNVPVGGVALDVGSGPGNVTAALGRVVGPGG
FT                   LALGVDISEPMLARAVRAEAGPNVGFIRADAQRLPLRDESVDAVVSVAMLQLIPDPSAA
FT                   MAEMVRVLRPGRRMAVMVPTAGQMARLINVLPNAGARVFDEDELGDALEGLGLVGVRTK
FT                   TMGTVQWARGRRP"
FT   gene            92701..93183
FT                   /locus_tag="Mjls_0085"
FT   CDS_pept        92701..93183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95898"
FT                   /protein_id="ABN95898.1"
FT                   /translation="MSAGGLLLVALAVAVGMVGIVVPLLPGTLLVFGAIAVWAVVEQNV
FT                   TAWVTLGVVTVILGAALLIKYLWPMRRMRAADVRTMSLVAGGVLGVIGFFVIPVLGLVI
FT                   GFVGGVYVAELGVRRDQRVAWASTVHAVKGVALSVGVELAGALLATVAWAVGVYLT"
FT   sig_peptide     92701..92802
FT                   /locus_tag="Mjls_0085"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.602 at
FT                   residue 34"
FT   gene            complement(93237..94073)
FT                   /locus_tag="Mjls_0086"
FT   CDS_pept        complement(93237..94073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95899"
FT                   /protein_id="ABN95899.1"
FT                   /translation="MSEPFIGSAALEAGALTRHALRTRFVAVHHDVYLPRDAEVTAVVR
FT                   AKAAWLRTRGHGVLAGFSASALHGARWIDPGRPATVIDANRRRTRALEVWADRLEDDEI
FT                   GEVDGIRVTTPVRTAVDLARRYPLNTAVAAIDALARATRISVDDVMAATFRPGRHGMSR
FT                   ARKAIELVDAGAESPKETWLRLVIIRAGFPRPETQVPVYNEYGVLIGVVDIGWQDRRLA
FT                   VEYEGKHHRMTRSAFDKDIRRLEEMIECGWSVVRITAADSEATVVRRLRVAWDRLA"
FT   gene            complement(94165..94965)
FT                   /locus_tag="Mjls_0087"
FT   CDS_pept        complement(94165..94965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0087"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: mmc:Mmcs_0097 protein tyrosine/serine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95900"
FT                   /protein_id="ABN95900.1"
FT                   /translation="MASAGDELSGAWNFRDVSSHTGVAPGVFFRASELSRLDDEGRAAL
FT                   SGYGVTDVADLRTLRELERHGPGRVPAGVDIHHLPFIETVASDAEAPHEHAFQRMMTDK
FT                   PEGESIAAAAARYMTEEYARIASAPLAQRAVRQVVTLLGSGRRVLAHCFAGKDRTGFTV
FT                   AVVLEAAGVDREAVMADYLHSNTAVPQLRESILVTVRERAAETPEVLEMAEARLTESVL
FT                   GVREEYLDAAFRTIAGEYGSLEGYLSAAGVSADELARLRSTLRG"
FT   gene            complement(94965..96266)
FT                   /locus_tag="Mjls_0088"
FT   CDS_pept        complement(94965..96266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0088"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mmc:Mmcs_0098 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95901"
FT                   /protein_id="ABN95901.1"
FT                   /translation="MERRALGHRQWPGGPSAWASSYRDGMDFAMSAKALDYHQRLTDFM
FT                   VEHVFPAEADYHRYREEAGPKDHTVPPVVEDLKKLAKERGLWNLFLPSESGLSNLEYAE
FT                   LAELSGWSMEIAPEVINCAAPDTGNMETLHLFANDEQRKQWLDPLLNGEIRSAFAMTEP
FT                   AVASSDARNIETTMLRDGSDYVINGRKWWITGAADPRCKLLIVMGRTNPDAASHQQQSM
FT                   ILVPADTPGVDIQRSLPVFGWQDQHGHCEIVFDNVRVPVENLLHEEGSGFAIAQARLGP
FT                   GRIHHCMRALGAAERALALMIDRVQKRVAFGKPLAEQGVVREAIAKSRNEIDMARLLCH
FT                   KAAWTIDQEGNKAAHVLVSQIKSVAPQVACDVIDRAIQVHGGAGVSDDFPLARLYAWHR
FT                   AMRLFDGPDEVHMRTIARAELGREKSPFAAAVCR"
FT   gene            complement(96324..97466)
FT                   /locus_tag="Mjls_0089"
FT   CDS_pept        complement(96324..97466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0089"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mmc:Mmcs_0099 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95902"
FT                   /protein_id="ABN95902.1"
FT                   /translation="MPVDRLLPSDEARELIALTRDIADKVLDPIVDEHEKTETYPEGVF
FT                   AQLGAAGLLSLPQPEEWGGGGQPYEVYLQVLEEIAARWAAVAVAVSVHSLSSHPLLAFG
FT                   TDEQKQRWLPGMLSGSQIGAYSLSEPQAGSDAAALRCAAVPSDGKYVITGEKSWITHGG
FT                   RADFYTLFARTGEGSRGISCFLIPGGQPGLSFGKPEEKMGLHAVPTTTAHYDEARVDAD
FT                   RRIGAEGQGLQIAFSALDSGRLGIAAVAVGLAQAALDEATRYANERTTFGRKIIDHQGL
FT                   GFLLADMAAAVVSARATYLDAARRRDLGLPYSTQASVAKLIATDAAMKVTTDAVQVLGG
FT                   VGYTRDFRVERYMREAKITQIFEGTNQIQRLVISRSLTAR"
FT   gene            complement(97472..98911)
FT                   /locus_tag="Mjls_0090"
FT   CDS_pept        complement(97472..98911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0090"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /note="PFAM: NAD(P) transhydrogenase, beta subunit; KEGG:
FT                   mmc:Mmcs_0100 NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95903"
FT                   /protein_id="ABN95903.1"
FT                   /translation="MLSLETTATAAYVVAAILFILALAGLSKHETSRAGNTFGIAGMAV
FT                   ALIATIALALDHDIEPLGLGLLIGAMVIGAVIGLWRAKVVEMTGMPELIALLHSFVGLA
FT                   AVLVGWNGYLHVEGQPDGAEAAAIAAEGMLGIHSAEVVIGVFIGAVTFTGSIVANLKLS
FT                   ARIKSAPMMLPGKNALNVGALVAFAALTVWFVIDPQLWLLVVVTVLALLLGWHLVASIG
FT                   GGDMPVVVSMLNSYSGWAAAASGFLLANDLLIVTGALVGSSGAYLSYIMCKAMNRSFIS
FT                   VIAGGFGIEAGPAEDKDYGEHREINAEGAAELLSSASSVIITPGYGMAVAQAQYGVADL
FT                   TRKLRERGVNVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDVVLVI
FT                   GANDTVNPAASEDPGSPIAGMPVLTVWNANHVIVFKRSMASGYAGVQNPLFFRDNTQML
FT                   FGDAKDRVDAINAALTVPEKV"
FT   gene            complement(98915..100438)
FT                   /locus_tag="Mjls_0091"
FT   CDS_pept        complement(98915..100438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0091"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="TIGRFAM: NAD(P) transhydrogenase, alpha subunit;
FT                   PFAM: alanine dehydrogenase/PNT domain protein; KEGG:
FT                   mmc:Mmcs_0101 NAD(P) transhydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95904"
FT                   /protein_id="ABN95904.1"
FT                   /translation="MLIAIPRESQPGETRVAATPQTVGQITKLGYSVVVESGAGVASSF
FT                   PDAAYVEAGAEIGDPWSADVVLKVNAPTDAEIAALRDGATLVGLISPALNPELVEKMST
FT                   RRITVLAMDAVPRISRAQSLDVLSSMANIAGYRAVVEAAHTFGRFFTGQVTAAGKVPPA
FT                   KVLVVGAGVAGLAAIGAAGSLGAIVRATDPRPEVADQVASLGGEYLAVDPAAAEVSATG
FT                   YAKEMGEDYKVREAALYAEQCKDVDIIITTALIPGRPAPRIITADMVASMKSGSVIVDM
FT                   AAANGGNVEGTVKDQAIVTDNGVTIIGYTDLAGRLPATASQLYATNLVNLLKLLTPNKD
FT                   GQLTLDFDDVVQRSVTVIRDGEVTWPPPPVQVSAAPAAKAAAPVEHKPAKQPMSMGRRL
FT                   GITFAAAAALFVLIALSPAALQVHLTVFALAIVIGYYVIGNVHHALHTPLMSVTNAISG
FT                   IIVVGALLQIGHGDPVVTAIATVAILLASINVFGGFSVTRRMLAMFSRS"
FT   gene            complement(100492..101178)
FT                   /locus_tag="Mjls_0092"
FT   CDS_pept        complement(100492..101178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0092"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmc:Mmcs_0102 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95905"
FT                   /protein_id="ABN95905.1"
FT                   /translation="MHHGPERIVLITGASGGIGAEVARHLAGPDTHVVVHYREHSGAAD
FT                   AVAGAIRDAGGRASTLGADISDEAEAATLMDSVAASFGRLDALVLNTASRAELGADPRY
FT                   AMRLNRDAQRRLAQLAVPLMPAGARIVFVTSHQAHFFPNKAVPKGYVAVAASKRAGETA
FT                   LYGMRSVLAHAGIHLTVVSGDRIDGPTLRPLPTADEFAEAIVGATRTPFPPSIVYVGKT
FT                   DYLMTA"
FT   gene            101316..102923
FT                   /locus_tag="Mjls_0093"
FT   CDS_pept        101316..102923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0093"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: mmc:Mmcs_0103 Na+/H+ antiporter; TC
FT                   2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95906"
FT                   /protein_id="ABN95906.1"
FT                   /translation="MDTSDPTSDRWKDHPALAALTLCLALLAATVVLAPAAQRLSVPYP
FT                   AVMLAFGLALAFIPGVPVLSPNPELILPLVLPPLLFAAARRTSWREFLDNRRPIALLAV
FT                   ALVGVTAVAVGATLHALVPTVPLIAAITLGAAVAPPDAVAATAVAQKLGIPRRLRTILE
FT                   GEGLSNDATSLVLYEVAVAGTMTGAFSAWGAGEALGLAVVLGVLVGLAIAVATRWLINK
FT                   LPAHPAGSGLVLVVPFAAYAAADAVHGSGVLAVVTVALAMSRYGDTQSSQTRLATGTTW
FT                   EIVELLLTGSAFAFVGLQMRAVADSIDMTFWELLQQGLIITLVVIVVRFLWIFPVATID
FT                   ERMHRRKAHVAEPIGWREMTVSSWAGMRGVVTLAAVLALPPQFPERERLVFYAFVVIVV
FT                   TLLLQGLTLPTVVRRLGVRASPHEEDDAVQALIRRARDAGFERLDEIRAREEADPEVIE
FT                   HARDNAERMWQSVGFAPPDAESHHAHTDHAMTLNALKDEILAAAREAVVKARSESGTDP
FT                   TVVDRVLRRLDTRGSQPE"
FT   sig_peptide     101316..101426
FT                   /locus_tag="Mjls_0093"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.761) with cleavage site probability 0.444 at
FT                   residue 37"
FT   gene            103058..103918
FT                   /locus_tag="Mjls_0094"
FT   CDS_pept        103058..103918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0094"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mmc:Mmcs_0104
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95907"
FT                   /protein_id="ABN95907.1"
FT                   /translation="MSVFVDLTPDESQLDSPVAPPRGKWAGRLTRAALPLISVAVFTGL
FT                   WQLAAASGIWNQTFVPYPGTVVRAFIEVSTTHDGTRGYAGYLLVEHLYMTLRRVLAGVV
FT                   IGVALGVLLGLVMGSVSWVRSVLEPWLTFLRALPPLAYFFLLVIWLGIDEAPKITLLAL
FT                   AALPPAAVATTAAVLAAPVGLTEAARALGASRGEVIRDVVVPSALPETFTGIRLAVGMA
FT                   YSSVVAAELFNGLPGVGGLVKDASNYNNTPVVLVGIFAIGISGLIIDGLLRTIERRSTP
FT                   WIGKV"
FT   gene            103925..104950
FT                   /locus_tag="Mjls_0095"
FT   CDS_pept        103925..104950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0095"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; SMART: extracellular
FT                   solute-binding protein, family 3; KEGG: mmc:Mmcs_0105
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95908"
FT                   /protein_id="ABN95908.1"
FT                   /translation="MRLKALAAVAVTMLAVAGCSVDTSGQDAGKQTIRIAYQSFPSGDL
FT                   IVKNNRWLEDALPDYNIKWTKFDSGADVNTAFIAKEVDFGALGSSPVARGLSAPLNIPY
FT                   KVAFVLDVAGDNEALVARNGSGVNTIADLRGKRVGTPFASTAHYSLLAALDQNGLSPND
FT                   VQLVDLQPQAILAAFDRGDIDAGYSWLPTLDQLRRNGKDLITSRQLARDGKPTLDLAVV
FT                   ADEFAEAHPDVVDIWRQQEARALTVIKDDPDAAAKAIAAEIGLTPEEVAGQLTQGVYLT
FT                   PAEVASPEWLGSEGAPGNIAVNLESASQFLAEQKQIPAAAPLKTFQDAIYTKGLPGAIT
FT                   Q"
FT   sig_peptide     103925..104002
FT                   /locus_tag="Mjls_0095"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.883 at
FT                   residue 26"
FT   gene            104934..105713
FT                   /locus_tag="Mjls_0096"
FT   CDS_pept        104934..105713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0096"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmc:Mmcs_0106 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95909"
FT                   /protein_id="ABN95909.1"
FT                   /translation="MPSPSDGAIRLRGVSHRYGRGGQEVTAVGPVDLTVEPGAFLVLVG
FT                   ASGCGKSTLLRLLAGFEAPTEGTIAVAGAPPTPGVTAGVVFQQPRLFPWRTVGGNVDLA
FT                   LKYARVPRERRAERREQLLARVGLEGTADRRIWEISGGQQQRVAIARALAAETPLFLLD
FT                   EPFAALDALTRERLQEDVRQVSAESGRTTVFVTHSADEAAFLGSRIVVLTRRPGQVALD
FT                   LPVDLPRTNVDPDELRRSPEYTELRAEVGRAVKAAAA"
FT   gene            complement(105821..105949)
FT                   /locus_tag="Mjls_0097"
FT   CDS_pept        complement(105821..105949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0097"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95910"
FT                   /protein_id="ABN95910.1"
FT                   /translation="MDPNPDYDASDEIEYFFNYFFWGLRGVSGPGGGYPPPAYPPV"
FT   gene            106098..106757
FT                   /locus_tag="Mjls_0098"
FT   CDS_pept        106098..106757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0098"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0108
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95911"
FT                   /protein_id="ABN95911.1"
FT                   /translation="MSAEASPNGSTRRDELLRVATKLFAARGYHGTRMDDVADAVGLNK
FT                   ATVYHYYASKSLILYDIYKGAADFTVDALHDDPTASARETIYHFTRRLLVGIANDIERA
FT                   AVYFQEGPYIGEWFTEEQVEYIREKETQVYEHVRDVIDRGIASGEFYDCDSHVLALGYI
FT                   GMTLGAYRWLRPQGRRTAQEIAEEFSTALLRGLIRDEAVRTESPLGVDVRTGVGSD"
FT   gene            106750..107523
FT                   /locus_tag="Mjls_0099"
FT   CDS_pept        106750..107523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0099"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   rha:RHA1_ro01497 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95912"
FT                   /protein_id="ABN95912.1"
FT                   /translation="MTDLFSLDGKVAVVTGGGRGIGVMIARGLLQAGASVYLSSRKEAE
FT                   LAAAVDELSPLGRVEAVPADLGTAEGVQTLSDALAAREDRVHALFNNAGANWGAPFAEF
FT                   PESGFDRVFDVNVKGVFLLTRALVPLLEAAATEQDPARVVNTGSVDGFHTPEKGRNNFS
FT                   YSASKAAVHMLTKHLATELAPKILVNAIAPGLFPSRMTKVLLAAGEEAVGAALPLGRVG
FT                   APDNMAGIAVFLASHASAYITGAIIPVDGGVSTIR"
FT   gene            107520..109286
FT                   /locus_tag="Mjls_0100"
FT   CDS_pept        107520..109286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0100"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0110 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95913"
FT                   /protein_id="ABN95913.1"
FT                   /translation="MKSTLLSRRDLDFLLFEWLRVDELTQRPRFADHSHDTFTGVLDLC
FT                   EQLAERYFAPHNKKSDAHEPTFDGEKVTVIPEVKEAWEAFAAADLLAMGMDAELGGAQL
FT                   PATVAQAAFAWISAANLATSGYLMLTIANANLLAEFGTAEQIDRFVRPMLAGRFSGTMA
FT                   LSETQAGSSLADITTRAEPRDDGTYRLFGSKMWISGAEHEITENIVNLVLAKIPGGPPG
FT                   TKGISLFVVPKYLVAEDGSVGERNDVVLAGLNHKMGQRGITNTVLNFGEGVFNPGGEPG
FT                   AVGYLVGEPHRGITYMFRMMNEARLGVGMGAVALGYTGYLKSVKYARERPQGRPVTAKD
FT                   PATPQVPIIEHADVKRMLLAQKSYVEGALALALYCARLVDLGDNQDLLDILTPVAKSWP
FT                   SQWCLEANSLAIQVHGGYGYTREYDVEQHYRDNRLNPIHEGTHGIQSVDLLGRKVTQRG
FT                   GASLRAVGGALAATVAAAGECGGEAASLAEELDARWQRLVAVTTAMFGSGDIEAAMANS
FT                   VVYLEAFGHVVIAWMWLEQFLAAEGRTGDFYDGKRQAARFFYRYELPKVGPQLDLLDSL
FT                   DRTTLEMRPTWF"
FT   gene            complement(109295..110407)
FT                   /locus_tag="Mjls_0101"
FT   CDS_pept        complement(109295..110407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0101"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_0111 alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95914"
FT                   /protein_id="ABN95914.1"
FT                   /translation="MTMTIRGAVLEEIGRPRPFTESAPLSVSELQLDPPGPDELLIRIE
FT                   AAGLCHSDLSVVDGNRVRPVPMLLGHEAAGIVEQIGPGGSDLEVGQRVVMTFLPRCGHC
FT                   TACATGGLTPCEPGTAANSAGTLMHGDIRLHRDGQPVHHHLGVSGFATYAVVDRHSVVA
FT                   VDADVPPVVASLLGCAVLTGGGAVLNVGKPQPGQTVVVVGLGGVGMAAMITAMAHDGVD
FT                   VVGIDQLEDKLDRARAMGINAAYTPEEAAERGLKAAVVIEAVGHPSALETAIAHTAPGG
FT                   RTITVGLPRPDARISVSPLGFVAEGRSLIGSYLGSAVPARDIPRFVELWRSGRLPVETL
FT                   VSSTISLDEINAGMDRLAEGKAVRQVIEFD"
FT   gene            110442..110885
FT                   /locus_tag="Mjls_0102"
FT   CDS_pept        110442..110885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0102"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mmc:Mmcs_0112 thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95915"
FT                   /protein_id="ABN95915.1"
FT                   /translation="MPPESADRPTSRDFPVHWPVSTRWTDNDMFGHLNNAVYYALFDTA
FT                   INGWINTTVDVDPVSAPWLGVVAESGCQYFAELRFPDPLTVGLSVARLGNSSVTYRLAL
FT                   FERDAVQVAAIGHWVHVYVDRSTRRPVPIPEAIRSLLETARVE"
FT   gene            110902..111348
FT                   /locus_tag="Mjls_0103"
FT   CDS_pept        110902..111348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0103"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: mmc:Mmcs_0113
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95916"
FT                   /protein_id="ABN95916.1"
FT                   /translation="MPLVSKTVEVEAPAEAIMAIVADFERFPEWNPEIKGCWILARYDD
FT                   GRPSQLRLDVEVQGQAGTFINAVYYPGENQIFTLLQQGDHFDKHEQRFSVVSIGASSLL
FT                   TVDMDVETKLPIPKPMVKKAIGETLDYLADNLKARAEHLGAGSA"
FT   gene            complement(111370..112125)
FT                   /locus_tag="Mjls_0104"
FT   CDS_pept        complement(111370..112125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0104"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   mmc:Mmcs_0114 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95917"
FT                   /protein_id="ABN95917.1"
FT                   /translation="MAKALRGQPRPITPKNRRAPVNAAPVARRPARRRATRREQLSDEV
FT                   AGHLRAAIMTGALRPGTFIRLDETAAELGVSITPVREALRTLRGEGMVRLEPHRGHVVV
FT                   PMTRGDIEDIFWLQATIAEKLAEAATERISETQIEELEQLNSALAEAVEHQDPEEVAFA
FT                   EFAFHRAFNHASGRIKLAWFLLHVARYLPPLLYATDPSWGTDAVASHRELIAALRRRDA
FT                   ETVVRLTTGQFTDGAQRLIVRLEKIGLWD"
FT   gene            112201..113871
FT                   /locus_tag="Mjls_0105"
FT   CDS_pept        112201..113871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0105"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0115 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95918"
FT                   /protein_id="ABN95918.1"
FT                   /translation="MTSEPDASEPSHTEQPYLARRQNWTNQLARHALMQPGDTALRFMG
FT                   RTTTWGELDDRVTKLAGALSRRGVGFGDRVLILMLNRTEFIESFLAVNKLGAIAVPVNF
FT                   RMTPPEIAFLVSDCAARVVVTEAVLAPVATAVRDLDPTLETVIVAGGATDDGILGYDDL
FT                   IAEPGEAPAPVDIPNDAPALIMYTSGTTGRPKGAVLTHVNIAGQAMTFLFTNGVDLNHD
FT                   VGFIGVPLFHIAGIGNTIVGLLLGRPTVLYPLGAFDPGALLDVLAEEKVTGIFLVPAQW
FT                   QAVCAAQRAKPRDLKLRVLSWGAAPASDTLLRDMAETFPGAQILAAFGQTEMSPVTCML
FT                   LGEDALRKLGSVGKVIPTVAARIVDEDMNDVPIGQVGEIVYRAPTLMAGYWNNPKATAE
FT                   AFEGGWFHSGDLVRQDEEGYIWVVDRKKDMIISGGENIYCAEVENVLAAHPAIAEVAVI
FT                   GRAHEKWGEVPVAVAAVRGAEDAAKPPALSLADLDEFLTERLARYKHPKALEIVDALPR
FT                   NPAGKVLKTELRQRYAGPKPIDAGESSTAPTGSAAGPGS"
FT   gene            114084..114881
FT                   /locus_tag="Mjls_0106"
FT   CDS_pept        114084..114881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0106"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_0116 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95919"
FT                   /protein_id="ABN95919.1"
FT                   /translation="MTASSGGLTGYVRDQVRPGLEAVGGFVRMCVLTGKALFRPFQWRE
FT                   FILQAWFLFRVSFLPTVAVSVPLTVLIIFTLNILLAEFGAADVSGAGAALGAVTQLGPL
FT                   VTVLVVAGAGSTAICADLGARTIREEIDALEVLGIDPIHRLVVPRVVASTFVALLLNGA
FT                   VITIGLVGGFIFGVYIQNVSAGAYVSTLTLVTGLPEVLISVVKATTFGLIAGLVGCYRG
FT                   LTVGGGAKGVGTGVNETLVLCVVALFAVNVVLTTIGVRFGTGR"
FT   gene            114883..115776
FT                   /locus_tag="Mjls_0107"
FT   CDS_pept        114883..115776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0107"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_0117 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95920"
FT                   /protein_id="ABN95920.1"
FT                   /translation="MATTSESNAKTGTVLRQRFPRGYARAEKLVAAPSRGLDSVGHVAW
FT                   FVVTAVGSIGHALRYYRKEVLRLIAEIGMGTGAMAVIGGTVAIVGFVTLSGGSLIAIQG
FT                   FASLGNIGVEAFTGFFAALVNVRIAAPVVSGQALAATVGAGATAELGAMRISEEIDALE
FT                   VMGIKSISYLVSTRIMAGFIVIIPLYAMAIIMSFLSAQVTTTLFYGQSTGTYEHYFRTF
FT                   LRPDDVAWSFVQAIIISIIVMLNHCYYGYYASGGPVGVGEAVGRSMRASLIAIVLVVLL
FT                   ASLALYGTDPNFNLTV"
FT   gene            115779..116999
FT                   /locus_tag="Mjls_0108"
FT   CDS_pept        115779..116999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0108"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0118 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95921"
FT                   /protein_id="ABN95921.1"
FT                   /translation="MAEPNSPVNKPRTPPYKIAGLVLLVIFAVVATLVAFQFRGDFASR
FT                   EKLTMMAARAGLNLDPGTKVTYNGVEIGRVAEVNAVSVGNDPRARITLEVDTKYMQLIP
FT                   ANVLADISATTVFGNKYVSFTTPPDPVPQRIKSTDVIDVTSVTTEFNTLFETVVSVAEK
FT                   VDPVKLNQTLTATAQALDGLGDRFGESIVNGNAILADLNPQMPQIRRDVRGLADLGEVY
FT                   ANAAPDLFDGLENAVTTARTLNEQRGNLDQALIAAVGFGNTGGEVFERGGPYLVRGAED
FT                   LIPTSALLDEYSPALFCTIRNFHDVEPKISSSLGGNGYSLNTHSEALGAGNPYVYPDNL
FT                   PRVNAKGGPEGRPGCWQPITRDLWPAPYLVLDTGASLAPYNHLELGQPIAIEYVWGRQI
FT                   GENTINP"
FT   gene            116996..118027
FT                   /locus_tag="Mjls_0109"
FT   CDS_pept        116996..118027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0109"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0119 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95922"
FT                   /protein_id="ABN95922.1"
FT                   /translation="MKITGTALKLGAFSLVLLLFTAIIIVVFGQMRFDRTTGYSAIFTN
FT                   VSGLRPGQFVRASGVEVGKVSKIELIEGGSRVKVDFKVDRSLPLFDESTASVRYLNLIG
FT                   DRYLELKRGDSDRKMPSGGTIPVERTEPALDLDALIGGFRPLFRALDPEKVNNIARSII
FT                   TVFQGQGGTINDILDQTASLTSALADRDQAIGEVIRNLNTVLDTTVRHQEQFDETLVNF
FT                   ERLITGLKNRADPIASSVADISDAAGTVADLLAENRSLLQDTVGYLEATQQPLVEQKGQ
FT                   LNDILVRLPNALKIIGRAGGVYGDFFNFYACDVTLKLNGLQPGGPVRTVKVWGQPTGRC
FT                   TPQ"
FT   sig_peptide     116996..117085
FT                   /locus_tag="Mjls_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.927 at
FT                   residue 30"
FT   gene            118024..119610
FT                   /locus_tag="Mjls_0110"
FT   CDS_pept        118024..119610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0110"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0120 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95923"
FT                   /protein_id="ABN95923.1"
FT                   /translation="MRTLEGSNRLRGGLMGIIILVLVVGVGQSFASVPMLFAKPRYFAQ
FT                   FGDTGGINPGDKVRIAGVDVGEVLKTEIEGDKVVVGFTLGGTQIGSDSRAAIRTDTILG
FT                   RKNIEIEPRGSTALEANGILPLGQTTTPYQIYDAFFDLTKSASGWDTTSVRESLNVLSE
FT                   TIDQTYPHLSAALDGVARFSDTIGKRDEQLKQLLANANKIAGVLGERSGQVNALLVNAQ
FT                   TLLAAINERSYAVGQLLERVSAFSEQVEGFIDDNPNLNRVLEQLRVISDILVERKFDLV
FT                   DVLTTLSKFTASLAEAFASGPYFKVMLVNLAPYWILQPYVDAAFKKRGIDPQKFWRDAG
FT                   LPAYQFPDPNGVRQPNGAPPPALATLQGTPEYPNPAVPRGDPCSYTPPADGLPTPGNPL
FT                   PCADLSVGPFGDNPYGPNYHGRPNVATSEPNPNGMLPTPGVASSGVPGQQAPVVPGTPV
FT                   PLPPAPPGARNEPPGPFPGPTAVGGQVNNVPPPPALPGPPPPPGPGQQLSPAQTGPLPG
FT                   NPPFLPPGSQQ"
FT   sig_peptide     118024..118119
FT                   /locus_tag="Mjls_0110"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.672 at
FT                   residue 32"
FT   gene            119625..121271
FT                   /locus_tag="Mjls_0111"
FT   CDS_pept        119625..121271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0111"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0121 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95924"
FT                   /protein_id="ABN95924.1"
FT                   /translation="MSTIFNVRNMKMPTLSRASVIIGTLVVVLALVAAFAGWQLYKRLS
FT                   TNTVVAYFSDTLALYPGDKVQIMGVRVGTIDKIEPAGDKMKVTFSYESKYKVPANATAS
FT                   ILNPSLVASRTIQLAPPYTGGPVMEDDAVIPIDRTQVPVEYDELRDSLDRILTDLGPTP
FT                   DQPKGPFGDVIESFADGLSGKGKQINTTLNSLSEALTTLNEGRGDFFSVVKSLALFVNA
FT                   LYRSDQQFVALNDDLAQFTNSFTNTDRELATALQDLNELLTTTRGFLDENSEVLTKDIN
FT                   NLADVTNAILQPEPLDGLETGLHVLPNLGGNILNISSPVNGGIVGVPVINGMANPMQFI
FT                   CSSIQAGSRLGYQESAELCAQYLAPILDALKFNFPPFGLNQISTAMTLPKMIAYSEDRL
FT                   RPPPGYKDTTVPGIFSRDTLFSHGNHEPGWVVAPGMQGVDVQPFTANMLTPQSLAALLG
FT                   GPDAPIPGAPPAFGTTRDGNLPGPPNAFDERNPLPPPWYPQPGPPPAPAPGVIPGDPGG
FT                   SPLSGPAPGPAPAAQAPAPAGPPLPAEAGAP"
FT   sig_peptide     119625..119729
FT                   /locus_tag="Mjls_0111"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.744 at
FT                   residue 35"
FT   gene            121271..122419
FT                   /locus_tag="Mjls_0112"
FT   CDS_pept        121271..122419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0112"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0122 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95925"
FT                   /protein_id="ABN95925.1"
FT                   /translation="MKHRIRRLATRTVALAVAAVVLTSCGSWKGIANVPLPGGPGTGGD
FT                   AMTVYVQMPDTLALNVNSRVRVADVFVGTVRAIELKNWVATLKLGIQPGVELPSNALAK
FT                   IGQTSLLGSQHVELEAPPDPSSEPLRDGDTIPLKNASAFPTTERVLASIATILRGGGIP
FT                   NLEVIQTEVNNLLTGRAEQIREFLGRLDVFTDELNQQREDLTRAIDSTNRLLNIVASRN
FT                   DTLDRVLTEFPPLIEHFAETRDLFADAVIAVGRISRAADTYLGQAQDPLHTNLQNLQRP
FT                   LKQLARSSPYLIGALKLMLTAPFSIENIPKVVRGDYINVSLNVDLTLSALDNAFLSGTG
FT                   VSGMARALEQSWGRDPATMIPDVRFTPNAHSAPNGPLVERGE"
FT   sig_peptide     121271..121411
FT                   /locus_tag="Mjls_0112"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.337 at
FT                   residue 47"
FT   gene            122423..123982
FT                   /locus_tag="Mjls_0113"
FT   CDS_pept        122423..123982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0113"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0123 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95926"
FT                   /protein_id="ABN95926.1"
FT                   /translation="MLTRFIKIQLIIFTVLTVIALAVLGWYYLRVPSLVGIGQYTLHAE
FT                   LPRSGGLYSTANVTYRGTTIGKVTAVEPTERGAKATMSIDNRYRIPVDASANVHSVSAI
FT                   GEQYLDLVSTGNPGQYFSDGQTITKSTVPSEVGPALDAANEGLAVLPREKIDALLTETA
FT                   DAVGGLGPSLQRLVDSTTLIAQDFKDNLGPVNDIIANSAPILESQVNSGDNIAQWSRNL
FT                   NILAAQSAEQDAALRSGLQQAAPTADQLNAVFSGVRDSLPQTLANLAVVIDMLKRYNKG
FT                   LEQALVVLPQGASVAQAGTIFEGEGLLHFGLSINQPPPCLTGFLPASEWRAPADTSMKE
FT                   LPSGTYCKIPKDFQANVVRGARNYPCADVPGKRAATPKECRSDEPYVPLGTNPWYGDPN
FT                   QIRDCPAAGARCNQPVHPGRNGVIPAPSINNGMNPLPADQLPQPPSPVSDPLSPPGQGR
FT                   VECSGQQPNPCIYTPAPGPPGTAVYNPASGEVVGPDGVKYNVSNSSNPGDDGWKEMLAP
FT                   AS"
FT   gene            123952..124623
FT                   /locus_tag="Mjls_0114"
FT   CDS_pept        123952..124623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0114"
FT                   /product="putative conserved MCE associated membrane
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0124 putative conserved MCE
FT                   associated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95927"
FT                   /protein_id="ABN95927.1"
FT                   /translation="MEGDAGTRQLNPTDAEETPDKSVAVSGDNPDDTESPAEDGILGER
FT                   VTTVPSEDDGRRPPRLGRGWLTAICAVLLLLGAGAGVGGYLALRSHEESTQLAENEAAA
FT                   VAAARDCVAATHAPDAAAMTESQAKILECSTGDFGVQAGLYGGLLVDAYRAANVQVQVS
FT                   DMRAAVEKHNADGSIDVLVAVRVKVTNSEAADQEQGYRLRVQMAPDEGTYKVARLDQVT
FT                   S"
FT   gene            124620..125591
FT                   /locus_tag="Mjls_0115"
FT   CDS_pept        124620..125591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0115"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   mmc:Mmcs_0125 RDD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95928"
FT                   /protein_id="ABN95928.1"
FT                   /translation="MTAVVDAPPDAPAAETTPAEPLARWHVRAAALAVDVLPGLAVVAT
FT                   TAPWVLAGPGIGWSWWVLTAVAAVALLAVIVNRVLLPSLIGWTLGRALCGIRVLRRDGG
FT                   EAALGRLLLRELAHVLDTVALFVGWLWPLWDRRNRTFADLLLRTEARVVARPDRDMRRF
FT                   TAKVLIGAVVVAVAAVGVTYLAVYRKEQGLDRARAQIAEQGPRIVEQMLSYGAETMDED
FT                   LNRAQTLTTEAYRPQLVAQQEAARKGGATTNEYWAVSSAVLSSSMDEAAMLLAMQGQRG
FT                   TKAEDLKFITATVRVDFDKIGDNWRVDNLTVLKAPLMQGAGQ"
FT   gene            125588..126139
FT                   /locus_tag="Mjls_0116"
FT   CDS_pept        125588..126139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95929"
FT                   /protein_id="ABN95929.1"
FT                   /translation="MSPRRRVDGDEPDFFAASPRRPRRWGLPLIATVAALLLAAALTVS
FT                   TLMLVSHETDRRAEVRDAAALDYVRSFMTSYTTLDPFNANAYADRILAQGTGEFAKMFK
FT                   EKMNEIVIQVARAEPTEGNVVEAGVQRWNDNGSVDVLVATTTTSKTPDGKKTIESGNRW
FT                   VATTTQEGQRWKISQLIQVI"
FT   gene            126106..127053
FT                   /locus_tag="Mjls_0117"
FT   CDS_pept        126106..127053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95930"
FT                   /protein_id="ABN95930.1"
FT                   /translation="MEDQPADSGDLTTDPAGTGSPEPKRGRRLPWRRAKKAAAEPDSPG
FT                   VADEEPATPEEPATPDEQAPRMPTGKARRSPKPVSTTDTEPEPEPEVAVEKESDAEPEG
FT                   EAQAAEPEVEAETADGAGESDAAGESEGEPEPEPVLVPHRPAGRRLLIAAAAASVVFVG
FT                   AGAFAGAMLQPYLADRAEVDTKLNIARTATEAITTLWSYTPEDMATLPDRSSRFLTGDF
FT                   ATEYRRYIDAIVSTNEQAKVTNTTQVMGTAVESLTPTEATALVYTNSVSTSPVSKNVPS
FT                   LRYLSYRLTMERDGADWLITGMNAVTKLDLTPQL"
FT   gene            127070..127744
FT                   /locus_tag="Mjls_0118"
FT   CDS_pept        127070..127744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0118"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   mmc:Mmcs_0128 protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95931"
FT                   /protein_id="ABN95931.1"
FT                   /translation="MAVRSPVSNRLTVTALLLLTFATGLIDAVSVLVLGHVFVANMTGN
FT                   VIFLGFWFVPHSGVDLTAALVAFVSFLIGAVIGGRLARHLGSRPRHWLSVALGVEVVAL
FT                   MVLAVLAGTGVLDYRDNTKLVLIACLAMVFAIQNATARQFGVQELSTTVLTQTIVGIGF
FT                   DSRLAGGSGEREKLRNGVVLTMCAGAVVGATLTLVTVAPVIALAGAVVATAAALFRFGP
FT                   PA"
FT   sig_peptide     127070..127156
FT                   /locus_tag="Mjls_0118"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.938) with cleavage site probability 0.906 at
FT                   residue 29"
FT   gene            127741..128511
FT                   /locus_tag="Mjls_0119"
FT   CDS_pept        127741..128511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0119"
FT                   /product="fructosamine kinase"
FT                   /note="PFAM: fructosamine kinase; KEGG: mmc:Mmcs_0129
FT                   fructosamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95932"
FT                   /protein_id="ABN95932.1"
FT                   /translation="MTEFVKRNPDAPPGFFACEAAGLRWLAAAGGAACVPVIDCDATSL
FT                   TLEHLDSAAPSRSAAAAFGARLAVTHDAGASGFGAGPDGWGGPGFFGPLQKPLPMSLTA
FT                   HPTWGEFYADERLGPMGEHAAPRLTAAGREALAAVRDLCRAGRFDDGDPPARLHGDLWS
FT                   GNLMWTPDGVVLIDPAAHGGHRETDLAMLALFGCPHFDEVIAGYQSVRPLRGGWRERIA
FT                   LHQLYPLLAHVVLFGGGYIRQTESALRSVLSDFA"
FT   gene            128884..131172
FT                   /locus_tag="Mjls_0120"
FT   CDS_pept        128884..131172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0120"
FT                   /product="AAA ATPase containing von Willebrand factor type
FT                   A (vWA) domain-like protein"
FT                   /note="KEGG: mmc:Mmcs_0130 AAA ATPase containing von
FT                   Willebrand factor type A (vWA) domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95933"
FT                   /protein_id="ABN95933.1"
FT                   /translation="MAKHRGAKRRSKKIAALGAVTVTATALTVGAAPAPQASAAAARST
FT                   DRVDLTADFRLFPPPQAIPDLTGGAGEAAYDLKNEFADFVFRSIFENLNLAAFAQAAGV
FT                   DPQSILERVLDNLPLALLTDPIFVDLLGGITLPLAAALGALPVLNQIPLLRDLLTQGLN
FT                   VAGLNTISGLLDILGLDLSNLADLTGLGERVGVNLVTSGDVFTLLKVLGTDLGWVPTLP
FT                   NSVADDVNETEYLGIGVDGVLDLVDTGIINVPGLLNQLLDLLNLNTDQIPDVLKVRAPV
FT                   VIGEGVGAFAAGMAYQDILAQLPNQPGGANYNGVEADPLLGSVTVLPMLLLRNPGRANG
FT                   GLFARLYPLAGLFGIDTVTPDTEVSNSGGVRLPGGLYVGGATLIPVKIDVTLQHDWLSD
FT                   VPAWPNPFSLLNTLTAVVAPTYILRGLDTGLVAGAVAGQLGPQIGEVVGGIAEDDPLAL
FT                   DFYVTVPIDALPLLEPTYLFFDAINLLTGANLNNPIGTALGPALSSLVNLGYTDVVRQW
FT                   NDDGDYWEYVRTFDDTDVPTAFGSFPDINWMNVPGDIAGAFAAGVRQAFEDGLVNRDGP
FT                   VKNALATLLNLIGLDNGLPGGIGGAGLNGVLDQIRDTIDDVLGGLDLPRPSTAAVNSVP
FT                   DDASPRIALRTVGGEDTPAEEADDDTRDHVEDVPVADTDTDGDAETDTDIDTGTDTENE
FT                   PVDEPEDQLEEDETTDERETTVEDEDASEAEASEAEPADTEDTADTKDTGDTKDTGDTG
FT                   ESGAGEKAA"
FT   sig_peptide     128884..129003
FT                   /locus_tag="Mjls_0120"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.544 at
FT                   residue 40"
FT   gene            complement(131176..133356)
FT                   /locus_tag="Mjls_0121"
FT   CDS_pept        complement(131176..133356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0121"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: mmc:Mmcs_0131
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95934"
FT                   /protein_id="ABN95934.1"
FT                   /translation="MTDVTNPPISRVTSRRGVSAGGRSGAPSRTFRTDIEGLRAVAVLA
FT                   VVLYHAGMPGLGGGFIGVDVFFVVSGFLITGLLWRQVAAGGGVRLGAFYAARARRLLPA
FT                   AALVLVATAVGAVLLLPPLQARAVLGDAIAGALYVGNYRFAIQGTDYLAATEPSPLQHY
FT                   WSLGVEEQFYLVWPLLIVGTAWLIARRFGPGAARSVLPFAAVLSAAAAASYAVSLAWTG
FT                   DWPAWAFFSLPTRAWELAAGGLVALSVGWWRRLPPVAAAAVGWSGLVLIVAACTRVTAT
FT                   TPFPGTAALLPVAGTALVIVAGCATPNLGVGRLLSKPLPRAIGRVSYSWYLWHWPVLIL
FT                   APAMFGTDLGLASRLAMIVISLGLAILTLHLVENPARFAAALRGSAVRSLAVGGVATAA
FT                   AVCAAIVLLVIRPVPTGDGPAATPVALTAPAPRATAGPAPEVAPSAPTPRQQVQAAVAA
FT                   SAEMRSVPADLSPSLGNVTKPEVFVNGCVLSWRDVDQPECVSGDAESAVSVALVGDSHA
FT                   AMWQPALETVAEQNHWRLETMSKVTCPLMDLPITSPYLGRTFSECEQWRRDVLARLESE
FT                   RPQLIVVDMSRRYGADFGFVSYDPAWVEGLGRLVSRLRATGAAVLVLGPAPDPLSTVPS
FT                   CVSDHMDDVVACSPGRAAALNAGGIAAEANAAQAAGGSYADLGDLFCTSQRCPVIVGNT
FT                   LVYRDDNHITGEYAQWLAPVIGEITLGAFAPN"
FT   gene            complement(133407..134438)
FT                   /locus_tag="Mjls_0122"
FT   CDS_pept        complement(133407..134438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95935"
FT                   /protein_id="ABN95935.1"
FT                   /translation="MFALCAALGTMGEPHARASDPKSLLLGAIANTKGSYLVYNFGGEF
FT                   AAPFRAADGREYTLNNGGHLMTIKNASSRLNPRLLVDTHQGYQARCERDPRARTGEGLW
FT                   QASETFTPHQAWQALGQPTIAVNANFFDVRGQQGGSWRETGCSSPLGAYVDNTRGLGRA
FT                   NAPITGTIAYAGKQGLSGGDETWSALATMILPVGGAPYVVMPKGKQDFDAASPEIQKLM
FT                   DRNARFVAVAGLGLLAPGETGQLNDPGPSAARTAVAYSSASDQLYVFQGGNYTPDNMQD
FT                   LFRGLGAEHALLLDGGGSSAIVLRRDTGGMWSGAGSPRGSCDTRQVLCDSRERALPSWL
FT                   AFN"
FT   gene            134726..135016
FT                   /locus_tag="Mjls_0123"
FT   CDS_pept        134726..135016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95936"
FT                   /protein_id="ABN95936.1"
FT                   /translation="MIGTILGALVVGLIVGALARLIMPGKQNIGVIMTIVLGALGSFLG
FT                   SWLTYQLGYSNSNGGFEIIPFLVGIIVAIVLIAIYVGVTGKRGSRPGSTVR"
FT   gene            complement(135072..136355)
FT                   /locus_tag="Mjls_0124"
FT   CDS_pept        complement(135072..136355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0124"
FT                   /product="SMP-30/gluconolaconase/LRE-like region"
FT                   /note="KEGG: mmc:Mmcs_0134 SMP-30/gluconolaconase/LRE-like
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95937"
FT                   /protein_id="ABN95937.1"
FT                   /translation="MRICLPYKAFGVLAVAALAGCSTSAPDETAPSPSTSTSAPAPASA
FT                   DRTVTVEVPAGMDAAPFDEARRVSIPAGWTMAVWARVPKARFARWAPDGALLVSVPSTG
FT                   EILKLDGSGSTPLLEGLTQPHGMAFAGSTLYVAESDEISAYDYVDGRAGNRRTVAAGLP
FT                   DAESPDLRGAYAHALKSVAVGPDGAVYFSIGSTGNISAEDRDATPPRATIMRVPPGGGP
FT                   AEPFATGVRNGTGLAVAPDGSVWTAVNGRDNVADPATGEVDPAYVNDHPPEQLAKLTPG
FT                   RELGWPYCNIDGGPADVPFIRDVQTNADGDKLDCAALPPVEQSFGAHSAPLGLSFVDGE
FT                   LPEPYARGALVGIHGSWNRRPPRAPEVSFYPWRDGGLGDQQTLVGGFQDEDGSRWGRPV
FT                   DAVAGPDGAVYITDDDAGAVYRLAPPGR"
FT   sig_peptide     complement(136218..136355)
FT                   /locus_tag="Mjls_0124"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.606 at
FT                   residue 46"
FT   gene            complement(136333..137097)
FT                   /locus_tag="Mjls_0125"
FT   CDS_pept        complement(136333..137097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0125"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; KEGG:
FT                   mmc:Mmcs_0135 pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95938"
FT                   /protein_id="ABN95938.1"
FT                   /translation="MTTAERIDVRRAGERPRTRISWLDSKHSFSFADHYDPANTHHGLL
FT                   LVNNDDTVTPGSGFETHPHRDMEIVTWVLRGSLVHQDSTGNSGVIYPGLAQRMSAGRGI
FT                   LHSEKNDSWTLTGEASHREPVHFVQMWVVPDESGIAPGYQQLEIDDEQLRGKFVTIASG
FT                   MPEHRDDTAITIRNRYAALHGARLEPGDNVELPQAPYLHLFVPRGEVTLEGAGALTEGD
FT                   AVRFTASGGQRVTAVEPAEILVWEMHANLSAV"
FT   gene            137170..137625
FT                   /locus_tag="Mjls_0126"
FT   CDS_pept        137170..137625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0126"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mmc:Mmcs_0136
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95939"
FT                   /protein_id="ABN95939.1"
FT                   /translation="MYSVWLSDEEQQVWRGYLAMVAELQAAMNRQLQHDCGLSLADYEV
FT                   LVALSERGGRRMYELGETLAWEQSRLSHQLRRMRERGLVSRRGATDDRRGATVALTDAG
FT                   RAALRTAAPGHAALVRRVLFDGMPTARRKAFSDVIDTVRERLRDSPV"
FT   gene            complement(137614..138738)
FT                   /locus_tag="Mjls_0127"
FT   CDS_pept        complement(137614..138738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0127"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_0137 alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95940"
FT                   /protein_id="ABN95940.1"
FT                   /translation="MRTKGALLWELNAPFRVDEIEVGDPVDDEVQIRVHAAGMCHSDYH
FT                   LTTGATPIGLPALGGHEGAGVVTKVGRNVTGIEEGDHVILAFIPACGQCQPCLKGYRSL
FT                   CDRGALLLGGKAIADGTSRVHAGSTEVSPMNLLGTFAPYMTVHKDSVVKIDHDVPFETA
FT                   AIMGCAVPTGFGSATNVAEVQPGETVVIVGVGGIGLSALQGAVIAGARNVVAVDPVEFK
FT                   RDQATKFGATHVFSSMAEAIGPVLELTHGFMAEKTIIAVGEMRGEYIEEAMTLTAKTGT
FT                   CVVTGMGSMFDADVKLNLFLFTMLQKTLKGNIFGGGSSHVETPRLVGLYKSGLLKVDEM
FT                   VTNTYRLEDINQGYQDMLDGKNIRGVITFDESDW"
FT   gene            138933..139835
FT                   /locus_tag="Mjls_0128"
FT   CDS_pept        138933..139835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95941"
FT                   /protein_id="ABN95941.1"
FT                   /translation="MMGPFLGTEALAAGMVTRRQLGRRYRALYRNVYLPAEQELTAVTR
FT                   AKGAWLWSGRDAVAAGLSASALHGSKWIEANEPAELIRIGDAVSGILIRRDRLPEDEVC
FT                   VRLGIPTTTAARTAFDLGRRGNLTAAVQRIDALANATLLTRADVDPLLERHRGARGIVQ
FT                   ARRAIDLMDGGAESPPETTVRLMLIAARFPRPETQIVVRDQFGRFVGRIDMGYREYQIG
FT                   VEYDGPQHWTDPIQHARDIDRQAELAAQGWVIIRVSRDILRHRRDVAIRRTRDAMRAAG
FT                   WPNWAQVRVDLRISVERWA"
FT   gene            complement(139863..140876)
FT                   /locus_tag="Mjls_0129"
FT   CDS_pept        complement(139863..140876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0129"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   mmc:Mmcs_0139 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95942"
FT                   /protein_id="ABN95942.1"
FT                   /translation="MSAIVRKLASVTVLARTVDDGPDEDAFLADAQKYRRELLAHCYRM
FT                   TGSLHDAEDLVQETYLRAWKSYKGFQGKSSVRTWLYRIATNTSLTALDGRARRPLPTGL
FT                   GAPSSDPVDDIHERAEVPWLQPLPDDAGDPSSIVGSRESVRLAFIAALQHLSPRQRAVL
FT                   VLREVLQWKAAEVADALGTSTAAVNSLLQRARAQLDAIGPSEDDDLRPPESPEARDLLT
FT                   RYIAAFETYDVDKLADLFTAEAVWEMPPFDGWYQGPHDIVLLSKTHCPAERAGDMQLIP
FT                   TTANGQTAAALYMRNPATGRHEAFQLHVLDVTADGISHVVAFHATTFAPFGLADTL"
FT   gene            140921..141760
FT                   /locus_tag="Mjls_0130"
FT   CDS_pept        140921..141760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0130"
FT                   /product="Acylglycerol lipase"
FT                   /EC_number="3.1.1.23"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0140
FT                   acylglycerol lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95943"
FT                   /protein_id="ABN95943.1"
FT                   /translation="MASTRSERHFDGVGGVRIVYDTWTPDAPARGVVVLSHGYAEHARR
FT                   YDHVAQRFGEAGLIVYALDHRGHGRSDGKRVYLRDIAEYTGDFHTLVGIAAREHPDLPR
FT                   IVLGHSMGGGVVFAYGAEHPGDYAAMVLSGPAVYAQSAVKPWLVTVAKLLGRIAPGAPV
FT                   EQLDADAVSRDPEVVAAYKADPLVHHGKLPAGVARGLFTVGETMPQRAGALTAPLLVVH
FT                   GEKDRLIPVEGSHRLVDRVASQDVHLKVYPELFHEVFNEPERATVLDDVISWIEVRL"
FT   gene            141757..142770
FT                   /locus_tag="Mjls_0131"
FT   CDS_pept        141757..142770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0131"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: mmc:Mmcs_0141 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95944"
FT                   /protein_id="ABN95944.1"
FT                   /translation="MKAVVRLAASCVTAALLVAGCGSDDKAADETAPAQTGWVDDEVTF
FT                   TADGLTIHGTYRHRDGSGPATLLISESGQTDRNGDNAVAGPVGNMRQLAELLSERDVAS
FT                   LRYDKVGTGRTGLGPYATRPADVGTAVYTTGAAAALRFLADQPDTARDRISVYALGEGT
FT                   VHAMSLAAANDPAVHSLALLQPLAARYLDIITGRVRAEADPTVLANWLAAVEEIRTKGT
FT                   VPAQLPEGLGAIVNPGNIKAVIEADRVDPLALAAKVPAGTPVLLTCSNSDGQAKCDALR
FT                   PLMDALRHTELTVVELDGVNHVLRDDPTDNVANYAQQTPLSPQVVKALDEFVGEQP"
FT   sig_peptide     141757..141861
FT                   /locus_tag="Mjls_0131"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.582 at
FT                   residue 35"
FT   gene            142781..143530
FT                   /locus_tag="Mjls_0132"
FT   CDS_pept        142781..143530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95945"
FT                   /protein_id="ABN95945.1"
FT                   /translation="MSDDKMLARIAALLRQAEGTDNVHEAEAFMAAAQRLATATSIDLA
FT                   VARSHSDQRTKAQTPVQRTITIGDAGTRGLRTYVQLFVVIAAANDAKCDVASNSTFVHA
FT                   YGFAEDIDASHALYASLVTQMVKASQAYIESGAHRPTPTITARLNFQLAFGARVGVRLT
FT                   EAREEALAAAAEAEDSRPGTAIALRDKDLELKDFYRQASQARGTWRATSATAGYSSAAR
FT                   RAGDRAGRRARLGPSQELAGARTALET"
FT   gene            143527..144042
FT                   /locus_tag="Mjls_0133"
FT   CDS_pept        143527..144042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95946"
FT                   /protein_id="ABN95946.1"
FT                   /translation="MSGRDTQRAKVYAAEQFVRTLFDRAAERGNRIVEFFGTQLTLPPE
FT                   ARFASVASVQAYVDDVLAHPRIRTGWPGAGALTVRSRRGATAAHYEVIDGRAVIAVPER
FT                   HTTWALRELVVLHEIAHHLSHAEPAHGPAFVSTFCEVAEAVMGPEVAHVLRVVYAKEGV
FT                   RLGGGSRG"
FT   gene            144046..144711
FT                   /locus_tag="Mjls_0134"
FT   CDS_pept        144046..144711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0134"
FT                   /product="O-methyltransferase, family 3"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; O-methyltransferase, family 3;
FT                   conserved hypothetical protein 95; KEGG: mmc:Mmcs_0144
FT                   O-methyltransferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95947"
FT                   /protein_id="ABN95947.1"
FT                   /translation="MRVSEPNPQAVDHLFDRLLHTEDDALIAARESAAAAGMPQIEVSA
FT                   QHGRLLLLLASVTHARRVLEIGTLAGYSTINLARGVGTDGRVVTLEFDPRHAEVARTNL
FT                   ARAGVADRVEVLVGAALDTLPTLQHGAPFDLVFIDADKENNVAYVEWAIKLGRPGTVIV
FT                   VDNVTRMGRIYDPAPDDLQAQAVREMLEMMGSHPRLSTAAIQTVGAKNWDGFAVAVVT"
FT   gene            144738..145145
FT                   /locus_tag="Mjls_0135"
FT   CDS_pept        144738..145145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95948"
FT                   /protein_id="ABN95948.1"
FT                   /translation="MGICYRNGMLTVDRVVNASPAEVWSVLVDLDAWPKWGPTVAGAEL
FT                   LDGTELGLGERGKVYTPLGIPLPFTITEFEPGRRWSWQVAGIPATAHGVEPIEAGTRLY
FT                   MGAPVWAGAYLPVLAVALQRIDRMVSGGGTS"
FT   gene            complement(145142..146884)
FT                   /locus_tag="Mjls_0136"
FT   CDS_pept        complement(145142..146884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0136"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: mmc:Mmcs_0146 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95949"
FT                   /db_xref="GOA:A3PSS2"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PSS2"
FT                   /protein_id="ABN95949.1"
FT                   /translation="MPSGSSESPADALRASDSTPDIKPRSRDVTDGLEKTAARGMLRAV
FT                   GMGDDDWVKPQIGVGSSWNEITPCNMSLQRLAQSVKGGVHSAGGFPLEFGTISVSDGIS
FT                   MGHEGMHFSLVSREVIADSVETVVQAERLDGTVLLAGCDKSIPGMLMAAARLDLASVFL
FT                   YNGSIMPGVAKLTDGSEREVTIIDAFEAVGACARGLMSREDVDIIERAICPGEGACGGM
FT                   YTANTMASAAEALGMSLPGSASPVAIDKRRDEYARRSGEAVVEMLRRGITARDILTKEA
FT                   FENAIAVVMAFGGSTNAVLHLLAIAWEANVKLTLEDFTRVGQKVPHLADVKPFGRHVMK
FT                   HVDEIGGVPVVMKALLDAGLMHGDCLTVTGETMAENLAHIEPPDPDGKVLRAMNNPIHP
FT                   TGGITILHGSLAPEGAVVKSAGFDSDVFEGTARVFERERAALDALEDGTITHGDVVVIR
FT                   YEGPKGGPGMREMLAITGAIKGAGLGKDVLLMTDGRFSGGTTGLCVGHIAPEAVDGGPI
FT                   AFVRDGDRIRLDVAKGTLDLLVDEAEFESRKAGFEPLPPVYTTGVLAKYTKLVGSAAVG
FT                   AVCG"
FT   gene            146964..147572
FT                   /locus_tag="Mjls_0137"
FT   CDS_pept        146964..147572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0137"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   mmc:Mmcs_0147 protein of unknown function DUF305"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95950"
FT                   /protein_id="ABN95950.1"
FT                   /translation="MTSRELRPLALSAALLTALFLSACTSTEQPQTEGSTSHAHSETAG
FT                   DAQAPHNADDVAFARDMMPHHEQALQLVDLARDRSSDPALQEIASAIAAAQGPEMDQLA
FT                   GMLRGWGQDPEAGMHHGGHGMAMPGMVDDATMKRLESLRGAEFDRLWLESMISHHQGAV
FT                   EMAKAEIANGDNADAKAMAEHIIEAQEAEIAQMKQMLEG"
FT   sig_peptide     146964..147083
FT                   /locus_tag="Mjls_0137"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.681 at
FT                   residue 40"
FT   gene            147575..147886
FT                   /locus_tag="Mjls_0138"
FT   CDS_pept        147575..147886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0138"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   mmc:Mmcs_0148 protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95951"
FT                   /protein_id="ABN95951.1"
FT                   /translation="MSTGAPEDVAVHGYSAQKENYAKRLRRIEGQVRGIAKMIEDDKYC
FT                   IDVLTQISAVNSALQSVALGLLDEHLGHCVTQAVAEGGEQADVKLAEASAAIARLVRS"
FT   gene            147914..148411
FT                   /locus_tag="Mjls_0139"
FT   CDS_pept        147914..148411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0139"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmc:Mmcs_0149 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95952"
FT                   /protein_id="ABN95952.1"
FT                   /translation="MVPASVEHLTALRDDRTAFGELLGCAVPDGWPEFPESIEFTIDQL
FT                   TEHPHQAGWWMHFFLADGGAVLVGSGGFVGPPHDGVVEIGYEIAPEFRGRGYATAAARA
FT                   MIDKAKTATGRLTTVVAHTLAHENPSTAVLRRLGFTRVAEIEDSDDGPLWRWEVAVPAG
FT                   AR"
FT   gene            148419..149621
FT                   /locus_tag="Mjls_0140"
FT   CDS_pept        148419..149621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0140"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmc:Mmcs_0150 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95953"
FT                   /protein_id="ABN95953.1"
FT                   /translation="MTRAWTPRVAGQLTVLAAAAFVYVTAEVLPIGALPAIAADLRVSE
FT                   ALVGTLLAGYALVAAVTTMPLVRLTASWPRRRTLLLTLVCLTASQAVCALAPNFAVLAG
FT                   GRVMCALTHGLMWSVIAPIGVRLVPADHAARATTAVYAGTGLALVVGNPLTAAMSQLWG
FT                   WRTAVVVVTAAAATVTVAAWRALPPMRSPANVAARVAPRPRNPRLLTLAALTLLGVTGH
FT                   FMAYTFVVVVIRDVVGVPGAQSAWLLGAFGVAGLVGMAALARPGDRRPHLAVVGCLAVM
FT                   VVSFGVLTGLAFGHRTGLLVLGVGAVAVVAWGAASTAVPPMLQAAVMRTAPEDPDGASG
FT                   VYVAAFQVGIVAGALGGGLLYERAGAGLVLAGSTAVTAVVLACVLRRSDLLRAPATVSE
FT                   R"
FT   sig_peptide     148419..148535
FT                   /locus_tag="Mjls_0140"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.825) with cleavage site probability 0.738 at
FT                   residue 39"
FT   gene            149698..150684
FT                   /locus_tag="Mjls_0141"
FT   CDS_pept        149698..150684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0141"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mmc:Mmcs_0151 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95954"
FT                   /protein_id="ABN95954.1"
FT                   /translation="MPQQTMRKLTTAIFAAGLFGGLVLSAAPALAQPAPPPPPPVPVDP
FT                   IAPPPPPANPFAFPAPAAADPFAPTAQPLPIPEGTPAGQNPTPYVGKPVFAPPTFNPVN
FT                   GSIAGAAKPIYINFQRPIANRALAEQAIHISSNPPVPGRFYWTSDTQVRWRPQDFWPAG
FT                   TVVNIDASGTKSSFTVPEQLVATIDNKALQMEIHRNGELVKTFPVSMGKKGYDTKNGTY
FT                   YVLEKFADIVMDSSTYGVPVDDPSGEGYKLKVQDAVRIDNSGVFVHSAPWSVGSQGESN
FT                   VSHGCINLSPANAQWFFDNFGSGDAVVIKNSTGIYNQPDGASDWQMF"
FT   sig_peptide     149698..149892
FT                   /locus_tag="Mjls_0141"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.873 at
FT                   residue 65"
FT   gene            150761..151744
FT                   /locus_tag="Mjls_0142"
FT   CDS_pept        150761..151744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95955"
FT                   /protein_id="ABN95955.1"
FT                   /translation="MTCRGLAEPGADKATARTVAVIVLILLAGVALRGRIPGAEPAADK
FT                   PTDAGPGSLIAVLVMLGLSMAVIAVSVVSQARHPVTRPATAADPPRFRGGEGAPFTWRM
FT                   VLVMVGALLVWLLVVLTLMRISGWLDVSVDQPAAPSPEPDPGSSSAADSEPPPPPPGSE
FT                   PPVSNAALGYFAAAAALFVLLSVIGAMAGRNARRRPTTVVATDDEGDDDAPSTSRTQSL
FT                   ARAAERGLIEIGDLSREPREAIIACYAAMERELGKSPGAMPQDSDTPTEVLARAVDRRL
FT                   LHGESATELVDLFEEARFSTHVMGEAHRDAAVRVLRLVLRELQDAA"
FT   gene            151741..152226
FT                   /locus_tag="Mjls_0143"
FT   CDS_pept        151741..152226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95956"
FT                   /protein_id="ABN95956.1"
FT                   /translation="MTRAVAAAMLMLVAVEIYAVVRLDRDDVLTVSAVALAGALIAARF
FT                   ALRGEAAPASTATDADERGAALRRWVDRTETMIGWSEASRADWDRRLRPMLARQFELAT
FT                   GQRKARDARAFHATGQMLFGPELWQWVDPENVSRTGADEPGPGREALGEILRRLERV"
FT   gene            152237..153199
FT                   /locus_tag="Mjls_0144"
FT   CDS_pept        152237..153199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0144"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_3; ATPase associated with various cellular
FT                   activities, AAA_5; KEGG: mmc:Mmcs_0154 ATPase associated
FT                   with various cellular activities, AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95957"
FT                   /protein_id="ABN95957.1"
FT                   /translation="MNMPAMTTTAHCEAVLDEIGEVVVGKRRALALILTAVLARGHILI
FT                   EDLPGLGKTLIARSFAAALGLQFTRVQFTPDLLPADLLGSTIYDMHSGRFEFRHGPIFT
FT                   NLLLADEINRTPPKTQAALLEAMAERQVSIDGVTHPLPTPFLVLATDNPIEYEGTYPLP
FT                   EAQLDRFAIRLELRYLSGPDEVTMLRRRLDRGSAAPTVQQVVDGDGLLAMQESVEQVTV
FT                   HEDVLQYVVSLAAASRQHPQVAVGVSPRAELDLVQLSRARALLAGRDFVIPEDVKSLAV
FT                   PALAHRISLRPEMWVRRVQGADVVEELLRRLPVPRTGNP"
FT   gene            153199..154425
FT                   /locus_tag="Mjls_0145"
FT   CDS_pept        153199..154425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0145"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   mmc:Mmcs_0155 protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95958"
FT                   /protein_id="ABN95958.1"
FT                   /translation="MYDVELHWRASPLARALATCAAVGLAAALFTMRWELVAFVAPLLG
FT                   VLCSVGWQPRPPGVSVSTSTPLQRCFETEPSTVDIRAVADDGSDVTMTPSTLDGADLVT
FT                   AADGTGATVTLTAARWGRYPVRANVRVAGRGGLLEGTGSVDAAHVCVFPLAAPQSVTVP
FT                   RTDLLDRLGTHLTRHLGPGVEYADIRGYVPGDQLRTVNWSVSARRRSLHVTQRLTDRSA
FT                   DVVVLVDTYAQPPGPATAATERIARGAVQVVQSALRYGDRAGLVTLGSRRTRWLGADIG
FT                   QRQFYRILDVMLAAGEFDATTGSLAPQAAVPPGAIVVAFSTMLETEFALALIDLRKRGH
FT                   TVIAVDVLEGSPLDGDRDPLIDRMWALQRSFMYRDMGTIGVDVVPWPADATLDQAMALT
FT                   RHRRTGARR"
FT   gene            154422..154892
FT                   /locus_tag="Mjls_0146"
FT   CDS_pept        154422..154892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95959"
FT                   /protein_id="ABN95959.1"
FT                   /translation="MKALLPGVFGVLMVAAVVYRVDGPALVTAVAALVAVTVSVWWRPA
FT                   AVVAVVLTVSAVVLAPSAPMSTALAGLAAAAYLVLRHNDGHGEGRATPPTMVAAVAFAL
FT                   TATAVVALPVDIPWLPLAAPVALLVGYVLTLRPFSDFGVLGRAQHDPARRNP"
FT   sig_peptide     154422..154517
FT                   /locus_tag="Mjls_0146"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.659) with cleavage site probability 0.376 at
FT                   residue 32"
FT   gene            complement(154889..156883)
FT                   /locus_tag="Mjls_0147"
FT   CDS_pept        complement(154889..156883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0147"
FT                   /product="endothelin-converting enzyme, Metallo peptidase,
FT                   MEROPS family M13"
FT                   /EC_number="3.4.24.71"
FT                   /note="PFAM: peptidase M13, neprilysin; peptidase M13;
FT                   KEGG: mmc:Mmcs_0157 neprilysin"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95960"
FT                   /protein_id="ABN95960.1"
FT                   /translation="MTVEATIKSGIDLSYLDTAARPQDDLFGHVNGRWLAEYEIPADRA
FT                   ADGAFRTLYDRAEEQIRDIITEAAEANAEDGTDEQRIGDLYASFLDEATVARIGVQPLL
FT                   DELALVDAADSPDALAAVLGGLQRTGVGGGAGVYVDTDSKNSTRYLLHFSQSGIGLPDE
FT                   SYFRDEQHAEILAAYPGHIAAMFALVYGGDHTQTAERIVALERELAAAHWDVVKRRDAD
FT                   LTYNLRTFADLSAEAPGFDWAGWVTALGTTPESVAEVVVRQPDYLTEFAAAWSSEPLED
FT                   WKHWVRWRLIHARAFLLTDELVAEDFAFYGRLLSGTEQIRDRWKRGVSVVENLMGEALG
FT                   KLYVQRHFPPNAKARMDELVANLREAYRVSINRLEWMTPQTREKALAKLDKFTPKIGYP
FT                   VRWKDYSQLVIRRDDLYGNYRRGYQLASDREVQKLGGPVDRDEWFMTPQTVNAYYNPGM
FT                   NEIVFPAAILQPPFFDADADDAANYGGIGAVIGHEIGHGFDDQGAKYDGDGNLVDWWTD
FT                   ADRTEFGARTKALIEQYEQYTPRELEGQNGHHDAHVNGAFTVGENIGDLGGLSIALLAY
FT                   ELSLKGEPAPVIDGLTGVQRVFFGWAQVWRTKYRSAEAIRRLATDPHSPPEFRCNGVIR
FT                   NLDAFYEAFEVGADDALYLEPGRRVRIWN"
FT   gene            156924..157526
FT                   /locus_tag="Mjls_0148"
FT   CDS_pept        156924..157526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95961"
FT                   /protein_id="ABN95961.1"
FT                   /translation="MPDERADAAESADGRVFTGFGVASAVLAALSVAAVVLAVMIWSGH
FT                   REASAERAYQTRVLQAAADWTNVLVNMNKDTVDASMQRLHENTIGDLNADFDSAVEPYR
FT                   ELVQRLQTRTKGQVDSVSIESLHHPVPGPDGGPALAPPPDPQLSAFASRTDTVLVVATS
FT                   ISDNVGNKEPQTVRWTLRLDVSDVDGKLMISRLEPIR"
FT   gene            157523..158212
FT                   /locus_tag="Mjls_0149"
FT   CDS_pept        157523..158212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0149"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0159 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95962"
FT                   /protein_id="ABN95962.1"
FT                   /translation="MRNRLRVLVFDILSPVAAIAGLLYIGLALGWPLWWVSVCSVLCLL
FT                   IVQGVIVNVALMRRDGVTVGTDDDGPGLRLAVMGLATVAVVAAVALGYQRWTVPDRAFT
FT                   ADSAEVVRIASSVSEATATFSPQSPTASIDRAAAQMVPERAQAFKDEFAGVAKQLTSKN
FT                   VSAQASTVSAGVEAIGPQAASVAVVLRGTQSVPGQPVDNAVLALRVTLSKTDGRWMVDD
FT                   VTPIHAR"
FT   sig_peptide     157523..157615
FT                   /locus_tag="Mjls_0149"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.707) with cleavage site probability 0.692 at
FT                   residue 31"
FT   gene            complement(158261..158680)
FT                   /locus_tag="Mjls_0150"
FT   CDS_pept        complement(158261..158680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0150"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   mmc:Mmcs_0160 CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95963"
FT                   /protein_id="ABN95963.1"
FT                   /translation="MTEWIEPEHDDLRRIMRETRTVAVVGASPDPMRPSYGVWDYLRSA
FT                   SHYELYLVNPTVSEIDGTPVYPSLADLPVVPDMVDVFRRSSELPGVLRDTISVGAKTLW
FT                   LQQGLWDEQIARDGVAAGLEVVMDRCLKVDYARLL"
FT   gene            complement(158709..159239)
FT                   /locus_tag="Mjls_0151"
FT   CDS_pept        complement(158709..159239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95964"
FT                   /protein_id="ABN95964.1"
FT                   /translation="MTLTSDARETRRDAATAATRPLTAASRRASIDDRPVEFWSTAAIR
FT                   DALETDDLTVWQRIVTAIKRDPYGRTARQVEEVLEKAKPYGVSKALAEVLVRTREQMAA
FT                   AERAEVGHHVQLLLNRSGLGAPEFASRIGVEVDEFQSYIDGEVSPSASLMIRMGRLSER
FT                   FAKIRAQRANNPR"
FT   gene            complement(159236..162175)
FT                   /locus_tag="Mjls_0152"
FT   CDS_pept        complement(159236..162175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0152"
FT                   /product="MmpL11"
FT                   /note="KEGG: mmc:Mmcs_0162 MmpL11"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95965"
FT                   /protein_id="ABN95965.1"
FT                   /translation="MMRLSGTLRRFRWAVFGAWVLLLVPAIYLALNHSSNLTGGGFEVE
FT                   GSQSLHVQYELEDHFPDQGASPLALVAAPRADASYDDMNAAVAHLEQIATQVPSVKISP
FT                   NPQQPPPQPDRPYVITLSLDFNNTGATDVAKDLRTRVGIDGEEPGEFRDGKVKMYVIGQ
FT                   GALGAAASQAIKTDVAQAEQWNLPIVLIVLLAVFGSFAAAAMPLLLGVCTVAVTMGLVY
FT                   LLSTITTMSVFVASTVSMFGIALAVDYSLFILMRFREELRAGRDAQQAADAAMATSGLA
FT                   VLLSGMTVIASVTGIYLINTPVLTSMATGAILAVAVAVLTSTTLTPAVLATFGRAAAKR
FT                   SSYLHFSRRPDTTQSRFWTRWTGWVMRRPWVAATSAALVLLTMAAPAFMMELGNSMQRQ
FT                   FEPTHEVRGGVNAAAEALGPGALGPVRVLVTFPDGNAASAAAKEPTLEAVRAEMSKAPN
FT                   VATVTPAEFGDDYRSALLSAVLTVDPEDKGARETVDWMRANLPSTAGPNVSVDVGGPTA
FT                   LIKDFDDRVSATQPLVFGFVALIAFLMLLISIRSVVLALKGVLMTVLSVAAAYGSLVAV
FT                   FQWGWLEPLGFEPIPSLDSTIPPLVLAMTFGLSMDYEIFLLTRIRERFLQTGNTRDAVA
FT                   YGVSTSARTITSAALIMIAVFIGFAFAGMPLVAQLGVACAVAIAVDATIVRLVLVPALM
FT                   AMFDRWNWWLPKWLDRVLPSVDFEKPLPKVQIDDLVIIPDDISALGPSGADLRGMVKSA
FT                   ARMKTLAPQTVTVADPLAFSGCQPIKQRMVARNGGDQTVKLRTGAGLWRGGRDGNGSTV
FT                   RTTLPVHPVTLWRGRLSVALDALETAQQTEAETDRAPVERRTPVETTNVQLPTGDRLQI
FT                   PTGAETLRLKSYLIMCRNSSRDYAEFAELVESMETQTAAIVLSGMDRYYCGQQPKKQWV
FT                   ATQLVRRLADPQPSDEHDAAISDPDAESDWALVRQRCLSVAVAMLEEAR"
FT   gene            162504..162983
FT                   /locus_tag="Mjls_0153"
FT   CDS_pept        162504..162983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95966"
FT                   /protein_id="ABN95966.1"
FT                   /translation="MRSITLGRHRLGRSVCAAFAVTAAGGVAAAALTMPATPATAAPDP
FT                   CAASQVAKTVAAVATNTSNYLAANPETDQALTTIAQQQAGPASLASLKAYLDANPQVGS
FT                   DMQKLQQPLTNLSGRCKLPVTIPQVLGLMQAAQQSGAAQPAAPAAASPAAATGHR"
FT   sig_peptide     162504..162629
FT                   /locus_tag="Mjls_0153"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 42"
FT   gene            163122..163520
FT                   /locus_tag="Mjls_0154"
FT   CDS_pept        163122..163520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95967"
FT                   /protein_id="ABN95967.1"
FT                   /translation="MLLPARTARRVVVGAAGAGAIAGAMLFGAVPAMAQPAPPPPLPPN
FT                   CTAADLAGVASGVSASTSAYLFTHPPVNDFFTSLEGQSRDQIRPQVEEYLNANPQVKAD
FT                   LTGIRQPLVDLKTRCGTATPPEDDVDTP"
FT   sig_peptide     163122..163304
FT                   /locus_tag="Mjls_0154"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.596 at
FT                   residue 61"
FT   gene            163526..164257
FT                   /locus_tag="Mjls_0155"
FT   CDS_pept        163526..164257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0155"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mmc:Mmcs_0165 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95968"
FT                   /protein_id="ABN95968.1"
FT                   /translation="MRGETGEPEPAAQDTPGRTVLMVDDDPDVRTSVARGLRHSGFDVR
FT                   VAANGKEALRLLSAESHDALVLDVQMPELDGVAVVTALRALGNDIPICVLSARDTVNDR
FT                   IAGLEAGADDYLTKPFDLGELVARLHALLRRAHHSDRPSDTMTVGPLTIDTARRLVFVD
FT                   GERVDLTKREFDLLAVLAENNGVVLSRQRLLELVWGYDFDVDTNVADVFISYLRRKLER
FT                   DGLPRVIHTVRGIGYVLRDEP"
FT   gene            164262..165599
FT                   /locus_tag="Mjls_0156"
FT   CDS_pept        164262..165599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0156"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: mmc:Mmcs_0166 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95969"
FT                   /protein_id="ABN95969.1"
FT                   /translation="MWLPRLFRSTSLRTRVAVASAAAASAVVAAFTILTSVVLASNDDA
FT                   QLDRRLDSIVDASMYPEQLQDPRRGVLTTGRDRSTGQVVFQRGFQLPKLPPGTETVEVN
FT                   GVDYRVRTLVVDQEGGVLVSIGIRADSILLSRGRIPEYVLVGLVTVLIAGGLGWLLAGP
FT                   AIRPLRKLTEQTSKLSTGTDEMPEVRGAREAEELSAAMSAMLRRLAAAQQATTNSLQAA
FT                   QDFAANAAHELRTPLTAMRADLDTLRIHDLPEDERAEVVADLSRAQRRVEAIITALGQL
FT                   ASGQLAQAADREPIDITDTLDRVARENMRSAPQIDIQVDAEDLGTVWGLPDGLRLAVDN
FT                   LVRNAITHGGAGRVVLTARRTDGWLTIVVDDDGRGLPAEEHETVLGRFRRGSTAAPGGS
FT                   GLGLALVAQQAELHGGTIELADSPLGGLRATLTVSTSTEGGDPQLR"
FT   sig_peptide     164262..164384
FT                   /locus_tag="Mjls_0156"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 41"
FT   gene            complement(165587..165970)
FT                   /locus_tag="Mjls_0157"
FT   CDS_pept        complement(165587..165970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0157"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0167 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95970"
FT                   /protein_id="ABN95970.1"
FT                   /translation="MPTVDRRTAALALLADLVCVVVFCTIGRRSHAEGLTVAGIAETAW
FT                   PFLAGTAVGWLAARAWRRPLSLTPTGVLVWVCTVAVGMVLRKLSGQGVAVSFVIVASLV
FT                   TALLLLGWRGVATALRHKQIQRS"
FT   sig_peptide     complement(165872..165970)
FT                   /locus_tag="Mjls_0157"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.995 at
FT                   residue 33"
FT   gene            complement(166030..167166)
FT                   /locus_tag="Mjls_0158"
FT   CDS_pept        complement(166030..167166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0158"
FT                   /product="conserved hypothetical protein 374"
FT                   /note="PFAM: conserved hypothetical protein 374; KEGG:
FT                   mmc:Mmcs_0168 conserved hypothetical protein 374"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95971"
FT                   /protein_id="ABN95971.1"
FT                   /translation="MSHDATANDAKRGRADPDGSTRGKYWWVRWAIITVAVVVLTVEVV
FT                   LVWDQLAKAWKSLVSANWWWVVAAVVASLASMHSFAQIQRTLLRSAGVHLKQWRSEAAY
FT                   YAGNALSTTMPGGPVLSATFLYRQQRLWGASPVVASWQLVMSGVLQGVGLALLGLGGAF
FT                   MLGASKNPLSLIFTLGGFAALLVLAQAVASRPELIDGIGARLLARFNSLRNKPLDTGLA
FT                   KWRELLRQLESVQLGRRDLSMAFGWSLFNWIADVACLAFACYAAGGHPSLAGLTVAYAA
FT                   ARAVGTIPLMPGGLLVVEAVLVPGLVSSGMTLASAISAMLIYRLVSWIFLAAIGWVVFF
FT                   FVFRTEKDIDPDAPVKGAHKAGEPIRNQPPRSAREDLA"
FT   gene            167285..168430
FT                   /locus_tag="Mjls_0159"
FT   CDS_pept        167285..168430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0159"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mmc:Mmcs_0169 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95972"
FT                   /protein_id="ABN95972.1"
FT                   /translation="MSDGVSLEDQSVSPLVRKAAAWSWRLLIIFGALVAVLWLVARLEI
FT                   IVVPVALATMLAALLMPAVDFLDRRGAPRGGAVALVLLSGIAVVGGILTFVVSQFVEGM
FT                   PALGEQVTRSIDGMRRWLVEGPLDLSREQIDNAGNAAIEAVRNNQERLTSGALSTAGTI
FT                   TEIVTGALLVLFTLIFLLHGGRNIFGFITQVFPPDVRDRVRGAGRAGFHSLIGYVRATF
FT                   LVALVDAIGIGTGLAIMSVPLALPLASLVFLGAFVPLVGAVVTGFLAVIVALLTKGLVY
FT                   ALITLGLILAVQQLEGHVLQPLVMGRAVSIHPLAVVLAIAGGGVLAGIVGALLAVPAVA
FT                   FLNSAIRVLLARDQAAAVENLETDEGPRIQAEPDDVEEKVD"
FT   gene            complement(168453..171722)
FT                   /locus_tag="Mjls_0160"
FT   CDS_pept        complement(168453..171722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0160"
FT                   /product="drug exporters of the RND superfamily-like
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0171 drug exporters of the RND
FT                   superfamily-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95973"
FT                   /protein_id="ABN95973.1"
FT                   /translation="MFAWWGRNVYRYRYIVIGVMVALCIGGGIYGISLGNNVTQSGFYD
FT                   EGSQSVQASVAGDEVYGRDRTSHVVAILTPPDGEKVDNPEWQREVVGELDALVKDHPDQ
FT                   VVSWVGWLRAPDAASETVQQMKTADLSKTFVSVPLKGDTDDEILKNYQVIEPDLQEIND
FT                   GNIQLAGLNPLASELTGSIGEDQKRAEVAAIPLVCVVLFFVFGGVIAAALPGLIGGLTI
FT                   AGALGIMRLLAEIMPVHFFAQPVVTLMGLGIAVDYGLFMVSRFREELAEGYDTEAAVRR
FT                   TVMTSGRTIMFSAVILVASSVPLLLFPQGFLKSITYAIIASVMLAAVLSITVLAAALAI
FT                   LGPRVDALGVKTLIKFAEPDPISSDPAVQKTNTFAIASIPLGLLVPPVGIALGHIARKR
FT                   IKQTGEQGANLALIGLVLGYTVLYGAMAYGVIALKDNGTIGSGVYWMLLGIVAFLVIVT
FT                   FGLALARYVPLARRPIVWWLHWLAEKTQKTKTRAEVEQGFWGKLVTHVMKRPGTFAFPI
FT                   IVVMILLIIPLGQLSLGGISEKYLPPDNSVRQAQEDFDRSFPGFRTEPLTIVLKSDNGD
FT                   PVTDQQVADIRAKAMSISGFIDPDNDPSKMWQERSVQEGGSEDPSVRVIQNGLENRNDA
FT                   ATKIEELRALSPPRGVSVWVGGTPALEQDSIHSLFDRLPLMVTILIVTTTILMFLAFGS
FT                   LVLPIKAALMSALTLGSTMGILTWMFVDGHGSGLMNYTPQPLMAPMIGLIIAVIWGLST
FT                   DYEVFLVSRMVEARARGLSTAEAIRVGTATTGRLITGAALVLAVVAGAFVFSDLVMMKY
FT                   LAFGLLLALLLDATIIRMFLVPAIMKMLGDDCWWAPRWMKRLQERLGLGEVELPDERKR
FT                   PLVRDPAEDQALVGAGAPVPPRPRPPHDPTHPGVEGRVGPTRIPPGPPRLNGPSVAGTS
FT                   RIPTNRPAPGHEPPTTRLSMAKNAVRGAVNTATTPRAPRPTGPAPKREEREIESWLGEL
FT                   RGGPSNPGGGQPPRPPQPSAEPTTAMRAGAPKPEPEPEGNEPTTAIPVQRPPQPEESDA
FT                   TTKIPTQQDPKSTEKLNAPEEQKRRGGGMSAAELLRREGRM"
FT   gene            complement(171769..172467)
FT                   /locus_tag="Mjls_0161"
FT   CDS_pept        complement(171769..172467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95974"
FT                   /protein_id="ABN95974.1"
FT                   /translation="MSVTEDLPQEIPQVTPPPPPAGPPAGTQRVLLVWDAPNLDMGLGS
FT                   IIGGRPTAAHRPRFDALGRWLLGRTADLSAGREDVTLEPEATVFTNIAPGSADVVRPWV
FT                   EALRNVGFAVFAKPKIDEDSDVDSDMLDHIALRRREGLAAVLVASADGQAFRLPLEEIA
FT                   REGIPVQVLGFREHASWALASDTLEFVDLEDIPGVFREPLPRIGLDSLPEQGAWLQPFR
FT                   PLSALLTSRV"
FT   gene            complement(172464..173267)
FT                   /locus_tag="Mjls_0162"
FT   CDS_pept        complement(172464..173267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0162"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: mmc:Mmcs_0173 hypothetical protein; TIGRFAM:
FT                   tRNA (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95975"
FT                   /protein_id="ABN95975.1"
FT                   /translation="MRHHGRMHARESDVAGGPARDSAGGPARDSAGDDSPSAHRHRRVT
FT                   SFRSRRSALSGGQQDTWERRWPELGTEARDDDGRPAALIDTAAWFGRTAPLVLEIGSGT
FT                   GTSTLAMAQDEPDIDVIAVEVYRRGLAQLLTGIDRAGVRNIRMIRGDGVDVLEYMVASG
FT                   SLTGVRVFFPDPWPKARHHKRRLLQPSTVALIADRLRPGGILHAATDHAGYAEQIAAVG
FT                   DAEPLLRRVDLTDDLPISVRRPVTKYERKALAGPDVAELLWEKVP"
FT   gene            173362..174372
FT                   /locus_tag="Mjls_0163"
FT   CDS_pept        173362..174372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95976"
FT                   /protein_id="ABN95976.1"
FT                   /translation="MPRFSRDPTRREGATIFVPDFDDVLTRFAQECGDAAVAAVAARLA
FT                   APLRVAVTGRAGVGRTTLARALARDGRRVAEHTPDVAVVVVAEAVKPEDVASVAGWCDA
FT                   DVPVVVVGNKADLTGPIPSDALRRYRSGEHGDVSVESVVALLAVVSLDDDALGALQLLA
FT                   AQPAELRSANAFLDAAHPLPRDVRTRLLRTLGLRGVAHSVRALRDGADPHDLPTLLREV
FT                   SGFDRVLDRLDALAAPARYDRIRAALAELQGRAAGDDRIAAFLADDDTVLAVMTAAVDV
FT                   VQAAGLAVDPGDDAATHLRRAVWWRGYSRGPVSPLHRACGADIARGSLRLFERRR"
FT   gene            174369..175862
FT                   /locus_tag="Mjls_0164"
FT   CDS_pept        174369..175862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95977"
FT                   /protein_id="ABN95977.1"
FT                   /translation="MSAASDPVAAADAVVAAVDPALDSPGVQSSDSVLVTGPWLAGVSS
FT                   LIAVLRDRLPEVSFVEADELPAGSAPVAVVFAVSAVSALAGSDCELLDLAADHTDCVIG
FT                   VVTKIDVHLDWREVMAADRELLGAHRRRYAALPWVGVAAAPDHGDPMVDDLVDLLRDTL
FT                   GDPAVLRRNRLRAWESQLEKVVARYRADGEGADRHARVSALRAQRDEIRRARRVEKSQR
FT                   AIALRSQIQQARVQLTYFARNRCASVRGELQEDIAELGRRRLDAFEQTVRGRAAEVMTE
FT                   VDEGVTTHLTAVAADLHLDDVPSPPQPIPVPDLPGPSLRSRRLETRLMMLLGAGFGLGV
FT                   ALAVSRLFSGVDPGLTVAGVLAGAAAGLAVAVWVVGIRGLLHDRGVLDRWVADVTATLR
FT                   SAAEEAVATRVLAAEAALTAALAAEEAADADAAAVRIAEIDAELREHAAATARAAALRD
FT                   RRLPGLQRALEAVCAELYDKKADEFTEANERNSGKNVGY"
FT   gene            176061..177890
FT                   /locus_tag="Mjls_0165"
FT   CDS_pept        176061..177890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0165"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   mmc:Mmcs_0176 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95978"
FT                   /db_xref="GOA:A3PSV1"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PSV1"
FT                   /protein_id="ABN95978.1"
FT                   /translation="MTSATIPGLDTAPTEHEGLLAWVREVAELTQPDRVVFTDGSEEEC
FT                   ARLTEQLCEAGTFQKLNEEKKPNSYLALSDPSDVARVESRTYICSEREIDAGPTNNWMD
FT                   PAEMRGIMTDLYRGSMRGRTMYVVPFCMGPLEAEDPKLGVEITDSEYVVVSMRTMTRMG
FT                   QAALDKMGTDGFFVKALHSLGAPLEPGEKDVPWPCNDTKYITHFPETREIWSYGSGYGG
FT                   NALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYFIAAAFPSACGKTNLAML
FT                   QPTIPGWRAETVGDDIAWMRFGKDGRLYAVNPEFGFFGVAPGTNWSSNPNAMKTIEAGN
FT                   TVFTNVAKTDDGDVWWEGLEGEPDHLIDWKGNDYILRETETKAAHPNSRYCTPISQCPT
FT                   LAPEWDDPQGVPISAILFGGRRKTTVPLITQARDWQHGVFIGATLGSEQTAAAEGKVGT
FT                   VRRDPMAMLPFLGYNVGDYFQHWIDIGKNADESKMPAVFFVNWFRRGDDGRFLWPGFGE
FT                   NSRVLKWAIERIEHKADGRSTPIGIVPTAQDLDLEGLDVDPEDVDAALAVKPEEWRQEL
FT                   PLIEEWFEFVGEKLPTGIRDEFDALKHRLAEEA"
FT   gene            178038..179558
FT                   /locus_tag="Mjls_0166"
FT   CDS_pept        178038..179558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0166"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0177 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95979"
FT                   /protein_id="ABN95979.1"
FT                   /translation="MQIRDTAVATPDKPAIIMYPSGTVVTFGELEARANRLAHLFRDAG
FT                   LVEGDAVAILMENNEHIHAVMWAARRSGLYYVPINTHLTAAEVAYIVDNSGAKAIVGSG
FT                   KLADTLAGLEAELPRGLPPVRLIAGAQLDGWQSYPDCVADKPDTPIADEIEGDLLQYSS
FT                   GTTGRPKGIKRELPHVPPSESPGMMAALVSFWMHPDAVYLSPAPLYHTAPSVWSMQTQA
FT                   GGITTVVMEKFDAEGALDAIAKYKVTHGQFVPVMFTRMLKLPEDVRKSYDVSSLERVMH
FT                   AAAPCPVEIKKQMIDWWGPIVDEYYASSEAHGSTLITAEEWLTHPGSVGRPLTGVLHIV
FT                   GEDGNELPPGQAGEIYFEGGYDFEYLNDPEKTASSRHPLGWKTVGDIGYLDEEGYLYLT
FT                   DRRHHMIISGGVNIYPQEAENMLITHPKVMDAAVFGVPDDEMGQSVRAVVQTVDPADAT
FT                   DGFAEELISWLRDRLAHYKCPRSLSFEPQLPRTDTGKLYKQELIKKYS"
FT   gene            179567..180442
FT                   /locus_tag="Mjls_0167"
FT   CDS_pept        179567..180442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0167"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mmc:Mmcs_0178 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95980"
FT                   /protein_id="ABN95980.1"
FT                   /translation="MELAGGIRVAVETPCEDASFTLTEAPSDDPRLVTVASVADTLAEL
FT                   DERCRRWPQAAAVCDDVLRSFDPARSTFAGVITESLAYSTLQSGPEFGRWLAERGPAQV
FT                   PETANPVVAERNDGCLTVRFNRPDRHNAFSTGARAALLEALEVARLDPSVDEVVLSGVG
FT                   RSFSSGGDLAEFGSFDDPASAHLARTRHSPALVLDEVTARLGRRCRAQVHGQVLGSGLE
FT                   MAAFCGWVVSSPDAVFGLPELTLGLIPGAGGTVSITRRIGRWRTGYLVLSGRTIDPSTA
FT                   LRWGLVDAVE"
FT   gene            complement(180597..181340)
FT                   /locus_tag="Mjls_0168"
FT   CDS_pept        complement(180597..181340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0168"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; KR; KEGG:
FT                   mmc:Mmcs_0179 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95981"
FT                   /protein_id="ABN95981.1"
FT                   /translation="MLGHMTDSKIILVTGASSGIGAAVATHLARAGHHVIAGARREDRL
FT                   RELADGAADLERGSLSVRRLDVTDRAEMAAFVDDAVSTHGRIDVLVNNAGIMPLSRLDA
FT                   LLVDQWDAMIDVNVRGLLNGIAAALPHFHRLGGGHFVTVASIGAHEVVPTSAVYSATKY
FT                   AAWAITEGLRQESDPSIRVTTVSPGVVESELASTITDPGAAAAMQEYRAAAITPDAIAR
FT                   AIAYAISEPEEVDVNEVIVRPARQR"
FT   sig_peptide     complement(181245..181340)
FT                   /locus_tag="Mjls_0168"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.631) with cleavage site probability 0.569 at
FT                   residue 32"
FT   gene            181382..182251
FT                   /locus_tag="Mjls_0169"
FT   CDS_pept        181382..182251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0169"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   mmc:Mmcs_0180 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95982"
FT                   /protein_id="ABN95982.1"
FT                   /translation="MQHTQAPAPSRPYRGDMAELGDYLRSRRAQVQPRDAGLVATGTRR
FT                   VPGLRREEVAWLAGLSVDYYVRLEQGRERSPSAPVLDALAAALRLDHDGHRHLFRLAGL
FT                   APRLDVAKTPDRVDPALSRLMAAWPDNPALVYNRAYDVLAANPLAQALFGDFGAGENLM
FT                   LLAFGEPRAREFYVDWQDVAENAVAGFRLNHAAAPADPRVQTVLAELLNDSAEFRALWE
FT                   RHDARGKSLTSKTFRHPEVGVLELTMQTFDVRSAPGQELVVYDAAPDSPGADALKLLGS
FT                   IAATAATQ"
FT   gene            complement(182302..182904)
FT                   /locus_tag="Mjls_0170"
FT   CDS_pept        complement(182302..182904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0170"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; KEGG: mmc:Mmcs_0181 UbiC transcription
FT                   regulator-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95983"
FT                   /protein_id="ABN95983.1"
FT                   /translation="MRRAFQDLVAEGVVYRVPGRGTYARETGRYLRQLGSIEDLMSLSQ
FT                   DTTMEVLRGLTRRVDIQAASRLRLDDDVVHTVVFRRLHGPPGQGVPFVSTTVHLPPSIA
FT                   RHIAGDNALQTGAVSTHTVIGLLEPHLDAPIAQAAQSITVAPADEAVAGAVGCAEGHPM
FT                   LRVDRLYSDDADRPVELSVSHFLPEQYTYRVTLRRSG"
FT   gene            complement(183049..184206)
FT                   /locus_tag="Mjls_0171"
FT   CDS_pept        complement(183049..184206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0171"
FT                   /product="Butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mmc:Mmcs_0182 butyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95984"
FT                   /protein_id="ABN95984.1"
FT                   /translation="MSRLSEEETMLVETVRAFVDRDVKPTVREVEHANEYPEAWIEQMK
FT                   RIGIYGLAIPESYGGSPVSTACYVEVTQELARGWMSLAGAMGGHTVVAKLLTLFGTEEQ
FT                   KRAYLPGMATGEIRATMALTEPGGGSDLQNMTTTALPCEGDGLVVNGSKTWISNARRSG
FT                   LIALLCKTDPAATPRHKGISVVLVEQGTTGLSVSRDLPKLGYKGVESCELVFDDCRVPV
FT                   TAILGGEPGRGFAQMMKGLETGRIQVASRALGVATAALEDALRYAQERESFGQPIWKHQ
FT                   SIGNYLADMATKLTAARQLTRYAAERYDSGERADMEAGMAKLFASEVAMEIALNAVRIH
FT                   GGYGYSTEYDVERYFRDAPLMIVGEGTNEIQRNVIAAQLVARGGI"
FT   gene            184272..185267
FT                   /locus_tag="Mjls_0172"
FT   CDS_pept        184272..185267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95985"
FT                   /protein_id="ABN95985.1"
FT                   /translation="MTLYGQIVGGPYFDDLAVGQVFDSAPTMTLSAGAAAVHQSILGDR
FT                   LRLALDGELAAAVTGSTSPLAHPGLVCDVAIGQSTLVTQRVRANLFYRGLAFHRYPVLG
FT                   DSLFTRTEVVGLKQNSVKPGRPRTGLAALRMTTVDQLGRLVLDFHRCAMLPLRDGAADT
FT                   GHADDLSAIGADASAPDPTAAWDAQAWRSRVRSSFDAGLAGTVLHSTADVVTSAPELAR
FT                   LTLNIAATHHDSRVGGGRRLVYGGHTIGLALSQATRLLPDLATVRAWESCDHTGPVYEG
FT                   DTLYSALHVDGATPLPDGRGGVLNLRSLVYAVDEQEDRQVLDWKFSALHF"
FT   gene            185360..186466
FT                   /locus_tag="Mjls_0173"
FT   CDS_pept        185360..186466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95986"
FT                   /protein_id="ABN95986.1"
FT                   /translation="MVSAFAIPAAVLTRAARVAAGLPVDVDIPELLTGRAALLDLPAPG
FT                   RLSAGGASRLLRARDGWCALTLSRPDDLAAVPALLEADHIDADPWPAIGDWLADRSADT
FT                   AVARARLLGMPAAMLAEAAPAQPVVQRITTQAPPRPWTDLLVIELASMWAGPLLGRMLV
FT                   RSGATVVKVESLARPDGTRRGSPEFFDWMNGGKHCITVDFDDATQLGALLAAADMVIEG
FT                   SRPAALARRGLGPDVVPARDGRVWVRITGHGTVAERADWVAFGDDAAVAGGLVGAAADG
FT                   PVFVGDAIADPLTGLEAMHAVVQSLHRGGGELVEVSMAAVAAGYAALPDEGTVEVAARA
FT                   PAPGPPAAHLGADNAAVRAVVERRLAAC"
FT   gene            186460..187755
FT                   /locus_tag="Mjls_0174"
FT   CDS_pept        186460..187755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0174"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: mmc:Mmcs_0185
FT                   amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95987"
FT                   /protein_id="ABN95987.1"
FT                   /translation="MLIRRATLLDGTRVDIRTAERIRDVADSLVPERGETVLDAAGATV
FT                   IPGLHDHHVHVHAAAAALGSVRVGPADVGDRDRLLRALRSATPGEDGWIRAVGYHEAVA
FT                   GPLDRALLDTLRPDVPVRVQHRSGVLWTLNSAGLTRLGLSGHPDGRLRSADAEWGAELE
FT                   RRQVPLGEFSRALARRGVTGITDATPDLDVTTVGDWSGEIVQRLHVLAPGKRILHDDAL
FT                   DLDELVAWMKDRHDGGTPVAVHCVTAAQLVVTIAALRIAGAQPGDRIEHAAVVPDDCIP
FT                   DLAELGVTVVTQPNFVVERGDQYRADVPAPEHRELWRVGSLLKAHVRVAFSTDTPFGDG
FT                   DPWAAMRAAVHRRTPSGAPLGTTERVDAATALALFCGSADSPTTPRAVAPGEPGDLCIV
FT                   EGSPDEVLAELDRDRVRATIVGGEPVWAPGRE"
FT   gene            complement(187766..188638)
FT                   /locus_tag="Mjls_0175"
FT   CDS_pept        complement(187766..188638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0175"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein,; KEGG:
FT                   mmc:Mmcs_0186 ion transport 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95988"
FT                   /protein_id="ABN95988.1"
FT                   /translation="MEWTATVAGIALIAVIVRDVFHTLFHPIGHGSIAPTVMKLIWRLL
FT                   GLLPPQRRIASLTGPLGIAMVVLAWGVIAVAGWTLIYWAQMPEGFAYGTELDPNERHDI
FT                   VDSLYLSLVTIGTLGFGDVVPTSVTLRLAAPIEALFGFMLLTAAVSWVLEIYPALHRRR
FT                   VLALQLSTLRRAREGDPVLPIDSVPVEVLTSLAAGIVEARNDFTQYSATYYFRDLETDA
FT                   SLAASLEYATQLAAEAMASAQDHVRTAGRLMKIAVDSLAELLDQEFLQLGGDTDAVVQA
FT                   YAVDHRHIN"
FT   gene            complement(188748..191045)
FT                   /locus_tag="Mjls_0176"
FT   CDS_pept        complement(188748..191045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0176"
FT                   /product="isocitrate lyase"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: mmc:Mmcs_0187 isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95989"
FT                   /protein_id="ABN95989.1"
FT                   /translation="MTTHAESKTGTSFDQEVAETQRYLDSPRFEGITRLYTARQVVEQR
FT                   GTIPVDHTVAREAATAFYPRLRELFSQGKSITTFGPYSPGQAVTMKRAGIEGIYLGGWA
FT                   TSAKGSTDEDPGPDLASYPLSQVPDEAAGLVRALLTADRNQHYLRLRMSEEQRAAAPPP
FT                   VDFRPFIIADADTGHGGDPHVRNLIRRFVEAGVPGYHIEDQRPGTKKCGHQGGKVLVPS
FT                   DEQIKRLNTARFQLDIMGVPGIIVARTDAEAANLIDSRADERDQPFLLGATNLSIPSYK
FT                   SCFLAMMRSFHDAGVTALNGHLLYWLPDGEYETARAWLERHGIADVIAKAVEQWRSDGD
FT                   PSNDALYDDVESQFIAAWEEDAGLKTYAETVAARLEFAEGDGEAYAMGVDEWTQFAKRA
FT                   SLYTAGKKARELGVDVDWDCELAKTPEGYYQLRGGIPYAIAKQLAAAPFADILWMETKT
FT                   ADLADAREFAEAIHAEYPDKMLAYNLSPSFNWDTTGMTDDEMRAFPEELGKMGFVFNFI
FT                   TYGGHQVDGVASEEFATALRQDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALLA
FT                   SSGRTATTKAMGKGSTQHQHLVQTEVPKKLLEDWLAMWSEHYQLGEKLRVQLRPRRAGG
FT                   EVLELGIYGERDSGEEKLADVLVDPIKDRYGRSILTVRDQNTYAEKLRKKRLMTLVHLW
FT                   LVHRFKADAVYYVTPTDDNVYQTEKMKSHGIFSDVHKDVGEIIVAEVNRARIEELLAPD
FT                   REALGRLIRKED"
FT   gene            191181..191969
FT                   /locus_tag="Mjls_0177"
FT   CDS_pept        191181..191969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0177"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0188 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95990"
FT                   /protein_id="ABN95990.1"
FT                   /translation="MKLTGYTALVTGASGGIGEEFATRLAADRVNLILVARRTERLEEL
FT                   RGRLLERHPGIDIDVLSADLGVPGAAAALAQQVDALGRRVDVLINNAGIGLHGSFAEQD
FT                   PAANAAQIQLNCVTLVELTGYFLPAMIAAKRGVVLNVGSTAGFQPVPSMAVYGATKAFV
FT                   LSFSEALWQETRGSGVKVLTLCPGATETEFFDRTGKSFMTRGRQSSAQVVDTALKALDR
FT                   PFPTVVSGLHNRILALGYRIAPRPVLAMVSEQLMKASGQR"
FT   gene            complement(191966..192748)
FT                   /locus_tag="Mjls_0178"
FT   CDS_pept        complement(191966..192748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0178"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; protein of
FT                   unknown function UPF0074; UbiC transcription
FT                   regulator-associated domain protein; KEGG: mmc:Mmcs_0189
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95991"
FT                   /protein_id="ABN95991.1"
FT                   /translation="MATHSEELRRRIVADINAGVPGAKLGSERDLAERYGTSRSSLRQV
FT                   LAALEEAGMVHRVIGRAGGIFISHGQVERNLADVVGVPAFLANQGYVAGTRVLSTKIAP
FT                   VDDATQAALRLQPTDFVVEIQRLRLADGSPISLELAQFPADAFPGLLEQQLGGSIYEVL
FT                   ENRYGLVPGRADERIEAVNATTTEASLLGVKPKSALLLITRVTYDSDGTPCEFSRDLFR
FT                   GDRIYLAVTAQGRGIGKGLGSGPDTNTASVKLQSQLAV"
FT   gene            complement(192817..193596)
FT                   /locus_tag="Mjls_0179"
FT   CDS_pept        complement(192817..193596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0179"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0190 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95992"
FT                   /protein_id="ABN95992.1"
FT                   /translation="MFTSLQGRSAIVTGGSKGIGRGIAEVFANAGVDVVVTGRNQADID
FT                   ATVADLGGKAGKVSGLAADVADPADCRRVVDTAVERHGGLDIVCANAGIFPSGRLEELT
FT                   PEDIEQVLSVNFKGTVYIVQAALSALAASGHGRVIVTSSITGPVTGYPGWSHYGASKSA
FT                   QLGFIRTAAMELAPKRITINAVLPGNIITEGLVDMGEDYMNQMAAAIPAGRLGSVADIG
FT                   NAALFFATEEAGYITGQSLIVDGGQILPESHQAIAEL"
FT   gene            complement(193631..194623)
FT                   /locus_tag="Mjls_0180"
FT   CDS_pept        complement(193631..194623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0180"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   mmc:Mmcs_0191 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95993"
FT                   /protein_id="ABN95993.1"
FT                   /translation="MGEVIADDVEVAERALADYDLPANSTLRLLNLSENATYLVECEDD
FT                   QSCSILRVHRQNYHRPHEIESELDWLEALRRDSDVTVPTVLPTRDGRRVVTVDHNGTAR
FT                   HVVHFGMVGGAEPDEGSVTLDDFRTLGAITASLHDHSRSWTRPAGFERFAWDWEHCLGS
FT                   EPRWGRWYDAEGVGPEERHLLDRAQDLLRQRLADYGSGPDRYGLIHADLRLANLLVDPP
FT                   TITVIDFDDCGFGWFFYDFGTAVSFIEDDPALPEWQASWVEGYRSRRPMTTADEDMLAS
FT                   FVFLRRLLLLAWMGTHSHSKESKTKAISYAAGSCALAERYLSTNGRRLA"
FT   gene            complement(194623..195276)
FT                   /locus_tag="Mjls_0181"
FT   CDS_pept        complement(194623..195276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95994"
FT                   /protein_id="ABN95994.1"
FT                   /translation="MPATASGTRTDIRVYLLVEDLQRQFAAYLGTPTRARGYPPYEGEH
FT                   ALIVEVSPALAIERVIDLALREVPGIQPGILYVERQFGVLEIHSASLSDVRRAGEAILT
FT                   GTGNKASDQLRPRVLYHDIITDITDQHAVILNRNRQASMILPGQSLLVYEMTPALFAAV
FT                   AANEAERAAPGLTVVDVQMIGAAGRLYIGGSVADVTTARDRITSVLAAIEGRDH"
FT   gene            complement(195321..195602)
FT                   /locus_tag="Mjls_0182"
FT   CDS_pept        complement(195321..195602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0182"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: mmc:Mmcs_0193
FT                   microcompartments protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95995"
FT                   /protein_id="ABN95995.1"
FT                   /translation="MPSNAIGLIETKGYVAALAAADAMVKAANVTITDRQQVGDGLVAV
FT                   IVTGEVGAVKAATEAGAEAASQVGELVSVHVIPRPHSELGAHFAVNAQ"
FT   gene            complement(195626..195880)
FT                   /locus_tag="Mjls_0183"
FT   CDS_pept        complement(195626..195880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0183"
FT                   /product="Ethanolamine utilization protein EutN/carboxysome
FT                   structural protein Ccml"
FT                   /note="PFAM: Ethanolamine utilization protein
FT                   EutN/carboxysome structural protein Ccml; KEGG:
FT                   mmc:Mmcs_0194 ethanolamine utilization protein
FT                   EutN/carboxysome structural protein CcmL"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95996"
FT                   /protein_id="ABN95996.1"
FT                   /translation="MIAATVTGNVWSTRRIEGIPAGAFLEVEVDGSGSRMIAFDVLGTG
FT                   LGERVLIAQGSVAANWFTGTPPPVDALIIGSIDDPSSTS"
FT   gene            complement(195877..196389)
FT                   /locus_tag="Mjls_0184"
FT   CDS_pept        complement(195877..196389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95997"
FT                   /protein_id="ABN95997.1"
FT                   /translation="MSTIDRAELRALVREVVREAVKDVAVKNGGAAPAPAAPPPPPPVQ
FT                   TVADQFGVTPSGPLAADGKHRAEAVRLTNDRELDAFVRALLKLFENPKSRADLKAGRLT
FT                   FRLAGAPTGGRGQTQRIDSGAVTERHIADVAAAGAALVLGPRAVLTPLAREKARALGVS
FT                   IEKEKRR"
FT   gene            complement(196386..196991)
FT                   /locus_tag="Mjls_0185"
FT   CDS_pept        complement(196386..196991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0185"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: mmc:Mmcs_0196
FT                   microcompartments protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95998"
FT                   /protein_id="ABN95998.1"
FT                   /translation="MAELRSFIFIDRLQPQTMSYLGTWIKGALPRANMAAQIIEVAPGL
FT                   DIEGITDVALKHAEVKAGILVVERQFGYLEFHGETGAVKAAADAALESLHQEADSAVRP
FT                   TILASRIISSIDHQHAFLINRNKIGSMVLAGESLFVLEVAPASYAILATNEAEKAADIK
FT                   VVDFRMIGATGRVYLSGTEADIRQAAEAARDALARSTV"
FT   gene            complement(196995..198572)
FT                   /locus_tag="Mjls_0186"
FT   CDS_pept        complement(196995..198572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0186"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0197
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95999"
FT                   /protein_id="ABN95999.1"
FT                   /translation="MSEIASGRAERREIASAGHMLERARWAARAYADYDQAAVSAITTA
FT                   VADAAYGAAERFAAEAVAETGMGVVADKVIKNRACSRGILDYYRGQDFVSPRVDTVNKI
FT                   VEIPRPAGVVLALTPTTNPVSTVYFKVLLALMTRNAVVVAPHPRAKQSSADAARLLADA
FT                   AVAAGAPDGIVQVVEEPSIPLVEALMADERTDVIVATGGTGVVRAAYSSGTPALGVGPG
FT                   NVPVLVDASADITAAAKRIVDSKAFDNSVLCTNESVLIVEDSVADALRSAMTRAGAHIL
FT                   DADATERLRAYMFADGHLNTDVVGRDAAWIAGQAGIRVTPKTRVLVAPFDHVISEEMLA
FT                   HEKLSPVIGMTTVPDAARGIRAARAVVRIGGAGHSAAIHSENASVITEFATQVPVLRVS
FT                   VNVGNSTGSSGLETNLAPSMTIGTGFVGRSSIGENLRPDNLMNWARIAYNSAPGVAMPS
FT                   FAGIDPWRSPAGPVPEYPRASNDRGAPPVSPSRSAPAARRAADPSIEALRAELRALVVE
FT                   ELAQLIKR"
FT   gene            complement(198569..199846)
FT                   /locus_tag="Mjls_0187"
FT   CDS_pept        complement(198569..199846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0187"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   mmc:Mmcs_0198 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96000"
FT                   /protein_id="ABN96000.1"
FT                   /translation="MYDYGTFSFESKTQVLDRAKAFWNPDKTQFWTDAGVDLVIDRRED
FT                   YFLWDMGGRRLIDMHLNGGTYNLGHRNPEVMQAVSQGMEIFDVGNHHFPSVARTALAQR
FT                   LVETAPASISKVAFGSGGGEAIDIALKSARHATGRRKIVSIIKAYHGHTGLAVATGDER
FT                   FAKLFLSDRPDEFIQVPFGDVAAMEQALKGNDVAAVIMETIPATYGFPLPPPGYLEAVY
FT                   ALTQKYGSLYIADEVQTGLMRTGELWAITKHGIEPDILVTGKGLSGGVYPITAALLGDR
FT                   AAQWLDQDGFAHISTFGGAELGCVAAIKTLEITTRPEVRSMVHYIADIFDNGLRRIQAD
FT                   YPDWFIGIRQNGVVIGLEFDHPEGAKFVMRELYENGVWAIFSTLDPRVLQFKPGLLLGR
FT                   DLCEDVLDRLEVAVGRAMTAARKGRP"
FT   gene            199997..201529
FT                   /locus_tag="Mjls_0188"
FT   CDS_pept        199997..201529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0188"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mmc:Mmcs_0199 amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96001"
FT                   /protein_id="ABN96001.1"
FT                   /translation="MADQAVTPQKTPAQGVQRLKRNAVGTLGVIFMAVATAAPITAMVG
FT                   NVPIAVGFGNGSHAPAGYLVATIVLGLFAIGYATMAKHITATGAFYGYISHGLGRIVGM
FT                   ASGLLITMAYIVFEASLIGIFAFFFKNFLSSQFGVDVHWIIPALLMLALNAILTYFDVN
FT                   LTAKVLGVFLVTEIVMLALGALAVLFQGGGPEGFVVAETLNPIGAFTPAAIAGASAGLG
FT                   LFFAFWSWVGFESTAMYGEESKDPKRIIPRATMIAVLGVGLFYVFVSWMAIAGTGPSKA
FT                   LELAQDADTSSEIFFGPVRSTYGEWAITLFNILLVTGSFACGMAFHNCASRYLYALGRE
FT                   GLSSGLQKTLGATHHKHGSPYIASFVQSGIALILVLGFFAAGMDPYVHMYTLLAILGTM
FT                   AILIVQSLCAFAVIAYFHFHKEHPSSAHWFKTFLAPLMGGIGMLYVVYLLWEHKESAAG
FT                   TASGTLLFKLTPWIVVAIFVFGAAMATYFKYCDARRYDLIGRIVYDDSEIRD"
FT   gene            complement(201526..202431)
FT                   /locus_tag="Mjls_0189"
FT   CDS_pept        complement(201526..202431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0189"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mmc:Mmcs_0200 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96002"
FT                   /protein_id="ABN96002.1"
FT                   /translation="MPNTHIHAFHPDLRSVARYIPRQVITPVTLPVVRMVTRLQGKRTP
FT                   KDIEELTLSSGVRVRLFRPTGVPVPAPALLWIHGGGYVIGTAAQDDELCRRFCRELGIT
FT                   VASVDYRLAPEHPYPTPVEDCYDALTWMARLPAVDPKRVAIGGASAGGGLAASLALLTR
FT                   DRGEIEPVAQLLVYPMIDDRTVERQGLDHPGHRLWNQASNKFGWSAYLGDADPDVAVPA
FT                   RREDLAGLPPAWVGVGTLDLFHDEDLAYAERLRAAGVPCQVEVVQGAFHGFDGVLPKAD
FT                   VSRAFFRSQCDTLRQAFASG"
FT   gene            complement(202537..204705)
FT                   /locus_tag="Mjls_0190"
FT   CDS_pept        complement(202537..204705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0190"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0201 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96003"
FT                   /protein_id="ABN96003.1"
FT                   /translation="MRKSALAITDDHIALAESAQGRLDRSGSRAAARATLEDGPAHPAD
FT                   LWRAAADLGWHGLAVAEQFGGAGFGLSELAVVLEMQGRDLTPGPFLPSVAASVVLDRCA
FT                   GDDVRAELLPGLSSGATVAALGLTGTLTVGADGSVTGKCPAVLGAPDADLLVLAAGEDV
FT                   VVLDAKDAGVTVTALDGIDTTRSIGTVAVRDVHVPAGRVLTGAARRAQTVFRILGAAEA
FT                   AGVGWACLDMAVEYAKVREQFGRTIGTFQAVKHHAANMLVDAEQTTAAVWDAARADDLD
FT                   SAWFPAAVAASHAIRASVFLAQNNIQLHGGIAFTWEHDAHLYLRRARSLAALLADGTDP
FT                   LVDIVEAQRSGRARGASFALPAEADEYRAAARAAAAEWAALPPDRRRDFLVDSGYLVPH
FT                   WPKPWGRAAGTLEQLVIEEELRDVDIPDMGITGWVTLTIAQAGTDDQRERWVEPVLRGE
FT                   VMWCQLFSEPGAGSDAAAVRTAAKRVDGGWRVTGQKVWTSLAHLCEWGLATVRTDPDAP
FT                   KHAGVTMMAIDMSADGVTVNPLRGLTGDSHFNEVFFDDVFVPDADVVGDVNKGWLVARA
FT                   TLGNERISIGGGSGAPTGFSADDLVALLDSAPADVAAAHVRRAGAVIAEAHTLRLLNLR
FT                   RASRAIAGAEPGPEGNVTKLLVAEQCQRQTELGMDLAGTAAVVGGAPTLTRAYLGNRAM
FT                   TIAGGTSEITRNTIAERILGLPRDPLLK"
FT   gene            204867..206090
FT                   /locus_tag="Mjls_0191"
FT   CDS_pept        204867..206090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0191"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mmc:Mmcs_0202 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96004"
FT                   /protein_id="ABN96004.1"
FT                   /translation="MTVRPDTRYPGPTLWSRARWLLNAKPADHMLAMSVASASLPVIGK
FT                   HLEPLGALAAMGVWGYRQMPELLSASAKSWFDPGNAEVRQRERDMTHEVSHQALRGVVP
FT                   ASDLAIDWPAPEKVPPLWKTFEHRRNVHKSSVRYGPLPSQLLDVWRPKELPAEPAPVLV
FT                   FVPGGAWVHGSRLLQGYAMMSHLAEMGWVCLSIDYRVAPHNPWPAHLHDVKTAIAWARA
FT                   NVDKFGGDRNFVAIAGASAGGHLAALAGLTINDPEMQCELPEGSDTSVDAVVGIYGRYD
FT                   WEDRSTAERARFVDFLERVVVRRKISRHPELFRKASPMAQVHSEAPPFLVIHGSGDSVI
FT                   PVWQARSFVDKLKAKSRSVVSYMELPGAGHGFDMIDGARTGSMATAIGLFLNQIHKNRT
FT                   LVGAREVI"
FT   gene            206117..207535
FT                   /locus_tag="Mjls_0192"
FT   CDS_pept        206117..207535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0192"
FT                   /product="Diacylglycerol O-acyltransferase"
FT                   /EC_number="2.3.1.20"
FT                   /note="PFAM: protein of unknown function UPF0089; KEGG:
FT                   mmc:Mmcs_0203 protein of unknown function UPF0089"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96005"
FT                   /protein_id="ABN96005.1"
FT                   /translation="MKRLSGWDAFLLYSETPTVHMHTLKLAVIQLDDLGGRNFGVEEFR
FT                   QVIHSRLYKLDPFRYELVDIPFKFHHPMWRENCEVDLEYHIRPYRVESPGGRRQLDEAV
FT                   GRIASTPLDRSRPLWEMYFIEGLADGRIAVLGKIHHALADGIASANLMARGMDLQSGPQ
FT                   RDRDSYATDPPPGRGELVRSAFRDHLRQIGKLPATWRYTAEGLQRVRRSNRKLSPELTR
FT                   PFTPPPSFMNHKVDGVRKFATATLALADIKQTAKHLGVTLNDLVLALSAGALRQLSLRY
FT                   DGHADHPLLASVPVSFDFNPDRISGNYFTGVLVCIPVQVEDPLQRVQECHKAAASAKEG
FT                   HHLIGPELVSRWSSYFPPAPAEALFRWLANKDGQNKVLNLPISNVPGPRERGRVGGALV
FT                   TEIYSVGPLTTGSGLNITVWSYVDQLNISVLSDGATLEDPHELTDAMVEAFVEIRTAAG
FT                   LSDELTVVETAMAP"
FT   gene            complement(207540..208784)
FT                   /locus_tag="Mjls_0193"
FT   CDS_pept        complement(207540..208784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0193"
FT                   /product="LipO"
FT                   /note="KEGG: mmc:Mmcs_0204 LipO"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96006"
FT                   /protein_id="ABN96006.1"
FT                   /translation="MARRRFPLLRAVAELVNAANGVRPLGRDGYITLPVFAFGWPTTEA
FT                   APLYLAGSMLDAGRRGLRGDFRGGRGRIALLVTAVAWALLGVIIRRNVTSKRYFDEPLR
FT                   ETLGDDYEMVAARAQPARPRNLIGVPPNELTRRRYVEKAGTVQYGPHPKVNFADIWRRA
FT                   DLPRDGRAPVLLQVPGGAWAIGMRRPQAYPMLSHMAEQGWIGVSIDYRVSPRHTWPDHI
FT                   VDVKRALAWIKEHIAEYGGDPDFVAITGGSAGGHLASLVALTPNDPQYQPGFEDADTSV
FT                   VAAVPIYGRYDWFSVEGPGRREFIAFLQKFVVKKRILEHRQEYLDASPITRVRPDAPPF
FT                   FVLHGQDDSIIPVGEGREFVDALRAVSRSVVAYAEIPHAQHAFDFFGSPRAHYTANAVD
FT                   QFLSWVNATRARAVA"
FT   gene            complement(208957..209751)
FT                   /locus_tag="Mjls_0194"
FT   CDS_pept        complement(208957..209751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0194"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   mmc:Mmcs_0205 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96007"
FT                   /protein_id="ABN96007.1"
FT                   /translation="MPSSDIAKWDPGFTERVMSVLRPLLKTYHRAEMRGLESFPSAGGA
FT                   LVVSNHSGGLFAMDVPVFAAGFYEEFGYDRPVFTLSHDLLMTGPTAEFFTKTGFIRANH
FT                   ENADEALRAGGVVIVFPGGDYDVYRPTLAESKIDFGGRTGYVRAALNAGVPLVPTVSIG
FT                   GQESQFYLTRGEWLAKTIRLDKLLRAKILPISFGFPFGLSAVLPVNLPLPTKIVTRVLP
FT                   PIDIVAEFGEDPDVDEVDAHVRHVMQRALDELAAERRFPVLG"
FT   gene            209866..210201
FT                   /locus_tag="Mjls_0195"
FT   CDS_pept        209866..210201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa23750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96008"
FT                   /protein_id="ABN96008.1"
FT                   /translation="MATRDELPLKDYDQLALPDLRHRIRSLDEPHLRLLFDHETEHGNR
FT                   IPVLEVLHARLKELHGGAEPSGGDQSNAPGVSGTPGGSRVQESTAAEANTPLRHGVANQ
FT                   TPSRGKP"
FT   gene            210308..211255
FT                   /locus_tag="Mjls_0196"
FT   CDS_pept        210308..211255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0196"
FT                   /product="pentapeptide repeat containing protein"
FT                   /note="PFAM: pentapeptide repeat containing protein; KEGG:
FT                   mmc:Mmcs_0207 pentapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96009"
FT                   /protein_id="ABN96009.1"
FT                   /translation="MKVSARSYLIAGVSLASAGLIVGGSNTPVLDTTRADITVAPMAAT
FT                   TTAPQLDGPGVGGAASAFGSVGAAFVAPAPAPDVTARIALPEVDGLDPEAGRPGVQLSL
FT                   LTGTPNLGYGNEGLFNAGVNNDGDFNIGGDNDGDFNIGTGNVGDFNIGYDNDGDFNIGG
FT                   DNEGNFNVGFDNRGGERNFGAGNTGSYNVGFFNTGEFNFGVGNTGVGNVGFFNTGDYTV
FT                   GAFNVGIRYAGNPGISTGRTVADTEDEDPGTSALRTRAAQSEDDNDDDAAVTRSEKNDD
FT                   ASTSDSTSTDKAGDTRAAKASDDKGDGNEGGDDE"
FT   sig_peptide     210308..210415
FT                   /locus_tag="Mjls_0196"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.393 at
FT                   residue 36"
FT   gene            211286..211888
FT                   /locus_tag="Mjls_0197"
FT   CDS_pept        211286..211888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96010"
FT                   /protein_id="ABN96010.1"
FT                   /translation="MRHVFTGHIAGFGTDAGVRVVVGCWQTSPFGAFTDVMVQQPDERR
FT                   VLLAPDRAVADFVAATYHFDRVEVGPVAATLEPDRLTVHSAVLDVEVSIGGPAPLDRLL
FT                   RLVPARLATAPWWLRAVDPVASRLVRGVHTAGTAGHGRREFYGVRRSRRITALVGRYRD
FT                   VDLVGLQPLRPPVSFGFASAPAAPQLVAVTTTIIDAG"
FT   gene            211927..212172
FT                   /locus_tag="Mjls_0198"
FT   CDS_pept        211927..212172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96011"
FT                   /protein_id="ABN96011.1"
FT                   /translation="MDTVTRLRHAQQRLLKAQRRLWLAQLAMWPTLIVTGVAVAAGAVW
FT                   LLRRRSAGGRHELPESPGAHRVETVAEHDGQGVIPN"
FT   sig_peptide     211927..212049
FT                   /locus_tag="Mjls_0198"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.679) with cleavage site probability 0.575 at
FT                   residue 41"
FT   gene            complement(212176..213006)
FT                   /locus_tag="Mjls_0199"
FT   CDS_pept        complement(212176..213006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0199"
FT                   /product="protein of unknown function DUF1206"
FT                   /note="PFAM: protein of unknown function DUF1206; KEGG:
FT                   mmc:Mmcs_0210 protein of unknown function DUF1206"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96012"
FT                   /protein_id="ABN96012.1"
FT                   /translation="MTDETGAAGAVRTATNHRGAQVAARVGYLINGILHLLIAYIIFRI
FT                   AIGSGHNDADQSGALAALAQTKGGFLALWGVAIALVPLTLWRLAETILGLHPSEHHDPD
FT                   PDPDDFLMVNRLKALGLAVVYAAVAAMAVQFALGSRHSSAERSVGLSIWLMRTPEGKAV
FT                   LAVIGLGVTAVGCYFAFKGASRRFRDDLNISGGRVLTVLGASGHVAEGLVLAVAGVLVV
FT                   VASVRADPSKATGLDGAVKALGQMPFGSVLIGVAAAGFAAYGLYSFALTRYARM"
FT   gene            complement(213022..213216)
FT                   /locus_tag="Mjls_0200"
FT   CDS_pept        complement(213022..213216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0200"
FT                   /product="CsbD family protein"
FT                   /note="KEGG: art:Arth_3578 CsbD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96013"
FT                   /protein_id="ABN96013.1"
FT                   /translation="MGVGDKARNKMQQIQGRMRATTGSAINDPGMRARGRGDERMAHLK
FT                   GAGEKLKDAFRSRRRPRGY"
FT   gene            213342..214187
FT                   /locus_tag="Mjls_0201"
FT   CDS_pept        213342..214187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0201"
FT                   /product="Arylamine N-acetyltransferase"
FT                   /EC_number="2.3.1.5"
FT                   /note="PFAM: N-acetyltransferase; KEGG: mmc:Mmcs_0211
FT                   arylamine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96014"
FT                   /protein_id="ABN96014.1"
FT                   /translation="MGHMTETAVDTRAYLTRIGYRGAGDPTLATLRALIAAHNRSIPFE
FT                   NLDPLLGTPVADLSATALTDKLVYRRRGGYCYEHNGLMGYVLEDLGFGVERIAGRVVWM
FT                   RRDDTLPAQTHQLLTVTVPEVSGRYLVDVGFGGQTLSSPLRFETGVEQPTRHEPYRIRD
FT                   HGEGYVLESLIRGEWRPLYLFADRPQPLIDLEVGSWYVSTHPASVFVVGLTAALVTDEA
FT                   RVNMRGRHLTVHRAEGSEQIRFDTAAQVLDALDERFGIDLTDLGDRAAVEQRIHEVLDS
FT                   "
FT   gene            complement(214205..215215)
FT                   /locus_tag="Mjls_0202"
FT   CDS_pept        complement(214205..215215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0202"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mmc:Mmcs_0212 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96015"
FT                   /protein_id="ABN96015.1"
FT                   /translation="MSDELRQLVDDLARRSYDARMGRHTRPESFDSELWQHLEETGLSR
FT                   LTTAEDAGPAESAIVLAGLARRSAAVPAAETDLLAAWLAGRAGLEVPDSGPLTVAVCTG
FT                   ARRGGRITGTARQVPWPRDATIVAAVRTEDGLHATVLDAPDIADGVDLAGQPRGVVTID
FT                   VPESACARTEPELAEELLRRGAWARCVQTIGAFDAAAELTAAHTRERVQFGRALSRFQA
FT                   VQHALAGMAGEIERARATVDLAVAAAAQYGFDSAATHYAVTVAKVTVGRAVEPVTTIAH
FT                   QLHGAIGVTVEHPLWLSTMRARSWVDEFGTTEQHARVLGRLALSAADPWDVLVGP"
FT   gene            complement(215212..216369)
FT                   /locus_tag="Mjls_0203"
FT   CDS_pept        complement(215212..216369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0203"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0213 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96016"
FT                   /protein_id="ABN96016.1"
FT                   /translation="MGELEALCANDDDLAALRTSIREFLAADRAAHGWQPAVDCWLAAW
FT                   DPEFSVRLAAAGFLGLTIPTEYGGHGLGHLHRYVVTEELLAHGAPVAAHWIADRQVAPG
FT                   LLAYGTGEQRRRLLPRIAAGRLSSAIGMSEHGAGSDLAAVATRATEVDGGWRLDGTKVW
FT                   TSGAHVADQVVVLARSAPVDPDHRHAGFSQFIVPTDAPGVTISPIVLMNGEHHFNEVLF
FT                   DGVFVPHADVLGEIGNGWHQVTAELGFERSGPERILSTATLVFEAVAALGRAGVDDRTA
FT                   AEVGDLMARMVSLRQLSISVARELTAGRDANTRAALVKDLGTRFEQESVEIVAGLLTSL
FT                   DEDAPEAERLRGLLATGRLHAPLFTLRGGTNEVLRGVVARGLGVR"
FT   gene            216542..217363
FT                   /locus_tag="Mjls_0204"
FT   CDS_pept        216542..217363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0204"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="SMART: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: mmc:Mmcs_0214 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96017"
FT                   /protein_id="ABN96017.1"
FT                   /translation="MARSSYASEFHFSREVRRLTGEPPAALRRRIMLERAAWRLRRGEP
FT                   VAAVAADEGWSSPEVFSRAFRRTFGVPPSRAADVGFRVPAPNGLHFHPPQSLWLDGDGT
FT                   TKEPDPSRLMVAHDVADTAYLIDRARELSEDQWWREVAPGQVVLHWDGPEPSVGAVLGA
FT                   LVWTKEVWLATIEGRDFPDRSRSTVDQLAVRHADIGKRWSAMVSEYSAAGRMGDTVIDA
FT                   LCDPPESFQLYGIVAHVLTFSAHRRGLARTMLAALGVPTEQGDPLDWMRRH"
FT   gene            217365..217898
FT                   /locus_tag="Mjls_0205"
FT   CDS_pept        217365..217898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0205"
FT                   /product="bifunctional deaminase-reductase-like protein"
FT                   /note="KEGG: mmc:Mmcs_0215 bifunctional
FT                   deaminase-reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96018"
FT                   /protein_id="ABN96018.1"
FT                   /translation="MATVYYTASSLDGYIVDADDSLDWLISRDIDPDGPFHYDAFVDQV
FT                   GALVMGAATYEWIVKNQPGEWMYSQPTWVVTHRPDIVAAGHPVHTFAGDVTELHPELVA
FT                   AAGGKDVWVVGGGELAAQFVAASLVDEMIVSYAPCTLGAGSPVLPIRSEWELVESAVNR
FT                   EFVCARWRVAALTG"
FT   gene            complement(217888..218505)
FT                   /locus_tag="Mjls_0206"
FT   CDS_pept        complement(217888..218505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0206"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP3661c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96019"
FT                   /protein_id="ABN96019.1"
FT                   /translation="MTRTSTKRGSTRTNMLIGAAEVLRERGAAGVTIDEVLQRSGAPRG
FT                   SVYYHFPEGRSQIVAEALEYAGESITSLIDEAAANGGRYLVEHFVDFWDRVLAESDFTA
FT                   GCPVVAAAIGSAEDGPQLTSVAGAIFGHWREALTRAFEVDGCEPSEAASLAITSIAALE
FT                   GAVVLCRATRDLDPLRQVHTQLEFLLKSREFIRRNGVPTVTQ"
FT   gene            complement(218860..220335)
FT                   /locus_tag="Mjls_0207"
FT   CDS_pept        complement(218860..220335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0207"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0217
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96020"
FT                   /protein_id="ABN96020.1"
FT                   /translation="MTQTVQEHKTTWDKLFIGGQWVAPSTSDVIEVFSPATGQKVGQVP
FT                   LAAEADVNAACAAARKAFDEGPWPRMSPDERAAVLGAAVKLMEERGAELKYLLAAETGQ
FT                   PQTIVDMMQYGAAMSSFTYFAGAADKFQWSEIRDGIYGQTLVTREPIGVVGAITAWNVP
FT                   FFLAANKLGPALLAGCTVVLKPAAETPLSVFAMAQMFAEAGLPEGVLSVVPGGAETGRA
FT                   LTANPEIDKYTFTGSSAVGKEIGKLAAEKLKPCTLELGGKSAAIVLEDADLDSTLPMLA
FT                   FSGVMNSGQACVAQTRILAPRSRYDEVVEKLANFVSAMPVGLPDDPNAAIGPLISEKQR
FT                   ERVESYIKKGTEEGARIVTGGSRPEGLDSGWFVQPTVFADVDNSMTIAQEEIFGPVLAV
FT                   IPYETEDDAIRIANDSVYGLAGSVWTTDNKKALEVASKIRTGTYAVNMYAFDPGAPFGG
FT                   YKNSGIGRENGPEGIEQYCQAKSTLLPFGYTPE"
FT   gene            complement(220382..221140)
FT                   /locus_tag="Mjls_0208"
FT   CDS_pept        complement(220382..221140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0208"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mmc:Mmcs_0218 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96021"
FT                   /db_xref="GOA:A3PSZ4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PSZ4"
FT                   /protein_id="ABN96021.1"
FT                   /translation="MSATELFARRATLARSVRLLSEFRFEQSDPARFYGALADDTAAMV
FT                   ADLWQAATETTPGGRTVLDVGGGPGFFAAAFARRGMEYVGVEPDPREMHAGPAAQAGGR
FT                   YVRASGTSLPFADGSVDVCLSSNVAEHVPDPWRLGNEMVRVTRPGGLAVLSYTVWLGPF
FT                   GGHEMGLTHYLGGARAADRYTRKHGHRPKNDYGSSLFAVSAHDGLEWAASTGALIAAFP
FT                   RYHPRWAWWTNAVPGLREFVVSNQVLVLQP"
FT   gene            221177..222337
FT                   /locus_tag="Mjls_0209"
FT   CDS_pept        221177..222337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0209"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mmc:Mmcs_0219 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96022"
FT                   /protein_id="ABN96022.1"
FT                   /translation="MSARPLRSVLLLCWRDTGHPQGGGSEMYLQRIGEQLAASGVRVTL
FT                   RTASYPGAARREVVDGVHVSRGGGRYSVYPWALLVMALARVGLGPLRGVRPDVVVDTQN
FT                   GVPFLARLVYGRRTAVLVHHCHREQWPVAGPVLGRLGWFVESVVSPRVHRRAQYLTVSL
FT                   PSSRDLTDLGVDGSRIAVVRNGLDEAPASTLTLPRSVTPRIAVLSRLVPHKQIEDALDA
FT                   VAALRPHIPDLHLDVLGGGWWQQKLVDHARLSGISDAVTFHGHVDDVTKHEVLQRSWVH
FT                   VLPSRKEGWGLAVTEAGQHAVPTIGYRSSGGLTDSIVDGVTGLLVDDRDELVEALRQLL
FT                   GDHVLREQLGAKAQARSVEFSWRQSASAMREVFDAMLSGRYVSGVV"
FT   gene            complement(222419..224014)
FT                   /locus_tag="Mjls_0210"
FT   CDS_pept        complement(222419..224014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96023"
FT                   /protein_id="ABN96023.1"
FT                   /translation="MTAPLLPPGYLLLRDAVSTPRSYLTDAALGLSEAAPRALPQDFAI
FT                   ALASHVLDGGVVVKVLLVAGLWAAGWGAARLASTVVPDAGVAGQCVAVTVAVWNPYVAE
FT                   RLLQGHWSLLVGYGCLPWVAAAVLRLRDGSGPWWPLPFWIAVAGLTPTGLLLAAVVAVV
FT                   SVCAPGAGRRRIAVLGAALGAAVVSALPWLVAAAVSGSLAVSPAAGLPAFAARAEPGLG
FT                   TLGSLAGLGGIWNADAVPGSRTTLFAVVATVVLLAVVLAGAWVVRHRPAARPLLILAAA
FT                   AVLFPAVMATGPGLAVLEHTVRALPGLGVLRDGQKWVALAVPGYAVAGAGAVLAVRRVS
FT                   PAALGAVCCAALIAVLPDLAFGVGGQMRAVQYPPGWAAAAAVINADPRPVAVLPPDSMR
FT                   QFAWAGEAPVLDPLPRWVRAEVLSTGDLVIGGTTVPGEGVRARAVQDLVMRGAPVSELA
FT                   DAGVGWVVVESGSAALDLPVAYRDDDLAVYRVGGDRPRSADRGLLIGAHVAWLAVLVGS
FT                   LVAGVVGLRRWPVA"
FT   gene            complement(224062..225264)
FT                   /locus_tag="Mjls_0211"
FT   CDS_pept        complement(224062..225264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96024"
FT                   /protein_id="ABN96024.1"
FT                   /translation="MNRAVALRIAACGLMGLGAALLIAALLLSTYTKGKISKVPLDIDT
FT                   TLISDGTGTAFDPASLLGERFVVDRDIPMAFQQQITVESPSNADVVTLQVGSTLRRTDK
FT                   QQDNGLLLAMVDTVTMDRSSAMAVTSESNPGGAVQKPRAIEDDQPPTNIALPHDGLTYR
FT                   FPFDTEKKTYPLFDPIAQKAYDANYDGEEDVNGLTTYKFTQNVGYDAEGKLVEPVKYAS
FT                   LYEDDADAQVTARAALWGVEGDPEEPITMSRFYAAERTLWVDPVSGTIVKSDEHGYHYY
FT                   ARDALRPEVTFADYKVTTNEESVESQVASARSERDRVALWGRILPITFTAVGLVLLVGG
FT                   ALLGSFSLRAESALIDPGLDEADHGFFQRDDAGEPVPGAEAKTEKLPAQRPTDLPPDRP
FT                   V"
FT   sig_peptide     complement(225160..225264)
FT                   /locus_tag="Mjls_0211"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.398 at
FT                   residue 35"
FT   gene            225392..226570
FT                   /locus_tag="Mjls_0212"
FT   CDS_pept        225392..226570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0212"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: mmc:Mmcs_0222
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96025"
FT                   /protein_id="ABN96025.1"
FT                   /translation="MTSSAEIGGTRSFLPAVEGMRACAAIGVVVTHVAFQTGHTSGADG
FT                   RFFGRFDLAVAVFFALSGFLLWRGHAAAARGLRTAPPTAHYLRSRIVRIMPGYLVAVVI
FT                   ILSLFPDTKPDLTVWLANLSLTQIYVPLTLTAGLTQMWSLSVEVSFYLVLPLLALLVRR
FT                   VPVRARIPVIVGAAVASLFWVYIPSDPDSGHNLWNWPPAFFSWFAAGMVLAELTVTQVG
FT                   WAHRLARRRILMAAIVVAAFSVAASPLAGREGLQPGTIGQVILKTAMGAVVAGALLAPL
FT                   VLDRPDTPHRILGSRVMVTLGRWSYGLFIWHLAALAMVFPMVGEFAFNGHMPSVLALTL
FT                   LFGFALAAVSYALVESPAREALRRWEFRRATPTHRAPPLDSSVSDVPEPISR"
FT   gene            complement(226539..228014)
FT                   /locus_tag="Mjls_0213"
FT   CDS_pept        complement(226539..228014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0213"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0223 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96026"
FT                   /protein_id="ABN96026.1"
FT                   /translation="MVDGVPPIGTQFSALAARNPDAPALTCAGRTVTRGELDATTNRLA
FT                   RAYAELGVRQGDYVTILLPNSIAWVEAVLATWKLGAVPQPLSARLPDAELSALLALRPP
FT                   ALLVGRVDPNDVSPSVPADFTPDPALPADPLPEAVSPAWKSMASGGSTGRPKLIEAGGD
FT                   SRVPSAIGLPLGAEDGDVNMVSVPLSHNTGFTTFAIGLLMGHHLVLMPRFEPHEFLRLV
FT                   SEHRVTFLTTVPTIMQRLLPVYRADPDAYDLSSIRRFWHVGAPCPPAVKEAWIGLLGPQ
FT                   ALWELYGGTELQALTFISGDQWLTHRGSVGTVVAGEMTVLDDDGNTCPPGVVGEIYMRR
FT                   SPGAAPTYRYIGSTAKSRDGWDSLGDLGYFDEDGFLYLNDRRVDMFTVGGRNVYPAEIE
FT                   SALSAHPDVLSCLVVGVPDDDLGQVPHALVQRAPGSALDEAAVTAFVAERLAGYKVPRT
FT                   VEFSEHPLRDDAGKARRSAVRAEVIARSARARR"
FT   gene            complement(228016..228993)
FT                   /locus_tag="Mjls_0214"
FT   CDS_pept        complement(228016..228993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0214"
FT                   /product="Aryldialkylphosphatase"
FT                   /EC_number="3.1.8.1"
FT                   /note="PFAM: aryldialkylphosphatase; KEGG: mmc:Mmcs_0224
FT                   aryldialkylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96027"
FT                   /protein_id="ABN96027.1"
FT                   /translation="MPQLNTAAGTIDTAGLGVTLMHEHVFIMTTEILLNYPDAWGDEAK
FT                   READAIARLDELKARGVDTIVDLTVVGLGRYIPRIARIAAATDLNIVVATGLYTYNDVP
FT                   FFFHFTGPGTALGGPEVMVDMFVRDIEHGIADTGVKAAILKCATDEPGLTPGVERVLRA
FT                   VAQAHRRTGVPISTHTHAATRRGLDQQRIFAEEGVDLSRVVIGHSGDTTDLDYLEALMA
FT                   AGSYIGMDRFGVDAFLGFEDRVATVAALCQRGHAGQMVLSHDASCYFDALPEETVAQTM
FT                   PNWHYLHIHNDVLPALRARGVTDEQLTTMLVDNPRRIFEHSGGY"
FT   gene            229090..230691
FT                   /locus_tag="Mjls_0215"
FT   CDS_pept        229090..230691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0215"
FT                   /product="protein of unknown function DUF894, DitE"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   major facilitator superfamily MFS_1; KEGG: mmc:Mmcs_0225
FT                   protein of unknown function DUF894, DitE"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96028"
FT                   /protein_id="ABN96028.1"
FT                   /translation="MATPQTRPVVSSWAPFSSPVYRALWIAQFVSNLGTWMQTVGAQWM
FT                   LVGDPGAAVLVPLVQTATTLPIMLLALPSGVLADLIDRRRLLIATQAAMASGVAALAML
FT                   TGFGLATPTVLLLLLFLIGCGQALTTPAWQAIQPELVPREQIPAAAALASMSVNGARAI
FT                   GPAVAGVLVSLSGPTTVFALNAFSFIGIVMVLLWWRRPVEEATMPLERPISALSAGRRY
FT                   IRSSPVIRRILLRTVLFTAPASALWGLLAVIAANQLNLSSSGYGLLLGALGVGAVLGAV
FT                   VLSRLHARFGQNQLMVMGAVGFAGATVVLATVHVLAAVLAALVVGGVAWLLTMSTLNAS
FT                   MQLSLPAWVRARGLSVYQLVFTGSQAIGSLVWGVVAGATSGVTALLISAALLIVCGVSV
FT                   AWWPLHPATGTLDVTPSAHWGEPALVFEPDPQDGPVVVLQSYVVAPEDEAGFLALMQRV
FT                   RRSRQRTGAMEWGIFRSGESADTFVELFLVRSWDEHLRQHLVRQTALDLALEREIEGYV
FT                   HGESTLRHFIAVRNGR"
FT   gene            complement(230666..234820)
FT                   /locus_tag="Mjls_0216"
FT   CDS_pept        complement(230666..234820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0216"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0226 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96029"
FT                   /protein_id="ABN96029.1"
FT                   /translation="MAALVLTFAQSPGQISPDTKLDLTANPLRFLARAANLWNSELPFG
FT                   QAQNQAYGYLFPHGTFFLAGDLLGLPGWVTQRLWWALLLTVGFWGVVRVAEALGLGSPT
FT                   SRVIGAVAYALSPRVLTTLGALSSETLPMMLAPWVLLPVILALRGEGSVRRLAARSAGA
FT                   IALMGAVNAVATLTGCLAAVLWWACHRPNRLWWRFTAWWFGCAALAVLWWVVPLLLLGR
FT                   ISPPFLDFIESSGVTTQWMSLTEMLRGTGSWTPFVAPTATAGSTLVTGSLAVLATTLVA
FT                   AAGMAGLALRSMPARGRLITMLLVGVALLAAGYAGGLGSPFADAVQAFLDGDGTPLRNL
FT                   QKLDPVLRLPLALGVIHLLARIPLPGSAPRPVWLHAFAHPEKDRRVAVGIVVLAALTAA
FT                   TSLAWTGRLTPPGAFTAIPGYWHETAAWLDAHNTGDPTAGRVLVAPGAPFATQVWGSSH
FT                   DEPLQVLGESPWGVRDSIPLTPPETIRALDSVQRLFAAGRPSAGLADTLARQGISYVVV
FT                   RNDLDPESSRSARPVLVHRAIDGSPGLTRVAQFGDPVGPGTLEGFVSDSGLRPRYPAVE
FT                   IYRVDAQHNPSTPYLVDAEAMARVDGAPEALLRLDERRRLLDRPPLGPMLLTADAERAG
FT                   LPAPLVTVTDTPTARETDYGRVDDHSSAIRTPDDPRNTFNRVPDYPSAGADVVYGRWTG
FT                   GRLSVSSSAADSTALPHVAPATGPTAAIDADTSTSWVSNALQAALGQWLQVDFDKPVTN
FT                   ATITVTPSATAVGAQVRRMEVATVNGTSTLRFEEAGKPLTVALPYGETPWVRITATGTD
FT                   DGSAGVQFGITDLSVTQYDANGFATPIQLRHTVEVPGPPAGSAVGLWDLGSELLGRQGC
FT                   VDSPDGVKCAAAMALSPEEPVNLSRTLAVPAPTSVQPTLWVRARQGPRLAELIRQPDTT
FT                   VVAGDADALDVLGSSYAAGDGDPRTAWTAPQRVVQHRTPPTLTLRLPAPTEVAALRITP
FT                   SKTEPPAHPRMVAVDLGNGPQARRLSGDGDTETIRLTPHRTDTIAVSLLDWNDIIDRTS
FT                   LGFDQLKPPGLAEVTALDRRGDPIGAADAGENRGRTVDVPCGAGPIIGVAGQFVPTRVT
FT                   ATVGALLDGAPVLARPCRTEPIALPAGQQELLVSPGATFVVDGVQLAAPAARDITPAPT
FT                   TPADTGAWGPDRREVRVVPGQRDRVLVVPESVNPGWQARGSGGDLLTPVVVNGWQQGWV
FT                   VPADTEGAVTLSFRSNTLYRAGLIGGLALLPLLALLVWLPARRRRDDEPAHPWRVPAVA
FT                   AAGGVLAVGAVISGWAGVVVVGGVLGVRYLLRNRSRLLDRFTLGVTAGGLTLAGAVLSQ
FT                   HPWRSVDGYVGFEPGVQLLALVSVAALAASAVPVNARSAPR"
FT   gene            complement(234912..235085)
FT                   /locus_tag="Mjls_0217"
FT   CDS_pept        complement(234912..235085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0217"
FT                   /product="small secreted protein"
FT                   /note="KEGG: mmc:Mmcs_0227 small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96030"
FT                   /protein_id="ABN96030.1"
FT                   /translation="MDRFIVPAAASIVVGLLLGAAAVFGVTLMVQEDSKPPLQAGDPAS
FT                   SVLNRVEYGDRS"
FT   sig_peptide     complement(235008..235085)
FT                   /locus_tag="Mjls_0217"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.655 at
FT                   residue 26"
FT   gene            complement(235111..235626)
FT                   /locus_tag="Mjls_0218"
FT   CDS_pept        complement(235111..235626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0218"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mmc:Mmcs_0228 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96031"
FT                   /protein_id="ABN96031.1"
FT                   /translation="MTAHADVSARESVSEVHRQVGQEIMVIAYDGTANARRAVHYAGRF
FT                   LSANRAVVLTVWSPTLRGSEPPAVDLDGPPDPAPDDEDIAYADAQRTNAEGIELARAAG
FT                   LSAEAMCVAATSTVWNTIIETADTLDADLIVTGTRGTTGLRSLLQSSVADRVLRHGHRP
FT                   VLIVPPGR"
FT   gene            235699..236892
FT                   /locus_tag="Mjls_0219"
FT   CDS_pept        235699..236892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0219"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein;
FT                   KEGG: mmc:Mmcs_0229 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96032"
FT                   /protein_id="ABN96032.1"
FT                   /translation="MAWTRGLCALVATSGMLLACSSPKQEPAAAPADPAITAAPVSAAP
FT                   AVPLKAPVPLAPGAAACGQGAALLSEMTTRDKLAQLLMVGVTGAADARAVVDNHRIGGI
FT                   MIGSWTDLSMMGAPLAEIAASAGPLPLAVSVDEEGGRVSRLASLIGSQPSARALAQSST
FT                   PDQVYGIALERGRAMRGLGVTIDFAPVVDVTGASAAIGDRSFGDDPATVTEYAGAYARG
FT                   LRDAGVLPVLKHFPGHGNASGDSHTEGVVTPPLSELQNSDLVPYRTLTAQAPVGVMVGH
FT                   MQVPGLTESDPASLSPAAYQLLRSGGYGGPGFNGPVFTDDISSMRAITDRYGVADAALR
FT                   ALQAGADTALWVTTAEVPAVLDRLEQAVGSGELTMPRVDQSVLRVAAMKGPNPRCGG"
FT   sig_peptide     235699..235830
FT                   /locus_tag="Mjls_0219"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.573 at
FT                   residue 44"
FT   gene            complement(236900..238354)
FT                   /locus_tag="Mjls_0220"
FT   CDS_pept        complement(236900..238354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0220"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase, major region;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   mmc:Mmcs_0230 Orn/Lys/Arg decarboxylase, major region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96033"
FT                   /protein_id="ABN96033.1"
FT                   /translation="MDSDRHTRAPLFEALRRFVERDQAPFYSPGHKGGRTLDPWFREHI
FT                   AAVDLNNLADLDTLHCPSGPILEAEELIADAWGAKASFILVQGSTGGNITVALSALRPG
FT                   DPVLVQRNAHKSVLAGLVQSGARPIWLTPQWDADFGVAHGLPVDRVEAALTAEAAAALW
FT                   ILHPTYFGTTADIAALTAVCRRHGIPLLADGAHSPHFAFHPDLPAAAETAGAAATVQSV
FT                   HKILSGLSQAAVLHVDTDQLDVPTVRRALQLVQTTSPHFAIMASIDLARRQMVEDGRRL
FT                   LDETLRRARDTAARLAQIPGLRVLSDHDLTGPGSGLHQRDETKLLIGTHGLAADASDIL
FT                   ARLTREHGVQPELAGAGHILCITTIGNTDADMDRLVDGLTDVALAVGRRDGGCPPDVGG
FT                   ALDLAPEIVLTPREAFFADVDTVSLRAAVGRIAAEPITPYPPGIPLVMPGERLSAEVVD
FT                   VLDGLRGAGNPISAADPTLERVTVVR"
FT   gene            complement(238344..239519)
FT                   /locus_tag="Mjls_0221"
FT   CDS_pept        complement(238344..239519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0221"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mmc:Mmcs_0231
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96034"
FT                   /protein_id="ABN96034.1"
FT                   /translation="MPVGDRTDVFAGVAADVPDALAEHLRAVDLVDHHVHGTFNEAVDR
FT                   AGFEAAINEGSTDPVPSFMTQFDSPLGLAIRRWCAPVLDLEPLAGADEYWSRRAEFGPD
FT                   ELSERFLRAAGVSRWVVDTGFKGDLITTPGQMTALSGVPSSEILRLERLTEDLLEAGTS
FT                   PRDYPEAFRSALDEAVADQGTVGVKTIAAYRVGFDVDWSRPSEATAVDSAQRLVARGAP
FT                   LRVDDPALIAFGVHEAAERGLPIQVHVGFGDRDLDLHRTDPLLLLPLLRAMTPVPVLLL
FT                   HCYPFQRQAGYLAQAFDHVNFDVGLAINYLGPRSTALVAEALDTAPFAKQLYSSDAFGP
FT                   PELHLLGSILWRRAMGLVLGDWVRTGDCTEADAIRIVDMIGVHNAERVYGL"
FT   gene            complement(239590..241098)
FT                   /locus_tag="Mjls_0222"
FT   CDS_pept        complement(239590..241098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0222"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mmc:Mmcs_0232 amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96035"
FT                   /protein_id="ABN96035.1"
FT                   /translation="MTQTPPETNLAPETDQLPHRRLPFWVALAMSVALVGPTLAMSGNG
FT                   QGLIGTVGKAIPLVFLIGLIGVSLVGYSFVRLTRHLNHAGSAYGLVGGTIGPRAGFFSG
FT                   FAMLGAYVGFSIGTLALTAAFTNAFIAQLQPDAEDPHQVPWLLVVLVGAGISFLLAGRD
FT                   IRLLAKILLGIEGIGILAMVILVAVIFAKGGAPTTGVDFSVFTFDGVSASAVLSGVVAA
FT                   FLSWAGFEACASMGEETDDPRRNIPRALGGTLLLTGVLFVVVMFAQVIGFGTDEAGLAA
FT                   FQGSGNTLGDLGSTYVGQWFSLLIIFTATVAAFGCHLATSATSGRMLYAFGRDGFGPKA
FT                   LAHIHAETGGPRRATWLVVGVALVVDLICGALDWPDMGTGNDAIDTYFLFAVAGSVCLM
FT                   VCYLLVEIAAAWFVGAPKFVGVHGGTGKVLGLLLPLLGAVVIAVVLWFNVKDAETWSAA
FT                   PLLGLYWCAIGLIIALAASGIAKRVGESLSRELELSPPDGRPVS"
FT   gene            complement(241122..242435)
FT                   /locus_tag="Mjls_0223"
FT   CDS_pept        complement(241122..242435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0223"
FT                   /product="glutamine synthetase, catalytic region"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   mmc:Mmcs_0233 glutamine synthetase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96036"
FT                   /protein_id="ABN96036.1"
FT                   /translation="MPQQDEELRAQGVALIAGSVTDLAGVTRAKYVPVRRLRAFEQSGM
FT                   GVSPSWSVFCVDSGIAFTPDIGVAGDLRIRIDGEHLRIIEDGIAWAPGDLHDQYGRPAP
FT                   LCPRSLLARVEQRAAERGLEVRVGGELECTMLAADSGPASAEPWSPYGIRTSLDRSAFL
FT                   VDLIGAAERAGLAVEQLHTEYGHDQLEMSLAPAGPVETADAIVLARIVIGRAAARHGMK
FT                   ISFSPVPFADAAGNGAHLHLSLTDSAGPLLSGGDGPYGIRPEGGAAIAGVLDTLPDLLG
FT                   VYAGSALSALRLKPGNWAGASACWGLENREAAVRFIAATPGNPHGANAELKLVDPSANP
FT                   YLAAAAFLGSALRGIDRRLPLPPEVPEDPRRSGATPPALPIGQQAALEALENSATAAEL
FT                   LTTPIIEALIAVRRHELTTYGDRPPAETTQALRLAWSC"
FT   gene            242551..243345
FT                   /locus_tag="Mjls_0224"
FT   CDS_pept        242551..243345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0224"
FT                   /product="glutamine amidotransferase, class-II"
FT                   /note="PFAM: glutamine amidotransferase, class-II; KEGG:
FT                   mmc:Mmcs_0234 glutamine amidotransferase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96037"
FT                   /protein_id="ABN96037.1"
FT                   /translation="MCRLLGVVSAVPVSVSDAVGAPTLKDFVALTKIHGDGWGVAAVEE
FT                   AGRSPRVEVSAGSALDDPAFDAATAERRAVASMVHLRWATNGLAVRPENSHPFLADGIA
FT                   MAHNGSIKPMAPLDALLEPGIAATLRGTTDSERYFALIRQHRRTAPTLAEAVRRAVSEL
FT                   RDRYPEASLNALLLGEGQLVAVHAHARSRLPAEDIEEITAADLPTEHLEDYFALRWARP
FT                   DDGTLVIGSTGFGDLDWQPLPPECVTAVSIDDRSMTLHPLGP"
FT   sig_peptide     242551..242616
FT                   /locus_tag="Mjls_0224"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.665) with cleavage site probability 0.321 at
FT                   residue 22"
FT   gene            243358..244221
FT                   /locus_tag="Mjls_0225"
FT   CDS_pept        243358..244221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0225"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: mmc:Mmcs_0235 transcriptional regulator, RpiR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96038"
FT                   /protein_id="ABN96038.1"
FT                   /translation="MPSPTGETVAALAAAALPALSRAERRVGRALLADYPSAGLASAAR
FT                   LAERADVSPPTVLRFAHSLGFEGFADLQVSLRAEISAMSSGPITRLPDAPAAGSPLDRL
FT                   LNQARAQNDRALETLAHLPGSSLEAAVALLADQTRPLFLHGGRFSVLLAQHLGAHLEQL
FT                   RPGVRLLADPSGRDLGAMMELTRRDVLVLFDYHRYQASAVDVAARFHRAGAAVVLITDD
FT                   LACPVAPDAEVVLAASSTVGTVYQSMAAGFLLTELLLPLVMEAIGEPARTRMALWEEQR
FT                   RGELLP"
FT   gene            244265..244921
FT                   /locus_tag="Mjls_0226"
FT   CDS_pept        244265..244921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0226"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0236
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96039"
FT                   /protein_id="ABN96039.1"
FT                   /translation="MAGGTKRLPRAVREQQMLDAAVQMFSVNGYHETSMDAIAAEAQIS
FT                   KPMLYLYYGSKEDLFGACLDRELGRFVDEVRSKIDFSQGARDLLRNAVLSFLTYIDTNR
FT                   ASWMVLYTQATSSQAFAHTVREGRERIIELVSRLLREGTRHPEPDTDFEMMAVALVGAG
FT                   EAIATRVSTGDADVDEAAELMINLFWRGLKGTPSDAAGQERSDSGMSKGAAVASN"
FT   gene            complement(244925..246013)
FT                   /locus_tag="Mjls_0227"
FT   CDS_pept        complement(244925..246013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0227"
FT                   /product="hydroxyneurosporene-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: O-methyltransferase, family 2;
FT                   Methyltransferase type 12; KEGG: mmc:Mmcs_0237
FT                   O-methyltransferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96040"
FT                   /protein_id="ABN96040.1"
FT                   /translation="MATPKVPPVRLARAVERLRHVLDRAHQRSAPPSAVMLEKILGAWI
FT                   SQGITVAADLRVADALADGPLPIGELARRVGANPDALARLMRALIGEGVFTQRRDGRYA
FT                   LNALGRTLCTEATMSVAGMARMIGHPAHREHWSQLLDAIRTGEATVPKLRGMPGFEYLS
FT                   ENRELGEIFNDAMTNLSETAVAPLTAAYDFRGFGTIVDVGGGHGRFLSAILAATPSARG
FT                   VLYDLPQVVEGATELLGSHGVADRLEIVGGSFFDSIPAGADAYVAKNVIHDWPDADALT
FT                   ILRNIRSAAGTGATLLLAEFVIPDHHRAFIGNWTDMEMLMATAARERTEAEYRKLYQQA
FT                   GFRLTRVVPTVAPISLIEGKAV"
FT   gene            complement(246019..246417)
FT                   /locus_tag="Mjls_0228"
FT   CDS_pept        complement(246019..246417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96041"
FT                   /protein_id="ABN96041.1"
FT                   /translation="MIRACLVLSMAAALTVAGTAAAHAQPVPPCTFTLSAPSVVQNADG
FT                   AVVAATVTPLECGWGAEPNYSVACLQLSGNSGPTTCTQSRGRDAARILYAPHIPGAGYT
FT                   ATGRGCGRWVGQPPAHLCQHLGPQNATL"
FT   sig_peptide     complement(246343..246417)
FT                   /locus_tag="Mjls_0228"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.792 at
FT                   residue 25"
FT   gene            complement(246532..247377)
FT                   /locus_tag="Mjls_0229"
FT   CDS_pept        complement(246532..247377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0229"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mmc:Mmcs_0239 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96042"
FT                   /protein_id="ABN96042.1"
FT                   /translation="MGGQPSGTRNLLRAAAGALPFVPRGESLPERTLTVDELAIDPANV
FT                   AAYADVTGLQFGDTVPLTYPFALTFPTVMALVTGFDFPFAAMGSVHIENHITQYRPIAV
FT                   SDTVSAAVHAENLREHRRGLLVDVVTDVEVGNELAWHQVTTFLHQQRTSLSDQPKPPPQ
FT                   KPPKLGPPNALLNITAGQIRQYASVGGDHNPIHTNPIAAKLFGFPTVIAHGMFSAAAVL
FT                   ANIEGQLPGAVEYSVRFAKPVVLPAKAGLYVERTADGGWDLTLRNSKGDPHLTGTVRGL
FT                   "
FT   gene            complement(247379..248740)
FT                   /locus_tag="Mjls_0230"
FT   CDS_pept        complement(247379..248740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0230"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0240 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96043"
FT                   /protein_id="ABN96043.1"
FT                   /translation="MASDIYTQIVHSGPGSFLAKQLGIPQPETLRRYKPGEPPLPGALL
FT                   IAGEGRVVEPLRTALADDYDVVANNIGGRWADKFGGLVYDATGITEPEGLKGLFEFFTP
FT                   LLRNVTPNARLVVIGSDPDEAGTPHEQIVQRALEGFTRSLAKELRRGATASLVYLSPEA
FT                   KTAATGLESTMRFILSGKSAYVDGQVYRVGADDATPPADWDKPLQGKVAVVTGAARGIG
FT                   ATIAEVFARDGAAVVAVDMKAPEGAADELAKVAEKVGGTALTLDVTAPDAVDKIAAHVR
FT                   DHHGGKLDILVNNAGITRDKLLANMDEGRWDSVIAVNLLAPLRLTEGLVDSGVLGEGGR
FT                   VIGLSSMAGIAGNRGQTNYATTKAGMIGLTDALAEKLHDKGITINAVAPGFIETKMTEA
FT                   IPFATREVGRRLNSLYQGGQPVDVAETIAYFANPASNAVTGNTIRVCGQAMLGA"
FT   gene            248851..250152
FT                   /locus_tag="Mjls_0231"
FT   CDS_pept        248851..250152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0231"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: mmc:Mmcs_0241 acetyl-CoA C-acyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96044"
FT                   /protein_id="ABN96044.1"
FT                   /translation="MADSRSMRRVAVLGGNRIPFARSDGAYANASNQDMFTAALGGLVD
FT                   RYHLQGEKLGAVIGGAVLKHSRDFNLMRECVLGSALSSYTPAFDIQQACGTGLQAAIAA
FT                   ADGIAAGRYESAAAGGVDTASDAPIALGDDLRKTLLGLRRAKSNVDRLKLVGKLPAAVG
FT                   IQIPVNSEPRTGMSMGEHAAVTAKEMGIKRVDQDELAAASHRNMAAAYDRGFFDDLVTP
FT                   FLGVYRDNNLRADSSAEKLAKLKPVFGVRHGDATMTAGNSTPLTDGASVALLASEEWAQ
FT                   QHSIEPLAYYVDGETAAVDYVNGRDGLLMAPTYAVPRLLARNGLTLQDFDFYEIHEAFA
FT                   SVVLAHLQAWESEEYCKERLGLDSALGSIDRSKLNVNGSSLAAGHPFAATGGRIVAQLA
FT                   KQLAEKKKQTGQPVRGLISICAAGGQGVAAILEA"
FT   gene            complement(250569..252404)
FT                   /locus_tag="Mjls_0232"
FT   CDS_pept        complement(250569..252404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0232"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0242 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96045"
FT                   /protein_id="ABN96045.1"
FT                   /translation="MSHYKSNVRDQVFNLFEVLGVDKAMGQGDFSELDADTAREMLDEM
FT                   ARLAEGPIAESFFEGDRNPPVFDPKTHSVKLPEPFKKSMRALFDAGWDKAGMPEELGGM
FT                   PMPRALQWALIEHVLGANPAAYMYAMGGGMAHILHNLGTEEQKKWAVLAAERGWGATMV
FT                   LTEPDAGSDVGAGRTKAVKQDDGSWHIDGVKRFITSADSDDLFENIFHLVLARPEGAGP
FT                   GTKGLSLFFVPKFLVDFETGELGERNGAFVTNVEHKMGLKVSATCELSLGQHGVPAKGW
FT                   LVGEVHNGIAQMFDVIEQARMMVGTKAIATLSTGYLNALEYAKSRVQGADMTQMTDKTA
FT                   PRVTITHHPDVRRSLMTQKSYAEGLRALYLYTATFQDTAVAKAVHDVDSELAVRVNDLM
FT                   LPIVKGVGSEQAYAKLTESLQTFGGSGFLQDYPIEQYIRDAKIDSLYEGTTAIQAQDFF
FT                   FRKIVRDKGQALAYVAGQIEQFVKSESGNGRLKAERALLATALEDVQAMAASLTGYLMA
FT                   AQENPAELYKVGLGSVRFLMSVGDLVIGWLLQQQAAVAIGALDGGATGEDKAFYEGKVA
FT                   VASFFAKNFLPLLTSTRQVVEHLDNEIMELDEAAF"
FT   gene            complement(252681..256757)
FT                   /locus_tag="Mjls_0233"
FT   CDS_pept        complement(252681..256757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0233"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; SMART: tyrosine protein kinase;
FT                   serine/threonine protein kinase; KEGG: mmc:Mmcs_1237
FT                   adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96046"
FT                   /protein_id="ABN96046.1"
FT                   /translation="MDGTPFGRYLLVELVGRGGMGEVWRAHDTATNRTVALKVLPAHLV
FT                   HDTEYRVRFQREARAAARLSDPHIVPIHGFGEIDGRLYVDMRLIEGRDLEHLLREGPLD
FT                   PARAVMIIDQVAAALEAAHEVGLVHRDVKPSNILVGKFDFTYLIDFGIARPIDDTGLTS
FT                   VNRAVGTFHYMAPERFRDGRGDPRSDTYALACVLYQCLTGSRPFHGDSLEQQIAGHLMT
FT                   PPPRPSTVQPGVPAKFDAVIARGMAKNAAERYRSAIDLAHAARTVITTTLAPPTESASK
FT                   PASPLGFPALPDTGAHIRTGSSIDELLDHAVSAINRGGDVVDRHAPAFEAEPAYADGED
FT                   LLVAPGEPGEIRRLTIMFADLVDSTVLSTEVEPETYRLLVGRYRDQVLRIVGEYEGHVG
FT                   STKGDGLLVVFGYPIAHENDVRRAVQAGLEITRDVARLSDQAQRRFGLRINVRVGVHRG
FT                   LVYLDTAQDDVFGLAANMAARVSGLAPPGSVVVSDSVEPLIKDAFELETLPPAPVKGVK
FT                   GLISHSRVISERAESSRGPTGPLVGREREMARLRRGWVRAQARTLTTPGVVIRGEAGIG
FT                   KSRLVTGVVELVEADGGVVLDLAGSPFHADVGLQPVRALLERRCGITRLTEPSRRVELL
FT                   REEIMLRTLDPDPLIGLLAPVLGIAPEHGYEPVPFEGRKLQESIAAAVLQYLSACHGGR
FT                   SGLVVVEDGHWLDPSTLELVGDLLRTADGGLLVVITGRHGGWLPGDWPAKVLDLQPLTD
FT                   EQVDALVVALDPTVTAEECAAVRERCDGVPFYIEQVVSGLGQTDPEENRPSVPDPLYEP
FT                   LFARLLTRPNVVPVVEAAAVIGRQVDRGLLIAVSGLSEDDVDDVIDELEDAQVLEPRGA
FT                   GGWRFRHELLREVAAELAPPSVRRELHGRVADALLRGAVGDPDWRLVASHYENAGRYTD
FT                   AASAYREASAAARLRGALTEARNYLTHALSELEKSPPGAARDRLEIRPRLERGFLAAAM
FT                   EGYQSVSVADDFERCLELVGTDLRDDEVWSTLVSVSSYYLSRADLDRAAQILGLVESAP
FT                   DTGREWLRPAVNGALGTIAFVRGEMAVARDYFGKALVSVAIEDRQRMGELWYVPHDPVS
FT                   MAHEHLAMDRLWHGDLAGAEAAMSAARERAEELGVPLGPYNVVNAIDMEIWLRVDAGQF
FT                   DRARALVAEMIEKAENYGFDFWQLFGATEQCMVDAEIALSASAPDRATLETLIAALTEF
FT                   VSFWRAVGLYVYQTHYDCVLAKLLTAAGRRDEARERISTALAIAVETGMHFHDAELLRA
FT                   RARTHSEEVSRAADLASARRLAREQDAPLFELRAALDEFEWRGAGARDVLDAAARRLPA
FT                   DGALPEIARARDLLG"
FT   gene            complement(256908..268016)
FT                   /locus_tag="Mjls_0234"
FT   CDS_pept        complement(256908..268016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0234"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; acyl transferase
FT                   domain protein; NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR;
FT                   phosphopantetheine-binding; Alcohol dehydrogenase,
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein; KR; KEGG: mmc:Mmcs_0244 beta-ketoacyl
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96047"
FT                   /protein_id="ABN96047.1"
FT                   /translation="MSHRGRALTADAREDTNGMESAAYPHVPANRFAIVGYAARFPGAQ
FT                   DADEFWDLLRDGREAISEVPQDRWNVDEFFDPEPGAPGKVVTRRAGFVDDVTGFDAPFF
FT                   GMSTREVRLMDPQHRLLLETAWRAVEHSGTAPTDLANSNTGVFVGLATHDYLGMASDEL
FT                   SYPEIEAYMAIGTSNAAAAGRISYRLGLQGPAVAVDTACSSSLVAIHQACQALQLGECD
FT                   LALAGGANVLLTPATMITFSNAHMLAPDGRCKTFDAAADGYVRGEGCGVIVIKRLEDAL
FT                   RDGDRIRAVIRGSAINQDGASGGLTVPNGVAQQRVITDALKRAGVRAGDVGYLEAHGTG
FT                   TSLGDPIEAQAAGEVLGAGREPSRPLLIGSAKTNIGHLEAAAGIAGVIKVILSLEHETL
FT                   PKHLNFTTPSPHIPWDRLAVKVVTESTPWERNGRPRIAGVSSFGFAGTNAHVILEEAPE
FT                   STVTPAATPEPGERFSLLPLSARTPSALVRIADRYRSWMTTHPEATLADVCFTASTARA
FT                   HLEQRAALVVDSRESAVELLGALAEDRPAPGLVRGESHDTPKTAWLFTGQGSQYPGMAR
FT                   ELFDTEPVFAETMKQCAAAVADVLEKPLLDVIFDAHGPEAAETLRQTSYAQPALFAVEM
FT                   GLARLWQSWGFEPDVVLGHSVGQYAAACVAGVLGLEDGARLMAERGRLFGSLPAGGRMV
FT                   AVFTAAERVENITDEYPRLSVAAYNGANTVLSGPAGDLEKAVATLAADGVRCDWLDTSH
FT                   AFHSALLDPILDEFESYAQQIEYAAPQRVLIDNRTGAALGWSAKLDGTYWRRHARQPVE
FT                   FAKSVRTLAELNCKVLLEIGPRPVLTAAALSAWPDPATAPRAIASLRRNTADHRQITEA
FT                   LADAYVLGHRPDFAAIQRPDAHKLDLPTYPFEHRQYSFRDNQAERPEQAGPPIHQAART
FT                   EAVGLLEDGRIEELAALLGDTDGDRQTFDVLSKLAAQHNQQRTSQSITDDRYEIRWEEL
FT                   TTASPAATGEPSTWIIVGDDTDAARPLIDAVTARGDRHRLVGSPVSDADEASLADALRA
FT                   SVDDASAPGGAVRILHIAALDATTAPSMRTLLRMQHRILNRTRRLFHAVTTTGLRTPIW
FT                   LITRGAQRVTATDTVAPDQSALWGFGRAASLELPHLWGGLADLPTGPGASEDEWSRLLD
FT                   RIGAPRQSDVTEDQVALRDGAVHVPRLVRRTGQPSGAPLRLRSDATYLVTGGLGAIGLE
FT                   IAGYLAAHGAGNVVLTSRRAPGDAAQQRIDALRDKFGCAIRVATADVADAHDVARLLAG
FT                   VQAELPPLAGIVHAAGEIGTTALSAMDDESQQAEVDRVFAGKVWGAWHLSEAAVDLQLD
FT                   FFISTSSIASVWGGFGQTAYGAANAFLDGLAWRLREQGIAATSVNFGPWSAGMADAESR
FT                   ARLEQRGVRTLDPADALAGLADVVAGPATQGVIARIDWARFLPLYQQAGRRAFLTELER
FT                   EVPVASTDAAPAVTASGKTPLVERLSGAPVQQRKKLLTDYLRDAVAEVTRVDSAEIRED
FT                   AGFFDLGMDSLMAVELRRRLEQGVGKEIPVTLVMDHPRLSDAADYLLGEVLGLSEQAPA
FT                   ESRPALASLASERTDDPIAIVAVSCRFPGAPDPEAFWDLLSGGVDAIREVPEDRFDIDE
FT                   FYDPDPDAAGKTYTRFGGFLDGIDGFDPEFFGISPREAVWIEPQQRLMLETVWEGIERA
FT                   GLSPADLRGSRTGVFVGVAANEYAHLLSSESIEKIEPHFITGNALNAISGRVAFALGLE
FT                   GPAVAVDTACSSALVAVHQAVQALHSGDCDLAVAGGVNVLLSPVTVVAASRARMLSPVG
FT                   RCKTFDASADGYVRSEGCGILLLKRLSDAVRDGDRVCAVIPGTAVNQDGASSGLTVPNG
FT                   GAQQRLIKTALTRAGLTGGDVDYLEAHGTGTPLGDPIEVQAAAAAYGASRDADRPLLMG
FT                   SVKSNIGHLESASGAAGLIKVVLSLQHGVLPQSLHFDNPSPHIPWDSLPVRVVDEAVPW
FT                   QPNGRPRRAGVSSFGFTGTNAHVLVEEAPQAPVSEDQEYDTDDQPVHVLPLSARSPEAL
FT                   VALARRYDSWLGAHPDADLAGVCFTAGTGRSHFEHRAAMVVDSVASARQGLADLADNRT
FT                   RPGVVRGEHTNRPTTAWLFTGQGSQYPRMARELFDAEPVFAETVTRCADAVDGMLPLPL
FT                   LEVLFAADRETAERLRHTSYAQPALFAVEMGLARLWQSWGVTPDVVLGHSVGQYAAACV
FT                   AGVFSLEDGARLMAERGRMFGSLPEGGRMVAIFADAKQVEQIAGEFARVSVGAYNGPNT
FT                   VLSGPGEDLEQIVARFADEGIRCTWLETSHAFHSELLDPVLDEFESYAAQFEFAAPTMP
FT                   LVCNRTGAVLTGQTPLDAQYWRRHSRQPVQFAESVRTVAALGCSVLMEIGPQPVLTGAA
FT                   VQIWPEHLAAPRAIASLRKGVGDRRQIADALAAAYVGGLRPDFAALQGQPHHRLELPTY
FT                   PFQRRRFWPKTSSITVDGPATSGILGSAKDLASGDTVYASRLSVKSQPWLSDHVIYGTV
FT                   VVPGATYAAMALAAVGTPARVKDVFFYEPIILPEKSSREVQLTLHMLGDGEQKFQVHSR
FT                   SYGVRDAEWSLNAEGTVVRGVDDAPVSQDDPVDEAIERCNRMRPQELFETFADMELAWG
FT                   PTWSGSLKSLWLGDGEAIGDVLVGAELAEQLGSEPIHPVLMDLCTGVAFPAFPALLAAE
FT                   QGVSDLFLPLRYGQVTVQEKMPRRFYCRAKWHHSELDSETQVFDLDFISRDGRPLGGIR
FT                   EFTVKRAPREALLRGLGGDATRLLYTLGWHEVPLPAVDPAAPNGNWLIAGFDELADAVP
FT                   GCIPFDRTTDPEPLGQLLTQAHERGMAFSGVVWRAAAPKPDESSADVAARIETEIANLL
FT                   SAVHAVQRGEVKLPGGLWIVTERAVACESGEPVDPVQAALWGFGRTTINEEPALRCKLV
FT                   DCDGSPEAVEALSALLTTPVDEPELALRQGKLLASRLLHWARSGHLTVPRSTDYVLAPT
FT                   ERGAIDNLRLTETEVPPPAEGYVQVKVEAAGLNFRDVLNVLGLYPGDPGPIGGDFAGVV
FT                   TQLGDGVGSGRAERRDGIKLEVGQRVYGFMQGAFSSRFNVPAQLLAPIPDGVGAVEAAT
FT                   IPAAALTARLAFDWAQLEPGDRVLIHAASGGVGLAAIQLAQQHGAVVFATASTYKRATL
FT                   RKMGVEYVYDSRSTDFADQILADTDGAGVDVVLNSLTNEGFVEATVRATAQNGRFAEIA
FT                   KRDIWTHEQMAAARPDISYEIVALDTVTIQEPERIRGLLGEVSDGLGKGEWAPLPAEIY
FT                   PLTEARAAFRRMQQARHIGKIVVQMPSPLQPRPDRSYLITGGLGAIGLHTASYLAQLGA
FT                   GDIVLTSRREPDADTQQVIDEITERHRCRIHTFAADVGDESQVEELLERIRAELPPLAG
FT                   VAHLAGVLDDALLSQQSVERFRTTLAPKAFGAYHLDHLTRDDDLDFFIVSSSVSSLFGS
FT                   PGQANYATANALLDGLVARRRAHGLPATGVNFGPWAQGGMASSEAATANISAQGLVPLE
FT                   PSAALSALAEVVANGTAQATVIKANWQRAAKVLGASRPPLLDLVLPSAAGEVTGDSELL
FT                   RQLQEIPVAQRAGFVTEFLQREVQNFLRLAQPPAASSRFLDLGTDSLMAIELRNRLHSQ
FT                   FGGAFTINATAVFDYPTIGGLAEYLVGQLPDAESPPAATADPVAAGDDSGGAPEVEGG"
FT   gene            268210..269631
FT                   /locus_tag="Mjls_0235"
FT   CDS_pept        268210..269631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0235"
FT                   /product="PapA3_1"
FT                   /note="KEGG: mmc:Mmcs_0245 PapA3_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96048"
FT                   /protein_id="ABN96048.1"
FT                   /translation="MRIGKITIGGLDEWALKPGTVTSWHPTPAAAEKARRAPVSSVPIS
FT                   YMQRQHLRNYRERTGAGLNFSRQIIASCEVSGECEIAAMDHAVNNYLRRHDTFRSWFED
FT                   IGDGEFVRHALEDPADIEFVPVHHGSMTVDEIQAHVVGIPSPLEWACFTFGIIQNDGHF
FT                   TFFAAMDHVHGDATLIGTTMLEANGMYSALSGGGEALTLPEAGSFDEFCVRERERTADL
FT                   TVDSKDVQAWIDFADSNGGGFPEFPLPLGNPQEATRSSMTTEVLMDVAQTERFDAACAA
FT                   AGARFVGGLFACLAQVEHELTGALTYYGLTPRDSRNATDNFMTQGWFTGLIPITVPIGA
FT                   GSFADAAWAAQASFDSNLNMAKVPYYRVLELAPWLNWPQPNFPVSNFFHAGAAPLNAVL
FT                   AAADMGLADNIGIYPDGRFSYQLTIYIFRYGEGTVMAIMHPDNPVAEKSVTRYMQAMRT
FT                   VSALVADSGHWGRVA"
FT   gene            269658..272654
FT                   /locus_tag="Mjls_0236"
FT   CDS_pept        269658..272654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0236"
FT                   /product="Transport protein"
FT                   /note="TIGRFAM: Transport protein; PFAM: MMPL domain
FT                   protein; KEGG: mmc:Mmcs_0246 transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96049"
FT                   /protein_id="ABN96049.1"
FT                   /translation="MRRLADLVVRWPWVVIGVWVAMAVALPLSFPSLGEMAQKHPLAIL
FT                   PSDAPSSVAAQKMAEAFQQSESDNLLVVAFINETGLEPADEVTYREVVDALRDDPADVV
FT                   SVQDFVSTPQLRQFLTSEDKTTWVLPVSLQGELGTPRAFDSFNRVSDVVEHKLPDGDTL
FT                   DVYLTGPAATVADLTVAGERDRLPIEIAIAVLVLGVLLLVYRSVVTMLLPLVTIGSSLM
FT                   IAQGVVAAYSHLTGSGVSNQSIVFLSAIMAGAGTDYAVFLISRYHDYLRSGSGFDEAVR
FT                   SAMISIGKVITASAVTVGLTFLVMNFAQMGVFKTIGVSAAIGIGVAYLAGMTLLPAILV
FT                   LAGPRGWVKPRRELTSRFWRRSGIRIVRRPVPHLIASVLVLLLLGGAAGFARFNYDDRE
FT                   VVADSAPSSIGYAALERHFPISQSIPQYILVQSPRDLRTPQALADLEQMASRIAQLPDV
FT                   SLVSGVTRPLGEVPPEFRATFQAGIVGDRLAAGSAQIDQRTGDLDELAAGATTLADTLG
FT                   DVRAQVNEVAPSLQTLLDAVTQVRVEYGGDRLVRDVDTAAKLVKSVNELGLSMGVNFAA
FT                   VRDMFGWIGPVLMALNGNAVCDANPSCVNTRMQFEKLMDAREDGRLERINTLAGELKGL
FT                   DDRQSLNSTVKTLNAAMTNIVKAVDDLGLDSPAEAQKGLRDVRQGADRLASGSRQVAGG
FT                   VDELVEQIKVMADGLDQASTFLLTMRKDAAGSSMAGFNIPAEVLRAVEFQKAAETFISP
FT                   DGHSARYLVQTSLNPFSPEAMDQVNTINDVARGAQPNTTLADASISMGGFPASLRDTRD
FT                   YYERDIRFIIIVTLIVVLLTLAVLLRSLIAPLYLVGSVVLSYFAAIGIGVLTFQVLLGQ
FT                   ELHWSVPPLAFVVLVAVGADYNMLFVSRLRDESPHSVRYGVIRTLGSTGGVITAAGLIF
FT                   AASMAGLLFASIGIVVQGGFVIGVGILLDTFVVRTITVPAIAALVGRANWWPSRVTASP
FT                   GAERIGAHP"
FT   sig_peptide     269658..269771
FT                   /locus_tag="Mjls_0236"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.692) with cleavage site probability 0.392 at
FT                   residue 38"
FT   gene            272654..274426
FT                   /locus_tag="Mjls_0237"
FT   CDS_pept        272654..274426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0237"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0247 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96050"
FT                   /protein_id="ABN96050.1"
FT                   /translation="MTPTSESSMLSMLHGRASLRPDDIAFTFTHYDRDPAGVPETLTWA
FT                   QLARRTMSVAREIRQYGSFGDRAVILAPQGLEYVLAFLGAMQAGLVAVPLPLPHRGSGH
FT                   DRVSAVLTDTKPAVVFTTSSTAGDVGDFVDASPLDTVPKIVEIDALNLDAEGEIRLDPA
FT                   GLPATAYLQYSSGSTRLPTGAMISHRNLQANYEQVMRTFFAGDGPSSTTTFVSWLPFYH
FT                   DMGLVLGICVPILSGHPAALTSPVAFLERPARWIRALAENPHAFSAAPNFAFDLAARKT
FT                   SDSDLAGLDLGGVRGIINGAERVEPATLERFADRFAHFDFHDHMLRPSYGLAEATVFVA
FT                   SGTWSETSPAAHFDADELGAGRVVPCAPGKGTALVKYDVPQSPVVRIVDTDTHRQCPDD
FT                   VVGEIWVHGDNVAAGYWSRPPEDQRCFGATLVDPSPGTPGGTWLRTGDLGFIHEGELFI
FT                   VGRIKDLLIIRGRNHHPEDIEATVQEITRGRVAAVSVPVNSTESLVTVIELKEPPVLDE
FT                   DAVSRFGELKSDVTAAISNAHGISVGDVVLVASGSIPTTTSGKIRRTASAELYRKDGFA
FT                   RLDGGKGQHGHLAG"
FT   gene            274476..275609
FT                   /locus_tag="Mjls_0238"
FT   CDS_pept        274476..275609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0238"
FT                   /product="PE-PPE, C-terminal domain protein"
FT                   /note="PFAM: PE-PPE, C-terminal domain protein; KEGG:
FT                   mmc:Mmcs_0248 PE-PPE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96051"
FT                   /protein_id="ABN96051.1"
FT                   /translation="MRRLLAFGSALTIIGAAGGFGFGSASADEPPVPPPPAPADGPPPL
FT                   GTPGRAYALGGAHVLGIPYDEYIMRTGSDWFPGLDRQIVDYPAGQVQGHTLERLFPGIG
FT                   RLDDSFPGLGIDGPSVGESVDVGTPNVINAVREGGRGTAIGLSEGAMVLNDVQAKLAYD
FT                   PAAPPPDELSFAMYGDPVARHAFGESFLTQNFPVGSVVPSLDYRIPAPVESQYDTYHFV
FT                   SAYDSIADWPDRPDNWISVANAIVGLATGHTAVAFTEPSMVPERNIRTTVNSRGAQTTT
FT                   FMIPEEHLPLVLPFKYLGVPKDTLMELDSVLKPYVDAGYSRNDDPLTAPITVDPVNGYD
FT                   PAEVTAPATQAAFGGAADPVSQLLSGLQYVLNNQPTG"
FT   sig_peptide     274476..274595
FT                   /locus_tag="Mjls_0238"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.446 at
FT                   residue 40"
FT   gene            complement(275658..276326)
FT                   /locus_tag="Mjls_0239"
FT   CDS_pept        complement(275658..276326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96052"
FT                   /protein_id="ABN96052.1"
FT                   /translation="MWIPLLVMAVAVSLEPFRVGMTVLMINRPQPRRQLLALLAGGFAM
FT                   GLTVGVIVLFVLRPALDSAHFTLPVVQIAVGAVVLVNAALVATGVWGRGRDAVSLADTR
FT                   FGPLATRTRRLLDGRSLWTAGIAGLGIALPSVDYLAALALIVASGAATTVQLGALMVFN
FT                   VVAFALVEIPLLCYLVAPERTRAALSALYEWLRAQGRRGVGALLAVIGCVLLGVGFAGL
FT                   "
FT   gene            276428..276913
FT                   /locus_tag="Mjls_0240"
FT   CDS_pept        276428..276913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0240"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: mmc:Mmcs_0250 flavin reductase-like, FMN-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96053"
FT                   /protein_id="ABN96053.1"
FT                   /translation="MSAIDLNPATLREAFGHFPTGVIAIAAEVDGIRVGLAASTFVPVS
FT                   LDPPLVSFCVQNTSTTWPKLKDLPRLGISVLGESHDAAARTLAAKAGDRFAGLETTSTD
FT                   EGAVFIHGTSVWLDSSVHDLVEAGDHTIVILRVEDITVHPDVAPIVFHRSTFRRLGG"
FT   gene            complement(276925..277086)
FT                   /locus_tag="Mjls_0241"
FT   CDS_pept        complement(276925..277086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96054"
FT                   /protein_id="ABN96054.1"
FT                   /translation="MTLSHTHSLNDIRTAIRELSTRADLARKEGRPSDAAEIERRIQGY
FT                   REELAQRP"
FT   gene            complement(277148..277900)
FT                   /locus_tag="Mjls_0242"
FT   CDS_pept        complement(277148..277900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0242"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; KEGG:
FT                   mmc:Mmcs_0252 succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96055"
FT                   /protein_id="ABN96055.1"
FT                   /translation="MSYQAKMRVWRGDDEGGALQDYTVEVNEGEVVLDIIHRLQQTQTG
FT                   DLAVRWNCKAGKCGSCSAEINGRPRLLCMTRMSTFGESETVTVTPLRAFPVIRDLVTDV
FT                   SFNYEKAREIPSFTPPKDLQPGEYRMAQEDVNRSQEFRKCIECFLCQNTCHVVRDHEEN
FT                   KKEFAGPRYLMRMAELDMHPLDVHARRAEDSQEVHGLGYCNITKCCTEVCPEHIKITDN
FT                   ALIPMKERVADRKYDPVVWLGNKLFRRK"
FT   gene            complement(277897..279843)
FT                   /locus_tag="Mjls_0243"
FT   CDS_pept        complement(277897..279843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0243"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmc:Mmcs_0253 succinate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96056"
FT                   /protein_id="ABN96056.1"
FT                   /translation="MAASDPRPGDSSGIERHQYDVVVIGAGGAGLRAVIEARERGLKVA
FT                   VVCKSLFGKAHTVMAEGGCAASMGNTNPKDNWQVHFGDTMRGGKFLNNWRMAELHAKEA
FT                   PDRVWELETYGALFDRTKDGRISQRNFGGHTYPRLAHVGDRTGLEIIRTMQQKIVSLQQ
FT                   EDKEELGDYEARIRVFAECTVTDLIKDGDRIAGAFGYWRESGSFILFDAPAVVLATGGI
FT                   GKSYKVTSNSWEYTGDGHALALRAGATLINMEFIQFHPTGMVWPPSVKGILVTEGVRGD
FT                   GGVLKNSDGKRFMFDYIPDVFKGQYAESEDEADQWLKDNDSARRTPDLLPRDEVARAIN
FT                   TEVKEGRGTPHGGVYLDIASRMSSEEIKRRLPSMYHQFMELAEVDITTDEMEVGPTCHY
FT                   VMGGIEVDPDTGAAKTPGLFAAGECAGGMHGSNRLGGNSLSDLLVFGRRAGLGASDYVR
FT                   ALGNRPTVSEEAVEAARKLALAPFDGPSDGQPENPYTMQLDLQDTMNELVGIIRKADEI
FT                   IEAQGKLDELRDRFKRMKVEGNRHFNPGWHLAIDLRNMLLVSECVAKAALERTESRGGH
FT                   TRDDYPSMEAEWRRTLLVCRAQGDDVVVPSVTVTREDQVPMRDDLLELLDIEELQKYYT
FT                   DEELANHPARRGS"
FT   gene            complement(279885..280703)
FT                   /locus_tag="Mjls_0244"
FT   CDS_pept        complement(279885..280703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0244"
FT                   /product="putative succinate dehydrogenase (membrane anchor
FT                   subunit) (succinic dehydrogenase)"
FT                   /note="KEGG: mmc:Mmcs_0254 putative succinate dehydrogenase
FT                   (membrane anchor subunit) (succinic dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96057"
FT                   /protein_id="ABN96057.1"
FT                   /translation="MSAPTADREGTGVYSAGRAKIPQRTLRTDRWWVPSLLTNLGLAAF
FT                   VVYATIRAFWGSAYWVADYHYLTPFYSPCVSKGCIPEASHFGQILPDVWWLPYAAFSLP
FT                   FLLLFRLTCYYYRKAYYRSVWQSPPGCAVAEPHSTYTGETKLPLIMQNLHRYFFYVAVL
FT                   ISLINTWDAILAFHSPSGFGFGLGNVILVVNVVLLWTYTISCHSCRHVTGGRLKHFSKH
FT                   PVRYWMWTQISKLNTRHMQFAWITLGTLVLTDFYVMLVASGTISDLRFIG"
FT   gene            complement(280801..281157)
FT                   /locus_tag="Mjls_0245"
FT   CDS_pept        complement(280801..281157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96058"
FT                   /protein_id="ABN96058.1"
FT                   /translation="MWLASVAYCDSRHPSAQGGHLSTTTGFAELHELIGGLRRCVTALA
FT                   SQYGDSPAMRRIVNDAERILNDIDRLDIDAEELELGRGLSRHHHVGEKIPIPDTQYDTE
FT                   FWRGVDDEGLGGTH"
FT   gene            281208..281966
FT                   /locus_tag="Mjls_0246"
FT   CDS_pept        281208..281966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96059"
FT                   /protein_id="ABN96059.1"
FT                   /translation="MPNHDLKQLADALLALHQPGNPVVLPTVWDAWSANLAVGAGFAAL
FT                   TVGSHPVADSVGRADNEGMTFDELLTRVAQITDAVDVPVSVDIESGYGEAPTRLIEGLL
FT                   GVGAVGLNIEDTVHGEGGRLRSAGEHAELVGALRAAADDAGVHVVVNARTDLFLRKDGD
FT                   DADRVDRAVARLKEAAEAGADVLYPVGRHDPDTQRRLTSELPLPVNAIGIPDQDDPASF
FT                   GPLGVARISFGPFLQAALATRANELLARWK"
FT   gene            complement(282063..282509)
FT                   /locus_tag="Mjls_0247"
FT   CDS_pept        complement(282063..282509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0247"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: mmc:Mmcs_0257
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96060"
FT                   /protein_id="ABN96060.1"
FT                   /translation="MSNVALRVRPAWDLDRWVRDFFGPAAANDGFSGTAAPGFSPAAEI
FT                   ARDGDDATVRVELPGVDVDKDVTVEVDNGQLVIHGERRDERSEEKDGRTLREMRYGSFR
FT                   RSFRLPQHVTGDAISASYDAGVLTVRVAGAYAGAQPQRIAIENK"
FT   gene            282668..285310
FT                   /locus_tag="Mjls_0248"
FT   CDS_pept        282668..285310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0248"
FT                   /product="assimilatory nitrite reductase (NAD(P)H) large
FT                   subunit precursor"
FT                   /EC_number="1.7.1.4"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], large subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; nitrite/sulfite reductase, hemoprotein
FT                   beta-component, ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: mmc:Mmcs_0258
FT                   nitrite reductase (NAD(P)H) large subunit, NirB"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96061"
FT                   /protein_id="ABN96061.1"
FT                   /translation="MGPSHEATSRQYPIPSLAPMSTSISNGPARNVVVVGHGMVGHRFV
FT                   EALRARDDAGAWRITVLAEETDAAYDRVGLTGYTEHWDRALLALAGNDYAGDDLVDLRL
FT                   GQRVTSIDRAARTVKTADGTAFAYDALVLATGSYAFVPPVPGRDLPACHVYRTFDDLDA
FT                   IRADAARARETSRAPVGVVIGGGLLGLEAANALRGFGLTAHVVERSPRLMSQQLDDAGG
FT                   ALLSRMIADLGIEVHLDVSTDAITPAQRNRPLRRSEEDDSLRVMLGDGSFIDAGVVVFA
FT                   AGVRPRDELARDAGLAIAERGGVLTDLGCKTSDPSIYAVGEVAAIEGRCYGLVGPGYTS
FT                   AEVVADRLLGGAAEFPEADMSTKLKLLGVDVASFGDAMGRTPDCLEVVVNDAVNQTYAK
FT                   LVLSDDAKTLLGGVLVGDASAYGVLRPMVGEQLPGDPMALIAPAGSGGAEGGLGVGALP
FT                   AAAQICSCNNVTKGDVTDAIAGGCCDVPGLKACTKAGTSCGSCVPLLKQLLEAEGVEQS
FT                   KALCEHFSHSRAELFEIVSATEIRTFSGLLERFGTGKGCDICKPTVASILASTSSEHIL
FT                   DGEQAALQDSNDHFLANIQRNGSYSVVPRVPGGDITPEQLILIGEIARDFDLYTKITGG
FT                   QRIDLFGARVEQLPEIWRRLVEGGMESGHAYGKALRTVKSCVGSDWCRYGQQDSVQMAI
FT                   NLELRYRGLRAPHKIKMGVSGCARECAEARGKDVGVIATEHGWNLYVGGNGGMTPKHAQ
FT                   LLAGDLDDETLIRYIDRFLMFYIRTADRLQRTAPWVEQLGLDHLREVVCDDSLGLASEF
FT                   EAAMARHVEGYSCEWKGVLEDPDKLSRFVSFVNAPDVPDPTVTFTENAGRKVPVPIGMP
FT                   SIRPLQETP"
FT   gene            285307..285678
FT                   /locus_tag="Mjls_0249"
FT   CDS_pept        285307..285678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0249"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   KEGG: mmc:Mmcs_0259 nitrite reductase (NAD(P)H) large
FT                   subunit, NirD"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96062"
FT                   /protein_id="ABN96062.1"
FT                   /translation="MTLLDDRNELNGPPDTRWTVACRYDYLIPCRGVGVLLPDGAQAAL
FT                   FRLDDGSLHAIGNIDPFSGAAVMSRGITGDRGGRAIVQSPIKKQAFAFDDGSCLDDPSV
FT                   SLPVYRTRRTADGIVEIEG"
FT   gene            complement(285682..286251)
FT                   /locus_tag="Mjls_0250"
FT   CDS_pept        complement(285682..286251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96063"
FT                   /protein_id="ABN96063.1"
FT                   /translation="MNIHRILAGVEEVKSLDAPAHASARIASQVVDGARLGHVLRGSWL
FT                   GHPVHPLLVTLPIGTWMTSVVFDVVFKDVATARRLVGVGLVATPPTVLAGWADYVLLNK
FT                   RQQRVGLVHAVSNAVGVTLFGLAYRAYRKEKVRTARVYSLLGLGAISVGGALGGHLSYA
FT                   QGAGVFRWQPVRALTHRGPVEYRRAA"
FT   gene            286324..287025
FT                   /locus_tag="Mjls_0251"
FT   CDS_pept        286324..287025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0251"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: GAF domain protein; ANTAR domain protein;
FT                   KEGG: mmc:Mmcs_0261 response regulator receiver and ANTAR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96064"
FT                   /protein_id="ABN96064.1"
FT                   /translation="MTAGVERLDEVLEHCLRHSTRRAQADLTGVLAGLTALAVSHLPGV
FT                   DHASVTLMADDDDIRCLAATDGHPLVLDNVQRGCGQGPCLDAATEHRVVRADDLTDESR
FT                   WPAFTAKSVDATPVRAILALPVFRDGRSSATLNLYADRPRGLDARTESSGAIVASHVAE
FT                   AMTAAYRTRSHGRSPRSTVINQAKTLLMRDFDVDVAQAYALLVKLAKQQNDSIEAVARQ
FT                   VVAADGPSGRN"
FT   gene            complement(287029..287724)
FT                   /locus_tag="Mjls_0252"
FT   CDS_pept        complement(287029..287724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0252"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: mmc:Mmcs_0262 cobalamin (vitamin B12)
FT                   biosynthesis CbiX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96065"
FT                   /protein_id="ABN96065.1"
FT                   /translation="MSAPANRILVAHGTRKSSGVALIGDIADRVAATLGSPVGVAFVDV
FT                   LGPTPSDALSALPDRPAVLVPAFLSRGYHVRSDIPAHVAASGHPDVTVADALGPDAQLV
FT                   RVVGDRLIESGWAPGDSVILAAAGTSDPLALRDLHTTAASLSAVTGARVDLAFAATGRP
FT                   RVDEAVAAARRSGARRVVVASYLLADGLFQDRLRASGADIVTAPLGTHPGLVRLIASRF
FT                   RRARIPIAA"
FT   gene            complement(287721..288869)
FT                   /locus_tag="Mjls_0253"
FT   CDS_pept        complement(287721..288869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0253"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   Uroporphyrinogen III synthase HEM4; KEGG: mmc:Mmcs_0263
FT                   uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96066"
FT                   /protein_id="ABN96066.1"
FT                   /translation="MSEPDWAPLTGFRVAVTSARRAEELSALLRRRGATVTSAAAIAMV
FT                   PLPDDDELRAHTQALIDAPPDIVIATTGIGLRGWIAAADGWGVAAELTAALAGARIVSR
FT                   GPKATGALRAAGLPEEWSPDSESSREVLRYLLDGGIAGKRIAVQLHGATDDWDPFPEFL
FT                   DELRAAGADVVPIRVYRWRPAPRDGDFDQLVAGIAEEKFDAVSFTSAPAVASVLMRATE
FT                   MGVADRVLTALRTNVHAMCVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLQA
FT                   RTVRVAGHLLEIRGTCVLVDGVVKSLSPAGMATIRALAHRPGAVVSRTDLLGALPGSGT
FT                   DTHAVETAVLRLRTALGDKQIVSTVVKRGYRLTVDDDLAEAL"
FT   gene            complement(289002..290396)
FT                   /locus_tag="Mjls_0254"
FT   CDS_pept        complement(289002..290396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0254"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmc:Mmcs_0264 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96067"
FT                   /protein_id="ABN96067.1"
FT                   /translation="MSHRITDWDPEDTIAWEAGNKYIARRNLIWSVAAEHIGFSVWSIW
FT                   SVMVLFMPEAVYGFSAGDKFLLGATATLVGACLRIPYTLATARFGGRNWTVFSAFVLLI
FT                   PTLGTMVLLANPGLPLWPYLLCAALAGFGGGNFASSMTNINAFYPQRLKGWALGLNAGG
FT                   GNIGVPMIQLVGLLVIATAGNRQPYWVCAVYLVALAVAGIGAALYMDNLEQHKIDFTAM
FT                   KDILRERDTWVISLLYIGTFGSFIGFAFAFGQVLQINFAARGQSPAEASLHAAQIAFVG
FT                   PLLGSLSRVYGGRLADRIGGGRVTLAVFAGMILAAGVLVTVSTLDDGSPGAATAATMIG
FT                   YVVGFIALFLLSGIGNGSVYKMIPSIFEARSRSLDAGEEQRVAWSRAMSGALIGFAGAI
FT                   GALGGVGINLALRQSYLSSGSATTAFWIFAVFYVVASAVTWVMYVRRPSGDASVDRASR
FT                   PDLART"
FT   gene            complement(290492..291115)
FT                   /locus_tag="Mjls_0255"
FT   CDS_pept        complement(290492..291115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0255"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmc:Mmcs_0265 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96068"
FT                   /protein_id="ABN96068.1"
FT                   /translation="MAGTPRWYNDGVLPQLSSEVRGHGVIHTARLVHTADLDNETREGA
FT                   RRMVSEAFRGDFTDDDWEHALGGMHALICSHGVLIAHAAVVQRRLLYRDAALRCGYIEA
FT                   VAVREDCRGQGLGSAVMDACEQVLRGAYQLGALATSTMARPMYRARGWVPWRGPTSVLS
FT                   PGGRISTPEDDGSVFVYPVGSALGSTDLDTTAELTCDWRHGDVW"
FT   gene            complement(291130..292071)
FT                   /locus_tag="Mjls_0256"
FT   CDS_pept        complement(291130..292071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0256"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0266
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96069"
FT                   /protein_id="ABN96069.1"
FT                   /translation="MQNSQVNRLFRRGGSTATPPPAAAPAWFAAAVGQRPRHHTIEVEG
FT                   CPIRVRAWGDPGNPPLVFVHGGGAHSGWWDHIAPFFTRTHTVVAPDLSGHGDSGTRQSY
FT                   AVAAWAREVLASASVSGSSARPTIVGHSMGGWVTAAAATRYGAQIDSVLIIDSPLRDRA
FT                   PEENRLRNRRRDSPGYRTEAEILARFKAVPAQEVTLPYIADPIARQSVRHTDNGWVWKF
FT                   DPEIFGGDLLEQTAAEHEIVEETFTRLPCRVGYLRCENGIVPPAMAEQIRSILQLRGPF
FT                   VELAEAGHHPMLDQPLPLVATIRTLLEFWSIT"
FT   gene            complement(292079..292957)
FT                   /locus_tag="Mjls_0257"
FT   CDS_pept        complement(292079..292957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0257"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: mmc:Mmcs_0267
FT                   allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96070"
FT                   /protein_id="ABN96070.1"
FT                   /translation="MTTLEILNTGPLALVEDLGRPGLAHMGVTRSGAADRRAHALANRL
FT                   VANPGDRATVEVMFGGLTARVRGGDVTVAVTGADTDPAVNGKPFGTNSIHYAHDGDVIS
FT                   LGMAQAGLRSYLAVRGGIDVAPVLGSRSYDVMSAIGPQPLKPGDVLPVGEHTEDFPELD
FT                   QAPVAAIDDDVLELMVVPGPHDDWFVDPEFLVRTNWQVTNRSDRVGMRLVGMPLDYRWP
FT                   DRQLPSEGATRGAIQVPPNGLPVILGPDHPVTGGYPVIAVVVDEDIDKASQARPGQTVR
FT                   LHWSRPRKPFA"
FT   gene            complement(292996..293661)
FT                   /locus_tag="Mjls_0258"
FT   CDS_pept        complement(292996..293661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0258"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   mmc:Mmcs_0268 allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96071"
FT                   /protein_id="ABN96071.1"
FT                   /translation="MTAVPDVMEPMVLGTVLDYGDRALLLQFDDTAQVLAWTDAVRAAG
FT                   LPGVVDIVPGSRTVLVKLDGPRYQAPTRQRLAALRIDRGAVAESASPPDRADAVIDVVY
FT                   DGADLADVARLTGMDTDQVVAAHTGTLWRVGFGGFAPGFAYLVGGDERLHVPRRAEPRT
FT                   KVPAGSVGLAGEFSGVYPRESPGGWQLIGHTDAVLWDVDRENPALLTPGMWVEFRVAE"
FT   gene            complement(293736..294416)
FT                   /locus_tag="Mjls_0259"
FT   CDS_pept        complement(293736..294416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0259"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   mmc:Mmcs_0269 protein of unknown function DUF165"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96072"
FT                   /protein_id="ABN96072.1"
FT                   /translation="MTVAPTDHRGSATIGSAYYPTLVAVFTGLVLISNVAATKGVAFGP
FT                   LLTDGGFLVFPLTYVIGDVLSEVYGFRAARRAVFIGFAMQALAVLVLWTTVRLPGAPDY
FT                   ANQDALATTVAAITGLAVAGLSGFLVGQLVNAWVVVQVKQRTKEQYLWARLLGSTVVGQ
FT                   FADTLVFCAIAAPIIGFGNMGSFAVYAALGWVYKTVIEAAMLPVTYRVIATIKRREPTY
FT                   EPAV"
FT   gene            complement(294429..295394)
FT                   /locus_tag="Mjls_0260"
FT   CDS_pept        complement(294429..295394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0260"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   mmc:Mmcs_0270 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96073"
FT                   /protein_id="ABN96073.1"
FT                   /translation="MSTAWSRRNFLAMTATLAGSTVLAGCGGDAPGTVAKDGSVTVTHA
FT                   FGETRIPGPPTRVVSAGLTEQDDLLAVEVVPIAVTDWFGGEPFGVWPWARGQLGPAQPT
FT                   VLSLGDGIQIEAIRALNPDLIVATNAGLDADTYTTLSEIAPTVAQSGSAAFFEPWKDQA
FT                   TIIGQAVFKADEMAALIARVDEKFTNAASANPQFGGKKALLLRGPLYRDSVQAVRPGWR
FT                   TDFLTQMGFTVADPGDPLIPRDRMASVLDAADVLIWTTESEQEQGALLADPTIAGLKAV
FT                   AGGRTIFTDKELAGAIAFASPLSYPLVADRLPPLLAQILA"
FT   sig_peptide     complement(295287..295394)
FT                   /locus_tag="Mjls_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.780 at
FT                   residue 36"
FT   gene            complement(295411..296454)
FT                   /locus_tag="Mjls_0261"
FT   CDS_pept        complement(295411..296454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0261"
FT                   /product="conserved hypothetical protein 698"
FT                   /note="PFAM: conserved hypothetical protein 698; KEGG:
FT                   nfa:nfa31840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96074"
FT                   /protein_id="ABN96074.1"
FT                   /translation="MSVVLALGAATRFLEAQVPRWADGTAFEGVAKSVEFPVYAIALGL
FT                   LGNVVLSRLALRDALSGGFRTEFFIKTGLVLLGASINLKVLVTAAGPAIIQALLLISIV
FT                   FGFTWWLGGRLGLEDKLRALLASAVSICGVSAAIAAAGAVQAKREQLAYAASLVIAFAL
FT                   PSIFLLPWLARVFGLPDAVAGAWIGGNIDTTAAVAASGAIAGEDALQIATIVKTTQNAL
FT                   IGIVAIALTAYFALKVERRSAQDARPTVGQFWERFPKFVLGFIAASIVGTLYLQGGGDK
FT                   ATITTVNDLRTWFLIFAFVAIGLEFSLRGLREAGWRPVAVFASATVVNIVVALGLALVL
FT                   FGSFEVG"
FT   gene            complement(296688..297485)
FT                   /locus_tag="Mjls_0262"
FT   CDS_pept        complement(296688..297485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0262"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0271 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96075"
FT                   /protein_id="ABN96075.1"
FT                   /translation="MRTPKSVFITGAAAGIGRKTAIAFARKGYTVGAFDIDEVGLKTLT
FT                   EELDRVQTPVVTGHLDVTDSDEMSQRIEEFTQVTGGRLDVLINNAGILRAGRFEELDLA
FT                   GHFKEIDINAKGVVNGLYAAFPHLRNTPGSVVVNLASASAIYGQAELANYSATKFFVRG
FT                   ITEALDLEWNRYGIRVIAMWPLYVQTAMTDNIKTGTTDSLGIRLTAQDIADAIVAAVEP
FT                   TALRRALHQVHFPVGAQSKVLATGARFSPAWLTRLVNKKLAHS"
FT   gene            complement(297797..298396)
FT                   /locus_tag="Mjls_0263"
FT   CDS_pept        complement(297797..298396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0263"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mmc:Mmcs_0272 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96076"
FT                   /protein_id="ABN96076.1"
FT                   /translation="MTYPVVLGFLSALTLIAAIGAQNAFVLRQGIRGEHVAAVVALCTV
FT                   SDVLLIGAGIAGFGALVTAHPAALDIARFGGAAFLIGYGLLAARRAARPAALTPSEQGP
FT                   ARLVGVLVTCAALTWLNPHVYLDTVVLLGALANEHREDRWLFGVGAVTASAVWFTALGF
FT                   GARRLGGLFSAPSTWRVLDALIAMIMIALGVAVALG"
FT   sig_peptide     complement(298331..298396)
FT                   /locus_tag="Mjls_0263"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.871) with cleavage site probability 0.595 at
FT                   residue 22"
FT   gene            298661..299431
FT                   /locus_tag="Mjls_0264"
FT   CDS_pept        298661..299431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0264"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_0273 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96077"
FT                   /protein_id="ABN96077.1"
FT                   /translation="MNRADLDRPLGAVGGLFGMALDAVRFTFRRPFQAREFLEQSWFVA
FT                   RVSLAPTLLVAIPFTVLVSFTLNILLRELGAADLSGAGAAFGAVTQVGPLVTVLIVAGA
FT                   GATAMCADLGSRTIREEIEAMEVLGINPVARLVTPRMLASGLVALLLNSLVVIIGIVGG
FT                   YAFSVFVQDVNPGAFAAGITLLTGIGEVIISCVKAALFGLIAGLVACYRGLSINRGGAK
FT                   AVGNAVNETVVYAFMALFVINVVVTAIGIRMTAG"
FT   gene            299435..300292
FT                   /locus_tag="Mjls_0265"
FT   CDS_pept        299435..300292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0265"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_0274 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96078"
FT                   /protein_id="ABN96078.1"
FT                   /translation="MGTLTTLGTAYPRVVSQFRKPASLVGRLGDHILFYGRALAGTPHA
FT                   AMHYRKEIVRLIAEISMGAGTLAMIGGTVVIVGFLTLAAGGTLAVQGYSSLGDIGIEAL
FT                   TGFLAAFINVRISAPVVAGIGLAATFGAGVTAQLGAMRINEEVDALETMGIRPIEYLVS
FT                   TRIIAGMIAITPLYSVAVILSFLASQLTTVVLFGQSGGLYDHYFNTFLNPVDLLWSFLQ
FT                   AILMALTVLFIHTYFGYFATGGPAGVGVAVGNAVRTSLIVVVAVTLLVSLSVYGSNGNF
FT                   NLSG"
FT   gene            300306..301493
FT                   /locus_tag="Mjls_0266"
FT   CDS_pept        300306..301493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0266"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0275 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96079"
FT                   /protein_id="ABN96079.1"
FT                   /translation="MKSISARNVAGTLAVVCIAAIVALAVGLFNGSFTRSATVTVVSDR
FT                   VGLVMNPDTKVKLHGAQVGKVAAIEALPDGRAAIRLAMDPSQLAIIPSNVLVNVGSTTV
FT                   FGSKAVELVPPANPSPDPLRAGQVLDAGHVTVEINTVFEQLVSVLAKVEPAKLNETLGA
FT                   LSQGLAGRGEKFGRTLVDLDTLLADLDPSMDNLSRDIAVAPGVLNAYADAAPDLLATAD
FT                   NASRISDTLVERQSDLDALLVSAIGLAEVGNDVVATNRGAFTDVMRLLVPTTDLTNQYH
FT                   TALNCGLAGMLPLAMAPPPPVPGVLLLDSFVLGTERYRYPQNLPKVAARGGPQCVGLPD
FT                   VGYETRAPYVVSDIDANPAQYGNQGILLNSEGLKQMLFGPLDGPPRNTSQIGQPG"
FT   sig_peptide     300306..300416
FT                   /locus_tag="Mjls_0266"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.838 at
FT                   residue 37"
FT   gene            301490..302515
FT                   /locus_tag="Mjls_0267"
FT   CDS_pept        301490..302515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0267"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0276 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96080"
FT                   /protein_id="ABN96080.1"
FT                   /translation="MRRLGPTVVKFGVFAVVMVLFTAALVAIFGQYRAGSANEYSAVFG
FT                   DASSVKSGDSVRIAGIRVGTVNGVSLQPDNTVVVDFDARTDVVLTTGTRVAVRYLNLVG
FT                   DRYLELVDGPGATQIQPAGSRIPKDRTEPALDLDLLLGGLKPVIRGLNPEDVNALTHSL
FT                   IQILQGQSGDIESLFARTSSFTNSIAANGETVRQMIDHLNTVVETMSRDGDKFSGAVAR
FT                   LEELVTGLAQDRDPIGAAIESLDKGTASLADLMTEARPPLAGSIDQLNRVAPLLEKDKE
FT                   LLDISLQKAPGNYRKLVRLGAYGSWLNQYLCGLSVRVTDLQGRTAYFPWIKQDTGRCAE
FT                   P"
FT   sig_peptide     301490..301600
FT                   /locus_tag="Mjls_0267"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.378 at
FT                   residue 37"
FT   gene            302515..303597
FT                   /locus_tag="Mjls_0268"
FT   CDS_pept        302515..303597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0268"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0277 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96081"
FT                   /protein_id="ABN96081.1"
FT                   /translation="MLKYGGSSSVRAGFIGLVLIVLVIVVGLQPQQLWSMATSVKYRAV
FT                   FAEAGGLAAGNDVKVSGVTVGTVSDVVLDKGKALVTFSLDGKVRLGSDSTAHIRTGTLL
FT                   GERMLTVEPKGSRRLGPMEAIPVSRTSSPYSLTEAVSDFTANTADTDTATLNQSLDILS
FT                   ETIDRLAPQLGPTFDGLTELSRSLNDRDETLGDLLAGAADVTAILSERSQQVNTLLLSA
FT                   NDLLAVLEQRRYAIVNLLANTSAMSQQLTGLVRDNEQELAPTLEKLNSVSEMLERNRDN
FT                   IGKALNGLAKYQVTQGEAVNNGFYYNAFIGNLIPGGALQPFLDYALGYRRGVNAGQPPD
FT                   NAGPRAEFPLPYNGILGGSR"
FT   sig_peptide     302515..302622
FT                   /locus_tag="Mjls_0268"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.733 at
FT                   residue 36"
FT   gene            303594..304949
FT                   /locus_tag="Mjls_0269"
FT   CDS_pept        303594..304949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0269"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0278 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96082"
FT                   /protein_id="ABN96082.1"
FT                   /translation="MIGRTKSAKVLTVALVALLVAGAAVIVRQEFFAPRTITAYFTSAT
FT                   SIYPGDEVRVVGVRVGTIESIEPVGEQARFTLAVDRGVSIPADAKAIIVAPNLIAARYV
FT                   QLTPAYESSGPVLPDDAVIGVERTAIPVEWDEVKEQLARLASELGPSGGVSDTSVSRFI
FT                   DSAANAMAGNGDKLRETISQLSGVGRILADGSGNIVDVIKNLQVFVTALRDSNVQIVQF
FT                   QDRLATVSSVVDGSRAEMDSALTNLAEAVGEVQRFIAGSRDQTAEQIQRLANVTQNVAD
FT                   NRVALENVLHVAPNAIGNGYNIYHPDTGTMLGGFAMGNFANPVQLICSAIGAVRNATAP
FT                   EASRICAEYLGPALRLLNFNYLPMPINAYLKKSPSPENLVYSDPALAPGGAGGSPTPPE
FT                   TPPAVSAFTGGGDVPPPSGWGTPPGPSAPATLDDMLLPAEAPPSPPQEGPPA"
FT   sig_peptide     303594..303713
FT                   /locus_tag="Mjls_0269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.565 at
FT                   residue 40"
FT   gene            304946..306145
FT                   /locus_tag="Mjls_0270"
FT   CDS_pept        304946..306145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0270"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0279 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96083"
FT                   /protein_id="ABN96083.1"
FT                   /translation="MIGRRSTLGVAAVAACVTVIASGCTFDGLNSIPLPGTVGTGSGAT
FT                   TYRVQLANVGTLESNSPVMVSDVVVGTVGKMTLRGWHADVEVTVRPETVIPANAVATVG
FT                   QTSLLGSMHLALDPPVGKMPSGRLQPGTTLGLDRSSTYPSTEQTLSSLSVVVNGGGLGQ
FT                   AGDIIREFNATLNGREDKLRDLLVRLRDFVGMLDTQRDDINASLAALNRLGGSLAGQRE
FT                   VITSALQRIPPALDVLIAERPRLTTALDKLRIFSDSATGLVEDTQADLVRNLKNLEPTL
FT                   KALADVGPNLGTALAYAPTFPYTQGFIDRAIRGDYMNQFIIFDFTIPRLKRGLFLGTRW
FT                   GEEGTPMVPAPGDPWYLNYTLDPLNAPVAPPTAVAPVPELTETSDGVDTVDPSPSAGGN
FT                   "
FT   sig_peptide     304946..305077
FT                   /locus_tag="Mjls_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.563 at
FT                   residue 44"
FT   gene            306145..307683
FT                   /locus_tag="Mjls_0271"
FT   CDS_pept        306145..307683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0271"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0280 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96084"
FT                   /protein_id="ABN96084.1"
FT                   /translation="MLTRFVRTQLIIFTVTAVVAMGVMIFGYLQAPTLLGIGRMTVTVE
FT                   LPGTGGLYRFSNVTYRGVEVGKVTDVRATRQGAVATLSLGTNQDIPADLHAAVRSVSAV
FT                   GEQYVDLQPRTGSAPYLHDGSVIGVENTSIPQAVGPMLDEVSAMIDSIPKDKISGLLDE
FT                   SAKALNGSAYDLGSMLDSSATVVGDAKGVSGEMRSLIDDSGPLLEGQAQTADQLRTWAR
FT                   SLAGVTGQVAANDPQVRTLLGTGPGAADEASRLLNAVKPTLPVLLANLTTIGQVAVTYH
FT                   ASIEQLLVLLPPYVAATQTVGVSRNNPTGMSLGDFTLNLNDPPACTVGFLPPSSWRSPD
FT                   DESDIDTPDGLYCKLPQDSPIGVRGARNYPCMGQPGKRAATAEQCASDKPFEPLAMRQH
FT                   VLGPYPFDPSLVAQGIPPDDRVDSDEQLYGPVGGTPMPPPSPEPAPAPGGPAVAPSAFT
FT                   PGESGGPSVAIATYDPQTGKYATPDGKVFTQPALGSKDAGGQNKTWQDLLPTGA"
FT   sig_peptide     306145..306255
FT                   /locus_tag="Mjls_0271"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.817) with cleavage site probability 0.446 at
FT                   residue 37"
FT   gene            complement(307688..308182)
FT                   /locus_tag="Mjls_0272"
FT   CDS_pept        complement(307688..308182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96085"
FT                   /protein_id="ABN96085.1"
FT                   /translation="MVTTVGALAAVASLAHPATASADPEWGLNGTYSATSNGEWAKKNE
FT                   VFRDEATVRAVWTIDTVCSYPTECTGTVRSDQGWEAPIYKKGGIWYVKHTVPRWEPCPD
FT                   GTAADGLQVFRFVPTVPDGSMTDPASTTLTGEDQTTGPSGACGVSRPLFITMPFKLVKL
FT                   S"
FT   sig_peptide     complement(308114..308182)
FT                   /locus_tag="Mjls_0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.917 at
FT                   residue 23"
FT   gene            308322..308702
FT                   /locus_tag="Mjls_0273"
FT   CDS_pept        308322..308702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96086"
FT                   /protein_id="ABN96086.1"
FT                   /translation="MRTPVFVVSAVVTAAVFASAPAGADPLGCEEPACVPGIAGNVTLG
FT                   APCANTSHFVFGTTDWGRLVFCGSPRRYAPRYFRSPPMEGIRVENTNCTGFENSVAQAP
FT                   DGLFLSCVASSGESLWVRGDNA"
FT   sig_peptide     308322..308396
FT                   /locus_tag="Mjls_0273"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 25"
FT   gene            308699..309103
FT                   /locus_tag="Mjls_0274"
FT   CDS_pept        308699..309103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96087"
FT                   /protein_id="ABN96087.1"
FT                   /translation="MNRFAAPAAIAGLILGMAPQASAQGPVPHHVRYTVTADQPTKADI
FT                   YYRAVDPPNWADYSHNPYRFSPKAEVVLDPASPWVFDTTLVDPNRWAMVTATSGVGPDQ
FT                   PHFRCELAVDGVVVASHEGPKGALCSQRSW"
FT   sig_peptide     308699..308770
FT                   /locus_tag="Mjls_0274"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.938 at
FT                   residue 24"
FT   gene            309107..309736
FT                   /locus_tag="Mjls_0275"
FT   CDS_pept        309107..309736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96088"
FT                   /protein_id="ABN96088.1"
FT                   /translation="MIDSIETRALAEEAEAEAAEALAEAARARAERLRAEAAEPQDKRR
FT                   RLRRPGWSTVVAVLAVFVTAASLAASGYVTWHHREAMHRQQQSAEFEAAARQIAITLMS
FT                   IDAAKAEESVKQILDSSTGQFHEEFKSASEDFVKLTQDGKVVTDVKVKAAAVESMTEDS
FT                   ATVLVTTTSTVTNAAGADKQPRAWRLSVDIVRDAGRLKMSKMEFVP"
FT   gene            309751..310239
FT                   /locus_tag="Mjls_0276"
FT   CDS_pept        309751..310239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96089"
FT                   /protein_id="ABN96089.1"
FT                   /translation="MRQARWRLILTVLIAAASVGLAVVLYVTQYRTDVQTDGAAASAAV
FT                   RAASEGTVALLSYQPDSVDTDLTAAKTHLTGEFLTYYGKFSDEILLPAARERAVRSEAA
FT                   VVRAAEAEIHPDAAKVLVYVNQTTTSRERPDASQTASSVMVSLTKVGERWLISAFDPI"
FT   sig_peptide     309751..309876
FT                   /locus_tag="Mjls_0276"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.357 at
FT                   residue 42"
FT   gene            complement(310236..310817)
FT                   /locus_tag="Mjls_0277"
FT   CDS_pept        complement(310236..310817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0277"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mmc:Mmcs_0286 thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96090"
FT                   /protein_id="ABN96090.1"
FT                   /translation="MNDGHEPLTESVRSLIDAVIRTEVDPEKIAAAHAHVAAALDILGE
FT                   QMMPGAYGVRAAPDGRRAPRGNVLIGERNAIAPPLIVDRDEAGLVSTEVDLGAAYEGPV
FT                   GHVHGGVCSLILDHLLGATAHRPDRPAFTGTLQLRYVRPTPLGPLRAEAWVEHEDGRKT
FT                   YARGRILSAGQTTVEAQGVFIRPRADRSAD"
FT   gene            complement(310814..312358)
FT                   /locus_tag="Mjls_0278"
FT   CDS_pept        complement(310814..312358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0278"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: mmc:Mmcs_0287 fumarate
FT                   reductase/succinate dehydrogenase flavoprotein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96091"
FT                   /protein_id="ABN96091.1"
FT                   /translation="MSAFDEEVDVVVVGSGGGVAGAYTAAREGLSVALVEATERFGGTT
FT                   AYSGGGGMWFPCNPVAQRAGIDDSPEDARAYFHRVVGDRTPLDLQRAYVLGGPRLIEYL
FT                   ERDEHFQFAELPWPDYFGAVEHARADGRRHIVPVPLPAADVGPQAAQIRGPLDAERLGH
FT                   PVPALLTGGRALIGRFLAALARFPHARTHLGAPLVDLVDVDGAVVGAVINRDGENVRVR
FT                   ARRGVLLAAGGFEQNSRMRESFGVPGRAEDTMGCPGNTGAAHRAAIRVGAATDLMDQAW
FT                   WSPGLTHPDGRSAFALWFTGGIFVDQRGERFVNESAPYDRLGRAVIAEMDSRGMTLPFW
FT                   MVYDDREGEVPPVKATNVSMVEAAQYRDAGLWRTADTLDTLADLIGVPADALTATVARF
FT                   NAMVAGGRDTDFGRGDEPYDRAFSGGRSPMVAIEQPPFHAAAFGVSDLGTKGGLRTDTS
FT                   ARVLDTDGRPIPGLYAAGNTMAAVSGTTYPGGGNPIGASLLFSHLAAMDMAGAGPR"
FT   gene            312460..313125
FT                   /locus_tag="Mjls_0279"
FT   CDS_pept        312460..313125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0279"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: mmc:Mmcs_0288 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96092"
FT                   /protein_id="ABN96092.1"
FT                   /translation="MKSGDGPNVTATGWALLGVLSYQDELTGYDIKKWTEWSLRFFYGS
FT                   PAYSQIYTELKKLENIGLLTSRVETDGGARSKRLYKITKAGLDALRDWADEGPVDPPQL
FT                   KHNPLLRVTFGHLTNPRRLKEIMQDHVAYADRMQREAATEARWAEAEPAWAYGRVALQW
FT                   AERYYAAERELAQSVIKDLDAAEEAFAKSAESNQDGKPSLAKDYWYEIERRVRAEEGD"
FT   gene            313195..314421
FT                   /locus_tag="Mjls_0280"
FT   CDS_pept        313195..314421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0280"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   mmc:Mmcs_0289 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96093"
FT                   /protein_id="ABN96093.1"
FT                   /translation="MGRERPTAADDIDPLQPAVLGPVTLRNRVIKAATSEGRSPDGLVT
FT                   DDLIAFHKRFADGGVGMTTVAYCTVAEDAASAPGQILMSRRAVPGLRRLADTVHQAGAA
FT                   VSAQLGHGGVVATRKVNKVTPKAPSRFVNPQSFDYCRPISRDEILTVVDQFGTAAQVAV
FT                   DAGFDAVELHLGHLYLPSSFLSPLMNRRKDEYGGSIDNRARFARQIAQRVREVVGNRAA
FT                   VIAKLSMEDGKRGGIALSESLRVVQLLDADRNLDAIELTQGSSVFKPMYLFRGDTPVDE
FT                   FAAVMPPPMNLGVRMVGKRVLGTFPYRDLYMLDAARQFVPVAAHTPLILLGGITTGEHM
FT                   QDAMREGFAFVALGRALLREPDLVNQIREQPGKRSLCNHNNKCMVTVFGKTHCVLDPGQ
FT                   RYGPVVSQS"
FT   gene            314430..314852
FT                   /locus_tag="Mjls_0281"
FT   CDS_pept        314430..314852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96094"
FT                   /protein_id="ABN96094.1"
FT                   /translation="MLGAVLALAAVLSPPAAHAETPYGNFEMQIQGRYDFHTWLWAVSR
FT                   CPGECLRVQAIAQPVAKAFAFRADAHLVDGRYTMTVDVPDGLRCGNVYYGPVIPTRDVY
FT                   TWDDATRSGTLSSSFATGCDGAPGGTLTYPFRLVRL"
FT   sig_peptide     314430..314489
FT                   /locus_tag="Mjls_0281"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.985 at
FT                   residue 20"
FT   gene            314863..315714
FT                   /locus_tag="Mjls_0282"
FT   CDS_pept        314863..315714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0282"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mmc:Mmcs_0291
FT                   luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96095"
FT                   /protein_id="ABN96095.1"
FT                   /translation="MRIGVSTPVVVQVPGVAAEWERDAGIEDLRTVAQAADSLGFEYLT
FT                   CSEHVAVPAADALARGAVYWDPLATLGFLAACTSRIRLATSVIVLGYHHPLEIAKRYGT
FT                   LDRVSGGRLTLGVGVGSLAAEFELLGAQFGDRGRRADDALRALRASLSTTRPAYDGEFY
FT                   QYASVVVEPCAAQPRVPIWVGGRTRRSLRRAVELADGWMPFGLSADRLSELLSTVDVPA
FT                   DFDIVLPVAPLDPSGDRDRAARRLRALDDLGATAVTCTLAATSAGHYCDQLEALRAIAD
FT                   DL"
FT   gene            complement(315725..316522)
FT                   /locus_tag="Mjls_0283"
FT   CDS_pept        complement(315725..316522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0283"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0292 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96096"
FT                   /protein_id="ABN96096.1"
FT                   /translation="MSRYTDRRVLITGGGSGIGQACVLRILDEGGHVVAADVSEAGLKD
FT                   TVSKAQSAADRLSTLVMDVGDEESVRAGVAEAIGILGGLDTLVNVAGILRSARLEQTTL
FT                   TDFERVLRINLVGTFLVTREAISALRNGNGPAVVNFSSTSAHFGHPYMSAYAASKGGIL
FT                   SMTHTLALEFAKDGIRFNCVQPGSISSGMTDGTGQARQSVGPGLPDDADYSLFSRLQPM
FT                   LAIDGGAMFADPSAVASVVAMLGSADAFFVTGTEVRVDGGTHM"
FT   gene            complement(316542..318248)
FT                   /locus_tag="Mjls_0284"
FT   CDS_pept        complement(316542..318248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0284"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mmc:Mmcs_0293 fumarate reductase/succinate
FT                   dehydrogenase flavoprotein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96097"
FT                   /protein_id="ABN96097.1"
FT                   /translation="MTTAHTATIPGGLPVRDTTVDLLVVGSGTGMGAALAAQARGLSVL
FT                   IVEKSEFVGGSTARSGGALWLPASQVIDGDGGGDTSQRAATYLDAVVDGTAPASRSAAF
FT                   LEHVDATIDLLRRTTPMRLFWAREYSDYHPEQPGGSAAGRTCECRPLDTAVLGEYLPRL
FT                   RPGVMEVKIPMPTTGADYRWLNLMSRVPRKGIPLVAKRLGQGIGGLLLGRRYAAGGQAL
FT                   AAGLFAGVLRAGIPIWTETALQRLVTDDGGRVTGAVVDHRGQEITVTARRGVVLAAGGF
FT                   DHHMDMRWKFQSERLGEHASLGAETNTGDAIRVAQDLGAAIDLMDQSWWFPAVAALPDG
FT                   DPKVMLAERSLPGSLIVDQTGSRFVNESCDYMTFGQAVLDRERAGDPVEAMWIVFDQQY
FT                   RNSYVFAAELFPRMAVPKAWYDAGIAHRSESLDDLGRKMGVPDAQFVATVQRFNEMAHA
FT                   GQDSDLGRGRSAYDRYYGDLTVTPNPNLRALDRGPFYAVKMVLSDLGTCGGLRADDRAR
FT                   ALREDGTTIDGLYAIGNTAANAFGATYPGAGATIAQGLVYGYIAAQDAAQA"
FT   gene            318349..319143
FT                   /locus_tag="Mjls_0285"
FT   CDS_pept        318349..319143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0285"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0294 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96098"
FT                   /protein_id="ABN96098.1"
FT                   /translation="MTDLDKYGPWAVIAGGSEGVGAEFARSLAGDGFNLVLIARKPGPL
FT                   DETAESCRELGADVRTLSLDLLDPEATSRIAEATADIEVGLLIYNAGASTCNDPFLDAD
FT                   LAEWRKIIDLNMSRMLELTQHFGRRMVAQSRGGIILVGSLSGYMGSVRHAVYSGVKAFG
FT                   RMFAESLWLELREQGVDVLELVLGVTRTPAMERAGLRFDIPGFIVNDPADVAREGLEHL
FT                   GDGPVRVAGGNAEQAARNSGPDRARIVLESHLAIQRLIGAQP"
FT   gene            319140..319643
FT                   /locus_tag="Mjls_0286"
FT   CDS_pept        319140..319643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96099"
FT                   /protein_id="ABN96099.1"
FT                   /translation="MSSDRLTALEARLQRLEDERDIQRLIASYGPYVDAADADGAAALW
FT                   AEDGSYDVEGWRMTSRDDVRAMVSSDGHRALVAAGCCHFLGPSIVTVDDDEAVAVCESV
FT                   VLRTTGETPVGYAVWRAAANHFHLRRVGGVWQIAARTTRLLDGNPEAHRLLTAGVAGQR
FT                   SDLS"
FT   gene            319695..320831
FT                   /locus_tag="Mjls_0287"
FT   CDS_pept        319695..320831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0287"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   mmc:Mmcs_0296 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96100"
FT                   /protein_id="ABN96100.1"
FT                   /translation="MTSDIDEVRQIEADAAPTRFARGWHCLGLTRDFGDGKPHTVNAFG
FT                   QKLVVFRSGDGRINVLDGYCRHMGGDLSQGEVKGNEIACPFHDWRWGGDGRCKQVPYSK
FT                   RAPRLARTATWTTLEQDGMLFVWNDPERKPPPDDVTIPRIEGATSDEWTDWHWYTTVVD
FT                   TNCREVIDNVVDMAHFFYIHGSLPTHFKNIFEGHVATQYMNSAGRADLQPPEGPRMLGI
FT                   TSVASYHGPSFMIDDLTYHYEEADHHTVLINCHYPIDANSFVLQYGIIVKKSEALPDDL
FT                   AVQTAVSLGDFVKMGFEQDVEIWKNKARIDNPLLCEEDGPVYQLRRWYEQFYVDIADVT
FT                   PDMVDRFEYEVDTTRPREEWMKIVEANISARASATSAG"
FT   gene            320828..321118
FT                   /locus_tag="Mjls_0288"
FT   CDS_pept        320828..321118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96101"
FT                   /protein_id="ABN96101.1"
FT                   /translation="MSVRPDNRLDDAPMVPVACRACGAKVLARKSSWQQTSVQWSADAA
FT                   QRCPQRRDSEALAAHGRRTVFLSCSELSESIVEAVRAGRLSIVDETVDVAP"
FT   gene            321128..321940
FT                   /locus_tag="Mjls_0289"
FT   CDS_pept        321128..321940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0289"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmc:Mmcs_0298 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96102"
FT                   /protein_id="ABN96102.1"
FT                   /translation="MTEHIDPPVAVVTGASRGAGRGIARALIAAGWRVYLTGRTVDSLG
FT                   EGSVAVPLDHRDDAAVGALFTRVEDEAGRLDLLVNNAAAVHDALTGRDPFWQKPVELGD
FT                   ILDVGLRSSYVAAWYAAPLLLRGPRGLIAFTSSPGSVCYMHGPAYGAQKAGVDKMAADM
FT                   AVDFRGTPVHTVSIWMGILLTEKLRGAFDGNPDGLAAMAEHAETPEFTGRVIDALYRDP
FT                   ARESLSGHTVIGAELAARYGITDEGGRQPVSHRGMLGAPRTPSDVVVR"
FT   gene            322037..323272
FT                   /locus_tag="Mjls_0290"
FT   CDS_pept        322037..323272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96103"
FT                   /protein_id="ABN96103.1"
FT                   /translation="MVDTEIDEAALIERIAALERAKSAAAAAQARATALLDEKRRAAEA
FT                   AAGVPANKRGRGLASEVALARHDCPNKGGRHLGFARVLVHEMPHTLAALECGALSEWRA
FT                   TLIVRESACLSVEDRRSLDTELCRDVSSLEGLGDKRIEAEAKKIAYRLDPQAVVDRAAR
FT                   AASERTVTCRPAPDTMTYVTALLPVAQGVAVYAALKRSADTTFDDRSRGQVMADTLVER
FT                   VTGCPAEVAVPVAVNLVITDEALLGGDPEPAVISGYGPVPAAVGRRLVDAAVTDKRSKA
FT                   TLRRLYRRPRSGALVAMESRARCFPKGLAAFIDLRDQTCRTPYCNAPIRHHDHARPHRA
FT                   GGPTSAANGLGECEQCNYAKEAPGWQVTAAIDETGTHTAEFTTPTGAVYRSTAPSPPGV
FT                   APPDAAGESRAA"
FT   gene            complement(323287..324363)
FT                   /locus_tag="Mjls_0291"
FT   CDS_pept        complement(323287..324363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96104"
FT                   /protein_id="ABN96104.1"
FT                   /translation="MLTDDRRLALSDVLRPASPPREVDDIYTDDQRERLLDVVRTQGPW
FT                   KLIIAQHFASAEELMATMSGAFPEGFEPSLDLFLTPTFRGYLANYGTVLYPELHDCFYN
FT                   EQFLAHAKSYWNAEYAKPEMMLFNINGPCANRDPGHLDSPSFRGVRHENAPTWLTSVMG
FT                   KSGLFQDHLIKMAQVITWFSLDEGSGFTYWPEGPLKAPQRLLPPVYNRGVVVQNEMMVH
FT                   RGEANGPLEQQTPAGLAFDTVFTGDPSDRDHWVLKNGDDVIARHHTDELRFLVHWSAEV
FT                   FSDYDELKKNMDHSDDLTIEQAIDTLVKDVNAQGISLKMPDNPLHDPQFIATLNAAYDL
FT                   GGPAAYPEEAPLSAFQLA"
FT   gene            complement(324455..325405)
FT                   /locus_tag="Mjls_0292"
FT   CDS_pept        complement(324455..325405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0292"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mmc:Mmcs_0301 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96105"
FT                   /protein_id="ABN96105.1"
FT                   /translation="MTVPGLDPDAAARVASFGAIPPMRERGLDAVRRAVEATPHPDDTP
FT                   EMADVDDLSIPGPAQPIPVRIYRPTEDDSAPVLVYFHGGGMVMGSNRSFEPLARALAAH
FT                   SGATVVSVEYRLAPEAPAPAQFDDAYAATVWVAGNAEVIRVDASRLAVVGDSAGGSLAA
FT                   AVALAARDRGGPSILCQVLLYPGLDRDMTCESIQLLADAPMLTRADIDYMHELADQGAA
FT                   VPPDQYRFPALATDLTGLPPAIVVTAGCDPIRDWGERYATRLRDAGVQTTQTRYPGAYH
FT                   GFLMRSDATARGRLAIAETGALLRAKFACPVPVSR"
FT   gene            complement(325402..326991)
FT                   /locus_tag="Mjls_0293"
FT   CDS_pept        complement(325402..326991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0293"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mmc:Mmcs_0302 fumarate reductase/succinate
FT                   dehydrogenase flavoprotein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96106"
FT                   /protein_id="ABN96106.1"
FT                   /translation="MNYDVIVVGFGAAGAAAAIEAADRGARVLVLDRGYGGGATALSGG
FT                   IVYAGGGTAEQQAGGYHDSVEDMRAYLESEVGDSVSGETLDRFCRQSPAMIEWLKAQGV
FT                   EFRGGEVPTYKTSYPTDDFYLYYSGNEKAYPYAGRARPVPRGHRVLARGMSSGKVLFDR
FT                   LARSAKHKGVEFIPLAQVHSLIQDDDGRIAGVRYRALDPAHPNARRHKVLTKLTGKAGT
FT                   WMPGLVEGLVARAEEMRTGASLDAEARAPAVILAAGGFVHNREWMQAHAPQFMKVSPLG
FT                   TVGDDGTGIALGLAAGGVTGKMDNVTAWRFLSPPSAFLEGLTVGADGRRIANEDLYGAT
FT                   HGNVLMRDFGGTGWAIYDAQTWRKVKSQIRTQTQIFQRLQLIYLFTIGHKKAASIEDLA
FT                   AENGIDAEGLRRTVDEYHRGLDNGAGDPAHKDPELCPPLLTPPFYSIDISADSSMFFPI
FT                   PGLTLGGLLVDESTGEILGADGESVPGLYAAGRNAVGVCSNSYVSGLSLADCIFSGRRA
FT                   GAHAAGGLGQPR"
FT   sig_peptide     complement(326926..326991)
FT                   /locus_tag="Mjls_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.810) with cleavage site probability 0.679 at
FT                   residue 22"
FT   gene            complement(327018..327806)
FT                   /locus_tag="Mjls_0294"
FT   CDS_pept        complement(327018..327806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0294"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0303 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96107"
FT                   /protein_id="ABN96107.1"
FT                   /translation="MRITDRVFVVTGAGNGMGRQVTLDLLRRGALVAAADVDEVGLTGT
FT                   ARLAMAGTRLSTHVLDVTDRDAVAAMPGRVVDVHGRVDGLVNIAGVIHRFAPFIDLPPE
FT                   TADRIMAVNFTGTVDMCRAFLPVLLARPEANLTNMSSLSALLPFASQTLYSASKGAVKQ
FT                   FSEGLYAELCDTNVHVVTVFPGNVATELTSNSGVEMLDAGSKKVRSTTPEAAGRKIVDG
FT                   IAEDRFRVLIGADAHSLDVLVRVSAKRTTRLVAKQIKSVL"
FT   gene            complement(327818..328678)
FT                   /locus_tag="Mjls_0295"
FT   CDS_pept        complement(327818..328678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0295"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0304 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96108"
FT                   /protein_id="ABN96108.1"
FT                   /translation="MNAGQTFGGGVAVITGAGAGIGAGLARHAARLGMTVVLADVDGDA
FT                   IAALRDELSDQGATAFDMVCDVRDFAAVEELAQRTYRDIGPVRLLVNNAGVEQFGYLWD
FT                   TPVENWQRVVDINVSGVFHGVRAFLPMMIEARTPAWVWNLSSIGGVAVVPLQAPYIMSK
FT                   HAVLALTECLALEVQLAEHDHIHVQAVLPGAVTSNIFESAGGVTDGDVGAAESQRLAML
FT                   DIKAAAMDPLAAAEVVFDQAADGRFYLLTQPEYVGNAMAERADVLTTQRAPLLRTKPRF
FT                   DPAQH"
FT   gene            complement(328683..329165)
FT                   /locus_tag="Mjls_0296"
FT   CDS_pept        complement(328683..329165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96109"
FT                   /protein_id="ABN96109.1"
FT                   /translation="MSNEIALSELQEFVAGFWYHYDEAHYDDMAAAYADDIRYISRSES
FT                   GASPFEELMSPELVGREAVMEWLSEHRKQSPYPLRHHATNLHRTGTDGDVTRARFYIFV
FT                   NQIANYVPFAVSSGVAEVAVRRGAGGLEFTEMEVILDTTNSVLLSEYSADPAAAGA"
FT   gene            complement(329228..330013)
FT                   /locus_tag="Mjls_0297"
FT   CDS_pept        complement(329228..330013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0297"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mmc:Mmcs_0306 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96110"
FT                   /protein_id="ABN96110.1"
FT                   /translation="MTADMSGPLRITTTAAIQVWTIDLPHVGNAITDDGFIAAFEAAVH
FT                   AVNADNAIRAVILTGEGKIFSAGGNVKEMADRQGMFGLEPLDQRRAYLDGIQRIPRALE
FT                   RLEVPLIAAVNGAAVGAGCDLAMMCDIRIASDRASFAESFVQVGLIPGDGGTWFLPRAV
FT                   GYARAAEMTLTGDRIDAATAAEWGMVSRVVPHEDLLAEAQALAERITKNPAHVLRMAKR
FT                   LLQESRTGSLESTLGMAAAMQPLAHRDAEHERRISRWRS"
FT   gene            complement(330010..331428)
FT                   /locus_tag="Mjls_0298"
FT   CDS_pept        complement(330010..331428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0298"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0307
FT                   betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96111"
FT                   /protein_id="ABN96111.1"
FT                   /translation="MHDYTRKTLFIDGRWATPDGGDAIEVIDPATEQVIGSVPDGTTAD
FT                   VDAAVAAARRAFDPLITVAERRERLDRVIAAMEKRLPDIGETITREMGAPVRIAQGVQT
FT                   KVPLAVARGIADVLATFEFEERMGNSLVVREPYGVVGAITPWNYPLYQVVAKVVPAIAA
FT                   GCTVVLKPSNEAPLSVFEFVEALDEAGLPPGVVNLVSGSGRVVGERIAEHPDVDLVSFT
FT                   GSTAVGQRVAELAAKTVKKVALELGGKSANVILEGGDLTTAVKVGVGNAYLNGGQTCMA
FT                   WTRMLVPESRYGEALELVEAAAARYTVGDPLDPATRIGPSASASQFATVRGFIERAQRD
FT                   GARLITGGAEKIRDIGYYVAPTVFADVDPDSELGQEEVFGPVLAVIPFRDEDDAVRIAN
FT                   GTPYGLAGAVWAGDLDHAIAFARRVQTGQLDLNGGAYNPVAPFGGYKKSGVGRELGRAG
FT                   FEEFLQTKSLQLPA"
FT   gene            complement(331443..332549)
FT                   /locus_tag="Mjls_0299"
FT   CDS_pept        complement(331443..332549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0299"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_0308 alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96112"
FT                   /protein_id="ABN96112.1"
FT                   /translation="MFEGRIARFDAPGQPFVIDTVDLADVGPGEILVKVTRTNICGSDL
FT                   HAWHGTFATRGLGGQLPTVLGHEMVGAVAALGDGVTADSNGVPLAEGTRVVFPYFYSCH
FT                   RCRNCLLGRRGACLNLKMAMLGRADEPPYFVGGYGDYYLLPAGAVVYTVPDVVSDEVAS
FT                   GANCALSQVMYGLERVDQQLGEVVVVQGAGALGLYAVAVAKARGAAKVIAIDGVPERLE
FT                   LATAFGADAVVDITEATTVKDRAKIVRTLTDGHGADVVVEVVGHPAAIDEGLKLLGQFG
FT                   RYVEIGNINIGKTFEFDPSRFVFGNKTMVGVSLYDPAVLSRALTFLEQHQDHLPLDRLA
FT                   AAHYPLDHINEAFAAADGKRDVRASIIP"
FT   gene            complement(332562..334175)
FT                   /locus_tag="Mjls_0300"
FT   CDS_pept        complement(332562..334175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0300"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0309 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96113"
FT                   /protein_id="ABN96113.1"
FT                   /translation="MAGDRACLGFPMDAAMDPVVVQARSHTLGDIPRRSARRFPDKTAI
FT                   VDGDVVLTFAEFERLVDRAAAALQDNGFGPGDRIALLSHNCWQYAVLAFATARAAVVLV
FT                   PINFMLTAEEISYLLGHSGVRGFLVEADLTATAEEAMRLGGSVTTKVALVPDGDAPAEG
FT                   WDDFARWLTTESPAPSPHIDDDQLLRLMYTSGTESRPKAVMHSSRSLMWQYVSTIVAGS
FT                   MAGDDVEVHSLPLYHCAQLDNFLATDVYLGATSIILPRPEPELVLRTIERYGVTNYFAP
FT                   PTVWISLLRCPVFDEVDLSSLRKGYYGASAMPREILAELRERLPDLRLWNFYGQTEMAP
FT                   LASALGPDEQDAHAGSAGRPVVNVETTILDEDDTPVATGVVGEIAHRSPHLMLGYLDDA
FT                   AKTAEAFRGGWFHSGDLGYYDEHGLLHVVDRKKDMIKTGGENVASREVEETLYRHAGVQ
FT                   EAAVFGLPHPVWVETVVAAVVLRDGSAVTEDDIIAHCRAHLAGYKTPKQVFFVDTLPKN
FT                   PSGKLLKRDLRQRFSAAHSH"
FT   gene            334243..336126
FT                   /locus_tag="Mjls_0301"
FT   CDS_pept        334243..336126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0301"
FT                   /product="Cyclohexanone monooxygenase"
FT                   /EC_number="1.14.13.22"
FT                   /note="KEGG: mmc:Mmcs_0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96114"
FT                   /protein_id="ABN96114.1"
FT                   /translation="MTTDAELRSHLRQADPGVLVAVLAQMTGDPSVIDEFAPAISHIPD
FT                   PPERAGVTDPDTMEALVDRIVEALDTPRSGGLAADDPNLFTRLLPVALGSDVEDEFVPL
FT                   LLEQGGFQLSQPTLPRDVPIPASTTVTIIGAGIAGIVAALAARDAGVAFEILDRNDEVG
FT                   GTWLTTKYPGIGVDTPSAYYSLSREVNPDWTNYYPQGAEYQAYLVSLADKHGLREHTRF
FT                   GTEVEALWWDDDRQEWQIHAVDRDGNRSVSHSRVVITAAGYLNRPRWPDIPGRDTFAGI
FT                   SVHSAQWDPSLDLTGKRVAIIGAGCTAVQIVDACVDQVEHLTVFQRQPHWVAPRKRLSD
FT                   DVPEYRRYLGRHLPYYANWHRLKSYWATADNNYPVIVRDPEWAERHLSISPANDVLLQM
FT                   CLEYIDRMFGEGTELAKKVTPDFAPYGKRIIRDPGGYYAALTRDHVDVEASEPAEVNAR
FT                   GIVTQDGRQIDLDVIVYATGYHLDFLSTVDIRGRGGRTLREEWGDSPRAYRGGTVPGFP
FT                   NLFITSAPNYSPGHGAGANFSMEVLAHYIMECLQLMASRRATTIEVTQEAYDDYVADID
FT                   DAMSRTVWCHTPNAHTYYRSGSGRVVVATPYRLIDVWQQHRAPVEDHFVIR"
FT   gene            336123..337010
FT                   /locus_tag="Mjls_0302"
FT   CDS_pept        336123..337010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0302"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0311 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96115"
FT                   /protein_id="ABN96115.1"
FT                   /translation="MSRLLSGKTALVTGSSRGIGRAIAQRLAAEGATVVVTARSHTPSP
FT                   SVRAGAAAALPGTIGETVEMIEAAGGTACGVAADLEDQQQRLRLIDEVLDRTGRLDILV
FT                   NNAGYADYSVVEHMAMDTFDRTVEHYLRTPFVLSQCAIPHMRTQGAGWIVNIGSVTGMA
FT                   PVRPFREYNKSSGDVVYASVKAALHRFTQGLAAELVDDDIAVNCVGPSTAVRTPGASQL
FT                   IPDTFPTEPVEYLAETVLAMCHLPAADRTGLVAFSLHYPWSQGLPVHTLDGSAVLPPLE
FT                   PPATANPNIRPAGL"
FT   gene            complement(337017..337637)
FT                   /locus_tag="Mjls_0303"
FT   CDS_pept        complement(337017..337637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0303"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /note="PFAM: Stress responsive alpha-beta barrel domain
FT                   protein; KEGG: mmc:Mmcs_0312 stress responsive alpha-beta
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96116"
FT                   /protein_id="ABN96116.1"
FT                   /translation="MYSVIRLLDVDESERDDVLDTLRRSTFGAERTLVEPTLPGVRNGG
FT                   DILVRLRFSDRHARVDAVTKLDELLDRNAVRHVNGATYSGSSTPGADGIATVYRALLLR
FT                   VRPGTDEATVRRFEDDLRLLPRYVRTIHSWQLSRVEDAIGTSTWTHVFEQEFTDVDGLM
FT                   GPYLMHPIHWAYVDRWFDPECPDMIVRDRVCHSFCRNDAVVHA"
FT   gene            complement(337630..337971)
FT                   /locus_tag="Mjls_0304"
FT   CDS_pept        complement(337630..337971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96117"
FT                   /protein_id="ABN96117.1"
FT                   /translation="MAEVFVTDRVVTRPGRTREFVDAYLTGYAPGARQRGMTLQRVLVS
FT                   PPIWFEDQPNTVTVTWSLPSARAWWEMTWQGRPDPSIGEWWTGIDELVTERSREVAADA
FT                   ADVDGLCDV"
FT   gene            complement(337964..338896)
FT                   /locus_tag="Mjls_0305"
FT   CDS_pept        complement(337964..338896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0305"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mmc:Mmcs_0314 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96118"
FT                   /protein_id="ABN96118.1"
FT                   /translation="MTGALDPQIADLIERLDRGFPPVQTMTGAQARATIRSRFIAPAEP
FT                   EPVAAVEDRSVGEIPIRIYHPAGAGPLPVLVYAHGGGFVFCDLDSHDGLCRDIANQTAA
FT                   IVVSVDYRLAPEHPWPAAAEDVYAVTRWVADNCTALGADPGRIAVGGDSAGGNLAAVTA
FT                   LIARDRGGPSLVAQLLVYPMVTPDFTTESYRLFGSGYYNPAEALRWYWDQYVPNDFDRT
FT                   HPYVSPLHADLSGLPPAVVVIAGHDPLRDEGVRFGEALSAAGVPTVVRCFDGGIHGFMT
FT                   MPSLELAQTARAQLCQDAVALLTGVPAGG"
FT   gene            complement(338893..339867)
FT                   /locus_tag="Mjls_0306"
FT   CDS_pept        complement(338893..339867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0306"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: mmc:Mmcs_0315
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96119"
FT                   /protein_id="ABN96119.1"
FT                   /translation="MGLIQFQDPSDLAHSVVIQTGIFLIGICLICTSAPGGAMTVQPGL
FT                   APVSPESTPSAVIDRVSLVLDAFDGPGRLTLAQIVRRTGLPRSSAHRMLERLVQLRWLR
FT                   RNGRDYELGMRLVELGSLAVHQDRLHRAATPLLHDLHRATGLVVHLAVLDGADVVYLEK
FT                   IGDRMVAALPSRVGGRQPAHCTAIGKALLAYNSDACDDVDLDNRRTKYSIGSAAQLANE
FT                   LAKTRAHGVAFDREESLPGFGCVAAPIGAPGEAVAALSVCGPMGRMVFDQRLAAPVRMT
FT                   AMGVWRNVEGGPQRVAPTLQQVRPLRSGPTPRPAHESTALQLA"
FT   gene            complement(339927..341390)
FT                   /locus_tag="Mjls_0307"
FT   CDS_pept        complement(339927..341390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0307"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mmc:Mmcs_0316 fumarate reductase/succinate
FT                   dehydrogenase flavoprotein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96120"
FT                   /protein_id="ABN96120.1"
FT                   /translation="MTADDVRPVPASSVTSWDHEADVVIAGYGVAGAAAAVEAAHAGAD
FT                   VLVLERTGSWGGAASMAGGFIYLGGGTPIQKACGFEDSVDNMAAFLNAAMGPGADDRRI
FT                   ADYCEGSVAHFDWLVECGVPFKAEFFGEPGWEPMGDQGLMYSGGENSYPFNTIATPAPR
FT                   GHVPQMSDKKQGEASAGYMLMKPLVETATAAGARALYDVRVQRLVVEADGRVTGICARQ
FT                   YGTDVTIRARRAVVLATGSFAYNDAMVAQYAPRIAGRPAASIEQHDGQAIRMAQALGAD
FT                   LAHMDATEVAIFIDPQQLVRGVLVNERGQRFVAEDTYPGRVGQLTLYHQNNTAYLIIDG
FT                   DAQEEAMASLSPQLMMRPPTWVCETVAELEAEIGLAPGSLQTTIAAYNDGAARGEDPLL
FT                   HKKPQWLRPVGSPVGAIDLRESTGGFTLGGLQTSLDGEVLHVDGEPIPGLFAAGRSTAG
FT                   LAAWGYASGISLGDGSFYGRRAGRAAAKG"
FT   gene            complement(341387..342295)
FT                   /locus_tag="Mjls_0308"
FT   CDS_pept        complement(341387..342295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0308"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mmc:Mmcs_0317
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96121"
FT                   /protein_id="ABN96121.1"
FT                   /translation="MTVLKSLGYVTVQTADIDRWRHFAFQVLGFAEGSGPDDSCLYLRM
FT                   DERAARIIVRPGDTDRIVTVGWEVRDHAALEQVKRDLDAAGTPFKQLSLEEADARRVEE
FT                   VIAFEDPAGTALEVFHGAVLDHSPVVTPFGARFVTGAQGLGHVVLPALDVNGVFEFYTG
FT                   VLGFRSRGAFRVPVPPEFGPVRVRFLGINERHHSLAICPASTVRDPGLVHLMVEVDSLD
FT                   AVGQALDRVAADGYQLSSTLGRHTNDKMVSFYVRAPGDWDIEFGTEGMRVDETYYTAEE
FT                   ITADSYWGHQWVGDLPAAMRP"
FT   gene            complement(342311..343492)
FT                   /locus_tag="Mjls_0309"
FT   CDS_pept        complement(342311..343492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0309"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain"
FT                   /note="PFAM: Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain; KEGG: mmc:Mmcs_0318 acyl-CoA dehydrogenase, type
FT                   2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96122"
FT                   /protein_id="ABN96122.1"
FT                   /translation="MTERVIDRVMELADQFREQAVEAERIGKLSDTTVKNMKAVGNIRL
FT                   LQPEEYGGYEVHPREFAETVMATAALDPAAGWVNGVVGVHPYQLAYADPKVAQEVWATD
FT                   VDTWIASPYAPQGVAKPVDGGYLFNGRWQFSSGTDACDWIILGAMVGDADGRPVMPPQI
FT                   LHMILPRSDYEIVDDSWDVVGLRGTGSKDVVVRDAFVPAYRTMDGLKVMDGSAQVEAGM
FT                   TKTLYKMPWSTMFPLGISSATIGICEGALAAHLDYQRERVNASGVAVKDDPYVMYAIGE
FT                   AAADIQASRQALLANVDRIFDMVDTGTEVTFADRAAVRRDQIKAVWRAVTAVDQIFARS
FT                   GGNALRMDKPLQRYWRDAHAGVAHAIHTPGTIYHASALSSLGVDPQGALRAMI"
FT   gene            complement(343582..344601)
FT                   /locus_tag="Mjls_0310"
FT   CDS_pept        complement(343582..344601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0310"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: mmc:Mmcs_0319 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96123"
FT                   /protein_id="ABN96123.1"
FT                   /translation="MIADVDSVQLIVTDVIEESHDARSLVFAEAAGLDYRPGQFLTLRV
FT                   PGTDGGAVARCYSLASSPHTDAAPKVTIKRVDGGYGSNWLCDNVVAGHVIESLPPSGTF
FT                   TPADLDRDLVLWAGGSGITPVMSILKSALAVGRGRVTLVYANRDERSVIFAAELRGLVT
FT                   RHPDRFTVAHWLESVQGLPGREQLAALARRFAGGEAYLCGPAPFMAAVQGALADAGVAR
FT                   DAVHTEVFRSLTGDPFAEVAPVDTATEDGADLRVDLDGRQHGLRWPRQSTLVDTMIAAG
FT                   LDVPYSCREGQCGSCAATLRSGRVDMPDTDILEPEDIEAGTILGCQATPASDDVHIEF"
FT   gene            344692..346314
FT                   /locus_tag="Mjls_0311"
FT   CDS_pept        344692..346314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0311"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mmc:Mmcs_0320 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96124"
FT                   /protein_id="ABN96124.1"
FT                   /translation="MDTSADQLPDHVDAVVVGAGFAGLYALHKLRSQGLTVRVFEAAPD
FT                   VGGTWYFNRYPGARCDVESVDYCYSFSDELQQEWNWSEKYATQAEILRYINWVADKLDL
FT                   RSGVTFNTKVTSAVLDEDTLRWTVTTDTGTVVNARFAIMATGPLSAALTPQFPGLDTFA
FT                   GEIYHTADWPHEDVDFTGKRVAVIGTGSSGIQSIPIIAEQAAQLHVFQRTPNYSVPAGN
FT                   RPLTDDDIATVKATYDERRRLSWRSGGGSPHIAHPKLTMEASPEERRAAFERRWELGGV
FT                   LFSKTFSDQMIDPRANEEARKFYEEKIRAVIDDPEVADLLIPNDHPIGTKRICTDTNYF
FT                   QTFNRPNVELISVRKTPIESVDPGGINTSDAHYDVDVIVLATGFDAMTGALAKMDIVGR
FT                   GGETLADDWRDGPRTYLGLGVDGFPNLFIVSGPGAPAVLANMVLHAEAHVNWISDCIDY
FT                   LDSHGCVAIEATPQAVDDWAAELSRRAEATLFTQANSWYLGANVPGKPRVFMLFIGGFG
FT                   VYLDICAEVADAGYKGFELLKAP"
FT   gene            complement(346405..347262)
FT                   /locus_tag="Mjls_0312"
FT   CDS_pept        complement(346405..347262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0312"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0323
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96125"
FT                   /protein_id="ABN96125.1"
FT                   /translation="MTATSDQLPLQELTTPSGTLRYYDTGAGPTVLFLHGSGPGVTGWR
FT                   NFRGVLPAFSAHFRCLILEFPGFGVSDDAGGHPMIDAQGAVAPFLDGLGVDRVDIVGNS
FT                   MGGGVGVNFAIHHPDRLRRLVTIGGIGTNVFSPGPSEGIRLLQEFTEDPTRQRLVDWLR
FT                   SMVYDEALVTEELIAERWELATDPETLAAARRMYGKAAFAQMMAFMRTSDAPLPWAQMH
FT                   KVAAPTLLTWGRDDRVSPLDMALIPMRTIPNAELHVFPNCGHWAMIEAKAAFEAAVLSF
FT                   LLRE"
FT   gene            complement(347297..347902)
FT                   /locus_tag="Mjls_0313"
FT   CDS_pept        complement(347297..347902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0313"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0324
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96126"
FT                   /protein_id="ABN96126.1"
FT                   /translation="MDSTITAVTRRDRVVAAALHLAADGYDAVHIRTVAELAGVAPSTV
FT                   YQHFASKDDLLVASLHRWLSACETDARAPLDRIAEPYDRLLYVADFITQRLWAEPLLAD
FT                   ALTRAYLCAESVAAANADRVRNSLSQMLTSAMGRELPTVRHQHIGDLVADIWASSMLAV
FT                   AQHRATADGSRERLARTIAVIARHDAEEGLPSAGLRAV"
FT   gene            347953..349326
FT                   /locus_tag="Mjls_0314"
FT   CDS_pept        347953..349326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0314"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: mmc:Mmcs_0325 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96127"
FT                   /protein_id="ABN96127.1"
FT                   /translation="MGFRPTGAPANAKIGDMDETATPDPALLRRVAISSLLGTAIEYYD
FT                   FLVYGTMSALVFGIIFFPESDPAVATIAAFGTLAAGYVARPVGGILFGHFGDRIGRKSM
FT                   LVLTMTLMGVASFLVGVLPTFAAIGVAAPILLVALRVIQGVAIGGEWGGATLMVTEHAE
FT                   PHRRGAWNGVMQMGSPIGSLLSVAVVTAITLMPDESFMSWGWRVPFLVSLLLLGLGIYV
FT                   RLSITESPVFEQAKRADDRPQGPPLVEVLRRPGNLVLACAVGIGPFALTALISTYMISY
FT                   ATAIGYHRTDVMTALIFTSTTALITIPLFSALSDRVGRRAVIVTGAIGIVCYAWPFYAL
FT                   VDMGSVPLLTVAMVIAQVLQSLMYAPLGALFSEMFGTRVRYTGASMGYQFAALLGAGFT
FT                   PLIASSLLAEGVSRTPLVVLAAGCGVVTIVAIWRVSETRGADLTDAGRLPRGAAAADR"
FT   gene            complement(349323..350162)
FT                   /locus_tag="Mjls_0315"
FT   CDS_pept        complement(349323..350162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0315"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmc:Mmcs_0326 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96128"
FT                   /protein_id="ABN96128.1"
FT                   /translation="MGTYAVTGSASGMGRATAERLRADGHRVIGVDVKEADVVADLSTP
FT                   DGRARAVSQVVSAAGGHLDGAVLAAGIGPGSGKGRLRLIAEVNYRGVVELLDGWRPALA
FT                   SAGNAKVVVVSSNSTTTTPLVPKRAVKALLAGDVDKAVRAVRLFGPVGSALIYAASKIA
FT                   VSRWVRRHAIRPEWAGAGIRLNALAPGAIMTPLLEEQLASKQQAKAVQRFPVPVGGFGD
FT                   AGQLADWIRFMLSDAADFLCGSVIFVDGGTDAHFRTDDWPKPVPARRLVSYLKRFRN"
FT   gene            350260..350637
FT                   /locus_tag="Mjls_0316"
FT   CDS_pept        350260..350637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96129"
FT                   /protein_id="ABN96129.1"
FT                   /translation="MAEPPTTEDGHHVVVNGRKWRATDPSIPADRRAELTRILMSWRRE
FT                   VRRTEGTDQERAARAGVQAAKVALGERGTPPWWEQTDEQRRARWQADVPAPGGPLPPEA
FT                   PVREHRGDHPHPGNGERTEHA"
FT   gene            350630..351526
FT                   /locus_tag="Mjls_0317"
FT   CDS_pept        350630..351526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0317"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mmc:Mmcs_0328 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96130"
FT                   /protein_id="ABN96130.1"
FT                   /translation="MPENTSAVVVGIDGSDSALQAARWAGAVAATCGAPLHILHGMPSL
FT                   GRNLTETAAAIQAAIMSYQRDSALIFLRAAADAVHEDRPDLSVTTEASETPVDEALIEA
FT                   SATARLIVLGGQDVTGAAALILGSTTLRVATHADCPAVAFRGDDVTVSDKPIVVGVDNT
FT                   AAGAGVLATAFDFADAMKVKLIVVRSWTTRAPAGDVTIPFLIDWEALEAAEWAALTELV
FT                   DGWRQRYPDVDAECVVETMSPARALLSHATGAQLVVVGSRGRNALAGLVLGSTSMNLLH
FT                   HSQVPVMVTRAHAPEGD"
FT   gene            complement(351587..352507)
FT                   /locus_tag="Mjls_0318"
FT   CDS_pept        complement(351587..352507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0318"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mmc:Mmcs_0329
FT                   luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96131"
FT                   /protein_id="ABN96131.1"
FT                   /translation="MKLVFNLPHMLRLKAMMQPWEAAVTGADQTRMAKCADAWGYDMIA
FT                   VPEHFVIPNDHVELSGPHYLQSTVAQAYLAGATERIRLNSCITVLPLQHPIVLAKALAT
FT                   ADWMSGGRMMVTFGVGWLEKEFELLGVPFHERGRMADEYLAAIVELWTSDSPSFHGKYV
FT                   SFDDIAFEPKPVQKPHLPVWIGGDADAALRRAAKFASGWWSFLTPPEKIAERLEFIKSQ
FT                   PGYDGRPFDVVHGLGTTRVGEGHVARDDPHGRPGMNAAEIVDRLCWLGEQGVTVSAVPL
FT                   PPVSGVDEYLDYAQWVVEEIKPQVP"
FT   gene            complement(352536..353375)
FT                   /locus_tag="Mjls_0319"
FT   CDS_pept        complement(352536..353375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0319"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0330 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96132"
FT                   /protein_id="ABN96132.1"
FT                   /translation="MGGRVDGKVAFITGAARGQGRSHAVRLAEEGADIIAVDVCGPISS
FT                   HTDIPPATPDDLAQTADLVKGLNRRIVTAEVDVRDFDALDAVVRSGVEQLGRLDIVVAN
FT                   AGIGNGGQTLDKTSEDDWRDMIDVNLSGVWKTVKAAVPHLLSGGRGGSIILTSSVGGLK
FT                   AYPHTGHYIAAKHGVIGLMRTFAVELGQHSIRVNAVCPTNVNTPLLMNEGTKKLFRPDL
FT                   ENPGVDDLAVAAQFMHVLPVGWVEPIDISNAVLFLASDESRYVTGLPVTVDAGSMLK"
FT   gene            complement(353455..354042)
FT                   /locus_tag="Mjls_0320"
FT   CDS_pept        complement(353455..354042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0320"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0331
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96133"
FT                   /protein_id="ABN96133.1"
FT                   /translation="MSAPRKPKADISARQRLIEATAKIMREEGYAAATSRRVAAEAGVK
FT                   QALVYYYFPTMDDLYVEVLRAGAEASLERMREALTADEPLHTLWTMNSDLRLTGLNTEF
FT                   MALANHRKAIRAELKSYAERVRDIETAAVAVALRARGVDLHEYPPTAVSMLIAQTARSL
FT                   CNESAVGVTLGHDEFRAFMERLLDRLTAGQDG"
FT   gene            354155..355432
FT                   /locus_tag="Mjls_0321"
FT   CDS_pept        354155..355432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0321"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmc:Mmcs_0332
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96134"
FT                   /protein_id="ABN96134.1"
FT                   /translation="MTDLASVDFFSDPDISQNPYGYWDALREQGPVVREPHHGVVAVTG
FT                   YQEVLAAFRDHDHFSAVNAIGGPFPPLPFEPQGDDITEQIEAHRHLFPIHEHMVVMDPP
FT                   AHERARSLLSRLLTPRRLKENEDFMWQLVDQQIDQIIGNGRCEFLSEYAKPFATSAIID
FT                   LLGVPEDDRPEFLAALGAETRQGTRVGALDGESVGLDPLQYLDDKFAGYLADRRREPRD
FT                   DVLSGMATATYPDGSTPELMEVVKPATFLFAAGQETVTKLLSAAVQTLGDRPEYQDLLR
FT                   EDPRRIPTFIEEALRMHAPTKVDFRLVRKTTTLGDVHLPAGTIVMLCLGAANRDPLKFD
FT                   DPHEFRPDRKNVREHLAFGRGIHTCAGAPLARVEGVVTVRRLLDRLRDIGIDESVHGPA
FT                   RRRNYVYEPTFLLRGLTSLHIEFTPA"
FT   gene            complement(355429..356238)
FT                   /locus_tag="Mjls_0322"
FT   CDS_pept        complement(355429..356238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0322"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mmc:Mmcs_0333 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96135"
FT                   /protein_id="ABN96135.1"
FT                   /translation="MSHSAETNADAYERVRHAYTDVMGVAAPEPHSSAMARLYDFVFAE
FT                   VWQRPVLSRRDRRFITLACVAAADAETPLRDHVYAALSSGDVTIAEMQEMVLHFAVYAG
FT                   WPKASRFNMIVDELWERIHAERGHQLPSPEPLLPLTTPSDPEDRLAVGEQAFKDVNCLA
FT                   FAPTRDNPFSGAGILNFVFGEVWLRPGLGMRERRLITVTCVGFQDAPYPIVSHVYAALK
FT                   SRDLSFDEMDELALHFAAHYGWPKAAHLAEAIREQKQRVTAEWADTG"
FT   gene            complement(356222..357031)
FT                   /locus_tag="Mjls_0323"
FT   CDS_pept        complement(356222..357031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0323"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   mmc:Mmcs_0334 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96136"
FT                   /protein_id="ABN96136.1"
FT                   /translation="MNERNGRVAGKRVVVTGAARGMGRSHAVRLAEEGADLILVDICRS
FT                   LPELEYPLATAEELDETGRLAETHGARVVTHVVDVRDGAALAAAVDDGVAQLGGLDAAV
FT                   ANAGVLTVGTWDTTTSEQWRAVVDVNLIGTWNTCAAAIPHLLEHGGSLVNISSAAGVKG
FT                   TPLHTPYTASKHGVVGMTRALANELAAKSIRVNTVHPTGVETGMRPDSLRGVLESRPDL
FT                   VPLFLNALPVVMADAVDISNAVLFLISDESRYVTGLEFKVDAGVTLR"
FT   gene            complement(357028..357858)
FT                   /locus_tag="Mjls_0324"
FT   CDS_pept        complement(357028..357858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0324"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmc:Mmcs_0335 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96137"
FT                   /protein_id="ABN96137.1"
FT                   /translation="MGSLDGKVAFITGAARGQGRSHAVRLAADGADIIGVDICADIESN
FT                   GYPMATRGELDETVALVEAQGGKMLGSVADVRDFHALKTALDAGVEHFGRLDIVCANAG
FT                   IATMAFRELTIEEDLEMWNDVVDVNLVGSFHTAKAAIPHLIAGQRGGSIVFTSSTAGLR
FT                   GFGGLQGGGLGYAASKHGIVGLMRTLANALAPHSIRVNTVHPTAVNTMMAVNPAMTAFL
FT                   ENYPDGGPHLQNPMPVQLLEPEEISSAIAYLVSDEAKHVTGVTFPVDAGFCNKL"
FT   gene            357946..358554
FT                   /locus_tag="Mjls_0325"
FT   CDS_pept        357946..358554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0325"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0336
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96138"
FT                   /protein_id="ABN96138.1"
FT                   /translation="MGEPRDRSDDRLLAVVVEILDNDGYDAVQLREVARRARVSLSTIY
FT                   KRYATRDELILAALEAWMEDNRYSGVVPHPKAADASLHEALMDLFRTIFEPWEQHPGML
FT                   TAYYRARSSPSGQTLLQRGLDVVVPAGLELLADVDDSFIDDLNAVVSSVVYGLLGRFST
FT                   GEIAITEILPTLDRAVYWLTTGYEAAKGSVVAVHTRDVR"
FT   gene            complement(358519..359208)
FT                   /locus_tag="Mjls_0326"
FT   CDS_pept        complement(358519..359208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0326"
FT                   /product="protein of unknown function DUF899, thioredoxin
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF899,
FT                   thioredoxin family protein; KEGG: mmc:Mmcs_0337 protein of
FT                   unknown function DUF899, thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96139"
FT                   /protein_id="ABN96139.1"
FT                   /translation="MTTGITGLPPEVDQQTWRAALEDLRRREKAATRELDAIAAQRRCL
FT                   PMVRMPDYTLIGAEGPVRLADVFKGRSQLITYNHMWTDGQEWQCGGCTGFTSQFTRLEF
FT                   LDNYDARFVIVTNGPIEEALAYKDKVGNKMEWYSSSESSFGADVDAPPGGGFGVNVFLR
FT                   DGDTVFRTWHTNGRGTEQLSHTFALIDLLPWGRQEEWQDSPDGWPQRPTYSGWLDSPDI
FT                   ARMYGNH"
FT   gene            359257..360729
FT                   /locus_tag="Mjls_0327"
FT   CDS_pept        359257..360729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0327"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: protein of unknown function DUF222; SMART: HNH
FT                   nuclease; KEGG: mmc:Mmcs_0170 protein of unknown function
FT                   DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96140"
FT                   /protein_id="ABN96140.1"
FT                   /translation="MCARKSSPRFDFLAHARELIETSFVTVVRWSLRGGVLFMLRTSVR
FT                   SMDGLSGAVDHLVASIAAMQTASIDDLSHEQIVAELDRIKAAVWAVPSVEHRLTARLMD
FT                   ADPHALGATSLKRLLADRLRISDKTAGERLADARQLGPRHTLTGERVQTELAHTADAVA
FT                   RGDIGTAHVRIIQDFVKKLPVWVSWDRREGYERDLVGHAVALRPEDFRKVADTLLGFID
FT                   QDGTEPDHHTHQRRREFTVGRQQADGMSRVQGWLTPEARAYWDVIAAKYAAPGASVPHD
FT                   DAVTGCDDRTTGQRHHDALTRALRHTVESGSLGQVAGVPAAIVATTTVNELERAAGWAH
FT                   TGGGNRLPVQDLIRMAAESRHYLAVFDDHTEEILYFGRAKRCATTAQRLALFARDKGCT
FT                   HPQCTVPFYWTEVHHTHDYSQGGRTDITDLTLACQPANLLIEKTGWTTQRPGNGRTQWI
FT                   PPTDQDTGQPRINHHFHPQRYLTDKADDDEPE"
FT   gene            complement(360766..361431)
FT                   /locus_tag="Mjls_0328"
FT   CDS_pept        complement(360766..361431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0328"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mmc:Mmcs_0339 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96141"
FT                   /protein_id="ABN96141.1"
FT                   /translation="MPLATTRRAGLVDQVIAQLRASVSAGEWPVGTRIPTEPALVAALG
FT                   VGRNTVREAVRALAHSGILEVRQGDGTYVRATSEVSGAVRRLCGSELREVLEVRRCLEV
FT                   EGARLAATVRTAEDLAEIRALLARRDALDARDEFVRADAEFHFAVVRASHNAVLTELYR
FT                   GLTEVVTASVATTVETHAFDRIPHDGLVEAIAAGDVDRAGHEAGGFLEELIEELPDRR"
FT   gene            361478..362689
FT                   /locus_tag="Mjls_0329"
FT   CDS_pept        361478..362689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0329"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmc:Mmcs_0340 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96142"
FT                   /protein_id="ABN96142.1"
FT                   /translation="MKGHPRVDATAGQASEAGVRAAGGVLLTIAVILTALNLRPAITSI
FT                   GPMLGEMRTSMGASATWAGVLTTLPGLCFAAAGLTAPWLSRRFGLSRAISAALTILSAG
FT                   LLIRVLDGPYVVLGGTLVATAGIALTNVLIPVVIKGSFPTRVGLMTGVYTAALQGGGAL
FT                   GSAVTPGLEAVFDDWRTALASWAVVAVVALVFWILASRGIAGGQPSTTRVKGRSLLRNR
FT                   LAWTVTLFFGCQSLLAYVMMGWLPEVFIDSGVSKSAAGLLVGLMSLIAVPISIFVSPLA
FT                   ARSSSQSPWIVGLGTIGVAGVIGLLIDPGAAPLLWSILVGLGLSVFSLALTVIALRART
FT                   TEDTAQLSGMAQGFGYLLAGLGPFLFGLLHDVTDGWTVPWAMVLVVYLVQMTMGALAGR
FT                   NRYV"
FT   gene            complement(362691..363086)
FT                   /locus_tag="Mjls_0330"
FT   CDS_pept        complement(362691..363086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0330"
FT                   /product="putative alanine and proline rich membrane
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0341 putative alanine and proline
FT                   rich membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96143"
FT                   /protein_id="ABN96143.1"
FT                   /translation="MWTWWQARPPSYDAAAQAGAKDTACAAYTQVRTGVATNTHLASPG
FT                   GDDDVTGVLAVAANARVALMGGGQYLLDILDPATPPELADAVRQFAMKLMQFGAAATAG
FT                   APDSDPGQQAVKRDLDALTATLDGLCG"
FT   gene            363241..363861
FT                   /locus_tag="Mjls_0331"
FT   CDS_pept        363241..363861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0331"
FT                   /product="peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysins; KEGG: mmc:Mmcs_0342 peptidase M15B and
FT                   M15C, D,D-carboxypeptidase VanY/endolysins"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96144"
FT                   /protein_id="ABN96144.1"
FT                   /translation="MGVWRTVCRVSVAVGCACGVLFGAAPSHADPAEPGGDTLVGPSAS
FT                   GTEPSSAPFDIGPAATDTFGGYLPEDGTLTAFDVENPIVGRLDPALLAAVQEATRAAAA
FT                   DGVDVEINSGWRSIGFQERLFEDGVRTYGSVEVARQFVASPQTSMHVVGRAVDVGGPGA
FT                   AAWMSRNGPRFGLCQVYANELWHYELTADANGACPPMKPNATG"
FT   sig_peptide     363241..363330
FT                   /locus_tag="Mjls_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            363921..364571
FT                   /locus_tag="Mjls_0332"
FT   CDS_pept        363921..364571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0332"
FT                   /product="FadD16"
FT                   /note="KEGG: mmc:Mmcs_0343 FadD16"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96145"
FT                   /protein_id="ABN96145.1"
FT                   /translation="MTTGVAGSLILTSDYRVADPSRVWPLLERRRAELAAIGAHHVFVH
FT                   TSIGEPDRVLVTMALHTVEPVADLLRSHVFFDWFDAVGVEDLPAVFAGELVDRFHIEPG
FT                   HHWTAKAPAVVIAGVTVVRDVDTLLGQVHRTRDLFRRNGIENVWIFRALDDPHEVMFLQ
FT                   DVADEESARRWLERPETAEKWLAEAGVGAYPPVFVGALRHVMRIDVAEHVNGP"
FT   gene            complement(364568..365848)
FT                   /locus_tag="Mjls_0333"
FT   CDS_pept        complement(364568..365848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96146"
FT                   /protein_id="ABN96146.1"
FT                   /translation="MSGDWVVGDHLGLPIPATAAALRDGGETFLTNAFRAFGALTEDNR
FT                   VVRIGRCEELTGGSTGRKMLLDVEYARPEPGLRTDLFVKFSRDFDDPVRDRGRTQMASE
FT                   VVFAALSRTPGFPIAIPHPRFGDFHAGTGTGILITDRITFGRNGVERQYEKCLDEDMPH
FT                   PDEHYRALVTALARLAGTQRSGRLPEHFSAAFPVDLRAATVGEPVTLSPDRLQRRLSRL
FT                   GEFTEAHPGLLPPHVRTPGFLARLGEEAREVLRREQAIWRSLREADDHIALSHWNANVD
FT                   NAWFWRDGGGVLQCGLMDWGCVSRLNLAMALWGALCAAETDLWDNHFDELLVLFCTELE
FT                   SAGGPRPDQVLMRQHLMLYMALMGITWLLDVPARIGNRLPDAGAHTTRHDPRIRGDESL
FT                   RAPLQMFTNMLNLWQTRGLSGHLEGLD"
FT   gene            complement(365848..366834)
FT                   /locus_tag="Mjls_0334"
FT   CDS_pept        complement(365848..366834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0334"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mmc:Mmcs_3763 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96147"
FT                   /protein_id="ABN96147.1"
FT                   /translation="MPEHDMRAYDYEKMKKDAEPFIKFEKDVENRIAYITFDRPEAQNS
FT                   TTMGMRQNYADLIHKCNVDDDVKVVVIRGEGEDFGSGGDLPEQRDMLENPGMPLLHELA
FT                   INDESVKYPPGDSYRYLSTVTDFYAKARAGNRPLQELRKISIIEAKGYCYGWHFYQAGD
FT                   ADLVISSEDALFGHPAFRYVGWGPRLWWWAETMGLRKFSEMLFTGRPFSAKEMYECGFI
FT                   NSVVPREKLEAETLKYAMACSRSRPTDTVAVQKTFLELYKQHKGEYFGSLLTGMVEGML
FT                   PLIANDRENDVDLTEGTFNKGLNNVVKDNDLNFPPEWRLSRSGRNKP"
FT   gene            complement(366926..369196)
FT                   /locus_tag="Mjls_0335"
FT   CDS_pept        complement(366926..369196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0335"
FT                   /product="trehalose synthase"
FT                   /note="TIGRFAM: trehalose synthase; PFAM: alpha amylase,
FT                   catalytic region; KEGG: mmc:Mmcs_0346 trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96148"
FT                   /protein_id="ABN96148.1"
FT                   /translation="MSEAPETDYDDQAGSGTDDQTNEPSEITYDEYLHPARPRALRFRP
FT                   RVKSPFTRRSVAQDGPARADNPAYVSWLLSQSMLADANEISQQFSGQGSMWQNPYATPS
FT                   PRGAVETASVWFTAYPLSLITRPNESFLKALADDEMWKAFADIGIEAIHTGPVKRAGGI
FT                   SGWQTTPSVDGHFDRISTEIDPAFGTEEEFRKMCGTANWYGGTIIDDIVPGHTGKGADF
FT                   RLAEMKYADYPGIYHMVEVDPRDWEHLPAVPPGVDSVNIDQATEEWLDKAGYIIGRLQR
FT                   VIFYAEGIKETNWSVTRPVLGVDGVERRWVYLHYFKDGQPSINWLDPSFAGMRLVIGDA
FT                   LHSLADLGTGGLRLDANGFLGAEKTAAEDSTAWSEGHPLSEAANHLIASMVRKVGGFTF
FT                   QELNLTIDDIRQIGEAGADLSYDFINRPAYQHALATADTEFLRLTLRTTLELGVDPASL
FT                   IHALQNHDELTYELVHWSNGHRDDIYTYKGEEITGEALGETIRRDLSVRLTGENAPYNL
FT                   VFTTNGIACTTATVIAATLGITDLNEIDDDPVRIDRIRRAHLLLAMFNALQPGVFALSG
FT                   WDLCGMLTLPAGQVGELLRGGDTRWIHRAAHDLMGVNPAATQSLAGMPRGRSLYGSIPD
FT                   QLDDETSFLRQLQAILRVRSHYGIATSRQVDIPEVSHRGMLVLVHQLADEGRYQLTVLN
FT                   FANEEVAGTVRSEALPPGAEVSDMFTGHAFATVDDLHSFTVEMPAHHGMSLLVEVTADD
FT                   SET"
FT   gene            complement(369376..370755)
FT                   /locus_tag="Mjls_0336"
FT   CDS_pept        complement(369376..370755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0336"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   mmc:Mmcs_0347 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96149"
FT                   /protein_id="ABN96149.1"
FT                   /translation="MTLTNETTLPNGLSIDDARAEAARAYELDRAHVFHSWSAQAEISP
FT                   MVITAAQGSYIWDGEGRRLLDFSCQLVNTNIGHQHPKVVAAIQAQAAKLCTVAPQHAND
FT                   ARSEAARLIAERTPGELNRIFFTNGGADAVEHAVRMARLHTGKYKVLSRYRSYHGGTET
FT                   AINLTGDPRRWPNDHGNAGVVHFFGPFLYRSQFHATTEAEESARALAHLEDIVRLEGPS
FT                   TIAAIVLESIPGTAGIMVPPPGYLAGVRDICDRYGIVMIADEVMAGFGRSGKWFSIDHF
FT                   DVTPDLLTFAKGVNSGYVPLGGVAIGPAIAETFAHRPYPGGLTYSGHPLATAAAVATIN
FT                   AMEEEDIVGNAARIGAEVLGPGLAELAARHPSVGEVRGTGVFWAIELVANPQTREPLAP
FT                   YGASSAAMNAVVAACKANGLLPFANFNRIHAVPPCTVTADEVREGLAILDQALDVADSH
FT                   L"
FT   gene            complement(370842..372335)
FT                   /locus_tag="Mjls_0337"
FT   CDS_pept        complement(370842..372335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0337"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0348
FT                   methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96150"
FT                   /protein_id="ABN96150.1"
FT                   /translation="MANTVQHWCNNDVFAGGSQATAPVTNPATGEVTGQVALAGVEDAR
FT                   TVIEAAAAAFPAWRDTSLAKRTSVLFNFRELLNARKHELAAIITAEHGKVLSDALGEVS
FT                   RGQEVVEFACGIPHLLKGGFTENASTNVDVYSIRQALGVVGIISPFNFPAMVPMWFFPV
FT                   AIATGNTVVLKPSEKDPSASLWLARLWKEAGLPDGVFNVLQGDKTAVDELLTHPKVKAV
FT                   SFVGSTPIAQYVYATGTAAGKRVQALGGAKNHAVILPDADLDLAADAMVNAGFGSAGER
FT                   CMAISACVAVGPIADDLVAKIGERARALRTGDGTKDSDMGPLVTKAHRDKVASYIDAGE
FT                   ADGAKVVVDGRQVSADGGENGFWLGPTLLDNVTPEMSVYTDEIFGPVLSVVRVETYDEA
FT                   LELINSNPYGNGTAIFTNDGGAARRFQNEVEVGMVGINVPIPVPMAYYSFGGWKNSLFG
FT                   DSHAHGTEGVHFFTRGKAITQRWLDPSHGGINLGFPQNN"
FT   gene            372416..374044
FT                   /locus_tag="Mjls_0338"
FT   CDS_pept        372416..374044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0338"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix, Fis-type; purine catabolism
FT                   PurC domain protein; KEGG: mmc:Mmcs_0349 purine catabolism
FT                   PurC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96151"
FT                   /protein_id="ABN96151.1"
FT                   /translation="MTMTVADVIGLPVVARGEPEVLSARRWEDPIRWVHVGDVADLSAL
FT                   LQGGELVLTTGAGLAADPRRYLQGLADAGAVGVVVELGTAMTAVPQWVVAHAERLDLAL
FT                   VALHRQIKFVAVTEVVHRRIVAAQYDEVAFDRRVHETFTELSMKRASPAGIVDAAARIL
FT                   GEPVVLEDLAHQALAVAPGGDAAATLLQNWERRSRASAADGDWAVTSVGPRGEEWGRLI
FT                   VPAAPPDRARATMVLERAAAALALHRMIERNRSGLHQQAQSGLIDDVVAGRITDEREAA
FT                   ARAHALGLRRSARYLPLVVRVDRGAVTMDPVVAQRRNVELLDAVAHTVNAAGHTALCSI
FT                   RRDGEIGALVALDPGRGGWDRALTALGERVHAEVRRRDGGARSEGRSVCAVGDPAAEIV
FT                   EAIHGLGEAAHVGEVAIAMHGHGQAVYRASDVRLRGLIALLRDDPRVQQFAETELRALL
FT                   LDDDERVPSNLEVLRQYLQVAGNKAALAQRLHMSRPALYKRLAAIGRTLGVDLDDAESM
FT                   TSLHVAVLILDAQRRAAPAVLTRGG"
FT   gene            374224..378396
FT                   /locus_tag="Mjls_0339"
FT   CDS_pept        374224..378396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0339"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: mmc:Mmcs_0350 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; Stage II sporulation E family protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein;
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96152"
FT                   /protein_id="ABN96152.1"
FT                   /translation="MGVEEAGAASLTSSASALFGADPEVGRHLAMVDWASTALGDPTAW
FT                   PQSLRTAVNILLSSRFPMWMAWGPELTFFCNAAYRRDTLGRKYPWALGRPASEVWAEIW
FT                   PDIGPRIESVLSNGRATWDSALLLFLERSGYSEETYHTFSYSPLRDDGGQVVGMLCVVS
FT                   EDTERVIAERRMTTLRDLGSDPSVVRTERQMLDFAAEQLGRNRHDLPFTLTYLFGDDGD
FT                   AVLAASSGITPGHAAAPETLSADGMSVWPVRQPAEGETVLLEIDGESLALPRGVWPDPP
FT                   TQALVVPLLQQGADPVGFLVAALNSHRRLDAPYRGFIELVAGHIAAGIGSARSYGAQQR
FT                   RAEELAELDLAKTTFFSNISHEFRTPLTLILGPLAEMLRTSELDVRVREELELAHRNGL
FT                   RLAKLVNTLLDFSRIQAGRMRAQFEPVDLAAVTAELASVFRSAIERAGLEFTVDCPPLA
FT                   EPVYVDRDMWEKVVLNLLSNALKFTREGAVTVRVTADDGVAVVTVADTGVGIPEAEMPR
FT                   LFERFHRVETVDARSTEGSGIGLALVKELIGLHGGTIGAQSEEGGGTTFTIQMPFGAAH
FT                   LPADEVVPHGRVSGVSANADPYLQEALRWLPASDPESDSGDPIAAPVPATGGSGTGTAV
FT                   PARILIADDNADMRAYLTGLLRGAGYEVTAVSDGRQALESIRAELPDLVVSDVMMPGLD
FT                   GLELVAALRAESRTAALPVLLLSARAGQESSIEGLHAGADDYLVKPFAAAELLARVHAN
FT                   VALARLRNHHSRWRTALIDSLQEAFFVCDEDGAVVEINAAFSQILGYGPEGLPYQPVQP
FT                   WWPDPDTDPEGYRQTSQAFGGVMGQSRGEFTFPVVHRDGHRLWVNANFNPARDPDTGRR
FT                   VAVGTFRDVTAEHYIVQREMALAALNAQLAEADTLDGALRAAVAELHRLWQARRVLAVT
FT                   FPGADGDVTPDVICAGEAVQWSDLPAGQRDTITALRTADLLTADTEEYGTAGITLQHPR
FT                   GVLVLWIELLEQRPFTPEDRTLLTVLAGRLGQGLQRVHRLDQQRETALTLQHAILGPAR
FT                   LPGGFAVRYHPATRPLQVGGDWYDVVDLDGDCIALVVGDCVGHDLEAATVMGQLRSACR
FT                   ALLLDQPSPGAALAGLDRFAARLPGARCTTVWCAVLSPETGELVYSSAGHPPPILVGPD
FT                   DGHRVLDDARGFALALRPDQERPEARVTLSARTTLLLYTDGLVERRRASLETGIGRAAD
FT                   LVADGRSDALDAVADQLMSRLAPDGGYQDDVALLLYRQPAPLDLVFPARNEYLASSRTA
FT                   LRRWLTKAGVGPDQAMNVLIAAGEAVANAIEHGHRDRPDGRVTLRATALVDRLQVSILD
FT                   TGSWKTPRTEVDTRRGRGVALMEGLMDDVTIRPGDDGTTVHLEAGIL"
FT   gene            378396..378728
FT                   /locus_tag="Mjls_0340"
FT   CDS_pept        378396..378728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0340"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: mmc:Mmcs_0351 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96153"
FT                   /protein_id="ABN96153.1"
FT                   /translation="MATPLTVNADRHTDGTPLLVAAGEIDLSNVETFTRALITVIAAAD
FT                   GAGGTVTVDLSAVEYLDSAAIGALSVHADQVPQMRLVANPYLIPVLRISGIDQLATVEP
FT                   AQPTDG"
FT   gene            378739..379902
FT                   /locus_tag="Mjls_0341"
FT   CDS_pept        378739..379902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0341"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: mmc:Mmcs_0352
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96154"
FT                   /protein_id="ABN96154.1"
FT                   /translation="MIGWFDRLQQRSRAMGYVIAVVYKYVDDQGGYLAALITYYAFVSL
FT                   FPLLLLLTTALGVVLVGRPELQRQIVESTVNQFPLIGEQLAQPEQLSGGAVAVVVGILG
FT                   ALYGGSGVGQAVQNAMNSVWAVPRNVRPDPIRSRVRSLLLLLVLGSAAIAATLLSAVGR
FT                   AVDDLGVLGTAGVVVGTIAINTGILLVAFRTTTSRELTYRQVLPGALAGALIWQFLQWF
FT                   GAGYVARTVSSASATNTVFALVLGLLAFLYLISVSLVLCAELNVVRVDHLYPRALLTPF
FT                   TDSVTLTSADRRTYTRKAKAERVKGFQHVAVTFRPSRSHSHEGLDPAAGEVEEEAGGHD
FT                   PQQRADLAGLPGAGADDHPRDEPDTDSVGDGVGERHGGDGEDDRQRH"
FT   gene            complement(379693..381108)
FT                   /locus_tag="Mjls_0342"
FT   CDS_pept        complement(379693..381108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0342"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   mmc:Mmcs_0353 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96155"
FT                   /protein_id="ABN96155.1"
FT                   /translation="MNRLDRFFEISARGSTLGAEVRGGLVTFIAMAYIIVLNPIILSSS
FT                   DDVEGNSLQFAQVSATTALAAGVMTILFGLIARLPFAFAAGLGINSFLATTVVGDVTWP
FT                   EAMGLVVINGLIIVLLAVTGLRRLVFDAVPMQLKLAITAGIGLFILFIGLVDAGFVSST
FT                   GLASPPVGLGAGGLGSINTVPTLIFVITLLVTGVLVARRVRGGILIGLVAGTVIAVVVE
FT                   AIWDLGSAQDKAGGWSLSVPQLSGSPFALPDLSLVGEFSLTGAFERIGILAAVMLVFTL
FT                   VFANFFDAMGTFTGLSREAGLSDDRGTFPRLRSALIVEGAGAAVGGASSASSNTVFIES
FT                   GAGIEEGARTGLANLITGALFLAAMFVSPLASIVPTEVAAAALVVVGAMMVSHLRHIEL
FT                   SEFSVALPVVLTVAAMPFTYSIANGIGVGFISWVVVRSGAGKAREISPLLWVVAAGFLF
FT                   YFARSWIETLMGV"
FT   gene            381183..382097
FT                   /locus_tag="Mjls_0343"
FT   CDS_pept        381183..382097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0343"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: mmc:Mmcs_0354
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96156"
FT                   /protein_id="ABN96156.1"
FT                   /translation="MATAHSRTRDEVRLGADQLAALAAVIEFGSFDAAAEHLHVTPSAV
FT                   SQRIKALEQRVGQVLVVREKPCRATASGIPLLRLAAQTALLEAEALGELGGPGAALVPR
FT                   VAVAVNADSMATWFTAVLGDVSEVLFDIRIEDQDHSARLLREGVVMGAVTTERSPVPGC
FT                   RVQSLGVMRYLSVASAGYVERYLPDGFTAVAAAHAPSLAWNRDDALQDMLIRRAFRRAI
FT                   TRPVHYVPTAEGFGAAVRAGLGWGMYPEQLAVPELVGGSFVRVADVHLDVPLYWQCWKL
FT                   DSPLVARLTGAVRSAAAGLARRR"
FT   gene            complement(382102..383313)
FT                   /locus_tag="Mjls_0344"
FT   CDS_pept        complement(382102..383313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0344"
FT                   /product="sulfide-quinone oxidoreductase"
FT                   /EC_number="1.8.5.-"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmc:Mmcs_0355 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96157"
FT                   /protein_id="ABN96157.1"
FT                   /translation="MDPTAEPADRCFDVLVVGGGNAGVSAAARLIRKGVTDVALIEPQR
FT                   VHTYRPLLSYVGGGQAAMRDAERTQRSVTPRRCTWLQDAAAMIDAPNRTVSCSSGRRYR
FT                   YRDLILGTGLVPDTDALPGIHTALDTPAVASNYVDRAEETWQLVQAMPPSGRVVFTVPR
FT                   PPVSCTATTLKPLFLAAAHWKRTGRFPGVDITLVVDRPHLLPAPRIDDRLRDHLRALGV
FT                   RVLFDTAVTALSPDQRNITVTGRDGSGETLPYDMLHLVPPFRGVRWLEGSGLTNGRPHG
FT                   LIDIDPETLRHRTHPEIWAAGDAAAVETDPSGGALRRQVSILVENLLAAREGGDLQRYD
FT                   GYTVAPVTTDAHHLIPGEYDRTGSVASSLPSFVDPLESRRTAWAFDRYVLPRTYWNLIL
FT                   RGRV"
FT   gene            383431..384516
FT                   /locus_tag="Mjls_0345"
FT   CDS_pept        383431..384516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0345"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: mmc:Mmcs_0356 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96158"
FT                   /protein_id="ABN96158.1"
FT                   /translation="MHWFRRWWRQPDHFDWITGYLAARGMLGVARWNLASSTVALALVP
FT                   AVLAMSSRGPDAGPDQVLSRIAVLGGLCAATLWVVRWPTRAQSVAYILAANLFITLACY
FT                   VQDDPMVGLMGCTVFATTGGYIALFHTPGYMLYNFGVALYVGVLQTVRLAVETSDPALA
FT                   VGLLLLVLVLNVAVPFAVQAIVHALGVDLLRAARDPLTGLLNRRAVYQQIEQLLSSHRD
FT                   RHVHLAVAVVDLDDFKQLNDSHGHAIGDEALVAVAQALRAGAGEGAVVGRLGGEEFVLA
FT                   ELLEAGQIDHWAQRMCTAVDVVPFPVTASVGVAAVCLPLPADDDAQTVIHMLIGAADHA
FT                   MYAAKRAGGNQFRHDDRSACC"
FT   gene            384530..385219
FT                   /locus_tag="Mjls_0346"
FT   CDS_pept        384530..385219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0346"
FT                   /product="4-amino-5-aminomethyl-2-methylpyrimidine
FT                   deaminase / thiaminase"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG: mmc:Mmcs_0357
FT                   transcriptional activator, TenA family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96159"
FT                   /protein_id="ABN96159.1"
FT                   /translation="METPDESTTNTWSQRLWHETEPIFSAIMAHPFISGLTDGTLDPEV
FT                   FAHYVAQDVHYLRDYARALAVVGAKAPRLADTAMFARHSAEIVEVELSLHETLLPEIGL
FT                   DPAELDRVPVAPTTRAYTSYLLATVYGGSFADGLAAILPCYWIYARVGEELIGRGSPDS
FT                   RYQRWIDSYGGDEFAATVKEVLELTDRVGPTLKPAEEAAARAHYVTTARYEWMFFDAAH
FT                   RREAWPV"
FT   gene            385222..385872
FT                   /locus_tag="Mjls_0347"
FT   CDS_pept        385222..385872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96160"
FT                   /protein_id="ABN96160.1"
FT                   /translation="MAPHSFDAPVRRWEDIPGWFGWRQAQEEAVAHFGDGDRFSAPRFV
FT                   APRFVEVGSYLGRSLCSLAEVVRQSGREIGIVGVDTCRGSGPEGAREINAHGPAVEFGG
FT                   GTFAGLLHRNVIACGFADTVALLITDSVSAARMFDDESLAWVHIDARHDYESVRADIAA
FT                   WAPKVGPGGWLSGDDYHPEWWPGVVAAVEEALPDAREWTPGQWRWRKPPASDR"
FT   gene            complement(385973..386428)
FT                   /locus_tag="Mjls_0348"
FT   CDS_pept        complement(385973..386428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0348"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: mmc:Mmcs_0359 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96161"
FT                   /protein_id="ABN96161.1"
FT                   /translation="MTLTSTSTGSHSAFHYGNPSFDCDRVRMRARCRQLATVVTVTGDI
FT                   DADNLSCVADYARRFVLAEKPFILDLSGVSTFAAEGLSLFYEIDARCAEADVEWSVIGS
FT                   QPVLQVLRASGTLDDMPVTASVPEALHHFSEGILARRRLLPLLTKTA"
FT   gene            complement(386581..387885)
FT                   /locus_tag="Mjls_0349"
FT   CDS_pept        complement(386581..387885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0349"
FT                   /product="DNA primase, small subunit"
FT                   /note="PFAM: DNA primase, small subunit; KEGG:
FT                   mmc:Mmcs_0360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96162"
FT                   /protein_id="ABN96162.1"
FT                   /translation="MADMAGSRAQGLTLDIAGRTLTVTHPDKVVFETHQGRPPISKLDL
FT                   IEYYLAVADGALRGVADRPMILKRFVKGITEEAVFQKRAPAKRPDYVDVAELKYASGTS
FT                   AKEAVIHDAAGLAWAVNIGCVDLNPHPTRSGDLAHPDELRVDLDPMPGVDWQQIVAVAM
FT                   VAREVLEDHGLTAWPKTSGSRGFHIYARIEPRWPFKFVRLAAQTIAREVERRAPDLATS
FT                   RWWKEEREGVFVDFNQNAFDRTVASAYSVRATPDARVSTPLRWDEVPGCRPEAFTVATV
FT                   PARYAEIGDPWESMDDHPGRLDALLDLADRLGPAEKAPRGAKRQGAGATGRRQSVMPLI
FT                   EIARTKTKDEALAALDTWRQRHPAAAERLQPPDVLVDGMRGPSSIWYRIRINLRHVPEE
FT                   QRPPQEPLLADYSPWGNYTGPQWASQSRHGPDTDR"
FT   gene            387943..389667
FT                   /locus_tag="Mjls_0350"
FT   CDS_pept        387943..389667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0350"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0361 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96163"
FT                   /protein_id="ABN96163.1"
FT                   /translation="MPKLTELPSQVAAKAKLYLDRGSAELHYARKMFEAGALQLEPPQN
FT                   MAAFVADMRRWGEFGMIPALNARRTPDRNAVIDDEGEMTYAELDEAAHAVAHALLAKGI
FT                   KGGDGVAVLARNHRWFLVAVYGAARTGARIILLNSEFSGPQIKEVSEREGAKLIIHDDE
FT                   YSKAVSQAKPELGYLRALGTNPDNSEPSESDAQTLADIVAGGDKTPAPKVTKHSSVIIL
FT                   TSGTTGTPKGANRKPPLSLAPIGGILSHVPFKSGEVTLLPAPMFHALGYLHATIGMMLG
FT                   STLVLRRRFKPATVLADVEKYRATAMVVVPVMLSRLLDHIEKTDTKPDLSSLRIVFVSG
FT                   SQLGAELATRAMKDIGPVIYNLYGSTEIAFATIARPEDLQKNPATVGPVVKGVRVKLFD
FT                   ENGKEVPRGEVGRIFVGTTFPFEGYTGGGHKQIIDGLMSSGDVGYFDEDGLLYVSGRDD
FT                   EMIVSGGENVFPAEVEDLISGHPDVVEATALGVEDKEWGHRLRAFVVKAEGASVDEDAI
FT                   KGYVKEHLARYKVPREVVFLDELPRNPTGKILKRELREMDVDGSDGSDGSGGDAKAE"
FT   gene            complement(389671..389979)
FT                   /locus_tag="Mjls_0351"
FT   CDS_pept        complement(389671..389979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96164"
FT                   /protein_id="ABN96164.1"
FT                   /translation="MTNDVEKRWHDPQAFHSAVTYVVAVIAVAGVCFAFYAIPDDHSLI
FT                   AAILVPVVLFAGGVGAFIQTYRVWKFRGTWPIWHGAGWFLFMLFLLCLSVPGSALTD"
FT   gene            390040..390945
FT                   /locus_tag="Mjls_0352"
FT   CDS_pept        390040..390945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0352"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   mmc:Mmcs_0363 ADP-ribosylation/crystallin J1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96165"
FT                   /protein_id="ABN96165.1"
FT                   /translation="MGGASVRSRIRAGLLAYAAGDAAGVPWEGCLAAEIDRPGIDELPR
FT                   RGDWPLGATSDDTALTLLVAEYLRDRGAVVDEADFLTRLAAAAPHIRGIGPSTRAAVDR
FT                   FRTRGALHAETGDTNGAAMRALPIGWAVADDGLRRTVTTGLSRTTHGAASAVAAACIAS
FT                   AMASAAVDGSSLLDAAAIEIDWAETQFGIELRPVRDAVDGRWRPGRNGVSLEAVGAVAA
FT                   VVDVVRHADVGHLSVADALRYAVSLGGDTDTAAAIAGGILGGRVTGTPDIPWLDRVDLP
FT                   DGATLDGLSAALAELRVSTG"
FT   gene            complement(390905..392191)
FT                   /locus_tag="Mjls_0353"
FT   CDS_pept        complement(390905..392191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0353"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmc:Mmcs_0364 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96166"
FT                   /protein_id="ABN96166.1"
FT                   /translation="MWRTVPILMALYFVNYLDRTNLGIARADISAHLQLSATMFGFASG
FT                   IFFIGYVLVEVPSNLALHRFGARRWLARIAVSWGLVVVAVGFAPNAPTLLALRFLLGVA
FT                   EAGLFPGVILYLSRWFPTAYRARVVAMFMLASPIAAAVGTPVGAWLIDVGDGLFGLAGW
FT                   QFMMICSGLPAIALGVVCWIALTDRPADANWLPDDEKRWLIGVLAAEEHAVSSRFDFPL
FT                   RRALRSPRVWALAVVYFGVAYGLYALAFFLPSIIAGFREDFGLTLSIEQVGLITAIPYA
FT                   FAAVAMYLWSRRADRTGAHTRHVAVPMLLGGLAIPVALYLDSPVLVMIPVTLAAMGVFS
FT                   AIPSFWALPSRFLTGAAAAGGIGLINSVGNLGGFAAPYVTGALDDALGSARAGMWAVGL
FT                   MMVISAGVVFTLSNDRLSPSTPATPPVRR"
FT   gene            complement(392278..392571)
FT                   /locus_tag="Mjls_0354"
FT   CDS_pept        complement(392278..392571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96167"
FT                   /protein_id="ABN96167.1"
FT                   /translation="MTVDYDAPRRKQEDLESDSLDELPVGRADARTAVLDDDAEEVDTV
FT                   DLPGADLSGEELTVRVIPKQADEFTCSSCFLVFHRSRLARDSNGTMICADCA"
FT   gene            complement(392673..394865)
FT                   /locus_tag="Mjls_0355"
FT   CDS_pept        complement(392673..394865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0355"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0366 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96168"
FT                   /protein_id="ABN96168.1"
FT                   /translation="MPIAITEEHNDLADSVRSLVARVAPSEMLHDALENPIPNPPPFWR
FT                   AAAEQGLQGVHLPESVGGQGFGILELAIVLAEFGYGAVPGPFVPSAIAGALIAAHDPDA
FT                   KVLSGLASGDVIAAYAIDSGLTATRHGDGLVIRGEVRAVPAAAQASVLVLPVAIDSSDE
FT                   WVVLDAGQLEIEPVASIDPLRPVAHVRANAVDVADDRVLSNLTPALARALIVTLLSAEA
FT                   IGVARWATDTASGYAKIREQFGRPIGQFQAIKHKCADMIAQTERATAAVWDAARALDEV
FT                   RENVTDEPHFEFAAAVAATLAPTAAQHCVQECIQVHGGIGFTWEHDTNVYYRRALVLAA
FT                   AFGRRADYPQHIVDTATTTGMRPINIDLDPDTEKLREEIRAEVAALKALPREERTVAIA
FT                   EGGWVVPHLPTPWGRGAGPVEQILIAQEFAAGRVKRPQMGIAAWLIPSIVAFGTDEQKQ
FT                   RFLPPTFRGEMIWCQLFSEPGAGSDLASLTTKATKVDGGWRVTGQKIWTTGAQYSQWGA
FT                   LLARTDPNAPKHNGITYFLLDMNSEGVEVKPLRELTGNAMFNTVFIDDVFIPDELVVGE
FT                   VNRGWEVSRNTLTNERVSIGSSEPPFLATLDGFVEFIRDGHFDQIGQNKAGQLIAEGHA
FT                   AKLLNLRSTLLTLAGGDAMPSAAISKLLSMKTGQGYAEFAVSSFGTDGVLAEPESLEFK
FT                   WVEYLLGSRATTIYGGTSEVQLNIIAERLLGLPRDP"
FT   gene            complement(394925..395542)
FT                   /locus_tag="Mjls_0356"
FT   CDS_pept        complement(394925..395542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0356"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0367
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96169"
FT                   /protein_id="ABN96169.1"
FT                   /translation="MGQVRPYRGVEAPERLAQRRQRFLEAGLDLLGSAEQDLAELTVRA
FT                   ICRRAGVTVRYFYECFTDKDDFVAAVFDWVINGIATTTQAAAAAAPPRAQSRAVMTDII
FT                   RTVSEDPRIGRLLFSSQLSNTVVVRKRAESGALFAMLSGRHASAALRQSENDRIKAAAH
FT                   FVVGGVGQTISAWLAGSFALDPDGLVDQLTAMVDQLADPRLY"
FT   gene            395617..396528
FT                   /locus_tag="Mjls_0357"
FT   CDS_pept        395617..396528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96170"
FT                   /protein_id="ABN96170.1"
FT                   /translation="MTVSEPLPHVERPVSAPAHPDKLTPPPALARRAASMEDGLMGVAL
FT                   LAGPANVIMQLARPGVGYGVLESRVESGRVDLHPVKRARTTFTYLAVATRGSDAQKAAF
FT                   RRAVNKAHAQVYSTDESPVKYHAFDKDLQLWVAACLYKGAVDVYRLFVGEMDDQAAEEH
FT                   YRDSMTMGTTLQVPPEMWPADRAAFDKYWQESLDKVHIDDTVREYLYPIAASRLRGLKL
FT                   PGPLQRRNEELALLITTGFLPQRFRDEMRLPWDADRQRRFDRLIGVLRTVNHLLPRFIR
FT                   QFPFNVLLKDLDRRIRTGRPLI"
FT   gene            396545..397447
FT                   /locus_tag="Mjls_0358"
FT   CDS_pept        396545..397447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0358"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: mmc:Mmcs_0369
FT                   protein of unknown function Mtu_121"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96171"
FT                   /db_xref="GOA:A3PTE4"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PTE4"
FT                   /protein_id="ABN96171.1"
FT                   /translation="MRHDNDSWDITTSVGSTALFVAASRALEARKPDPLAVDPYAEVFC
FT                   RAAGGDWAGLFDAGADPKPDHVLFSEFGEQFVNFQGARTRYFDAYFAAASDAGVRQVVL
FT                   LAAGLDSRAYRLPWPDGTVVYELDQPRVLEFKREVLAERGEQPVAQRREVAVDLRDDWC
FT                   AALTAAGFDPARPSAWLAEGLLMYLPATAQEALFSGIDALSAPRSWAAVEESVPMPAEV
FT                   FAYKREEERAAGEEGTFFTLVYNERHAPAERWFGERGWAAEPTSLADYLTRVGRPAPVD
FT                   DPEFGAMISAIRLVTATKG"
FT   gene            397643..399427
FT                   /locus_tag="Mjls_0359"
FT   CDS_pept        397643..399427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0359"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; KEGG: mmc:Mmcs_0370 AAA ATPase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96172"
FT                   /protein_id="ABN96172.1"
FT                   /translation="MVSRFATCCRALGLTVNDRQRPADVSAARTGFAALTHIAHDQCDA
FT                   WVGLAAAGDVSARVVEAIWSTRHSAGALQRHLEMAPGALGFHYDSGLYLQFRATDGDDF
FT                   QLAYAAALCDNGAYADADALVGELIERRPGWPQARWLRVAIHHRTQRWSDVVRLLTPVV
FT                   NDPSLDTTYAHAARVTLGLALARLGMFAPAMSYLAEPAGPIAVAAVDGGLAKGLTLRAQ
FT                   GEEEDAADALQELYAANPENAEIEAALTDPTFGLVTTTAARIEARSNPWDPETEPSESD
FT                   FVDPGAKDRKAHLLVEAEAELADFIGLEEVKYQVARLKSSVAMSIRRQERGLAVAQRTN
FT                   HLVFAGPPGTGKTTIARVVAKIYCGLGLLRKETVREVHRADLIGQHIGETEAKTNAIID
FT                   AALDGVLFLDEAYALVSTGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRKDLDMFLD
FT                   ANEGLRSRFTRSIDFPSYSPGELVEMAVRMAEKRDSVFERAAHDDMEKLFAKLAESSSP
FT                   DANGVDRRSLDIAGNGRFVRNLVERSEEEREYRLDHSGDHSAEADDFTDEELMTITVDD
FT                   VRKSAEPLLRGLGLTVSA"
FT   gene            399424..400974
FT                   /locus_tag="Mjls_0360"
FT   CDS_pept        399424..400974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0360"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690; KEGG:
FT                   mmc:Mmcs_0371 protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96173"
FT                   /protein_id="ABN96173.1"
FT                   /translation="MTTPDDRRSFSSRTPANENPERITYRRGFVTRHQVSGWRFVMRRT
FT                   ASGVALHDTRMLVDPLRTQSRAVLTGALILITGLAGCFAFSLIRPAGSAGTDTVLADRS
FT                   TAALYVRIGEQLHPVLNLTSARLIAGRADNPTTVKTSEIDQFPRGNLVGIPGAPERMVQ
FT                   NDSRDAEWTVCDASSGANAGVTVLGGPVASGGERARPLVDDQAVLVSGDAGAWLLWDGR
FT                   RSPVDLANRAVTDALGFGATPTTPRPIAAGLFNAIPEAPPLAAPPIPDAGAPPRFPLPV
FT                   AAPVGAVVAAFEADNTIRYYAVLPDGLQPVPQVLAAILRNTNSYGLNQPPRLGADEVSR
FT                   LPVSQLLDTDAYPADPVTLVDPAADPLTCAHWSKAADAEQSSLGLLSGAALPMPEGMRT
FT                   LDLVGGGNGVTANRVALTSGRGYFVQTVGQEPGSPTAGSLFWVSDTGVRYGIEPGENGQ
FT                   TIAALGLTAAPVPAPWSVLAQFAAGPTLSRDDALLAHDALTPDPNPARLENLTLQENP"
FT   gene            400971..404936
FT                   /locus_tag="Mjls_0361"
FT   CDS_pept        400971..404936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0361"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: mmc:Mmcs_0372 cell division FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96174"
FT                   /protein_id="ABN96174.1"
FT                   /translation="MSRLIFEAHRRVPPPATRKGTITIEPPPELPRLVPPSLLRRVLPY
FT                   LIVLLIVGMIVALIATGMRLISPTMLFFPFVLLLAATAMYRGTDNKMRTEEVDAERADY
FT                   LRYLSVVRDNVRAHAAEQRAALEWSHPSPDVLATIPGTRRQWERDPRDADFLVLRAGLH
FT                   DTPLDTTLRVKDTADEIDLEPVSHTTLRGLLDVQRTVRDAPKGIDVTKVSRITVFGEAD
FT                   EVRGALRAWIAQAVTWHDPSVLGVALAAPDVDGDDWSWLKWLPHTDIPGEADGVGPARY
FT                   LTTDIEALRAALAHVLADRAAFPGDPDRALRHLLVIVDDPDADVEDLIRSPGLAGVTVV
FT                   HRIATPPHREQYPNPERPILRIADGRIERWQTGGWAPYVDTADTMGAADARHIARRLSR
FT                   WDSNPSHARSTTTGGSTFTTLLGIPDASALDVASLWAPRSREEELRVPIGVTATGEPLY
FT                   FDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHSAERLNVIYADFKGEAGAD
FT                   IFRDFPQVVAVISNMAEKRSLADRFADTLRGEVARREQLLKETGRRVQGSAFNSVTEYE
FT                   NAVAAGHDLPPLPTLFVVADEFTLMLADHPEYANLFDYVARKGRSFRIHILFASQTLDV
FT                   GKIKDIDKNTSYRIGLKVASPSISRQIIGVEDAYHIESGREHKGEGFLVPAPGAVPIKF
FT                   RSTYVDGIYEPPRAERSIVVRALPQPQLFTASRVEPEPDTVIPSSAPEAEAAPPRKLIA
FT                   TIGQQLAQYGPKAPRLWLPPLDEPIRLVEVLQRSAVPTRQWRWPLGEIDKPFEMRRDPL
FT                   VFDATSSAANMVIHGGPKSGKSTALQTFMLSAAALHSPRDVTFYCLDYGGGKLAPMADL
FT                   AHVGSVATPLEPERIRRTFGELEQLLRARQALGARGEGTSGEAYPETFLVIDNLYAFSR
FT                   DNTDTFNTRNPLLARVTELVNSGLAYGIHVVITTPNWLEVPLNMRDGLGLRLELKLHDS
FT                   HDSNVRIVGGLRRPAESVPADQPGRGLTMAAEHFLFATPALDLIPAINARFPEQTAPPV
FT                   RLLPHDLAPEAIGPLYPGPERVVIGQREEDLAPVELDFAQNPLLMVFGDNRSGKTTLLR
FT                   HLIRTVREHSEPDDVAFTVIDRRLQLVDEPLFPDNEYTANIDRITPAMLGLSALIEKRR
FT                   PPAGLTPAELSRWSYQGHTHYLIIDDVDQIPDGPAVNGPYVGQRPWTPLVGLLSQAGDL
FT                   GLRVIVTARATGSAHAVMTAPLLRRLNDLQATALMLSGNPQDSGKLRGHRFSRLPAGRA
FT                   MLLGDTDTPTFLQLVNPLVAESVASAGSTHTNGKDYR"
FT   gene            404936..405244
FT                   /locus_tag="Mjls_0362"
FT   CDS_pept        404936..405244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0362"
FT                   /product="PE domain protein"
FT                   /note="PFAM: PE domain protein; KEGG: mmc:Mmcs_0373 PE-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96175"
FT                   /protein_id="ABN96175.1"
FT                   /translation="MTLRVVPEGLTAASAAVEALTARLASAHAAAAPLIGTVLPPAADA
FT                   VSLQTAAGLSANGGRHEAVAAQGVQELGRSGVGVGQSGASYAAGDAMNASAYMIARG"
FT   sig_peptide     404936..405025
FT                   /locus_tag="Mjls_0362"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.893) with cleavage site probability 0.778 at
FT                   residue 30"
FT   gene            405245..406822
FT                   /locus_tag="Mjls_0363"
FT   CDS_pept        405245..406822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0363"
FT                   /product="PPE protein"
FT                   /note="PFAM: PPE protein; KEGG: mmc:Mmcs_0374 PPE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96176"
FT                   /protein_id="ABN96176.1"
FT                   /translation="MVPPIWMALPPEVHSALLSSGPGPGSLLAAAGAWQSLSAEYASAA
FT                   AELTGILGSVQAGAWEGPSAEQYVAAHTPYLAWLAQASANSAATAAQHETAAAAYTTAL
FT                   ATMPTLGELAANHATHAVLLATNFLGINTIPIAVNEADYVRMWIQAATSMSTYQAVAGA
FT                   AVAAAPTTAPAPYLLAPGVGEAGQAMASVQQLGAQAQASESGSALNISDSINQLLEQYL
FT                   QSAPGGQEIIDFLRDPLGNLQTLINDFMTNPSAALVTWGPLLSAVAYQVFTNLVGWPTW
FT                   AMIFASPFLLAALIPLGIAGLVLIIDALKPELTQPPAEQTEPAPAPAPRPDQQVLPVAG
FT                   VPAPGAPATPGTAPAGSSAAAPAAPAPAAAAAAPLVPYAVRGGDPGEGFTPTVRDSTGA
FT                   KAPAGDIPAAAAAAAAASAAERRKRRRRKITEVKGRGYADAYMDYEDDPDEPPVVEPRV
FT                   AASSRGAGPMGFTGTAPGAADARATGLTTLSPDAFGTGPVSPMLPGTWNPDSEPDQPAE
FT                   GQEGGPRT"
FT   gene            406872..407165
FT                   /locus_tag="Mjls_0364"
FT   CDS_pept        406872..407165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96177"
FT                   /protein_id="ABN96177.1"
FT                   /translation="MSMLDAHIPQLIASEAAFGAKAALMRSTMAQAEQAAQSSQAFHMG
FT                   ESSAAFQAAHARFIEVSAKINALLDIAQVNLGDAAGTYVAEDAAAAGTYTAI"
FT   gene            407195..407482
FT                   /locus_tag="Mjls_0365"
FT   CDS_pept        407195..407482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96178"
FT                   /protein_id="ABN96178.1"
FT                   /translation="MSQIMYNYPAMLAHAGEMSSYAGAMHAVGADIASEQAALAGAWQG
FT                   DTGMTYQAWQAQWNASLEELVRAYRAMASTHEMNTMSMSARDQAEGAKWG"
FT   gene            407519..408463
FT                   /locus_tag="Mjls_0366"
FT   CDS_pept        407519..408463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0366"
FT                   /product="putative DNA-binding protein"
FT                   /note="KEGG: mmc:Mmcs_0378 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96179"
FT                   /protein_id="ABN96179.1"
FT                   /translation="MGPNAVELTAAQAWFVADAVGAGSLPWVLAVTPPYSQEADRVPFT
FT                   AETVAALETLGVLSGDGVVDARVADWVRVVCRAEQWLDLRFVSGRGALLRGVVARRADQ
FT                   TVVALRSRSLITFTRMAIDHPHALVPVLCAGLSGRAPARFAEFTLPAAVGARADEQIRQ
FT                   GTPLAEVLDFLGIPPSARPVVEAAFDTSRTYVEIVAGEHRDGHRVTTQVGVSVVDTTEG
FT                   RVLVSPVRAFDGEWVSTFAPGTPFAIAAAVERLTGSLPSGAWFPDLHLTRDFDTRPRDE
FT                   YDTREPRTRHARHHDTVRQHCDADRAGGRTRRW"
FT   gene            408486..409820
FT                   /locus_tag="Mjls_0367"
FT   CDS_pept        408486..409820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0367"
FT                   /product="protein of unknown function DUF571"
FT                   /note="PFAM: protein of unknown function DUF571; KEGG:
FT                   mmc:Mmcs_0379 protein of unknown function DUF571"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96180"
FT                   /protein_id="ABN96180.1"
FT                   /translation="MALPAGLPLREILPAVQRMARPHDDGDRDDPAPQPARLSLAPIGG
FT                   APFSLDATLDTVGVVDGDLLALQPVPAGPSAPRIVEDIADAAVIFSAAREKRWGPTHIR
FT                   RAAAAAVVGLILVATGLSVAHRLVTDDGIGLIVVCAVAVAAVLGALLSRASSPALASTL
FT                   ALSALPAVAAAFALAVPGDFGAAQILLAAAGVTAWSVISLTTGDRAVAVFTTTAATGFG
FT                   VLLTAAGASLWTLSETVLGCVLILTGLLVTVQAAQLSAMWARFPLPVIPAPGDPTPSAQ
FT                   PLRVLEDLPRRVQLSQSHQTGFLAAGVVLGVTGSLVLVGQQDVSRWAWYVVVAVAAGAV
FT                   LRARVWDSAPCKAWLLAHPLLLGVVLLVLFAATDRFDAAWWALAATAAVVVVWVIVALN
FT                   PSIASPETYSLPMRRLVGFAATAVDASLIPVMALLVGLFSWVLNR"
FT   gene            409817..411202
FT                   /locus_tag="Mjls_0368"
FT   CDS_pept        409817..411202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0368"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: mmc:Mmcs_0380 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96181"
FT                   /protein_id="ABN96181.1"
FT                   /translation="MIRSLALLAVTGAVALLAAPSAAAVTPPQVDPATPPPSGTAGPVQ
FT                   PMAQRGDCVVGGVLAGSDPGAVSPNQLALNLSGAWRHSRGEGQTVAVIDTGVKPGPRLP
FT                   NVEPGGDFLGSTDGLTDCDGHGTLVAGLIAGQPGADGFSGVAPGARIVSIRQNSPRFSP
FT                   VNPGEDPAVSRAAADVASLARAVVRAADLGARVINISVVSCLPAGRSVDQTELGAALRY
FT                   AAREKDAVIVAAAGNDRAGMNTGSACESNPPGDAARPDDPRNWAGVTSVSIPSWWQPYV
FT                   LSVGSLTSTGQPSDFTMSGPWVGIAAPGENITSVSNGPDGGLANGLPNDRDELFPVSGT
FT                   SYAAAYVSGVAALVRSRFPELTAEQVVARLTATAHGGPRSPSNVVGAGSVDPVAALTWR
FT                   VPSATAAAAVASKPIAAPPNPPVPDHTPRTVALIGTAALALTVLAALAWRSGATRPRKD
FT                   EAS"
FT   sig_peptide     409817..409891
FT                   /locus_tag="Mjls_0368"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.818 at
FT                   residue 25"
FT   gene            411199..412152
FT                   /locus_tag="Mjls_0369"
FT   CDS_pept        411199..412152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0369"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0381 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96182"
FT                   /protein_id="ABN96182.1"
FT                   /translation="MTARITLALLFALPAALAYPWQTDTDWWLLGVAIAVVVLLFAWWR
FT                   GLFVTEMVRRRFAILTRNRRGGHRQEPAEHFATVALRVDEAPTGDVPLALLAGYADRYG
FT                   VRAHKVRVVSRDLAGERTTWIALTVGAADNLAALRARSPRLPLRQTTEIAARRLTDHLR
FT                   ELGWTVTPVDETAAPVPHPVRETWRGLRSEHGHVAAYRVTVDDQVSDTLAAVAALLSAE
FT                   TWTAIDIVCGAESPEIVVGCAVRTEDRPKAKEPLPALTPQRGRHRPAAEALHPLADQRL
FT                   EGRPVPVTGDGLHRLRWPVDHPPVTELVEVGTSDPQ"
FT   gene            complement(412138..413127)
FT                   /locus_tag="Mjls_0370"
FT   CDS_pept        complement(412138..413127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0370"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="PFAM: Lactate/malate dehydrogenase; KEGG:
FT                   mmc:Mmcs_0382 lactate/malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96183"
FT                   /protein_id="ABN96183.1"
FT                   /translation="MIGAVTTPPASPEVRSARPKVSIIGAGSVGTAIAYACLIRGSAGT
FT                   LALYDTNSAKVRAEVLDLNHGSQFVPECRVGGSDDIAVTAGSAIVVVTAGAKQHPGQSR
FT                   LDLAAANVAMAQTLTPQLLEHSPDAVVIFVTNPVDVVTYAASSVVDAQPGQIFGTGTVL
FT                   DSSRFRYLVAQRAAIAVGNVHALVIGEHGDSEIPLWSTLSIGGVGADAYRVDGRLVFDE
FT                   PTRTAVATDVVNAAYEIIAGKGATNLAIGLATARVVEAVLGDQHRVLPVSTVQDGAYGI
FT                   TGVALSLPTVVSAGGARRVLEVELSPGELDGLRRSAQTLADVRRSLGI"
FT   gene            413230..415077
FT                   /locus_tag="Mjls_0371"
FT   CDS_pept        413230..415077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0371"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: pyruvate kinase; KEGG: mmc:Mmcs_0383 pyruvate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96184"
FT                   /protein_id="ABN96184.1"
FT                   /translation="MSSAQTRVVSRLETADRALEQLDELIERLEKAEDAWSDWLTAVSP
FT                   EHRASATNMVHYWSLRQSDLRDLQRRLAGLGLSSLGRSEPHVEGTLRLVHAAVAAMRHG
FT                   SWHPPGVTAVDANVGDELLREHAVDLFGPAPAERATRIMVTLPSSAATDPDLVRDLIAR
FT                   GMNVARINCAHDDAEAWTAMAGHVRRAAESTGRKCLVAMDLAGPKLRTGPIRPGPRVIK
FT                   LRPTRDALGRVVTPFRLRLTASEEPTGSSESAMAVVPVDEAWLARRRDGDVVGFHDARG
FT                   AKRQLVLSRPDEMAGAVIATGDKTSYLATGTVLHAGAHDPCEVGLLPEREQTLMVQRGD
FT                   ELTLTRDCAPVPADHGGAPRIGCTLPEVFDHARPGEKIRFDDGRIGGEIVAVERDALRV
FT                   RIDRTAPGGSKLGSAKGVNVPDTHLPIAALTDKDVEDLATVVAIADIVQISFVQRPSDI
FT                   TQLHDELHRLGGDHLGVVLKIETRRAFEHLPQLLLTAMRRPRVGVMIARGDLAVEVGYE
FT                   RLAEVQEEVLWLCEAAHLPVIWATQVLESLAKSGLPSRAEISDAAMGERAECVMLNKGP
FT                   HIVDAVVVLDDILRRMNEHHYKKNALLRQLRSWRPDATE"
FT   gene            complement(415084..415491)
FT                   /locus_tag="Mjls_0372"
FT   CDS_pept        complement(415084..415491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96185"
FT                   /protein_id="ABN96185.1"
FT                   /translation="MSAESQPVSILPESECWRLLDSVALGRLVTCAGGQPEIFPVNFAV
FT                   QDRTVLFRTAEGTKLTSAAISNQVLFEADAHTATEGWSVVVKGVARTVHGDDELEKAAG
FT                   AQLFSWTATTKQHFVRIRPDRVTGRRFGFVA"
FT   gene            complement(415547..416743)
FT                   /locus_tag="Mjls_0373"
FT   CDS_pept        complement(415547..416743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96186"
FT                   /protein_id="ABN96186.1"
FT                   /translation="MTQSADPVDPPVPVLDIPGADAGARGLPRQADLTLRQRMIVDSSA
FT                   VADIALRTGVASMVGAAMLPSVVASALRPSTTGADAEHLRFYGELAAAKDPEVSFPAPT
FT                   VPPRISSRPANPVAEWTAHGRVHNIRFRSSFEAVNPALRDRCHGYRRNNVVHAQHWRHE
FT                   DGPRPTLCVIHGFMGSAYLFNGQFLSLPWFYRSGYDVLLYTLPFHGRRAEKYSPYSGYG
FT                   YFANGFAGFAEAMAQAVHDFRSLIDHLEFTGVDRVAVTGISLGGFTSALLACVDDRIQA
FT                   VIPNVPVVTPDRTVDEWFPANKLVALNRRIAGLDPELEAAASRYPSPLNYAPLVPRDRR
FT                   LIITGLGDRLAPPQQAELLWEHWERCAFHWFPGNHLLHVSQPDYLRRMTRFLRDFMFD"
FT   gene            416870..417634
FT                   /locus_tag="Mjls_0374"
FT   CDS_pept        416870..417634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0374"
FT                   /product="Trans-aconitate 2-methyltransferase"
FT                   /EC_number="2.1.1.144"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mmc:Mmcs_0386 trans-aconitate
FT                   2-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96187"
FT                   /db_xref="GOA:A3PTG0"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR023506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PTG0"
FT                   /protein_id="ABN96187.1"
FT                   /translation="MWNPEAYLSFADHRGRPFFDLLARVGADAPRRVVDLGCGPGNLTV
FT                   VLRHRWPEAVVEAWDNSPEMVAAARERGVQANLGDVRGWSPQPDTDVVLSNATLQWVPE
FT                   HPELLTRWAGALAAGSWLAMQVPGNFDAPSHQAVRRLADREPWAPLLHDIPFRVGKVVE
FT                   TPADYAALLTDAGCSVDAWETTYIHELTDAHPVLEWITGTALRPVRSRLTDEQWDRFRA
FT                   ELIPLLDEAYPVRADGRTFFPFRRVFVVARTG"
FT   gene            complement(417631..419490)
FT                   /locus_tag="Mjls_0375"
FT   CDS_pept        complement(417631..419490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0375"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="KEGG: mmc:Mmcs_0387 sulfate adenylyltransferase,
FT                   large subunit; TIGRFAM: small GTP-binding protein; sulfate
FT                   adenylyltransferase, large subunit; PFAM: protein synthesis
FT                   factor, GTP-binding; adenylylsulfate kinase; elongation
FT                   factor Tu, domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96188"
FT                   /protein_id="ABN96188.1"
FT                   /translation="MGTRQLLRITTAGSVDDGKSTLIGRLLHDTDSLPLDHLEAVTDEE
FT                   GVADLAALSDGLRAEREQGITIDVAYRFFSTANRSYILADTPGHERYTRNMFTGASNAH
FT                   VAVLLVDARAGVLRQTNRHARIAKLLGIKHFVAAVNKIDLVDFDGNRFAEVAAELQTLS
FT                   ARLGGLDITVIPLAAKHGDNVVHRSDRTPWYDGPTLLEYLEGVELVPPQPEPNKLRLPV
FT                   QWVSRPTAEQRRRYTGRLSAGTLSVGDTVVSLPAGTRSTVTVVDTLDDDRPVAVAPLSV
FT                   AIELADDIDVGRGDVFVSGADDATLPVLARELDATVCWFADAPLRAGDRLALKQGTRTV
FT                   RATVQALHSRLDPETLDEFDNPVELVLNDIGSLTLRTSSVVVTDAYADNRDSGAFILID
FT                   ESSNDTVGAGTILEPREVTPGAQTRNDIRWHPSSLDRTHRWTSTGQRGATIWFTGLPAS
FT                   GKSTVAVAVERALVESGQVAYLLDGDNIRHGLSDDLGFAAGDRAENIRRVGHLTRLFAD
FT                   AGVVALASLVSPLKSDREIARTLSDAAKLPFLEVYVSTPVEECEKRDPKGLYARARAGE
FT                   LKGLTGVDAPYEPPDAPDLVLDTTGADIADLVKQVIDLLDSRR"
FT   gene            complement(419490..420410)
FT                   /locus_tag="Mjls_0376"
FT   CDS_pept        complement(419490..420410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0376"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: mmc:Mmcs_0388 sulfate adenylyltransferase,
FT                   small subunit; TIGRFAM: sulfate adenylyltransferase, small
FT                   subunit; PFAM: phosphoadenosine phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96189"
FT                   /protein_id="ABN96189.1"
FT                   /translation="MTTTDIDALRVDELRLLEAEAVHIIREVVAELERPVLLFSAGKDS
FT                   IVLLRLAEKAFRPSPLPFPVMHVDTGHNFDEVIEFRDRRVTGHGHKLIVASVQESIDRG
FT                   RVPDPGPGASRNRQQTRTLLDALEEGGFDAAFGGARRDEERARAKERILSFRDEFGQWD
FT                   PRAQRPEPWSLYNGRIKKGEQVRVFPLSNWTELDVWRYIQLENLELPSIYFAHRREVFA
FT                   RDGILLAVSQYAQPRDGETSAVEWVRYRTVGDLTITGAVRSEATDIERVIAEISAATVS
FT                   ERGETRADDRTSVAAMEDRKREGYF"
FT   gene            complement(420407..421210)
FT                   /locus_tag="Mjls_0377"
FT   CDS_pept        complement(420407..421210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96190"
FT                   /protein_id="ABN96190.1"
FT                   /translation="MPSRSTAYLVLASQRSGSTLLVESLRATGVAGEPQEFFQYLPETS
FT                   QAPQPREWFADIEDESILRLLDPLDEGKPDLAPATIWRDYIRTVGRTPNGVWGGKLMWN
FT                   QTPLLLDRAKDLPDRSGDGLLSAIRDVVGSDPVLVHVYRPDVISQAVSFWRAVQTRVWR
FT                   GRPDPNRDARAEYHAGAIAHVVRMLRAQEDGWRNWFAEENVEPIDVPYPVLWRNLTQVV
FT                   ADVLDRLGQDPRLAPAPVLERQADQRSDEWVDRYRADAERDGLPT"
FT   gene            complement(421277..422674)
FT                   /locus_tag="Mjls_0378"
FT   CDS_pept        complement(421277..422674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0378"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: mmc:Mmcs_0390 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96191"
FT                   /protein_id="ABN96191.1"
FT                   /translation="MTGQPRVTPQDRANVLIVHWHDLGRYLGAYGHPDVQSPRLDRFAA
FT                   ESILFTRAHATAPLCSPSRGSLFTGRYPQSNGLVGLAHHGWEYRAGVRTLPHILSENGW
FT                   HTALFGMQHETSYPPKLGFDEFDVSNSYCEYVVERATGWLLDAPQRPFLLTAGFFETHR
FT                   PYPRDRYEPADATTVALPDYLPEDREVRQDLAEFYGSITVADAAVGQLLDTLAATGLDR
FT                   STWVVFMTDHGPALPRAKSTLYDAGTGIAMIIRPPLDAGIAPGVYDDLFSGVDLLPTLL
FT                   DVLGVDIPGEVEGLSHADNLLGGAEKTREVRTAVYTTKTYHDSFDPIRAIRTKEFSYIE
FT                   NYAQRPLLDLPWDIAESAPGRIVGPRARTPRPARELYDLRTDPTEQHNLLTSENKINAE
FT                   AVATDLALLLDDWRVKTNDVIPSDFAGTRISDRYTETYLRIHRREVTSRSAIAAERGVK
FT                   GERRTAQ"
FT   gene            422764..423186
FT                   /locus_tag="Mjls_0379"
FT   CDS_pept        422764..423186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0379"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mmc:Mmcs_0391 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96192"
FT                   /protein_id="ABN96192.1"
FT                   /translation="MDEFSAEVVAFLSEGTRTGKLGYVASDGRPLVAPVWFIVEGNQLV
FT                   FNTDRDTAKGRALRRDPRVVLCVDDERPPFSFVQVQGLASTSEDPDGLLDTATRIGGRY
FT                   MGADRAEEFGRRNGVPGELVVRITPTKVVAVFDLAD"
FT   gene            complement(423211..423693)
FT                   /locus_tag="Mjls_0380"
FT   CDS_pept        complement(423211..423693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96193"
FT                   /protein_id="ABN96193.1"
FT                   /translation="MAVFLRKLLRIGRLPDEMRAQSEAEGILHLSEFVPVTRRFTGSIP
FT                   GKRASGSVSGYTGALVLTRERVLATLSTVPGLAGRTIDQRWDTPADGPVGVEIAPDGLH
FT                   FEVDVHRVDPRSHGELSMHYKSDIPDDVLAVLPTRSLQISVPPEWVFRAVGVPYRP"
FT   gene            423741..424400
FT                   /locus_tag="Mjls_0381"
FT   CDS_pept        423741..424400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0381"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   mmc:Mmcs_0393 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96194"
FT                   /protein_id="ABN96194.1"
FT                   /translation="MSNRRWLIGSAVSAAAVFVLMWIGYAHWAWLFEADLAVLEPLDRF
FT                   GAAHPGWVTGWDIYCTVLGPTVLRLAGVVVIVVSLVRRQYRTALFLVLTVELSGLLLVA
FT                   AKAIADRPRPATALVAAQSTSFPSGHALGVMVCVLAFLAVLSPTLAPAARRWAIALGVV
FT                   LIVTIGVARVVLNVHHPSDVVAGWALGYVYFVMCWLWYPPRVSPAAETPAAPGTAP"
FT   sig_peptide     423741..423821
FT                   /locus_tag="Mjls_0381"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.742) with cleavage site probability 0.740 at
FT                   residue 27"
FT   gene            complement(424354..425844)
FT                   /locus_tag="Mjls_0382"
FT   CDS_pept        complement(424354..425844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0382"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related;
FT                   diacylglycerol kinase, catalytic region; KEGG:
FT                   mmc:Mmcs_0394 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96195"
FT                   /protein_id="ABN96195.1"
FT                   /translation="MDLSIRRRGSSLRQIGKGLGSLDREVFEAVAESPSPLLDATMPRL
FT                   TRAADHSKLWFAIAAGLMASGGPRTRRGATRGVLSLAVTSLVANQGAKRIWRRARPSYL
FT                   PVPLARRGRRFPTSNSLPSGHSASAAAFAVGVGLESPPIGLGLALLAGLVGLSRVATGA
FT                   HYPGDVFAGFGLGAAVSVLGGRVVPPTTPTKLPTAEPLRVPTPPRPEGAGVVLVINPAS
FT                   GGGNGARVVDEVRDALPRAEVVELDEGDDLQQVLREAAGRAEVLAVGGGDGTVATAAGI
FT                   AKEAGLPLAVFPGGTFNHFAKDIGCDSVARTVDAIRRGSVACVDLVCLNEEHMVINTAS
FT                   IGAYPQFVQTREKLEHKVGKPVAGLYAMFHTLRRAEPVRIQYDNRTLQTSLFFLGNSTY
FT                   LPSGFAPAQRHRMDDGLLDVRILETGKRFSRVRILTALMLGRLERSPLYHEMRVPEFTF
FT                   TAIDGPTVLACDGEVGTECQTASFTAQYRVLPVFRPLD"
FT   gene            425907..426500
FT                   /locus_tag="Mjls_0383"
FT   CDS_pept        425907..426500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0383"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: mmc:Mmcs_0395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96196"
FT                   /protein_id="ABN96196.1"
FT                   /translation="MLDVDVIADPAAAVVALDPVRSRLLAELTEPASAAALATRVGITR
FT                   QKVNYHLRALEQHQLVAVAGERKWGGLKERLLVATASSYVVAPGALGAAAADPARSRDR
FT                   LSASYLIALSARAVQEVGDLWREARAKDKRLATLSLDATVRFRSAADRADFTRELSEAV
FT                   TTLVARYHDDTAPGGRAHRVVLAAYPQPRDQEDA"
FT   gene            426500..427324
FT                   /locus_tag="Mjls_0384"
FT   CDS_pept        426500..427324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0384"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: mmc:Mmcs_0396 activator of HSP90 ATPase 1-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96197"
FT                   /protein_id="ABN96197.1"
FT                   /translation="MPIRKDDGRRWVEMELLVPGTPEQVWDAMATGPGMSAWFTPTTVE
FT                   ERVGGELHFDFGGGATQRGVVTGWEPPRRLTYEEHDWSGIGSPGPLATEITVTGRRGGE
FT                   CVVRMVHSLFTDADDWDDELEGFEGGWPGFFAVLRLYLRDFAGQPAAPVRVMAEYPGEV
FT                   ADGWSRLATALALTGADVGQRVASPSGAPEFGGVVERVHQTRESRDVMVRLDHPGNGIA
FT                   VVGMYPMGDAARAMVSLYRYGDAAADTAADQRQVWAQWLDGVLGRDPIVSQR"
FT   gene            427360..428013
FT                   /locus_tag="Mjls_0385"
FT   CDS_pept        427360..428013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0385"
FT                   /product="putative conserved exported protein"
FT                   /note="KEGG: mmc:Mmcs_0397 putative conserved exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96198"
FT                   /protein_id="ABN96198.1"
FT                   /translation="MRRLLTLLCAAAVCLVAGAPVAPATAPWFASSVGPATQVISVVGV
FT                   GGSSAKMDVYQRTAVGWQPVAAGIPAFIGAKGMAPQTHDGEMKTPMGVFTLDFAFGTEP
FT                   NPGGGLPYVQVGPDHWWDGDMKSPTYNTMQVCKKEQCRFNTSLSAGTENLDIPQYRHAV
FT                   VMGVNKARVPGNGGAFFVHSTDGGPTAGCVAIDDGRLVEIMRWLRPGALIAVSK"
FT   sig_peptide     427360..427434
FT                   /locus_tag="Mjls_0385"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.408 at
FT                   residue 25"
FT   gene            complement(428017..428523)
FT                   /locus_tag="Mjls_0386"
FT   CDS_pept        complement(428017..428523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96199"
FT                   /protein_id="ABN96199.1"
FT                   /translation="MPGLYAVRTGCAAMSAMGDIDEIKNVKYRYLRALDTKDWAAFTDT
FT                   LTEDVVGEYGESLGEDHRFTDREALVSFMRASLGPEVITEHRVDHPEIVVDGDEATGTW
FT                   YLQDRVIAPDFDFMLIGAAFYRDRYRRTPDGWKICATGYDRTYDASMSLANLNFKLKRG
FT                   RALNL"
FT   gene            428582..429295
FT                   /locus_tag="Mjls_0387"
FT   CDS_pept        428582..429295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96200"
FT                   /protein_id="ABN96200.1"
FT                   /translation="MAVVAGPGRFEEAASAALGLALLTLWVGRRRGVPVHALEAFGVAF
FT                   FAVLAVLGLIAPPDTIRWLELWAGELSNVALAVFAVATLLIRRPFTLAYAKDTAPQEYW
FT                   DSPVFLRINYVISAVWAGAFLVSAAAGAYADGVLGDNDNFWFSWIVPLAAIIFAGAFTD
FT                   YYPDRATGESTDSWARVFDWLPIFVVITGIVGWVSDSTSDTVGIALIVIGSVGSAVMRK
FT                   VFPDEPAKIPGPSQS"
FT   gene            complement(429290..430813)
FT                   /locus_tag="Mjls_0388"
FT   CDS_pept        complement(429290..430813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0388"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; FAD dependent
FT                   oxidoreductase; KEGG: mmc:Mmcs_0400 FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96201"
FT                   /protein_id="ABN96201.1"
FT                   /translation="MTSLWLAGRPEQAVAPNPLDETTRSADVVVVGAGLTGLVTAVLLA
FT                   RAGRDVMVLEAFRAGAGATGNTTAKISLLQGTKLSKIVGKHGPGVAKKYVEGNLEGQEW
FT                   LIQRCENHGISVQREDAFTYAQSDTGLPAARAELEACQAAGLDTEWVDGSHGAHVPFPF
FT                   EGGVRLAGQAQFDPMPLLDSLIVELDERGGRLIQGVRVQRVSGTDGDSRGLTLHVRTSG
FT                   GDEFDVDTRQCVLATGIPILDRGGFFARLKPARSYCMAYKVPGTITRGMYLSTDSPTRS
FT                   VRYAPTQDGDRLIVGGAGHPVGREKHPSSSVQELDAWAKQHYPGAMQTNYWSAQDYSPA
FT                   DELPYVGPILPGQDKIYVATGFDKWGMTNGAAAALALSSSILGGRMDWADAFASWSPHE
FT                   LSGIPKAVQANVEVGINLAKGWITPVTRIADRTPQSGGVVSGPPWALEARSVVDGVERR
FT                   VSPVCPHLGGIVNWNDSDESWECPLHGSRFAPDGTLLEGPATRDLTRSL"
FT   gene            430896..432680
FT                   /locus_tag="Mjls_0389"
FT   CDS_pept        430896..432680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0389"
FT                   /product="conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0401 conserved hypothetical proline
FT                   and threonine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96202"
FT                   /protein_id="ABN96202.1"
FT                   /translation="MSDPLGLSIGTTNLVAARVGNPPVIRRSTLSLFSDRTPQVGLPAE
FT                   QSGGVVLDGFVERVGDPVPLVAADGTSYRAEALLVEALDAMTEAVGAAPSGDIAIAVPA
FT                   HWGTATVYALRNALRTNPVFTSNGAPARLVSDAVASLTALRANPGLPTDGVVALLDFGG
FT                   SGTSITLADAAAGFAPVDETTRFTEFSGDLIDQALLTHVLTGITDAGGVDPAGTAAVGS
FT                   LTRLRERCRDAKERLSAVTAADVAAELPGYHSTIRITRAELEEMLQRPLAGVLAALDAA
FT                   LERTRIGWAGVSAVVTIGGGASIPLITQQLSAHTRVPVITTRQPALDAAVGAALFAAYS
FT                   AAAEAPTGMAAAAPVTAMIDDAPGSATFRALAWSQDDTTSDEPVPYTGDDAYEPYNPFG
FT                   PAPTGARPEVQYLPADEPEDGRRGWHVPQLAFGAAAVVAAIAVGGVAYALTSTSADSTP
FT                   VTEFETTRLPAGAPLPEPSSAPPPPVVTVTTAPPAPAPPPEPGTPLPPPPPVTPVTTTP
FT                   TTTTTTTTTTTTTTTTTTTTTTQPTTTTTQPTTTQPTTTQPTTTQPPVTTTTQPPVTTT
FT                   YVTVPFVPIPIPIQVPNN"
FT   gene            432911..434017
FT                   /locus_tag="Mjls_0390"
FT   CDS_pept        432911..434017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0390"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: mmc:Mmcs_0402
FT                   fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96203"
FT                   /protein_id="ABN96203.1"
FT                   /translation="MAITDVAQYAHLSNTDIESLGAELDTIRRDIEESLGARDAAYIRR
FT                   TIAFQRALDVGARLLIAAGSGKTAWIAGTAGLAFAKTVENMEIGHNVGHGQWDWMNDPE
FT                   IHSNTWEWDMAGPSSQWRYSHNYLHHVFTNVIDMDEDLGFGVMRVTRDQPWEPRYLLQP
FT                   LRNIALAIGFEWGIALHDIHAAKERAQTPGGKHAQSRLIRKKIARQMVKDYLIFPALSR
FT                   SRWRRTLGANVAANIVRNLWAYVVIFCGHFPDGAEKFTAAVLEQESKPEWYLRQMLGTA
FT                   NFNAGPLMAFASGNLCYQIEHHLFPDLPSNRYAQIAVRVRAQCEKFDLPYTTGSLMRQY
FT                   WQTLRTIHRLALPDGDDGHRSVSATRKR"
FT   gene            434053..434928
FT                   /locus_tag="Mjls_0391"
FT   CDS_pept        434053..434928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0391"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0403
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96204"
FT                   /protein_id="ABN96204.1"
FT                   /translation="MNDVEYVELHGERVAYRDAGSGEVLLLIHGMAGCSDTWNAVLPRL
FT                   AENYRVIAPDLLGHGRSAKPRTDYSLGAFAAGLRDLLDELGVDRATIVGQSLGGGVAMQ
FT                   FMYQHPQYCRRLILISSGGLGPDVGWVLRLLAAPGAEVLLPVVAPKPVVALGNRLRPVL
FT                   GALGLGSPQAAQTWQSYSSLSDPPTRAAFQRTLRSVVDHRGQSVSALSRLGMHLEVPSL
FT                   VIWGDRDPIIPVAHAYSVQAARPGSALKVLPGVGHYPHVEAPDEVVDAIRQFFLDTAAD
FT                   DPHHHPGAVT"
FT   gene            435018..435875
FT                   /locus_tag="Mjls_0392"
FT   CDS_pept        435018..435875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0392"
FT                   /product="endoglucanase, family 26; S-layer domain protein"
FT                   /note="KEGG: mmc:Mmcs_0404 endoglucanase, family 26;
FT                   S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96205"
FT                   /protein_id="ABN96205.1"
FT                   /translation="MGAGLQLGLSTPAGVFGLDEVAATGAAVDRHVDLVLWYEDFAAPP
FT                   PVSGVTKVSATGAVPVITWEPWLWRTDVTVAGAETISEIAAGAHDDHLFAWAAALTITG
FT                   EPVHLRFAHEFNGDWYPWTPAHGATPDAYVAAWRHTHDLFRRAGATNVRWMWSPDAICG
FT                   GEVPLRAWFPGDDYVDVVGIDGYNWGTTRPWSRWTPPVELFEPAVTEIRALTGRPMMIA
FT                   EVGCAEDGGDKAEWISSFVEWAAAQPDVDAVIWFEHDKETDWRITSTPAATAAMAGALR
FT                   TVMQ"
FT   gene            435872..437113
FT                   /locus_tag="Mjls_0393"
FT   CDS_pept        435872..437113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0393"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; Stage II sporulation E
FT                   family protein; SMART: protein phosphatase 2C domain
FT                   protein; KEGG: mmc:Mmcs_0405 serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96206"
FT                   /protein_id="ABN96206.1"
FT                   /translation="MTAETPVSPFALPPEVEDERVRSLAQLHVLDTPPEDRFARITRMA
FT                   RAVFGIPMAAVALVDRDRQWFKQVDGLDIGTNLPRNQTICQATIARSYEQPDNPALIIE
FT                   DAAARPEFAMVPGIGEPGGIRFYAGYPLYGPGGHPVGTFCIYDTEPRSLTEAELTTFTE
FT                   LASWAQRELEHSDDLERAADVQRHLLPRPLGDLPGYSVCAMCLPAYAVGGDFYDHYRVE
FT                   GGAVFTVADVMGKGLGAAILAASVRSALRGASSAFARVERPLAPEDVVDAVALQLSEDL
FT                   SSTDTFVTLFHCQLDSATGTVRFVDAGHGIALVVRADGRVEGLDSAGLPLGVMPGDTWD
FT                   CGEVTLGEGDTLIIASDGVLDLIGDGSDARPALRFVATHPEPADLCARARALVAEKSPL
FT                   DDVTLVAVRREPTA"
FT   gene            437110..439086
FT                   /locus_tag="Mjls_0394"
FT   CDS_pept        437110..439086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0394"
FT                   /product="Cellulose synthase (UDP-forming)"
FT                   /EC_number="2.4.1.12"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   mmc:Mmcs_0406 cellulose synthase (UDP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96207"
FT                   /protein_id="ABN96207.1"
FT                   /translation="MRHQLPEISPGKYPSPWLRLLILCTALLGINYIVWRWFGSINWAA
FT                   WWIAVPLVIAETYSVIDSLLFAMTMWKMLRRNPPPPPPDDATVDVFITTYNEPIDMVLE
FT                   TAEAAQRIRFPHSTWILDDGDRHDLAEAAAERGIGYITRSSSWTPDKPRHAKAGNLNNA
FT                   LFETHGEFILVLDADQVPEPEILDRTLGYFRDPHMALVQTPQYFHNVPFSDPLGSQAPL
FT                   FYGPIQQGKDGWNAAYFCGSNAVLRREALMRLGIRGYVRAVEEGVRRTLYAARKMIRTA
FT                   RKQPGADQPEVQEALESVLQAVRDARRQLRDKRALADITFDFQQRVDAAARTVVDADIT
FT                   AMRADLEVITALSEHPEATATTVVFDDEALESLAGREWSPLGAIESIGAMIRAVDVGRD
FT                   DEAQPMLPMATISVTEDMATCMRLHALGWRSAYHHEVLARGLAPDDVRTMLTQRLRWAQ
FT                   GTIQVMLRENPFVQKGLSIGQKLMYWATMYSYLAGFAALAYIAAPAIYLIFGIMPVTAY
FT                   SWDFFGRLIPFLVLNQLMFIIISRGTPTWRGQQYSLALFPVWIRACYTAFLNVVFGRPL
FT                   GFAVTPKTRQEATAIPWHLVKWQLAAMAMLVVASIIGIVQLYFGAISVLGVGVNLFWVI
FT                   FDLLILSVVIQAVRFRGHQDEGV"
FT   gene            439086..439427
FT                   /locus_tag="Mjls_0395"
FT   CDS_pept        439086..439427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0395"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   mmc:Mmcs_0407 anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96208"
FT                   /protein_id="ABN96208.1"
FT                   /translation="MSRYPTRTTDSGVLVIRPEGRLNMVAAPALRKQIHELVDGGSTRV
FT                   VVDLSATEFIDSSGLGALISGLKVARQAGGDLRIAAPTRQVTTVLELTNLNRVLSTYDS
FT                   ADGAFDGDA"
FT   gene            439414..439827
FT                   /locus_tag="Mjls_0396"
FT   CDS_pept        439414..439827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0396"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: mmc:Mmcs_0408 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96209"
FT                   /protein_id="ABN96209.1"
FT                   /translation="MATHDPSVVLETTTGPDTLDAVQRTLDTLWAEHDVDEMVRMHVDL
FT                   AVGEIAANIIEHSGGGDPVRMRMEVSLDPDVVRTTFFDDGHPSPIDLGEVSMPEELSDR
FT                   GRGLAIAHRVLDELSYRRDSDGNHWTLVRSRTP"
FT   gene            439865..440443
FT                   /locus_tag="Mjls_0397"
FT   CDS_pept        439865..440443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0397"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0409
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96210"
FT                   /protein_id="ABN96210.1"
FT                   /translation="MSVPEKQSGLRERKKLQTRETIRREALRLIKERGYQNTTVEQISA
FT                   AADVSPRTFSRYFPTKEAVLLSDDQIAPIIEAFVDAPADLSVIEAYRHAVARTFGALSE
FT                   EQRAEAIFGQRLMYAIPEARGLIYTEYVRLIELITEALTKRPGQPADTVERRVLAGAIV
FT                   GVLIAASHDTPLPGDPIARFLQVLDDKLK"
FT   gene            complement(440495..440743)
FT                   /locus_tag="Mjls_0398"
FT   CDS_pept        complement(440495..440743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96211"
FT                   /protein_id="ABN96211.1"
FT                   /translation="MNKLGFATIVASGLTAAFLGLAAPAQAAPAGPGNAQDTINSLEDR
FT                   GYAIRVNHHGMVKPLDESKIVSVRYDNGDRLVYVDVR"
FT   sig_peptide     complement(440660..440743)
FT                   /locus_tag="Mjls_0398"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.952 at
FT                   residue 28"
FT   gene            441083..443188
FT                   /locus_tag="Mjls_0399"
FT   CDS_pept        441083..443188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96212"
FT                   /protein_id="ABN96212.1"
FT                   /translation="MDASAYIGRVGGLAVALGVGAAVMVGAPGTAFAETGEPTSQTPPD
FT                   DSPKPAAEQDDPGQEQAEERAEEQAEEPDPEALEGLPDDDGDEPVVEEPVVEEPVVEEP
FT                   VVVEDDAEKDAEGADPDVTLPIVDPTTFERESRNRPDSTLQTEKSSEPEGFETLSETAD
FT                   VASFVVDTAHEASEQPAAAARTVLVDNVEEMVQTVLSPAAAAVTAITAPTAARNSAPVI
FT                   NRLLAAFGLGSLRNLPSLPSPAWALSALLALGSRRELERSVATRSVSTSTPTVSLAAAA
FT                   TPYDPAKDYVVTPVSVSGNTVRITNVTGPGGLNNTTTRFGIGGTDLGIMWDNGIKDNPN
FT                   TAVNEHQVLIAFGDTFSNRTPVRTGVWRMNTLFRSTDTVLSNGMYVADGIPHDPGMYSG
FT                   SPMSDPNFSREIIGNYHYGIGPEVTMIPTAAISVPGAGKDGATRQYINYMAVKSWDSPG
FT                   RWTTNYSAIAYSDDNGQNWTVVPQSSVRPAAAGRTILPFVNGDQNFQQGAYVRKYTVDP
FT                   VTGKPLKNAAGQEITDGYIYSYGTPAGRTGTAYVSRVAEADILDKTKYEYWNGTSWTPG
FT                   NPAAAKPILPSTTTTSFFGLIKTTTYPTVSEMSVQYNSYEKKYIMLYGDKNNNIVMRKA
FT                   DSPEGPWSAPITLVTSSKMPGLYAPMIHPWSSTDNVSAADQQYLYWNLSTWDDYQVKLM
FT                   RTDLTKV"
FT   sig_peptide     441083..441184
FT                   /locus_tag="Mjls_0399"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 34"
FT   gene            443220..443696
FT                   /locus_tag="Mjls_0400"
FT   CDS_pept        443220..443696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96213"
FT                   /protein_id="ABN96213.1"
FT                   /translation="MKRRTLAALAVGAAVLSLPATAVAHAAPPAPQPGAGCAPAVDRAL
FT                   AHTADDTVVQCSAGRWEVYAGPYPSSDRWFSGGDGLDLHGQGMRNPEMLSGPWTGIPQD
FT                   PATRCRAEQTAVVSAGKVGEPQVAEGEPGQPLRFEVLPVMFSIQLTGDCLWQAD"
FT   sig_peptide     443220..443300
FT                   /locus_tag="Mjls_0400"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.930 at
FT                   residue 27"
FT   gene            443791..445065
FT                   /locus_tag="Mjls_0401"
FT   CDS_pept        443791..445065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96214"
FT                   /protein_id="ABN96214.1"
FT                   /translation="MDLVLGVSVTSTALRFVLVEGATGDGATVDSGTLAMPVSGDSLDA
FT                   LVGAVSGEGPYAAAPGQRPLAVGVTWTESVTEQAAGLMTALTARGVRDVVALSPAESAA
FT                   ALAAGLGDLAAQTDVAVCVAEPDVALVAVVTADTVHVDQIDRAGAGTLARQVRETADST
FT                   AVYPEAVYVLGSADDVDAVVAALAGLVTAPVLSAAEADLALARGAALASAQGSVGVDAP
FT                   LALAQVTADAPRSWLTWRIPALTSVLVAAVVTFVVSLSVALGLELTPQMRSDDAATRQV
FT                   ASASDQAKAAVDAPAPEALPKAAPKPAAPPPPPEAPPAEAVTVVDIAPAAPAPAPEVAP
FT                   VIEPVYAAPEVAPPPAPVYVPPAPPVYVPPAPAYVPPPAPVAPAYTPPQAGYVPPVAPQ
FT                   QPRLRDRIIERLPIINRFHEPQYPY"
FT   gene            445436..446035
FT                   /locus_tag="Mjls_0402"
FT   CDS_pept        445436..446035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0402"
FT                   /product="putative conserved exported protein"
FT                   /note="KEGG: mmc:Mmcs_0414 putative conserved exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96215"
FT                   /protein_id="ABN96215.1"
FT                   /translation="MLAAPAAVVLAAGADVHREAQTVAAPAPPPQLPPYDLEVVASGAV
FT                   GGPADLKVAPSETVSVANWKVANRASYRALPVGVAPERGLQVKTILAARAISAVFPEIQ
FT                   QIGGMRPDALRWHPNGLAIDVMIPNPGSAEGIALGNQIVAYVIKNAERFGMQDAIWRGV
FT                   YYTPNGPRGSGNGHFDHVHITTTGGGYPTGSETYFR"
FT   gene            446176..447030
FT                   /locus_tag="Mjls_0403"
FT   CDS_pept        446176..447030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0403"
FT                   /product="PE-PPE, C-terminal domain protein"
FT                   /note="PFAM: PE-PPE, C-terminal domain protein; KEGG:
FT                   mmc:Mmcs_0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96216"
FT                   /protein_id="ABN96216.1"
FT                   /translation="MSSTSRVGISSLFACALLFGSTAVTPDISQAQPGPGGATVLTLAP
FT                   AFNELKSNWLRGELFAAPNVKVKVPYTNIPSATNTHKGADKLNEMLHAYPGPKIVAGHS
FT                   QGAQVADDWLRRYGPTSDIDPATVQFVLTGDLESKYNGCANVPGSGCVAAYGGNNFPDD
FT                   TPYTVKVIARQYDYFADCPNDLSNETAKKNRNASQVVGGKGELNSVHTNYSNIGLNDPG
FT                   NKTFVEGNATYILGAPATYFLPVVTQKWTSNESKVVEDAELRPIVESAYNRPMGAPPAP
FT                   PAP"
FT   sig_peptide     446176..446271
FT                   /locus_tag="Mjls_0403"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            447113..447964
FT                   /locus_tag="Mjls_0404"
FT   CDS_pept        447113..447964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0404"
FT                   /product="glycoside hydrolase, family 16"
FT                   /note="PFAM: glycoside hydrolase, family 16; KEGG:
FT                   mmc:Mmcs_0416 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96217"
FT                   /protein_id="ABN96217.1"
FT                   /translation="MDRRSAMLMFGVGVAAAALPVAKAGAQPVIGDTPPGPGVPEAGVP
FT                   GLLFSDEFNGPAGAPPNPASWFIVPARETIRNPVEWDKPFNMGRYVTDQEHVFQDGAGN
FT                   LVIRATRGPGANIQEKYASGKVIGNWRGGVGTTWEARIKLNCLTDGAWPAFWLINDNPV
FT                   RGGEVDLVEWYGNRDWPSGTTVHARLDGTQFQTHKHPVDSDWHTWRMTWQPQGMYFWKD
FT                   YQPGMEPFFTVLANSLPEWPFNDPGYTMAPVFNIAVGGSGGREPAGGNYPAEMLIDWIR
FT                   VF"
FT   sig_peptide     447113..447193
FT                   /locus_tag="Mjls_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.817 at
FT                   residue 27"
FT   gene            complement(448279..448401)
FT                   /locus_tag="Mjls_0405"
FT   CDS_pept        complement(448279..448401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_0426 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96218"
FT                   /protein_id="ABN96218.1"
FT                   /translation="MLTVVLVVVLVTTLVDVLGSAVVVGGGVLVSVIVTVSVSV"
FT   gene            complement(448468..448893)
FT                   /locus_tag="Mjls_0406"
FT   CDS_pept        complement(448468..448893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96219"
FT                   /protein_id="ABN96219.1"
FT                   /translation="MRRLVVRAGAVVGAVVTSGCGLTGSPPSEPSAQAGQITLDGQTRE
FT                   TRSVECSQIEWSLMIDAGAEPGRAHAYLRLGGQEPVVETVSIDDIGPVNGVAGGDLGKA
FT                   EATLDDTIYTITGTVVGPDPANPGQSQTMPFEIKAPC"
FT   sig_peptide     complement(448789..448893)
FT                   /locus_tag="Mjls_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.850 at
FT                   residue 35"
FT   gene            complement(448972..450471)
FT                   /locus_tag="Mjls_0407"
FT   CDS_pept        complement(448972..450471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0407"
FT                   /product="PE-PPE, C-terminal domain protein"
FT                   /note="PFAM: PE-PPE, C-terminal domain protein; KEGG:
FT                   mmc:Mmcs_0419 PE-PPE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96220"
FT                   /protein_id="ABN96220.1"
FT                   /translation="MRILARSGLALLVAVGTVLLALVSTVTLVFTLAASTYVIRGTEYG
FT                   VPFCLPFCHGNPTPEELAMPYVDGTVNNPPDGIVVVDYPASFWPFSDGYFVDPTYDDAV
FT                   EQGVNALPPPGQFQDLDGSVIFGYSQGTQVATLYKREFNEYWASDPTAAPDVTFVLLGN
FT                   GSRPNGGLMSRFDGAYVPILDVSFIGPTPTTTAGATPGEITTYDIARQYDLFADFPTNP
FT                   LNILAVANAFAGQLFVHPDYGSVDMSQAVFQGTYGDTAYYLIPTYPLPLLMPLTWIPVI
FT                   GPIAVDMLDPVLRVLVEAGYDRTINPGVPTPANFLYLPDPVTLGSSLLHAIPTGLTYGT
FT                   QDILHLREPGTPPPGVAGQDAYGIGGPSVTLPNQTPPPAPAVQTVAAPSTPKVPSATPT
FT                   TAVPLSDGVNDSVIPSTSPPAPKQHIVDEPIGGSSSNGAVKRSASTADDAPADASTQSR
FT                   PKSSGTTDRPSGAGNSNGKGGSSSSSTGNSNGKGSSSSTGD"
FT   sig_peptide     complement(450370..450471)
FT                   /locus_tag="Mjls_0407"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.658 at
FT                   residue 34"
FT   gene            complement(450681..451208)
FT                   /locus_tag="Mjls_0408"
FT   CDS_pept        complement(450681..451208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96221"
FT                   /db_xref="GOA:A3PTJ4"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PTJ4"
FT                   /protein_id="ABN96221.1"
FT                   /translation="MNARSTYPGDVAVTIPEVHPDLTALAPLLGTWSGKGSGEYPTIEP
FT                   FDYTEEITFGHTGKPFLTYVQRTRAADDGRPLHAETGYLRAPTPNNVEWILAHPTGITE
FT                   IQEGPLTADGDTLRMDLISTDIGRSESAKEVMAVGRSMQISGDTLTYTLRMAAVGRPLQ
FT                   HHLSAVLHRVSS"
FT   gene            451294..452694
FT                   /locus_tag="Mjls_0409"
FT   CDS_pept        451294..452694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0409"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: mmc:Mmcs_0422 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96222"
FT                   /protein_id="ABN96222.1"
FT                   /translation="MTAEPSRIVVTGASGNVGTGVLRALASQLPDAEVVGVCRRPPTDG
FT                   EPYERVRWHTVDLSAPSAVADLEPALRGADVVIHLALAVHPVRDEHYLYRANVLGTQAL
FT                   LKAMTAAGVRQLVYASSLGIYAPGSGPPVTEDWPTTGQTTSVYSRHKVMVEQVLDEFEL
FT                   DHPEVTVSRFRPTVVVQREAAWLIKSLYLGPLVPRSVLELLRRRELPVLPVPAPLALQF
FT                   VHADDVGDAVVRMVTQQVRGSFNIAADVLDTAALADLVGARPVSVPPQAVRTLIAALSA
FT                   VRVVALTPGWYDVAFKTPLMDTSKARRTLGWEPARSSAESARELIEGLADGAVGTSAAM
FT                   GWRLRPRRDVRAAVDRAHDVTLVSWGALALLRAAGMRRARVVDAVVVASNLATGTPMAL
FT                   DRILERRADPVALLAPVAVLAALGATLRGGWPAVAVTGALQVLRMSERNQRKAKLVSNA
FT                   EVPAGSRG"
FT   gene            452704..453579
FT                   /locus_tag="Mjls_0410"
FT   CDS_pept        452704..453579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0410"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; Male
FT                   sterility C-terminal domain; KR; KEGG: mmc:Mmcs_0423
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96223"
FT                   /protein_id="ABN96223.1"
FT                   /translation="MDESAATPEVVVVTGASSGIGEETALRYAGRGARLVLAARTEDAL
FT                   QRVADACRAAGAEAVLVQATDIADAAEVEELFGVAEGHFGRIDIVVQSAAITAFGRFED
FT                   VPAGVFDSIVRTNLIGSANVARSALAHFHKRGRGHLVLIGSLLGTAAAPYQSAYVASKF
FT                   ALNGLVRTLRQENRHLSGIKIHGVYPGPVDTPVYGTASNYFGRAPRVPPTAVKPSSVVS
FT                   AIVRATDRGRSSERQVGVFNRPVIAMYRLAPPVYDVLMGVFLRTFGFTSESTEPTHGNA
FT                   FARDRHPKAD"
FT   gene            complement(453591..454934)
FT                   /locus_tag="Mjls_0411"
FT   CDS_pept        complement(453591..454934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0411"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="PFAM: secretory lipase; KEGG: mmc:Mmcs_0424
FT                   triacylglycerol lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96224"
FT                   /protein_id="ABN96224.1"
FT                   /translation="MDDYSATQVRAAHAPHDELRRGERPIPPDHDPFYRAPEGYEHAEP
FT                   GTVLRSRDVEIGFLGLVGQPVKAVQLLYRTTNLHEEPEVAVTTVLVPAQREPDVAYPML
FT                   SYQCAIDAVASRCFPSFAMRRGAGPIGAFTQAEYLLVTAALAEGWAVCVPDHEGCHGMW
FT                   GAPVEPGYRILDGLRAAQQCERLDLSPSAPVGLWGYSGGGLASAWAAELCERYAPELNI
FT                   VGAVLGSPVGDPGSVARRLNGSFFAGLAALMISALTQVFPGAQNVVDEHATDEGKALLE
FT                   KLQTMTTAQAVWQLRNVDIGSYVDMTADELWDLPEVRHIFDETKLGKSTPKPPVLVIQA
FT                   VHDGIISVDDVDALVAEYERIGAAVTYHRDRFCGHLLLHPLSAPMTLRWLRDRFTDRPV
FT                   YEHKTRTVWPTMFNPSTYLGMVKLGVITAKVVLGRSVERQPLSTTDAP"
FT   gene            complement(455051..456294)
FT                   /pseudo
FT                   /locus_tag="Mjls_0412"
FT   gene            complement(456613..457893)
FT                   /locus_tag="Mjls_0413"
FT   CDS_pept        complement(456613..457893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0413"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: HNH endonuclease; protein of unknown function
FT                   DUF222; SMART: HNH nuclease; KEGG: mmc:Mmcs_0426 protein of
FT                   unknown function DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96225"
FT                   /protein_id="ABN96225.1"
FT                   /translation="MSSNVSSGAVALLPKERLEVLFEEVAELAGQRNAIDARLVEIAAE
FT                   IEHDGLGGITGAKSVAHLMAWKTGSSSRNGKTIAAIAHRITEFPRCVQALRDGRLSLDQ
FT                   VGVIAEGAGAGSDEHYAELARSASVTQLRTAIRLEPRPEPEPDKDADGEPKPVPVAQAS
FT                   IRKTSDEQYTYWRIALPHVEAAVFDAALRSHHDALIAQWKRDHDTPTDTPAGGRPPMPA
FT                   LADAFAALVEAGWDTEVTRRPHGQRTTVVVHLDLDERIAALHLGPLLSEADRRYLGCDA
FT                   TCEVWFERHGQPLGSGRTTRMISRRLRRALEHRHRTCAVPGCGATRGLHAHHIQHWEDG
FT                   GATDLDNLVLLCPYHHRAHHRGVITITGPADQLTVTDSTGRELQSGSLARPPNQPPPTV
FT                   APYRGPSGERADWWWYTPFQPPPPTTN"
FT   gene            458038..459672
FT                   /locus_tag="Mjls_0414"
FT   CDS_pept        458038..459672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0414"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; Tetratricopeptide
FT                   TPR_4; KEGG: mmc:Mmcs_0427 transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96226"
FT                   /protein_id="ABN96226.1"
FT                   /translation="MVRDARAEASTAYERHGWEDAYNLLSSADAQDSLAAEDLNRLATA
FT                   AHLTGRFDAAGEAWERAYRAYVEHGHVAEAVRCSFWHAVTLMLRGEHARGSGWLVRAQG
FT                   LLEEAGLDSVERGYLRIPVALQALGGGDPSAAYAEFDAIAAVARRFGDPDLRALGQLGR
FT                   GQALVARGEAARGTAIFDEAMLAVTTGEVSAIAAGIVYCAVIISCQQVFDVRRAAEWTA
FT                   TMSRWCAEQQGLKAFRGQCLVHRSQIMQLQGEWSDAMEEVRRACDALSDVPGDPVLGMA
FT                   HYQQAELLRLRGELDRAELAYREASGWGHPVQPGLALLRLAQGRVDDALAAIRRAMAAA
FT                   EGPVERSRVLAAYAEIALAAGDVEAARSAAEQLETIAADFESPYLRAVGEYARGSVLLA
FT                   GGDPAAACTVLRRSWAAWQELDAPYEAARVRLRMAQACRRMNDDDTAAMELDAARRVFE
FT                   QLGAAPALAQVAEVSTNAPAGAPSGLTTRELEVLRLLATGATNREIARTLVISEKTVAR
FT                   HLGNIFNKLDVSSRTAATAYAYQHDLV"
FT   gene            459910..460746
FT                   /locus_tag="Mjls_0415"
FT   CDS_pept        459910..460746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0415"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   UbiE/COQ5 methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: mmc:Mmcs_0428
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96227"
FT                   /protein_id="ABN96227.1"
FT                   /translation="MNIHAPSQDLIRDAWDAIAPRFDEFVTPESMQYGAHALRQLHIGR
FT                   GTRFLDVACGSGALSLPAARLGADVVAVDISQAMTERVAARARAQGLSNIWCRVMNGQD
FT                   LDLADDTFDIAASQHGVSLLPDVDAGLAEMVRVTKRGGTVLVIAFGALPKAEFLAFFVA
FT                   AIKAAVPGFAVPPLDPPPLPFQLADRELFRSKLITAGLNDVTVERTAWEMPFRSGAHMC
FT                   TMVTSSNPLGAQLVAGLTAAQRADVEHVLDGILRERSGGQRGAVLYADVNVGVGTK"
FT   gene            460781..461446
FT                   /locus_tag="Mjls_0416"
FT   CDS_pept        460781..461446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96228"
FT                   /protein_id="ABN96228.1"
FT                   /translation="MPGDAGAQPSTHLVLIRPSGIVTRGSLCHLPERAAPGTAGFPPTT
FT                   NRVYPLVNATGTVLVTDVIGTGAPGDPLSTILTLCRPGEMPVVVEIPGPPVGKGLGADG
FT                   TVTYAASTASGSTFTVLRPGQPAVTISTPGLVSNGPVVGPDGTLYQVTDDRVSGRTNLT
FT                   IVTAAGEVTRLDFAGSSPSLAIDPDGGKVVLVMTTREGGIETRTGYEIAVVTGAASSV"
FT   gene            complement(461457..461530)
FT                   /locus_tag="Mjls_R0004"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(461457..461530)
FT                   /locus_tag="Mjls_R0004"
FT                   /product="tRNA-Gly"
FT   gene            461590..462162
FT                   /locus_tag="Mjls_0417"
FT   CDS_pept        461590..462162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0417"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: mmc:Mmcs_0430 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96229"
FT                   /db_xref="GOA:A3PTK2"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PTK2"
FT                   /protein_id="ABN96229.1"
FT                   /translation="MLLSDRDIRAEIDAGRLGIDPFEDSLVQPSSVDVRLDTLFRVFNN
FT                   TRYTHIDPAKQQDELTSLVEPSPGEPFVLHPGEFVLGSTLETCTLPDDLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCLLRLTSPAEHPYG
FT                   SAKVGSKYQGQRGPTPSRSYQNFIKLS"
FT   gene            462438..464243
FT                   /locus_tag="Mjls_0418"
FT   CDS_pept        462438..464243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96230"
FT                   /protein_id="ABN96230.1"
FT                   /translation="MKVLVVGSFGSGAPGRHNRHSKLLEGLVDIVLGVSMTPTTVRMVL
FT                   VEGDKADGVTVDHDVFDINAVEGSATSNAADQVVAAVLGTQESAAAGGHHLRSVGVAWS
FT                   DHASAAALRDTLTARGIEDVMLVSEGHAAASLAQAVGRAVGYTATALFFIDRDAATLSV
FT                   VQTDDGSVTKVLSRSLHSTDAMAVITEMAAAVDAQNSPPQGMFVVGSGVDVSEVKAHLG
FT                   RLLSLPINAPEEPELALARGAALASAHAPDFEASTVGLAYSQDPEEGTTAGSSYAAFGA
FT                   AATQLAPVSSAAAAPPMVFAEPEAVPTPVDDENRKPFLLVGSALSSIFVVGVVALVISL
FT                   AVNIRPTADQRPSPAEAAIVPSAQAPRPAPAPEAQPVIAPPAPPAETIKAPVPVVREAP
FT                   APAPAAPRTVYVEKAPVPVAPPAPAPLPAAPPAPVPAPIPAAPVPAPVPVLPAPAFRPP
FT                   VVLPPPVIRLPRPQLPPIFRDDDEPERPSWPNPWQPKPQTPPKQDDDYWPQRPTVPTVP
FT                   QAPKPVVPQAPQTPYVPQAPQMPYVPSVPQAPSNPYYPPSSSGGGSGPSRGDYGSGSGS
FT                   GSYDGGGSSGGEDSVWPFPSFGGGD"
FT   gene            464266..464592
FT                   /locus_tag="Mjls_0419"
FT   CDS_pept        464266..464592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96231"
FT                   /protein_id="ABN96231.1"
FT                   /translation="MSPVYALNLFDVADRDEYLAYARRSPAAVSAHGGRVVALGKFRES
FT                   VTGDIEPRQVLILVEWESKEAFDSYRNDPDLADLHPHREDGSSAYVWHLFDRLDDLRPL
FT                   LKLE"
FT   gene            464592..465935
FT                   /locus_tag="Mjls_0420"
FT   CDS_pept        464592..465935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0420"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmc:Mmcs_0433
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96232"
FT                   /protein_id="ABN96232.1"
FT                   /translation="MVHDSSGATVRQRVRWLALHGFVRGMSRLGMRRGDPQARLIADPT
FT                   VRANPAAFADEHRVKGPLIRGRVGLITFDHAVAHELLRSDDFRVSSLGGELPRPLRRVI
FT                   DRTDTGLLHPIEPPSLLSIEPPDHTRCRKLVSSVFTTRAVTALRDGVEATAVKLLDDLE
FT                   RDATGSGPVDIVARYCSLLPVSVISDVLGVPEADRAQILHYGELGAPSLDIGLSWQQYL
FT                   RVHSGIVGFNAWLVNHLENLRRNPGDDLLSQLISATEDGAGLSERELQATAGLVLAAGF
FT                   ETTVNLLGNGIKMLLDHPDQLAKLRDRPELWPTAVEEILRLDSPVQMSARVAKKDVEVA
FT                   GVPVRAGELIIIHLAGANRDPKVFDDPHRFDIERDNAGKHLSFSGGRHFCLGAALARAE
FT                   GEVGLRTFFDRFPDAKLAGTASRRDTRVLRGWSTLPITLGTARAALGS"
FT   gene            465937..466686
FT                   /locus_tag="Mjls_0421"
FT   CDS_pept        465937..466686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0421"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503; KEGG:
FT                   mmc:Mmcs_0434 protein of unknown function DUF1503"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96233"
FT                   /protein_id="ABN96233.1"
FT                   /translation="MDFRAALLEQTNSFGDLIATGDPETPVTTCGDWTLRQLFRHVGRG
FT                   NRWAAQIVAERRHEPLDPREVRDGRPPEDPDGAIQWLRDGARLLIHAVDSVGSGTKVWT
FT                   FLGPRPAGWWIRRRVHEVAVHRADAALALGQPYDLPPDLAADALSEWIELAAVQAGRRG
FT                   LPIERGHTLHLHATDESLGGVGEWMITSTEDGIDWTHEHGKGDVAVRGPVADLLLAVTR
FT                   RRTLTDSGLEAFGKTEIWDRWLEQTPF"
FT   gene            466707..467075
FT                   /locus_tag="Mjls_0422"
FT   CDS_pept        466707..467075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96234"
FT                   /protein_id="ABN96234.1"
FT                   /translation="MTTSEKATVLAWHDALNARDIDTLLELSSDDIEIGDAHGAAQGHA
FT                   ALRDWARALDVNAEPGRLYIRDGVVVVEQQITSVTGETGTAASAFRVVHDKVTSMFRHA
FT                   DLSSALAATELGEEDLTG"
FT   gene            467075..467938
FT                   /locus_tag="Mjls_0423"
FT   CDS_pept        467075..467938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0423"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: mmc:Mmcs_0436
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96235"
FT                   /protein_id="ABN96235.1"
FT                   /translation="MRGIILAGGSGTRLYPITLGASKQLLPVYDKPLIYYPLSTLIMAG
FT                   IRDIQVITTAEDAPAFRRLLGDGAHFGVNLTYAVQDEPDGLAQAFVIGAHHIGTDSVAL
FT                   VLGDNIFYGPGLGTGLRRFHDVSGGSIFAYWVANPSAYGVVEFSADGTALSLEEKPATP
FT                   KSHYAVPGLYFYDNDVIEIAKSLKKSARGEYEITEINQRYLDQGRLTVEILARGTAWLD
FT                   TGTFDSLLDASDYVRTIERRQGLKISVPEEVAWRVGFIDDEQLAARGHSLLKSGYGAYL
FT                   LELLDR"
FT   gene            complement(467939..470029)
FT                   /locus_tag="Mjls_0424"
FT   CDS_pept        complement(467939..470029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0424"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding; KEGG: mmc:Mmcs_0437
FT                   aldehyde oxidase and xanthine dehydrogenase, molybdopterin
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96236"
FT                   /protein_id="ABN96236.1"
FT                   /translation="MTLLDPQAIGAPMARLDGRAKVTGAAPYAFEQRVDDPAYLHPIQS
FT                   TIARGRVTAVDTDAARAVDGVLDVLTVFDAPELADTSDGELSILQDDRVHFRGQIIGGV
FT                   VAETAEIARHAAALVQVSYAEEPHHVELTADHPGLYTPEQVNPSYPSDTDEGDVEAALA
FT                   SAEVTVDKTYSTPIEHNNPMEPHACIAIWTADGVTMYDSTQGVHAARKALAPLFGLEPD
FT                   QMRVIAPHVGGGFGSKGAPHAHDVLALLAAQRSGGRPVKLALTRQQMFALVGYRTPTIQ
FT                   RIRLGANQDGTLTALAHEVVEQTSAVKEYAEQTAVTSRKMYAAPNRRTAHQLASLDVPV
FT                   PFWFRAPGECPGTYAAEVAMDELAVACGVDPIELRVRNDPEVDPETGNPWSGRHLVECL
FT                   RLGAERFGWSSRDPVPAQRVSGDWYVGLGVASATYPAMQMPGNSARITYADEGRYLVQI
FT                   GAADIGTGTWTTLTQIAADALGCDVAAVDLEIGDSALPEASVAGGSSGINSWGRAIVTA
FT                   ARQFRRDHGDPPAIGATTVAEAPENPESEKFTMQSFGAHFVEARVNRDTGEIRVPRMLG
FT                   VFSIGRAINARTLRSQLIGGMTMGLSMALHEESVRDPRFGHVVTQDFATYHISAHADVA
FT                   DIDAVWLDEADEHANPMGSRGAGEIGIVGSAAAVVNAVYNATGVRVRDLPVTLDKVLPG
FT                   LP"
FT   gene            complement(470026..471018)
FT                   /locus_tag="Mjls_0425"
FT   CDS_pept        complement(470026..471018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0425"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   mmc:Mmcs_0438 molybdopterin dehydrogenase, FAD-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96237"
FT                   /protein_id="ABN96237.1"
FT                   /translation="MRAFDYHLAESPADAVATLTAHPDAAYLAGGTNLVDHMKLGVATP
FT                   DLLVDVSRLPLDEVTATDDGGVRIGATVRNSDLAAHPVIRSRYPVLSRAMLSAASGQLR
FT                   NSATTAGNLLQRTRCVYFQDVTTPCNKRSPGSGCSAIGGYVRYHAILGASRHCIAVHPS
FT                   DMAVAMSALDGVVVIEGSDGERRIPIDEFYRLPGDEPHRDTVLRHGELITAVELPAPPP
FT                   GAVSEYRKVRDRASFAFALVSVAAELSLADDRIGSARIAFGGVAHKPWRAHRAEEVLTG
FT                   APPTDDTFAAAADAELSAADPQPGNEFKVALARRTLIAELRALTGRGRP"
FT   gene            complement(471015..471536)
FT                   /locus_tag="Mjls_0426"
FT   CDS_pept        complement(471015..471536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0426"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: mmc:Mmcs_0439 (2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96238"
FT                   /protein_id="ABN96238.1"
FT                   /translation="MTQPTGHREVTLEVDGRPHTLHLDNRVTLLDALREHLGVTAPKKG
FT                   CDHGQCGSCTVLRDGRRVTTCLTFAVAADGAHITTAAGLGDGDDLHPVAQAFYDEDGFQ
FT                   CGYCTPGQICSAVGMLDEVKSGAPSFVSDDLEAVPELTDDEIRERMSGNLCRCAAYPNI
FT                   VAAIERAAVQ"
FT   gene            complement(471575..472807)
FT                   /locus_tag="Mjls_0427"
FT   CDS_pept        complement(471575..472807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0427"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: mmc:Mmcs_0440
FT                   YibE/F-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96239"
FT                   /protein_id="ABN96239.1"
FT                   /translation="MSHSHPHSHSLSGPSPLGPLAARIVVGLLALIGVAVAIGAVLLWP
FT                   SQQKADIPLPFQNAEGGAVTTEAGQVRATSLAPCGSPSAGQVLTADPVPTPADGSQCVQ
FT                   VLVAIDSGPNKGANTLLEFSGGPGQPQLAAGDDIRLSRQVSPGGATSYTFYDYSRGWPL
FT                   ALLAAAFAVVVVAVARWRGLRALVGIVVAFAVLVVFLLPALRDGASAVPVALVASAVIL
FT                   YAVIYLAHGVSLRTSAALLGTLTSLLLAAVLSWGAIEIAHLTGLSEDQNNEVAAYLGNV
FT                   SITGLLLAGFIIGSLGVLNDVTVTQASTAFELAELEGSSRRAVFVGAMRVGRDHIASTV
FT                   YTLVLAYAGSALPLLLLFSVANRSLVDVLTSESVAIEIARSAVGGIALALSVPLTTGIA
FT                   AVLATPRADRH"
FT   sig_peptide     complement(472694..472807)
FT                   /locus_tag="Mjls_0427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.666) with cleavage site probability 0.265 at
FT                   residue 38"
FT   gene            complement(472921..474207)
FT                   /locus_tag="Mjls_0428"
FT   CDS_pept        complement(472921..474207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0428"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mmc:Mmcs_0441 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96240"
FT                   /protein_id="ABN96240.1"
FT                   /translation="MDDVTMPQTPAERTWHAQGHQPRPRTFTQSSKLQDVLYEIRGPVH
FT                   EHASRLEAEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSKGIMPARRAV
FT                   FTRYELVDGFPRFDVDDVFLGNGASELIQMVLQALLDNGDQVLIPAPDYPLWTACTSLA
FT                   GGTPVHYLCDETQGWNPDVADIESKITDRTKAIVVINPNNPTGAVYSRETLERIADLAR
FT                   KHQLLLLADEIYDKILYDDAKHISLASVAPDVLTLTFNGLSKAYRVAGYRSGWLVITGP
FT                   KEHASSFIEGISLLANMRLCPNVPAQHAIQVALGGHQSIDDLVLPGGRLLEQRDVAWEK
FT                   LNEIPGVSCVKPAGALYAFPRLDPEVYEIHDDELLVLDLLLQEKILVVQGTGFNWPTPD
FT                   HLRIVTLPWARDLANAIERLGNFLVSYRQ"
FT   gene            complement(474289..477417)
FT                   /locus_tag="Mjls_0429"
FT   CDS_pept        complement(474289..477417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0429"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: mmc:Mmcs_0442 protein of
FT                   unknown function DUF224, cysteine-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96241"
FT                   /protein_id="ABN96241.1"
FT                   /translation="MDTQILIRLIVGLLMTGIVIALAAKRVLWLTKLIRSGAPTSEANN
FT                   RKDNLGKRITTQFEEVFGQTRLLRWSIPGIAHFFTMWGFFILASVYLEAYGLLFDHDFH
FT                   IPIIGTWDALGFLQDFFAVAVLLGIITFAIIRIVREPKKHGRDSRFYGSHTGGAWLILF
FT                   MIFNVIWTYALVRGAAADVGNLPYGNGAFFSQFMGWVLSPLGHDVNEWVETIALLLHIA
FT                   VMLVFLLIVLHSKHLHIGLAPINVTFKRLPNGLGPLLPMEYNGEPIDFEDPAEDAVLGR
FT                   GKIEDFTWKGYLDFTTCTECGRCQSQCPAWNTGKPLSPKLVIMNLRDHMFAKAPYILGD
FT                   KESPLENTPEGGLGEELRGEKESEKHSHDHVPESGFERIMGSGPEQATRPLVGTLEQGG
FT                   VIDPDVLWSCTTCGACVEQCPVDIEHIDHIVDMRRYQVMMESEFPGELGVLFKNLETKG
FT                   NPWGQNAKDRTNWIDEVDFDVPVFGKDVESFEGYEYLFWVGCAGAYEDRAKKTTKAVAE
FT                   LLAIAGVKYLVLGEGETCNGDSARRSGNEFLFQQLAAQNVETLNDLFEGVERVDRKVVV
FT                   TCPHCFNTLGREYPQVGGNYTVLHHTQLLNRLVRDKKLVPVTPADGGADITYHDPCYLG
FT                   RHNKVYEAPRELIGASGAKLTEMPRHADRGLCCGAGGARMWMEEHIGKRVNVERTEEAM
FT                   DTASTIATGCPFCRVMITDGVDDVAATRNVEKAEVLDVAQLLLGSLDKSGVTLPEKGTA
FT                   AKESEERAAVRAEEAAAAAPAPEKAPEKEPEAPAEAPAAKASTTTESKPAGATPAAAPA
FT                   KGLGIAGGAKRPGAKKTATEKTAAAPAEAKGLGLAAGAKRPGAKKTATEKTTAAPEAKA
FT                   ETAGTTEAPAEAKPEPEVKGLGLAAGAKRPGAKKTPAKASPNEGAATVVQPPNADPDKA
FT                   EAGTEAPDTADSDRGLETKPEPEVKGLGIAAGARRPGAKKKTAAPAAAPAKPAEPEAEP
FT                   QAQPEAQAEPEPEPEPEAPSQPASGNGDARVVGDEPPVKGLGIAKGARRPGKR"
FT   gene            complement(477554..480091)
FT                   /locus_tag="Mjls_0430"
FT   CDS_pept        complement(477554..480091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0430"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; Sigma-70, region 4
FT                   type 2; KEGG: mmc:Mmcs_0443 transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96242"
FT                   /protein_id="ABN96242.1"
FT                   /translation="MASPAPHRPAELPAAAREAVTAIEADPAAPAKVLVTGGIGTGKST
FT                   VLAAVRAALRSAGRPVLSRPRRPDDPAEAAVVVDDAHLLDPGDLDRLTDLVADSGSTVV
FT                   IATQPLAHNAPLRALVTALERENPAVALGSVTAVEVGRAAAATLGAAPAPEVVRLLTAV
FT                   TAGLPFLLRPALTAVGDGAAAVRQAARIALIERLRRLDEPLLDTLLVASLSPELGPDDV
FT                   AAALHIPSDAALAVVDRARASGLLEPAYHHSFLRTVHEGIAQLVGAARHHDIEVSLLRS
FT                   QLELSTLTADLALRMAEHGLRDERLGTALADLAAQTANDPARSARLYRAAADAGATALS
FT                   AQLADALALTGDCATAGRIADELLTSQDPDERAAAVRISASIAMHDGSAAHAFDLFRWL
FT                   GPSPDALLSAAGTVAALAAADGDTARELARTQAAGPPTSIARAARSLADGLMLSLDQPY
FT                   PVAAARLGQSLNADAGVVTPDTPAALVTLAALHGGDPVRARSVMSRAVRSGRDDGSGDA
FT                   IFVTYRHRLLLGWTHMQDGQLQAAATALPRPTADLHRRDALWAAALQTAIARRSGDSGA
FT                   MQMHWYSAMEVLAEYSVDLFALLPLGELWVAAARLRQVERLQHTLDEAFALLTALGDPL
FT                   LWSVPLHWAGVHAGILANSPEAVAPHGQALTAASRDGRAQSAFAKALASAGRTWLRVLA
FT                   NHVDVDEVSAAARGLAQFGHTWDATRLAGQAALQTPDGRVSQAMLQLARDLKQSVAGAE
FT                   VPTETTGMGALTPAAATAAATPARAASAQLSEREREVAELLLLGMPYRDIGAQLFISAK
FT                   TVEHHVARIRRRLGAESRSEMLSMLRALLAPSG"
FT   gene            complement(480101..481906)
FT                   /locus_tag="Mjls_0431"
FT   CDS_pept        complement(480101..481906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0431"
FT                   /product="conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0444 conserved hypothetical proline
FT                   and threonine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96243"
FT                   /protein_id="ABN96243.1"
FT                   /translation="MTEPLGLSIGMTNLVAARVGRPPVIRRAILTLFADRAPEVGVPGE
FT                   WSANPTEPGLVLSGFVDRVGDPVPLVASDGSAHRGELVLAEALDAMARTVDGGSPIAIA
FT                   VPAHWGPGTVGALRGALRNRPNLAPHGVPAALIPDSTAALAALQAAPGLPDQGVVVLVD
FT                   LGGSGSSISLADAGANLDAVGQTVRYPEFSGDAIDQALLNHVLVGIADAGSADPASTAA
FT                   VGSLARLRDECRQAKERLSADTATAVPVDLPGVQSDIRVTRPELEQLISEPLGGLLNAI
FT                   EDTLQRNQIPVANVTAVATVGGGAAIPLVTQRLSEHLRAPVVTTPESQLNVAAGAALVA
FT                   NQSADADAPTGMAPAADAPTSMGAAAWAAGAAGLAAGAAAADGASSATFRALAWSQDDE
FT                   PAGEPVPYAGADYDPSATGARPPVAFAPDDTGYGAGHGEEPGPLPWYKRPPVLFGAAAA
FT                   AALAALSGLAITLTGTEGDSTPVTETATTFSMEPSPQAPPPPVTTVTIGPDGVATTTVS
FT                   QPPPPPPTTTQQTTTTTQPTTTTTTTTQQTTTTTQPTTTTTRPTTTQPPTTTQPPPTTT
FT                   AAPPPTTVDPPDPPVTTVPVPDDGA"
FT   gene            482154..482678
FT                   /locus_tag="Mjls_0432"
FT   CDS_pept        482154..482678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96244"
FT                   /protein_id="ABN96244.1"
FT                   /translation="MANSLLDFVMSLVRDPDAAARYAADPAAAIADAQLTDVTSVDVDN
FT                   LIPVVTESMPMAAASTGLDPFGAEAAGNVWSSGAATAAFDAFADPAPASAVIDTTSAVI
FT                   DTTDHFDQAADPLTGSDTLVDSLSTQLTDPVLDEATPAGTGLDDVWGAALDDVQPADHD
FT                   PGQNPGFDLFD"
FT   gene            482795..484015
FT                   /locus_tag="Mjls_0433"
FT   CDS_pept        482795..484015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96245"
FT                   /protein_id="ABN96245.1"
FT                   /translation="MGMSSHPLRGSLSEGWQPRWPGVSNSITWCPDRRRAGETTSPGNR
FT                   EDTKGSHMNIIDFILDLFRSPASAASFVVDPDGALRDAGLPNVTAAQLASVAATAAPAG
FT                   YALGGGDPIVGLQRAVADHHQLASNFASPFSPQTSFAPTTEFASRNDTDLLSGNNVPIA
FT                   SPDQAAGANAQNGAFNLGFGDITLGDKTTQTATNGGVVVGGDNDGDIVSGDGAVLGDGN
FT                   TMNNGDILAGSGSNVVVGKDNEVEDNSQTAGGDLIADNDAPVLNDVDTSGGNGGGADGG
FT                   GSLIGIGGGNAVGGDGGNGGGIIITDNDVNAGTQIDGDYGSDNVEDNSVNTSVETNTST
FT                   STESKIEDNSSSYESNIGSGNDTAIGSGNETNTSLFSGNDTGFETNTGIDTDVASNNDT
FT                   NTGLDVF"
FT   gene            484111..485970
FT                   /locus_tag="Mjls_0434"
FT   CDS_pept        484111..485970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96246"
FT                   /protein_id="ABN96246.1"
FT                   /translation="MTRPNGPRNVADTRKVVTELIEHTTKIAEAQDRGDLVARLARART
FT                   RIGDPQIRVVIAGQLKQGKSLLLNSLLNMPVARVGDDESTVLATVVSYAEQPSARLVVA
FT                   RPDGEEPELVEIPTTDLGKDLRRAPQADGREVLRVEVTVPSPLLKGGLAFVDTPGVGGH
FT                   GQPHLSATLGLLPDADAMLMISDTSQEFTEPEMTFIRQALEICPVAAIVATKTDLYPHW
FT                   RQVVDANAGHLHRAGITTPLIPASSTLRSHAVQLNDKELNEESNFPAIVKFLSEQVLAR
FT                   NTDRVRDQVVNEIRAAAEHLSMAVQSELSALDDPAAGGTLTADLERRKKEAEEALQQTA
FT                   LWQQVLNDGIADLTADVDHDLRQRFRNITFHTERVIDAGDPTLHWAEIGAELEESVATA
FT                   VGDNFVWAYQRAEALAAEVARTFMEAGLDAVRMPAIDAREMGAEFGEFRSLAHLEAKPL
FT                   KIGHKIVTGMRGSYGGVLMFGMLTSFAGLGMFNPLSLGAGFVLGRKAYKEDMENRMLRV
FT                   RSEAKTNVRRFVDDVAFVVGKESRDRLKGIQRQLRDHYREIANQTTRSLNESLQATIAA
FT                   ARLAESERNARTKELQRQLNILRQVIEHAEKLGTPAAAPVAAP"
FT   gene            486057..487565
FT                   /locus_tag="Mjls_0435"
FT   CDS_pept        486057..487565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0435"
FT                   /product="isoniazid inducible protein IniC"
FT                   /note="KEGG: mmc:Mmcs_0448 isoniazid inductible gene
FT                   protein IniC"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96247"
FT                   /protein_id="ABN96247.1"
FT                   /translation="MRAILGGTIAAYRDDPAYRQRPEVHNELERIGARLNQPIRIALAG
FT                   TLKAGKSTLVNALVGEEIAPTDATEATRIVTWFRHGPTPKVTANHRGGRRSNVPIARRS
FT                   SGPADERGLTFDLARLDPDDVLDLDVEWPAAELIDSTIIDTPGTSSLSRDVSERTLRLL
FT                   VPGDGVPRVDAVVFLLRTLNAADIALLKQIGELVGGSSGALGVIGVASRADEIGAGRID
FT                   AMLSAKDVATRFTEEMDRTGICQAVVPVSGLLALTARTLRQSEFVALEKLAGVDPAELA
FT                   KAMLSVDRFVREDSPLPVDASTRAALLDRFGMFGVRISIAVLRAGVKDSVALADELLER
FT                   SGLVALRDVIDQQFAQRSDLLKAHTALLSLRQFVQLNPIYATPYIIADIDPLLADTHAF
FT                   EELRLLSQLRSRTTTLTDDEMASLRRLIGGSGTDAASRLGLQPEDPYDGPRAAFAAAQR
FT                   WRRRAEHPLNDPFTARACRAAVRSAEALVAAYAAKGRSYRDGPA"
FT   gene            487596..489437
FT                   /locus_tag="Mjls_0436"
FT   CDS_pept        487596..489437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0436"
FT                   /product="conserved hypothetical proline rich protein"
FT                   /note="KEGG: mmc:Mmcs_0449 conserved hypothetical proline
FT                   rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96248"
FT                   /protein_id="ABN96248.1"
FT                   /translation="MRTSLGVSLGAANLVAVADGRPTIQPAVLTVGGSTITGFVDRVGD
FT                   PVPLVAADGSAHYGGQLAAAAIEALTRAAHPLRRPDVVAVAVPAHWSTAAVAALRAVVP
FT                   HVTVVSDAVAALTALQANPGLPARGVVALCDFGATGTSITLADAGDGFRVIGETVRYDD
FT                   FSGDLIDQAVLQHVLADLAAGIPADPSGTSAVASLSALREQSRAAKERLSVHTATALAG
FT                   PHGDIRLTRPELESLLAGPLAGFVDTVLDVLHRNGVVPAQLAAVATVGGGARIPIVTQR
FT                   LSEALRLPVITGPYAQVVAAAGAELIATRGSEQDAVTALAPVFDAAPATEAAIPLAWSA
FT                   ETEDFEAATQYAQPVYDPALARPGIHFDPEPIEDSPDGSAWYRRPGALFAGAACLAALA
FT                   ATGLILTSQTGEADAVQAGSSQITAPVATQPIEQPAPQQAAAPQGGAPAPVVTERVAAA
FT                   APAPAPRAVQPPSRPNPNAPAERRVASKQVAPAPRAPAPARVPAPAPAPAPAPAPAPSM
FT                   GLPRIPLPEFTLPRPAPPSSTPAPAPAPEPEPQPTQEPQPTQEPEPEPTVAPEPEPTVV
FT                   PEPTVAPQPEPTAAPEPSAEAPAEPQPECVPDAETVC"
FT   sig_peptide     487596..487697
FT                   /locus_tag="Mjls_0436"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.857) with cleavage site probability 0.568 at
FT                   residue 34"
FT   gene            complement(489546..490064)
FT                   /locus_tag="Mjls_0437"
FT   CDS_pept        complement(489546..490064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96249"
FT                   /protein_id="ABN96249.1"
FT                   /translation="MARPPEDPNYSDNEPTQYSNAYSDEPTQYGDYTGAYDQPPPEEPQ
FT                   PWYRKPGALIALGAIAALLVAVIVWLVVQLVSGDDSGESTTTTTTTTTTSEAPSVVPPQ
FT                   TVTESPTETTAPTETTAPPETTTTTPSETTTTTTAPTTTTTSPAATTTVETSTSTVTIT
FT                   VPTLVPPGG"
FT   gene            complement(490596..491525)
FT                   /locus_tag="Mjls_0438"
FT   CDS_pept        complement(490596..491525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0438"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mmc:Mmcs_0451
FT                   luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96250"
FT                   /protein_id="ABN96250.1"
FT                   /translation="MDFRVFVEPQQGARYADQLAVARAAEQLGYSAFFRSDHYLAMSGD
FT                   GLPGPTDSWVTLAGIARETSSIRLGTMVTSATFRHPGPLAVSVAQVDEMSGGRVELGLG
FT                   AGWFEAEHKAYAIPFPPLGERFDRLTEQLDILTGMWATPVGEMFDYSGTHYTVVDSPAL
FT                   PKPVQAVPPVIIGGQGAKRTPALAAKYAGEFNVPFVPLDTLSTQFDRVRAAVAEAGREP
FT                   DSMVYSAAFVLCAGADDAEIARRADAIGREVDELRSNSPMVGTPAEIVDKLGPFAEAGV
FT                   ERVYLQMLDMADLDHLALVAGQVLPQLR"
FT   gene            complement(491536..492153)
FT                   /locus_tag="Mjls_0439"
FT   CDS_pept        complement(491536..492153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0452 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96251"
FT                   /protein_id="ABN96251.1"
FT                   /translation="MTAAQRERAALVDAMRAKGPDAPTLCAGWKTRDLAAHLYVREHRP
FT                   DATAGIAVPALAKYTEKVQNRAAEGDWDDLLDKIAAGPPLYSPFKLLDPVANLAEMFIH
FT                   CEDVRRAQPGWEPRTLDDATVNGLTRTLSLMARLTLAKAPARAALRTPEGKTLVTAGKG
FT                   DPVTVTGRPEESLLFAVGREARVDFEGDPAAVQALRDAPKGL"
FT   gene            492422..493330
FT                   /locus_tag="Mjls_0440"
FT   CDS_pept        492422..493330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96252"
FT                   /protein_id="ABN96252.1"
FT                   /translation="MPEVQLHHDGYPKYRRMVRFDWSETPVHWVPGDPFSTHMMNVLHL
FT                   LLPEGERHFIKAVLEASSLVDDPELEGSIKPFIQQESWHAWAHQIVLDHLAEQGIDTKP
FT                   YTERLGRSLSMTLGDPPRFLPARLHRWWLYRRLADVAALEHFTAVLGQWVLQNRALDYA
FT                   GADPVMLDLLRWHGAEEVEHRSLVFDVYQNVCGSYWIRAISMLTTAPLFIGWWIAGARY
FT                   LMKNDPTIDQTWRWRDWLRAARQYRLPGPGSLLFTIPVRYLRRGHHPDHEASTEMAVQY
FT                   LEYSPAARAARERAGLAPQTT"
FT   gene            493379..493570
FT                   /locus_tag="Mjls_0441"
FT   CDS_pept        493379..493570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0441"
FT                   /product="ferredoxin (3Fe-4S)"
FT                   /note="KEGG: mmc:Mmcs_0454 ferredoxin (3Fe-4S)"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96253"
FT                   /protein_id="ABN96253.1"
FT                   /translation="MKVSVDFDTCDGNAVCMSICHEVFELDDDGYLHLLQENPSEELRE
FT                   QVIGAERSCPTQAITVEG"
FT   gene            493574..494779
FT                   /locus_tag="Mjls_0442"
FT   CDS_pept        493574..494779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0442"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmc:Mmcs_0455 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96254"
FT                   /protein_id="ABN96254.1"
FT                   /translation="MPVDRQLANILVVGTGVAGMRAAETLRLDGYRGELTVVGAERHAP
FT                   YQRPPLSKKLLSGAVHRAGADLAPRMDLEARVLRGASVRELDMSTRTAHLRDGSDDVSV
FT                   PFDGLVVATGAAARQWPDGPVPDGVMALRTVDDCLAIRERLESRPRVVVVGGGFIGAEV
FT                   AATCRSMGLSVTLIEKSSAPMASALGEEMAACWERLHRGNGVELRSGVGVESFAGDDRV
FT                   EAVHLTDGTRLPADLVVIGLGVTPSVDWLSGSDLRIDNGGVVCDATGAVEGVTDVVAAG
FT                   DVASWWHPRYERYLRIEHWEHAERQGVAAAHTLLAGPERAQEFDALPYFWTDQYDVKMQ
FT                   MLGVPDGYDSVAVVEGSPDRWDFVAAYGRDGRVIAVLSTIPGRVHAYRDAVFGAFPPAP
FT                   PG"
FT   gene            complement(494789..495136)
FT                   /locus_tag="Mjls_0443"
FT   CDS_pept        complement(494789..495136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96255"
FT                   /protein_id="ABN96255.1"
FT                   /translation="MIVKRLALMLGLVALLVGVVGLLTPVSVSPERQVVDCGSALGPDL
FT                   SEAQALDDGNAANVPVDGGLLVDVAYTDLCRAELHDRRVWTVSLAVAGAAVVAAVGVLG
FT                   VGSRRRERQES"
FT   sig_peptide     complement(495047..495136)
FT                   /locus_tag="Mjls_0443"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.483 at
FT                   residue 30"
FT   gene            495234..495701
FT                   /locus_tag="Mjls_0444"
FT   CDS_pept        495234..495701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96256"
FT                   /protein_id="ABN96256.1"
FT                   /translation="MVDRLRGLGLAPRRPLTRVAATALALSAVLAGCSEQQPTEPPVSR
FT                   ATVTVNDTAVASLVPRCERQQKYLSVRAGNSRGEITGVLDVGGARPVAKWVKIRDLGGF
FT                   SGDFWEGGVGSIKTVRNDGDTTELGGTAYGVYTARPHELAQTARFSFEVQC"
FT   sig_peptide     495234..495374
FT                   /locus_tag="Mjls_0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.971) with cleavage site probability 0.551 at
FT                   residue 47"
FT   gene            495695..496171
FT                   /locus_tag="Mjls_0445"
FT   CDS_pept        495695..496171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96257"
FT                   /protein_id="ABN96257.1"
FT                   /translation="MLSAGRATGVVERMLRCRPLVRAPILLYRCGLGFMLGDRFLMLEH
FT                   VGRSTGRRRYVVLEVVAHRTRDSYTVASGFGEQAQWLRNVAAQPRVRVSTGRRISVPAT
FT                   ARRLTGPEADDVLTDYRSRHPRAWRALRGVLERNLGGRVEPPGTELPVVEVALD"
FT   gene            complement(496179..497594)
FT                   /locus_tag="Mjls_0446"
FT   CDS_pept        complement(496179..497594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0446"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: mmc:Mmcs_0459 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96258"
FT                   /protein_id="ABN96258.1"
FT                   /translation="MSEQRPAPHIFVLFGATGDLAKRKLFPGLYRLAAAGRLPEEYAII
FT                   GSGRHSPGGDDEFRDSVGDGLRDSVDDIDDRVLSNLLQSLSFQTSDSDDGSDLAEAVRS
FT                   ARTRLGDGAQTLIYLSVPPRAMQPMIAMLGREGLAEGARVVVEKPFGTDLDTARELDAT
FT                   LKDVVDEDQVYRIDHFIGKEAVQNILAVRFANGLIEPAWHRNHLVSVQIDVPEELTIEG
FT                   RGSFYESTGCFRDMISTHLCQVLGFVAMEPPVHLDPVSLRNEKAKVFEAMRPLDPDRVV
FT                   FGQYDGYREEEGVADDSQVETFVALEAFIDTERWQGVPFYLRTGKALGATRRTVTLTFR
FT                   GPPMALFGADDNEHSPNQLVLELTDSPEFQVRLLAKRPGPDLGLMPLDLSLGVADEDSD
FT                   DTPLEAYERLLLDVMRGDQTLFTRADEVDRLWQVCQPVLDAPPQALTYASGSWGPQEAL
FT                   ALPGAAGWRLPDA"
FT   gene            complement(497647..498207)
FT                   /locus_tag="Mjls_0447"
FT   CDS_pept        complement(497647..498207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0447"
FT                   /product="putative lipoprotein LpqJ"
FT                   /note="KEGG: mmc:Mmcs_0460 putative lipoprotein LpqJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96259"
FT                   /protein_id="ABN96259.1"
FT                   /translation="MRSKVVMAGVVTVATLLTGCQNDTSGTAVRSPDSLIEPTEPTVPT
FT                   PRPSRTSTPAPPPRTLTPAPPSASAPPSAAEVLAPQNGYVFIQTKSGKTRCQLSTEEVG
FT                   CEAQFTDSPEVGGLPANGVRLSADGQVEWVLGNLGDIPAVTLDYRRYSAVGWTIDASSD
FT                   GTRFTNDRTQRGMFVSVERVQTF"
FT   sig_peptide     complement(498124..498207)
FT                   /locus_tag="Mjls_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.602 at
FT                   residue 28"
FT   gene            complement(498217..498960)
FT                   /locus_tag="Mjls_0448"
FT   CDS_pept        complement(498217..498960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96260"
FT                   /protein_id="ABN96260.1"
FT                   /translation="METTVDEIAPGVFRLSTYVPEITEHGFTFNQFLLTGDEPFLFHCG
FT                   QRQLFPLVSAAIQRVIPLEKLRWISFGHLEADECGAVNLLLASAPNAQVVHGQLACMLS
FT                   LTDMCDRPPVAATDEPLDTGGHSLRFIATPHVPHNWEAGLWFDDATGTLLAGDLFTHVG
FT                   RCPALTENDCVAPALEAEAFFHATGLCTDLVPTLTTLAELRPTTLAIMHGSSFTGDGEH
FT                   QLRRLADGYTDMMRASLQSLTPQPP"
FT   gene            499176..501044
FT                   /locus_tag="Mjls_0449"
FT   CDS_pept        499176..501044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0449"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: mmc:Mmcs_0462 chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96261"
FT                   /db_xref="GOA:A3PTN4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PTN4"
FT                   /protein_id="ABN96261.1"
FT                   /translation="MARAVGIDLGTTNSVVAVLEGGDPVVVANSEGSRTTPSVVAFARN
FT                   GEVLVGQPAKNQAVTNVDRTIRSVKRHMGTDWNTEIDGKKYTAQEISARTLMKLKRDAE
FT                   SYLGEDITDAVITVPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTAAALAYGLDKGEKE
FT                   QTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDERVVTWLVDKFKASSGI
FT                   DLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKNPLFLDEQLTRAEFQRI
FT                   TQDLLDRTRQPFQSVIKDAGISVGDIDHVVLVGGSTRMPAVSELVKEMTGGKEPNKGVN
FT                   PDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSET
FT                   FTTADDNQPSVQIQVFQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTFDIDANGIV
FT                   HVTAKDKGTGKENTIRIQEGSGLSKEEIDRMIKDAEAHADEDRKRREEADVRNQAETLV
FT                   YQTEKFVKEQREAEGGSKVPEDVLTKVDGAISEAKTALAGTDIGAIKAAMEKLGTESQA
FT                   LGQAIYEATQAEQAAGGGAGGADGSSSSSDDDVVDAEVVDDDRENK"
FT   gene            501041..501688
FT                   /locus_tag="Mjls_0450"
FT   CDS_pept        501041..501688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0450"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: mmc:Mmcs_0463 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96262"
FT                   /protein_id="ABN96262.1"
FT                   /translation="MTRPFNSESDPQEPVTVTDKRRIDPVTGEVRDPSGPAPSGPAPDA
FT                   APDSFAGETPEEADKAGELLADLQRVQADFANYRKRALRDQQLTADRAKAGVMAQLLPI
FT                   LDDLDRARSHGDLDTGPLKAVADKLVSTLEGLGLTPYGEEGDEFDPGLHEAVQHEGEGT
FT                   HPVVGTVMRRGYKVGDQVVRHALVGVVDTVPAGDTAENASAAGREAAESDNQ"
FT   gene            501717..502895
FT                   /locus_tag="Mjls_0451"
FT   CDS_pept        501717..502895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0451"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: mmc:Mmcs_0464
FT                   chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96263"
FT                   /protein_id="ABN96263.1"
FT                   /translation="MAQREWVEKDFYKELGVSSDASADEIKKAYRKLARDLHPDTNPDP
FT                   SAAERFKAVSEAHSVLSDAAKRKEYDETRRLFAGGGFGRGRFNGGGGGFGGFGGADGGV
FT                   EFNLNDLFDAAGQTGGANIGDLFGGLFGRGASPRPSRPRRGNDLETETELSFLEATKGV
FT                   AMPLRLTSPAPCTNCHGSGARPGTSPKVCPNCNGAGVVNRNQGAFGFSEPCTECKGSGS
FT                   IIEHPCGECKGTGVTTRTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVTVHV
FT                   RPDKVFGRDGDDLTVSVPVSFHELALGTTLSVPTLEGKVGVRVPKGTSDGRILRVRGRG
FT                   VPKRGGGHGDLLVTVKVAVPPNLEGEAAEALEAYAKAERASGFDPRAGWAGA"
FT   gene            502898..503287
FT                   /locus_tag="Mjls_0452"
FT   CDS_pept        502898..503287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0452"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: mmc:Mmcs_0465
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96264"
FT                   /protein_id="ABN96264.1"
FT                   /translation="MAAKRNEEARTFLISVAAELAGMHAQTLRTYDRLGLVSPQRTSGG
FT                   GRRYSERDVDLLREVQRLSQDEGVNLAGIKRIIELTNQVEALQSRVKELVREVEELRAN
FT                   QRRDLAVPAKSTALVVWQPRHGRGR"
FT   gene            504148..505464
FT                   /locus_tag="Mjls_0453"
FT   CDS_pept        504148..505464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96265"
FT                   /protein_id="ABN96265.1"
FT                   /translation="MASISMERSTVARGVMTRRCRHLTRVAPWLLAVSLALRFVGSIPF
FT                   LDMLFVDLRVYILGGEALTQPGTLYGLTYIDSYGDHLPFIYPPFAALLFYPLHFLPFPV
FT                   VAWIWQLAVVAGLYGLVRISQRMLGGGSHRVAMLWTAAGIWFEPIRTILTCSQVGVFLT
FT                   LAVLYAAYTSRSWLSGLLVGLSAGVKVTPAITGLYFVGMRRWAAVCFSLAAFLATVLVS
FT                   AVIAPQETRQFFGGLFSRVPMPTATCLNQSWRGTVSRIVGYDAGRSLVLLVAIGVTAVL
FT                   ALLAWRELGRGPGGRDALASLLVVQLFGLTASPISWAHHWVWVVPLTIWLLHGPWRGRA
FT                   GARVLGSGWIALMVIGVPTLLSGQQADLSTFSRPWYLAVAAAVYVPMTLVTFAWIIVAS
FT                   RTGTRRTCPPSEPKAESAPSTSAVVFTPAASHAERPTNR"
FT   gene            505461..506747
FT                   /locus_tag="Mjls_0454"
FT   CDS_pept        505461..506747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96266"
FT                   /protein_id="ABN96266.1"
FT                   /translation="MTRLPLPIPRSDGAKAAPTVGRYSRPMRAASALKVRPCLARVVAL
FT                   APILLAVSIIARLASTMVYYFFAGDAFFDLHVYVIGGAALNHPGTLYDVVYVDPTKGER
FT                   LPFTYPAFAAMVFYPLHLLPFGLLAFLWQIALIAAIYASIRISQRLIGDGAGGPRVAML
FT                   WTAVAIWLEPVASSVQTGQVGVFLMLAVLYAAYSSRWWLSGLLVGAGAGVKLTPAITGL
FT                   YFVGMRRWAAAAFSAVTFFATVGLAYVALPADAGRYFPDQMTEAGTTLPIGSSWNQSWL
FT                   GGLSRILGYDPGLHPLVIAAVAVTALLAALAWRALGSADGRDRLASLLVVQFLGLMASP
FT                   VSWIHHWVWVIPLIIWLIHGPWRERAGARLLGLGWLALMVISVPSLLSLAQPDIWEISR
FT                   PWYLAWAEMVYIVASLSTLAWIIRTGRRA"
FT   gene            506740..508008
FT                   /locus_tag="Mjls_0455"
FT   CDS_pept        506740..508008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96267"
FT                   /protein_id="ABN96267.1"
FT                   /translation="MPESGVPAGRRRLLAPLLLVTSAAALLAVTMANPPDLVDFHVYML
FT                   GGVALDRPDTLYSFAYSDQSPDQPLPFVYPPFAAILFRPLTALPFVVAGVLWQLGILAA
FT                   VYGIVRISQRLLGGGSHRTAMLWTAGLIWLEPVRVALDLGQVGIFLTLAVLYAVCSRRW
FT                   WLSGLLVGLAAGVKLTPAITGLYFLGVRRWTAAAFSAVVFVATIGLSYLVVGDQVRNYF
FT                   TRVMGDTSINPIGIALNQSWRGAISRFLGHDAGGSALVIAAIAGTAVLALFAWAALGAG
FT                   SRPRDRLGSVLVVQLFGLLMSPISWVHHWAWVVPLVLWLLSGPWRNEPGARVLGWGWLA
FT                   LTFVGVPSQLSLLEPSLWEISRPWYLAWAGLAYVVAAVATLGWIVLTGRRNAAPTPPVR
FT                   RRFARVVGTRGKQIACEEHRAGR"
FT   sig_peptide     506740..506838
FT                   /locus_tag="Mjls_0455"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.994 at
FT                   residue 33"
FT   gene            complement(508005..508907)
FT                   /locus_tag="Mjls_0456"
FT   CDS_pept        complement(508005..508907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0456"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: mmc:Mmcs_0469 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96268"
FT                   /protein_id="ABN96268.1"
FT                   /translation="MAEHQPVTLSDPSSSVTATYVPAAGMICTSLADGGVEFLGQRRGV
FT                   EAYITSGKTMGIPLLYPWANRLSSSKYAIDGGVVTLTPGVAGVRTDENGVPIHGVLGAY
FT                   PGWVVTERSDNTLVAEVDWADKPRLLATFPFPHVLTMSVTLADRTLTVDTTVTPSAAAP
FT                   VPLCYGYHPYLQIPDVARAQWQLQSPTMRHLRVDAWGLPTGATEEWAGGTAPLGDRELD
FT                   HGFDQVDDGALFVLAGGDRRVEVTFEKGYPAAQLFAPSADDLVAVEPMAAPTDALRREN
FT                   YRLAAPGEPDTSRFTIRVT"
FT   gene            complement(508955..510121)
FT                   /locus_tag="Mjls_0457"
FT   CDS_pept        complement(508955..510121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0457"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: globin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: mmc:Mmcs_0470 oxidoreductase FAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96269"
FT                   /protein_id="ABN96269.1"
FT                   /translation="MGLDDRDALAVLRDAVDPRRGSDPLIADFYTRWFAADLSVRDLFP
FT                   PDMARQRTVFAEAMTWLFGELIDQRAEEPVAFLAQLGRDHRKYGVVQRHYDTMGDALYA
FT                   ALRSGLADQWSDRVAEAAHDAVALATGVMRGAADAEEGPPFCDGTVIEHIRATRDVSVV
FT                   RLKLDQPLAYHPGQYVTVQVPQWPRRWRYFSPAIPADPDGYVEFHIRSVPGGMVSTAIV
FT                   NETWVGDRWRVSNPHGALAVDRDGGDVLMVAGSTGLAPLRTLIMDMTRFGVNPRVHLFF
FT                   GGRFPCDLYDLMTLWQIASTNPWLSVTPVSEYSSDPPWAADYPDPSPPRGLHVRQTGRL
FT                   DEVVTRYGNWGDRQILICGGVAMTEATKAALIAKGAPPERIQHDPLTT"
FT   gene            complement(510138..511139)
FT                   /locus_tag="Mjls_0458"
FT   CDS_pept        complement(510138..511139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96270"
FT                   /protein_id="ABN96270.1"
FT                   /translation="MTTTSSPHTPTRHHEPPPAFRAAGIVIALAAVVAIVALAFALPAA
FT                   KSGPHDVPIGVAGPQAANGRIAAMLDERAPGAFAVTYYPGEDALRDAIADRQVYGGLAV
FT                   GPDGRKLLIASGAGPAVAQVLTQLGTGMAAQTGSAPTIEDVAPLPDTDPRGTGLAASAL
FT                   PITLAGILPAIALVLALRREVWTRLAAAVVFSGVAAWTITALLYYVLGSFDQNFWGVTA
FT                   GLTLGLLACGLPILGLGSLFGRVGLACGAALALLVGNPLSGLSSAPEMLPRGWGEVGQW
FT                   FPQGATATLLRSTAFFGGAGATSAIVVAICWAVAGAVLVALAALRERARTGD"
FT   sig_peptide     complement(511014..511139)
FT                   /locus_tag="Mjls_0458"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.522 at
FT                   residue 42"
FT   gene            511293..511874
FT                   /locus_tag="Mjls_0459"
FT   CDS_pept        511293..511874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0459"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0472
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96271"
FT                   /protein_id="ABN96271.1"
FT                   /translation="MSREVVLAAAKNRFATDGYERTTLRAIAKDAHVDPSMVLYLFGSK
FT                   LDLFRESLRLILDPERLVEALSEAGGDVGSRMARVYLQIWESPETGPSMVVMLQSATSN
FT                   SEAHEAFRTFMQTYVLAAVSGVLGGDEHARLRAMLAATTLVGTAVLRYVMKVPPLATIP
FT                   TEDLVALLAPTVTRYLTADAEELGLPAQSV"
FT   gene            complement(511862..512527)
FT                   /locus_tag="Mjls_0460"
FT   CDS_pept        complement(511862..512527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96272"
FT                   /protein_id="ABN96272.1"
FT                   /translation="MTGSWGTVLTELIPLALVIALSPLSIIPAVLMLQTPRPRPTALAF
FT                   MAGWLIGLGALTAIFVAVSGAIGGFEKPPSWASWLRIVIGAALIVFGLVRFARRHSSSH
FT                   QPKWLRNLTTLGPGRAAGTAAVLTVANPKVLFICVAAGLAIGSAGLGNAVWAAVVYFAA
FT                   IAGCSVAVPILAYAVSGGRLDDPLARLKDWMERNHATLMAVILVVIGLLVLYKGIHTL"
FT   gene            512613..513545
FT                   /locus_tag="Mjls_0461"
FT   CDS_pept        512613..513545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0461"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   syf:Synpcc7942_2318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96273"
FT                   /protein_id="ABN96273.1"
FT                   /translation="MATAVTVFHPSDGQARFAAFVDAFVESARGMAGFVAACTSLADFE
FT                   PAVAVTFADGGSLERWLDCSGHAEALRFGQELGFWRAATPMVLADDAPPPAGVAAFRHD
FT                   VADGREDEFLATQRCLGIAVADAPGYEGTALFPPDDAGRWLSVVRFRSDRRLADWLSSA
FT                   RRAEALPELRSTLVEDFSSLAQTTPFGTTVRVDDGRLRMTPNWKSAMMVMLVLYPTVML
FT                   LSRFLGPVLDGWSVQPWLALWLSQVASVVLMQWWLMPAATGLFRRWLDPVDGAGRTTTL
FT                   RGAAVVVAVYALTLALFASVAWLQYWDHP"
FT   gene            complement(513555..514187)
FT                   /locus_tag="Mjls_0462"
FT   CDS_pept        complement(513555..514187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0462"
FT                   /product="adenylate cyclase"
FT                   /note="KEGG: blo:BL0349 narrowly conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96274"
FT                   /protein_id="ABN96274.1"
FT                   /translation="MSDRDSRESGDFEYERKFLVCGMPAVAASDPSPALIAQVYLFASD
FT                   GYAVRVRLQGPAPAELDAGPAELVDALGDEAIGTVTAKGPAAGGTRYEAERELDPLVAG
FT                   QIVSRAEHVVLKIRSSVWLGEDGWVIDRFLGANEPLVLAEVERDSPVVDLVIPSFCTTE
FT                   VSEDDRFRNEHLAFHPFSGWAENYEREFGLLGPRFVDALGQNVFEGT"
FT   gene            complement(514287..514751)
FT                   /locus_tag="Mjls_0463"
FT   CDS_pept        complement(514287..514751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96275"
FT                   /protein_id="ABN96275.1"
FT                   /translation="MTDGREFDDDELAALASFTPRFDEDADDDLDALGVYTSTGPDDND
FT                   DPAQDLIFVAANPSGTVTVTALLGGECQCVDLAPTVTALTETELAAEIVAVAQVAAQRA
FT                   GAGAYELFAAMFRAQGEDRASVDDLLRHQLRLPTPDEARASAAELAARSR"
FT   gene            complement(514748..515077)
FT                   /locus_tag="Mjls_0464"
FT   CDS_pept        complement(514748..515077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96276"
FT                   /protein_id="ABN96276.1"
FT                   /translation="MSSPFDQLRIDPAHLQDLADKQGGTATQIASAAPVTQGVAASVAT
FT                   SHGNICAPTSEAAARAEQARADACAAMEFMSTSLQESLLGAIAWYSRTDSESWDELDGR
FT                   MRPAP"
FT   gene            complement(515091..515858)
FT                   /locus_tag="Mjls_0465"
FT   CDS_pept        complement(515091..515858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96277"
FT                   /protein_id="ABN96277.1"
FT                   /translation="MGIFDELGDVLKKVAGTMRKFDPFGPFGEAGEMLTNIVTVAEAVE
FT                   SSGPDALWNFAADTAEIASVAEFFLPRAKQTPIIAAGLKTVMGMQVLCGWTNPPDRGEG
FT                   YDTGYQLFNEAIDTLKTASPDARWEGEASDAYSKASAEQLARARMMVDADIDVSNALSA
FT                   EAGTVDNTRRILNNAATMMGNAIIPAVTAKAIPRIGRVISLEIEMSVVGISLPTCFWYM
FT                   SEMRAASERAAKTIDDATSIYEAVSRGCYPVNM"
FT   gene            516184..516783
FT                   /locus_tag="Mjls_0466"
FT   CDS_pept        516184..516783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96278"
FT                   /protein_id="ABN96278.1"
FT                   /translation="MDVSCALETQSGQQVGLIRPRSNRSSAINREVADLSYEVLGPGGA
FT                   PILSLKRLGGLARRHTIVVEDATGRHLGRIRQTSSVWRQMRTTRITVALEVGGHQVATT
FT                   DICIHPRDRFAAVCEPIGPTVGPAIATVERQWRSVGTSNDFFDYTLSCLQPTVHPLPEL
FT                   LLATAFAHYLYDRLAVGGPLETYQSFGRGGTWHDPR"
FT   gene            516914..519460
FT                   /locus_tag="Mjls_0467"
FT   CDS_pept        516914..519460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0467"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: mmc:Mmcs_0478 ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96279"
FT                   /protein_id="ABN96279.1"
FT                   /translation="MDSFNPTTKTQAALTSALQAASAAGNPQIAPAHLLMALLTQNDGI
FT                   AAPLLEAVGVEPATVRAETQRLLDRLPSASGASSQPQLSRESLAAVTAAQQLATEIDDE
FT                   YVSTEHLMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVTSPDPEGSYQALEK
FT                   YSTDLTARAREGQLDPVIGRDTEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVAGDVPESLRGKTVISLDLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFIDELH
FT                   TIVGAGATGDSSMDAGNMIKPMLARGELRLVGATTLDEYRKYIEKDAALERRFQQVYVG
FT                   EPSVEDTVGILRGLKERYEVHHGVRITDSALVSAATLSDRYITARFLPDKAIDLVDEAA
FT                   SRLRMEIDSRPVEIDEVERLVRRLEIEEMALAKEEDDASKERLEKLRGELADYKEKLAE
FT                   LTTRWQNEKNAIDIVRELKEQLEALRGEADRAERDGNLEKAAELRYGRIPEVEKKLDAA
FT                   VPQAEARDDVMLKEEVGPDDIAEVVSAWTGIPAGRMLEGETAKLLRMEDELGKRVVGQR
FT                   RAVQAVSDAVRRTRAGVADPNRPTGSFMFLGPTGVGKTELAKALAEFLFDDERAMVRID
FT                   MSEYGEKHSVARLVGAPPGYIGYDQGGQLTEAVRRRPYTVVLFDEIEKAHPDVFDVLLQ
FT                   VLDEGRLTDGQGRTVDFRNTILILTSNLGAGGTEDMVMAAVRSAFKPEFINRLDDVIVF
FT                   DGLNPEELVSIVDIQLQQLAKRLAQRRLTLEVSLPAKKWLADRGFDPLYGARPLRRLIQ
FT                   QSIGDQLAKMLLAGDVHDGDIVPVNVSPDGESLVLG"
FT   gene            519633..520499
FT                   /locus_tag="Mjls_0468"
FT   CDS_pept        519633..520499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96280"
FT                   /protein_id="ABN96280.1"
FT                   /translation="MVPLWFTLSALCFVGAAVLLYVDIDRRRGLGRRRKSWAKSHGFDY
FT                   EHESADILKRWKRGVMSTVGDVTAKNVVLGQIRGEAVFIFDLEDVATVIALHRKVGTNV
FT                   VVDMRLKGIKEPRENDIWLLGAIGPRMVYSTNLDAARRACDRRMVTFAHTAPDCAEIMW
FT                   NEQHWTLISMPVTSTRAQWDEGLRTVRQFNDLLRVLPPIPQTDSVQAVARRSGSPSRPI
FT                   NPAPHRPPEPPQGRPDVGRPGSAAPARPYAQRPEAGRPDGPPAARPDTARRTPPARNGH
FT                   QSANFQR"
FT   gene            520515..521291
FT                   /locus_tag="Mjls_0469"
FT   CDS_pept        520515..521291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0469"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0480 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96281"
FT                   /protein_id="ABN96281.1"
FT                   /translation="MPRPVVLITGPTSGLGEGFARRYAADGHDLVLVARDEARLEALAG
FT                   ALRAETGAGVEVLPADLADADDRAKVAERLSAGVRVLVNNAGFGTSGEFWTADYQVLQS
FT                   QLDVNVTAVMQLTHAALPPMLDAHAGTVINVASVSGLLPGRGSTYSASKAWVIAFSEGL
FT                   ANGLGGTGVGVHALCPGFIHTEFHQRAGIEMSGLPSWMWLEVDDVVGDCLTAVAKDRVV
FT                   IVPGVQYKAMTTVSRLVPRHLVRAMTRTVGRGRGRT"
FT   gene            521298..522194
FT                   /locus_tag="Mjls_0470"
FT   CDS_pept        521298..522194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96282"
FT                   /protein_id="ABN96282.1"
FT                   /translation="MRALVAVVVTVLLVAVTGCSKAEGRSDTYSAPTAKVGESLAVSGW
FT                   NISVSNLRFEADHVLVDVDASHSGEGEPVAPESLRFGLYGALVHPIEANGLGSCQNVDA
FT                   LNVNPVSAPSPDRLSGTVCLGPQRDQSQVRGIYAYSPQDRMAGTTVAYAAAFPVGLLPT
FT                   RDTETGLTLKTTSLDAFRADGAQLNQAALGDPEAFSGNGYMLLGLQIDGLASRYREDSM
FT                   RRGGPLMVVVAPTLPGKGLSYACAAYGASVLVLPEASREAVNMRASLCTQGEINRALLF
FT                   ASVSVVGTHAALWTTGD"
FT   sig_peptide     521298..521372
FT                   /locus_tag="Mjls_0470"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.554 at
FT                   residue 25"
FT   gene            522187..522831
FT                   /locus_tag="Mjls_0471"
FT   CDS_pept        522187..522831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0471"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   mmc:Mmcs_0482 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96283"
FT                   /protein_id="ABN96283.1"
FT                   /translation="MTEAPGPTEWGEAPGVGPWPGELPDDPRYDPELLRDGDTRNVVDA
FT                   YRYWTREAIIADIDRRRHPLHIAIENFGNDANIGSVVRTANAFAVDTVHIVGRRRWNRR
FT                   GAMVTDRYQRLRHHDSTAEMLDFAAEAGLTAVAVDNIPGAVPLEHTDLPRECLLIFGQE
FT                   GPGITDDAKTGARLTVSIAAFGSTRSINAAVAAGIAMHTWIVQHADLGKAW"
FT   gene            complement(522724..524301)
FT                   /locus_tag="Mjls_0472"
FT   CDS_pept        complement(522724..524301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0472"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmc:Mmcs_0483 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96284"
FT                   /protein_id="ABN96284.1"
FT                   /translation="MTRRWLALSVLTLAVLVIGIDGTVLALATPFISSDLHTSATELLW
FT                   IGDIYSFVLASLLITMGSLGDRIGHRRLLLCGATLFAAVSVVTAYAPTAEALIGARALL
FT                   GVAGATLAPATLALIRGIFADARQRSMAVGIWAAAFSAGAALGPMVGGVLLEHFWWGSV
FT                   FLINAPVMAVLVIGGLTLLPEHRNPEPGPWDLPSVGLSMLGILSVVYAIKETAAHGPRL
FT                   SALATAVVGVSALTVFVRRQLRLPSPLIDVRLFGNRAFSGVVGANLLSVLGLSGLVFFL
FT                   SQYFQLVQGYSPLGAGLAELPAAVTATVFGVLAGFAVRRWTQRAVLTTGLALVGVAMAT
FT                   LTTIHPTSPYPHLGIALFVVGVGLGLAFTVASDVILASVPRERAGAAAAVSETAYELGM
FT                   ALGIAVVGSILTGVYRTLVVPPGLSPAAATQARDSLAAATDVAAGLPPAQAGALLDAAR
FT                   ESFSSGLAVASGVGAALMLTSAVTVWVLLRERLPRLAEVGVLNDPGVHGDAGGDGRVDT
FT                   ACGAERGN"
FT   sig_peptide     complement(524221..524301)
FT                   /locus_tag="Mjls_0472"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.798 at
FT                   residue 27"
FT   gene            complement(524298..524858)
FT                   /locus_tag="Mjls_0473"
FT   CDS_pept        complement(524298..524858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0473"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0484
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96285"
FT                   /protein_id="ABN96285.1"
FT                   /translation="MRYSRFMVTDRESVLRAAADFLGRRPNATQDEIAAAVGVSRATLH
FT                   RHFAGKPALMAALDDLAIAEMRTAVDAARLSEGSAADALRRLVAACRPVSPYLALLYSQ
FT                   SQDIDGDQSMQGWAESDAAITALFERGQRSGEFRPDLTAAWLTEALYSLVAGAGWCIQV
FT                   GRAAGRDFERMISELLLSGVQNS"
FT   gene            524932..526095
FT                   /locus_tag="Mjls_0474"
FT   CDS_pept        524932..526095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0474"
FT                   /product="glycoside hydrolase, family 76"
FT                   /note="PFAM: glycoside hydrolase, family 76; KEGG:
FT                   mmc:Mmcs_0485 glycoside hydrolase, family 76"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96286"
FT                   /protein_id="ABN96286.1"
FT                   /translation="MDQLWANRAASAEAAITQRHLRRLWGLPGTQLGVVAWPAAGPHKQ
FT                   FRTWHYWWQAHLLDCLVDAQLREPDPDRQRRITRQIRAHRIRNIGRWTNDYYDDMAWLA
FT                   LALERAGRLAGVARPRALGTLCEQFLNAWVPEDGGGIPWRKQDQFFNAPANGPAGIFLA
FT                   RYDNRLRRAQQMADWIDEVLIDPDTQLVFDGIKGGSLVRAQYTYCQGVVLGLETELAVR
FT                   IGGDDGGGEHALRVHRLVAAVAEHMAPDGVIKGAGGGDGGLFNGILARYLALVATTLPG
FT                   DTADDVAARDTARRIVLASAEAAWGNRQTVGADGGALPLFGAFWERTAELPTAAGRQAE
FT                   SVEGAVNASEIPERDLSVQLSGWMLMEAAHAVSDQPAESADPGPAET"
FT   gene            526092..527933
FT                   /locus_tag="Mjls_0475"
FT   CDS_pept        526092..527933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0475"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="PFAM: DSBA oxidoreductase; Na+/H+ antiporter NhaA;
FT                   KEGG: mmc:Mmcs_0486 Na+/H+ antiporter NhaA; TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96287"
FT                   /db_xref="GOA:A3PTR0"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PTR0"
FT                   /protein_id="ABN96287.1"
FT                   /translation="MTEASARTIGPLPSRFSRDPKTPRSTDNAAAALLLAFTVLAILWA
FT                   NSPWAQSYSTFWDTHVAVSFGEYRAELSVKHLVNDGLMAFFFFIVGLEVKSEFVIGELT
FT                   DRSRAAVPVVAAIAGLIVPAVIFLTFNPSGPDAQAWGVVISTDTAFLVGALAVIKPKFP
FT                   ARLRIFLLTLAVVDDVGALGAIALFYTDDLKLAPLAVAALLIAALAMVRRLPSLRGPAY
FT                   AVLGFALWIALYLAHVHPTLAGVAVAVLIPVFTPERRQVEQTVDLVRAFRQSPNPQYAR
FT                   AVTRGLRESISINERLQTAVGPYVSFVVLPIFALANAGVHLDEQTITAAMSSTLTWGIV
FT                   AGLVVGKFVGITAATALMSATGWGQLAPGLSLRRVAGGAALSGIGFTISLFIVDVAIED
FT                   PARQDEARVGVLIASVLAFTLSWALFRITDWISPPEPVGLTLVRPVDPERDHIRGDPDA
FT                   PLVLVEYGDYECPFCGRATGAIDEVRTHFGDDLLYVWRHFPLERAHPRSFDAARASEGA
FT                   AAQGKFFEMGRELFAHQDDLEWSDMYRYAVAIGLDIEQFDQDVRVHASKVLHRVRDDAQ
FT                   DAEVMDLNSTPTFFVNGKRHKGPWDAASLIRALEAGR"
FT   sig_peptide     526092..526244
FT                   /locus_tag="Mjls_0475"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.847) with cleavage site probability 0.448 at
FT                   residue 51"
FT   gene            complement(527939..528895)
FT                   /locus_tag="Mjls_0476"
FT   CDS_pept        complement(527939..528895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0476"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: mmc:Mmcs_0487 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96288"
FT                   /protein_id="ABN96288.1"
FT                   /translation="MTPAQLRAYSAVVRLGSVRAAAEELGMSDAGISMHVTQLRKELDD
FT                   PLFSRTSAGLAFTPGGLRLASRAIEILGLQQQTAIEVTEAAHGRRLLRIAASTMFAEHA
FT                   APGLIELFSARADDLTVELSVHPTSRFRDLIESRAVDITLGPAPADPGPALVVRPFLKY
FT                   QIITVAAPETAAGPGMQAPAQLREHDWMLGPSAGGVDGEVATMLRNLSIPESRQRIFQS
FT                   EAAALEEVQRAGGVTLTLGFAVSRDLSSRRLVQIKGAGLQTSGEWFASTLTPAARPPAS
FT                   SELMRFITTPRCTQAMIRGTGVGVTRFKPKVHVTLWS"
FT   gene            528931..530091
FT                   /locus_tag="Mjls_0477"
FT   CDS_pept        528931..530091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0477"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   mmc:Mmcs_0488 protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96289"
FT                   /protein_id="ABN96289.1"
FT                   /translation="MRDVLSALSAVWRTGGTAGLATVVRTFRSAPRQPGAAMVVAPDGT
FT                   VTGSVSGGCVEGAVYELAGDVVGSGTPALQRYGVSDDDAFAVGLTCGGILDVFVEPVSP
FT                   ATFPDLDAVVEDIESHRPVALATVIAHPDATRVGRRLVVRSDEVSGTLGSSRADAAVTD
FT                   DARGLLATGRNEVLTYGPDGQRRGAGMEVFVAAYAPRPRMLVFGAIDFAAAVAQQGSFL
FT                   GYRVTVCDARPVFATAARFPTADEVVVDWPHRYLAAQVAAGDVDARTVICVLTHDPKFD
FT                   VPLLEVALRLPQVAYIGAMGSRRTHDDRLTRLRDAGLTDAELDRLASPIGLDLGARTPE
FT                   ETAVSIAAEIVAVRWGGTGRRLTDTDGRIHHDQGKDSEFSDRLTRY"
FT   gene            530149..531024
FT                   /locus_tag="Mjls_0478"
FT   CDS_pept        530149..531024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0478"
FT                   /product="carbon monoxide dehydrogenase, medium subunit"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   mmc:Mmcs_0489 carbon-monoxide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96290"
FT                   /protein_id="ABN96290.1"
FT                   /translation="MQVPGPFEYERATSVDHAIGLLDRLGDGAMIVAGGHSLLPMMKLR
FT                   IANPEYLVDINDLTRELGYITVDARAVRIGAMTRHRQVLESAELAEVCPIFADAERMIA
FT                   DPVVRNRGTLGGSLCQADPAEDLTTVCQTLGAVCVARGPSGQREIPIDEFLEGPYETSL
FT                   SHNEILLEVRIPVRPNTSSAYTKVERRVGDWAVTAAGAMVTLDGDTITAARIGLTAVNP
FT                   DAAALAAVGAALVGRTADEDAFAEAGRQAADACAPDSDMRGSADYKRHLASELTVRNLR
FT                   TAVRRVRERA"
FT   gene            531027..531602
FT                   /locus_tag="Mjls_0479"
FT   CDS_pept        531027..531602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0479"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: mmc:Mmcs_0490 (2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96291"
FT                   /protein_id="ABN96291.1"
FT                   /translation="MQVSMTVNGEPVSADVEPRMLLVHFLRDELRLTGTHWGCDTSNCG
FT                   TCVVSLDGEPVKSCTMLAVMADGHDVRTVEGLEVDGKLDPVQEGFMQCHGLQCGFCTPG
FT                   MMITARALLDRNPHPTEHEIREAISGQICRCTGYTTIVRSVQWAAGHARGRDVESGPSA
FT                   TDFAPQSQTDDTLGPVAGDHLIETGSPS"
FT   gene            531599..533989
FT                   /locus_tag="Mjls_0480"
FT   CDS_pept        531599..533989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0480"
FT                   /product="carbon monoxide dehydrogenase, large subunit
FT                   apoprotein"
FT                   /note="TIGRFAM: carbon-monoxide dehydrogenase, large
FT                   subunit; PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding; KEGG: mmc:Mmcs_0491
FT                   carbon-monoxide dehydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96292"
FT                   /protein_id="ABN96292.1"
FT                   /translation="MTAVDERPDAQADNDRKPCGYGRMLRKEDPRFVRGRGNYVDDVTL
FT                   PGMLHLAILRSPYAHARIANIDISAAEAHPKVKAVVTGADLAEKGLAWMPTLSNDVQAV
FT                   LATDKVRFQGQEVAFVVAEDRYSARDGVELIDVDYEPLDPVIDVRRALDPDAAVIRTDL
FT                   DGKTDNHCFDWETGDAAATDAAFAKADVVVKQEMVYPRVHPAPMETCGAVADLDPVSGK
FT                   LTLWSTTQAPHAHRTLYALVAGLPEHKIRVISPDIGGGFGNKVPIYPGYVCAIVGSLLL
FT                   GKPVKWMEDRSENLTSTGFARDYIMVGEIAATSDGKILAVRSNVLADHGAFNGVAAPTK
FT                   YPAGFFGVFTGSYDLEAAYCHMTAVYTNKAPGGVAYACSFRITEAVYFVERLVDCLAYE
FT                   MKMDPADLRLRNLLKPDQFPYHSKTGWTYDSGDYETTMRKAMDMVGYEQLRAEQAAKRE
FT                   RGELMGIGMAFFTEAVGAGPRKDMDILGLGMADGCELRVHPTGKAVVRLSVQTQGQGHE
FT                   TTFAQIVAEELGIPPDDIDVVHGDTDQTPFGLGTYGSRSTPVSGAAAALVARKVRDKAK
FT                   IIASGMLEVSVADLEWDKGAFHVKGDPAASVTIQDIAMRAHGAGDLPEGIEGGLDAQIC
FT                   YNPENLTYPYGAYFCVVDVDPGTAVVKVRRFLAVDDCGTRINPMIIEGQVHGGIVDGIG
FT                   MALMEMIAFDEEGNCLGGSLMDYLIPTALEVPELETGHTVTPSPHHPIGAKGIGESATV
FT                   GSPPAVVNAVVDALAPFGIRHADMPLTPSRVWEAMQGRPTPPI"
FT   gene            533992..534762
FT                   /locus_tag="Mjls_0481"
FT   CDS_pept        533992..534762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0481"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   mmc:Mmcs_0492 protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96293"
FT                   /protein_id="ABN96293.1"
FT                   /translation="MRSADTMHDRAQQLLQTRIPFVRATVVRAQQPTSAHPGDEAILLS
FT                   DGTIEGFIGGECAQSSVRKAALGALQANQSVLLRVLPDGDVHFPDAPGACVVVNPCLSG
FT                   GALEIFLVPQVPAPLVRICGDTPIAEALAQVCAVLGYEVTRSAGEPAGATAVVIASHGG
FT                   PEAEMIRAALDADVGYIGLVASRVRGAAVLEGLHLTAAERARVHTPVGLPIGARTAAEI
FT                   AVSIAAELIAAIRVDAAAPHPAEVGAAEDHHRCH"
FT   gene            534935..535639
FT                   /locus_tag="Mjls_0482"
FT   CDS_pept        534935..535639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0482"
FT                   /product="putative oxidoreductase"
FT                   /note="KEGG: mmc:Mmcs_0493 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96294"
FT                   /protein_id="ABN96294.1"
FT                   /translation="MCGAPLIRLQCYEGLSAGEALYDWNYQRQLLSIRLAEARGDHITE
FT                   ADLYAEKYLADRPILRCVRHPGPTPPVLLIDEIDRADDEFEALLLEFLGESSVTVPEIG
FT                   TFVAAVPPIAVLTSNRSRDLHDALRRRCLYHWIDYPQPERAVAILRRTVPGATTALIEQ
FT                   AAQFVGAARELDLDKPPGIAETIDWVAALVTLGVAELVESVDTVLAGFSALAKTPDDRA
FT                   VLRDALVDHSWT"
FT   gene            535652..536320
FT                   /locus_tag="Mjls_0483"
FT   CDS_pept        535652..536320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0483"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   mmc:Mmcs_0494 carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96295"
FT                   /protein_id="ABN96295.1"
FT                   /translation="MKIANEFTVGVPIEQAWDVLTDLEQVIPLMPGAAMTGRDGDDVMG
FT                   KVKVKVGPVTSEFNGKVHFVEQNRAEHRAVIDGRGKEARGTGNAAATVTAQLHPDGDRT
FT                   RVTVDTDLKIVGKLAQFGSGMLQQVSEKLLGQFVESLEAKLAGDATPPAAAQEVATPVA
FT                   GGDGDAPRPQVVPAPPAEAPPIDLLELAGGGAVKKYGPPAVGALLLLVLLLVALRRRRR
FT                   "
FT   gene            536317..537585
FT                   /locus_tag="Mjls_0484"
FT   CDS_pept        536317..537585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0484"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="PFAM: VWA containing CoxE family protein; SMART: von
FT                   Willebrand factor, type A; KEGG: mmc:Mmcs_0495 VWA
FT                   containing CoxE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96296"
FT                   /protein_id="ABN96296.1"
FT                   /translation="MSAPLLLRGVDLAAFAVALVARLRGGGVVVSASGSAEFVHAMRAL
FT                   RPGRRTELYWAARLTLVNRADDLETFDRVFEAVFADAVLGLDPFAMKHRSADPDPSRPV
FT                   ARPGQGPPEDVDGLPWVTRPTNIRAAAGSEGTITLPDVLPSGMTARADEPFDQFEPEDL
FT                   RLLGQWLEDAAPHWPRRRTLRRRPHPRGDRIDLRRTVRASRGTGWETIRLTRTRRRQRD
FT                   RRIVLVCDVSRSMQAYATVYLHLMRAVMMRRDRLRPEVFAFSTSLTRLTPVLSHRSPEL
FT                   ALARANETVADRYGGTHVGRSIGELVSGPHGAVLRGAVVIIASDGWDSDAPEVLVHALA
FT                   RVRRRAYRVVWLNPRAAHVDYRPLAGSMAAALPFCDEFMPAHSISGLRDLFEVLGESSA
FT                   SGDRPRAVVRGRSRPAARRRMPC"
FT   sig_peptide     536317..536415
FT                   /locus_tag="Mjls_0484"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.844) with cleavage site probability 0.810 at
FT                   residue 33"
FT   gene            537579..538433
FT                   /locus_tag="Mjls_0485"
FT   CDS_pept        537579..538433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0485"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0496
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96297"
FT                   /protein_id="ABN96297.1"
FT                   /translation="MLSGMDQYRRDGLVFEVRDEGPADGPVVVLLHGFPQRNTSWDAII
FT                   ERLTAQGYRCLAPNQRGYSPGARPRRRRDYRIPELIADVGALIDASGAERVHLVGHDWG
FT                   AAVAWGVAAEMPERLATVVPVSVPHPAAFLKSIPTSRQGLASWYMYFFQLPYVPELLLT
FT                   RRRGALALGALRRTGQSEAAAERDVAAMLDPGALTAGLNWYRAMPFMDPRATGGKITVP
FT                   TMFVWSDRDSALLPKGAYDTARYVSGEYRFEIMSGASHWLPEERADELAALLLEWFDAH
FT                   PIT"
FT   gene            538463..539374
FT                   /locus_tag="Mjls_0486"
FT   CDS_pept        538463..539374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96298"
FT                   /protein_id="ABN96298.1"
FT                   /translation="MSESSRPTIEFPARIGVWWASETWSITDAQDVAREIEALGYGSLF
FT                   IPEVTGKECLTQSAAFLSATDRLVIGTGIANIHIRLPSAAETGGRTLGALHPNRFVLGL
FT                   GVSHAPLVEHGMGGTYSKPLATMRGYLEKMAAVSEAIEPGAPRPTRLLAALGPKMIELS
FT                   GTHADGAHPYLVTPEQTRTTRDILGPDKWIVSEQAVAIGGDDADQLRRAHQHLEVYSGL
FT                   PNYRNSWLRQGFDESDLVRGGSDRLARGIVGMGSVDAAAASVTAHLDAGADHVVLQVLG
FT                   DDPMADPRPALRELAAALGLNG"
FT   gene            539451..540860
FT                   /locus_tag="Mjls_0487"
FT   CDS_pept        539451..540860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0487"
FT                   /product="selenium-binding protein"
FT                   /note="PFAM: selenium-binding protein; KEGG: mmc:Mmcs_0498
FT                   selenium-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96299"
FT                   /protein_id="ABN96299.1"
FT                   /translation="MAHPSIDPTFYRTAADAAAAPGEQLAYVVAFDRAAHDHDAMTVVD
FT                   VNPGSERYGRVVGWTEVPGLGDELHHFGWNACSSALKHEGHDMHGLERRYLLVPGLRSS
FT                   RVHVFDTRPDPRNPTLVKTIDASTLSETAGYSRPHTLHCGPDGVFLTCLGGREGDDDGP
FT                   GGIALLDHATFDVLRAWETDRGPQHFHYDAWWHLNQNVLISSEWGSPSMIENGIVPELL
FT                   LGQKYGHAIHFWDLAKGEHRQRLDLGAQHQMVLEVRPSHDPEATWGFVGVVISTDDLSG
FT                   SVWRWFRDGDEWKAEKVITVPAEPADPDILPPALKPFAAVPPLISDIDLSVDDRFLYVS
FT                   CWGTGELKQFDVSDPANPKQVGSVRLGGIVDRAPHPAMPDTPLAGGPQMVEVSRDGKRV
FT                   YFTNSLYGAWDDQFYPDGVGAWMVKLDADPDGGMSIDESFFPHGEEFRGLRVHQIRLQG
FT                   GDASSDSYCYR"
FT   gene            complement(540851..541537)
FT                   /locus_tag="Mjls_0488"
FT   CDS_pept        complement(540851..541537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0488"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   mmc:Mmcs_0499 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96300"
FT                   /protein_id="ABN96300.1"
FT                   /translation="MNTENVVALVSGANRGLGRHFAEQLIARGAKVYAGARKPETVDLP
FT                   GAIPVQLDITDPESIRRAAEFAADVNVVINNAGVSTQSTLLDGSLDDIRLEMETHYFGT
FT                   LQVLRAFAPIIERNGGGAVLNVLSVLSWFHPPTSGAYSAAKAAAWALTDAVRTELAPKG
FT                   IHVAALHVGYMDTDMVSYIPADQKSDPGAIAELALDGLFAGENEILGDALTRDVKAALS
FT                   GAPRQR"
FT   gene            541624..542646
FT                   /locus_tag="Mjls_0489"
FT   CDS_pept        541624..542646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0489"
FT                   /product="nitroalkane oxidase"
FT                   /EC_number="1.7.3.1"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   mmc:Mmcs_0500 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96301"
FT                   /protein_id="ABN96301.1"
FT                   /translation="MTSPLSALGVRLPVIAAPMAGGATTTDMVVAAARAGSLGLLAAGY
FT                   KTPDALQAEIATVRAASIPFGVNVFAPNPVPIGIAAYRRYAALIQPEADRFGLTLPPDP
FT                   IDDDDAFGAKVDLLRADPVPIVSFTFGLPASDVIRALQKAGTTVVQTVTSPQEAEAAAA
FT                   AGVDMLAVQASVAGGHSGTFTPDRMDAPVVLTELVRAVVTRVGLPVIAAGGLATPADVT
FT                   AVLHAGAAAAAVGTVLLRADESGASATHRAALADPTRTETVITRAFTGRPARGLRNRFI
FT                   DRFEADAPLGYPAVHHLTSPLRKAAAAGGDADLVHLWAGTGYRHAAEKPTATILTELAS
FT                   "
FT   sig_peptide     541624..541692
FT                   /locus_tag="Mjls_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.461 at
FT                   residue 23"
FT   gene            complement(542643..543338)
FT                   /locus_tag="Mjls_0490"
FT   CDS_pept        complement(542643..543338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96302"
FT                   /protein_id="ABN96302.1"
FT                   /translation="MTTTHLALMPDFLDPLVLLGYFGGWALVGLLVVIFVESGVLFPVL
FT                   PGDSLLFVAGMLAAGTAAVAESGGEPINFHLWQLLVFIPIAAILGGQVGYWIGRSVGTA
FT                   MFKPNARILKQRYLEEAHLFFEERGPFAIVIARFVPIVRTLAPLTAGAARMSYPVFALF
FT                   NILGAVVWGVGLTLLGYWLGRFEMVQKLLEPIVIAIVIVSVAPMLLEWYKRRKAAKRAG
FT                   IAAPPIEPA"
FT   gene            543426..544439
FT                   /locus_tag="Mjls_0491"
FT   CDS_pept        543426..544439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0491"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_0502 alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96303"
FT                   /protein_id="ABN96303.1"
FT                   /translation="MATHKAVHVAAAGEPLTLADVETPSPPPGHLRIDVAACGVCGTDH
FT                   GFVNGNFPGLSWPITLGHEIAGTVAELGDGVDEFAVGDRVAVGWFGGNCNKCIPCRRGL
FT                   FMQCVNMQVPSWHYPGGYAESVVVPATAPARIPDGLSFVEAAPMGCAGVTTFNGLRQTR
FT                   ARAGDLVAVLGIGGLGHLGVQFARAMGFETVAIARGAAKEDDARALGAHHYIDSTAGDV
FT                   AAALQKLGGAAVVLATAASSAAMGQTVGGLGPQGELIVVGVTPEQLPISPLDLINSGLS
FT                   VTGHPSGTARDVEETMHFAVLSGVRARVEEKPLAEAAEAYAAMDEGRARYRMVLTM"
FT   gene            544470..545507
FT                   /locus_tag="Mjls_0492"
FT   CDS_pept        544470..545507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0492"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: mmc:Mmcs_0503 fructose-bisphosphate aldolase,
FT                   class II; TIGRFAM: ketose-bisphosphate aldolases;
FT                   fructose-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96304"
FT                   /protein_id="ABN96304.1"
FT                   /translation="MPIATPEVYAEMLDRAKKHSFAFPAINCTSSETVNAAIKGFADAG
FT                   SDGIIQFSTGGAEFASGLGVKEMVTGAVALAEFAHVIAEKYPITVALHTDHCPKDKLDT
FT                   YVRPLLAISADRVAAGGNPLFQSHMWDGSAVPIDENLTIAQELLKQAAAAKIVLEVEIG
FT                   VVGGEEDGVEAEINDKLYTTSEDFEKTIDALGAGEHGRYLLAATFGNVHGVYKPGNVKL
FT                   KPEVLAEGQKVAAAKLGLDSDAQPFDFVFHGGSGSLKSEIEDSLRYGVVKMNVDTDTQY
FT                   AFTRPIAAHMFTNYDGVLKIDGEVGNKKVYDPRSYLKKAEAGMAERVIEACRDLHSEGR
FT                   SVTAD"
FT   gene            complement(545504..546337)
FT                   /locus_tag="Mjls_0493"
FT   CDS_pept        complement(545504..546337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96305"
FT                   /protein_id="ABN96305.1"
FT                   /translation="MSNPRGPGQGDEPTEPSAAGGPGDQTGPDDATRPSPTADHEPATE
FT                   VIASSSPGADQFEPSEGERRFTAPSGFDAGSTQKIDPPPDPATEVFPRSEGGLPGSGTD
FT                   PFAAQKAAGPQVIPPRGDAPRPPQQGRRSWGWVVAVVLVIAALVAIAILGTILLTRGSG
FT                   STASQEDQVRATIEQFDVAIQNGDLATLRGITCGAKRDSYVNYDDKAWAETHKRVAAAK
FT                   QYPVVASIDQIVVNGDHAEANVTAFMAYAPQTRSTRSFDLEFRDDQWKICQAPSP"
FT   gene            546397..546852
FT                   /locus_tag="Mjls_0494"
FT   CDS_pept        546397..546852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96306"
FT                   /protein_id="ABN96306.1"
FT                   /translation="MTARRDRHGTMLSMTRMGDLLGPDPVLLPGDPEAEAELEASENPA
FT                   IVAAAHPSASVAWAALAEEALADDKAVTAYAYARTGYHRGLDQLRRNGWKGFGPVPYRH
FT                   EPNRGFLRCVAALARAADTIGETDEYQRCLDLLDDCDPSARAEFGLS"
FT   gene            complement(546878..547774)
FT                   /locus_tag="Mjls_0495"
FT   CDS_pept        complement(546878..547774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0495"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   mmc:Mmcs_0506 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96307"
FT                   /protein_id="ABN96307.1"
FT                   /translation="MGAGHDHQHGTDTRVSRMLIAAAVLTAFFVLELVTALWIDSIALL
FT                   ADAGHMLTDLVAMFMGLTAVLLARRGSASPARTYGWHRAEVFTAVANAVLLLAMAVFIL
FT                   YEAVERLGDAPDVPGVPMIVVALAGLAANAVVVLLLRSHSKESLAVKGAYMEVVADTVG
FT                   SIGVLIAGIVTVTTSWPYADVVVAVFVALWVLPRAISLARAALRILSESSPAHIDVDEL
FT                   KTALCAVEGVTEVHDLHVWTLVPGKDVVTAHLTSARDSARVLDDARAVLAARGLDHATV
FT                   QVEPPGETDCNCESNDW"
FT   gene            complement(547831..548610)
FT                   /locus_tag="Mjls_0496"
FT   CDS_pept        complement(547831..548610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0496"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: mmc:Mmcs_0507 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96308"
FT                   /protein_id="ABN96308.1"
FT                   /translation="MSIRPLRQSVRPSPVFLAVVAITVAGGALAWMAADTVAPLAYAGV
FT                   FVLVIAGWLVSLSLHEFGHAYTAFRFGDRDVEIRGYLTLNPLKYSHPMLSLGLPVLFIA
FT                   LGGIGLPGGAVYLRTSWMTARQKTLVSLAGPSANLVLAVLLLGSTRLLYDPAHGVFWAG
FT                   LAFLGFLQVTAFVLNMLPVPGLDGYGALEPHLSPDTQRALVPVKQWGFFILLILLLAPA
FT                   LNQWFFGAVYWLAELSGVPSALMSIGGQLTRFWSAWL"
FT   sig_peptide     complement(548485..548610)
FT                   /locus_tag="Mjls_0496"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.409 at
FT                   residue 42"
FT   gene            complement(548642..549370)
FT                   /locus_tag="Mjls_0497"
FT   CDS_pept        complement(548642..549370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0497"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mmc:Mmcs_0508 GntR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96309"
FT                   /protein_id="ABN96309.1"
FT                   /translation="MPDDFLLRPLDAPPAYAAVVERVRRAVALGVLLPGDRLPSERALA
FT                   EGLGVSRVTVREALRVLQGERLLITKRGNGGTVVAPTVARLGDDPDGVDYGRRLDEVFE
FT                   LRLAVESMAARLAARRGRPEGLRWLDSCQEALRASSDVHTFRRADSEFHLAVARLSGNS
FT                   MLSQVIEDARAAAFSRLDRQDFAVIYESSIRGHAAVIEAIRNADPDGAAAAMAAHIEEA
FT                   RDEVAAVLSTRESPEVRSAG"
FT   gene            549426..550103
FT                   /locus_tag="Mjls_0498"
FT   CDS_pept        549426..550103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0498"
FT                   /product="gamma-glutamyl-gamma-aminobutyrate hydrolase"
FT                   /note="PFAM: glutamine amidotransferase class-I; peptidase
FT                   C26; KEGG: mmc:Mmcs_0509 peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96310"
FT                   /protein_id="ABN96310.1"
FT                   /translation="MNSEVTPLIGVCGLSVAARWGLWDQPAVLVAQTYLEAIHRAGGQP
FT                   LILPPSAHADTDLLLHTVDAIVLAGDGDIEAQRDDFELDIAAAALSEAVPVLGVCRGLQ
FT                   ALNVAAGGTVRRRFGHHHTAETTSHTVDVAVDSLLGEAGYAGVREVTSRHRQGLATVGD
FT                   GGKVTAASVPDGAIEAVEWPDHPFALGVHWHPEDPLMHELFRALISAATAPLFNTSTLP
FT                   VQP"
FT   gene            550144..551349
FT                   /locus_tag="Mjls_0499"
FT   CDS_pept        550144..551349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0499"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   mmc:Mmcs_0510 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96311"
FT                   /protein_id="ABN96311.1"
FT                   /translation="MTIDNISTIAPFGNHLPVRITFGEGSAHRLPDLLRDAGAQRVLVL
FT                   TDQGIEHHNPAVAAVLTTLSTSGLTVSRLDKAPGEPTIEMVDAATARMTSESVDAIVAL
FT                   GGGSVIDTAKAARLCHQQGLTFGEFLDSARTYPAPAVPLIAVPTTAGTGSEVSGGAVVS
FT                   DPQAGRKAGIAHPNMRAQYAVVDPVLTWSMPPVMTANTGIDALAQAMAAVIAKVRTPIG
FT                   DAIALEAVRLMGHSLPAAYRDGADAAARAGMACGSMMAGLAMNISDCAAEHSLGQAIGG
FT                   LTGAPHGLTIGLVLAETLERERHHVPDQMERIADAWGLPADGTADGSRLVGAVRRLLSD
FT                   LQFPVLSDLGLGAEHLDRLTDLALSDYFITMAPQPWDRAEVHQAFARALATRDRGLVTA
FT                   AG"
FT   gene            551357..553003
FT                   /locus_tag="Mjls_0500"
FT   CDS_pept        551357..553003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0500"
FT                   /product="cyclohexanone monooxygenase"
FT                   /note="KEGG: mmc:Mmcs_0511 cyclohexanone monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96312"
FT                   /protein_id="ABN96312.1"
FT                   /translation="MSAQQDSPDRFDVVIVGAGFAGLYMLHRVRALGLTARIVERGEDV
FT                   GGTWYWNRYPGARCDIESIDYAYSFDETLTREWRWTERYAAQPEILSYIGHVADRFDLR
FT                   DDITFGTTVRRADWDDDTAQWTLVCDTGQVLRATFCVMATGCLSVAKQPEFPGLSQFRG
FT                   RWYHTGRWPHDPVDFTGRRVAVIGTGSSGIQAIPRIAEAAEQLFVLQRTPNYSMPAQNR
FT                   PLAADEFDSAIADFATRRRICQRSDAGVPHPPPTQGTFDVTAEERERRYEEGWQRGGIN
FT                   ALSAAFTDFFTDEDANRMAQEFARNKIRSIVEDAQTAELLCPQHHIGTKRTCVDTGYFQ
FT                   TYNRDNVELVNSRAEPIDQITATGIRLVGGRHLDVDTLVFAIGFDAITGALTDIDIRGT
FT                   GGAALRDEWDDGPRTLLGLQTAGFPNLFMVTGPGSPSVLSNMLVSIEQHVDWIADCLLH
FT                   LRKLGHDRIEATRDAQDRWMEHIDELAAETLYPQANSWYLGANIPGKARTFMPYVAGCG
FT                   EYRRECDEIVASGYSGFLLGRPSPVREGTSA"
FT   gene            553000..554400
FT                   /locus_tag="Mjls_0501"
FT   CDS_pept        553000..554400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0501"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   mmc:Mmcs_0512 glutamate--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96313"
FT                   /protein_id="ABN96313.1"
FT                   /translation="MIDSRTAPTASEVLARLHAEDIATVILGGTDTHGVMRGKRVPISQ
FT                   LPRMLEHGMPMCDVFWVMHVDESDLVARPDGYRGYFPTERQGYPDILAVPDLTTLRIVP
FT                   WHNDTALLLCDWELPADHRPVPIAPRSVLRRVVERADAMGYRPLSALELEFYLLREKAG
FT                   TTHRKRADELVPLQEAPSTYGVVMGSLQEDIGALIRRHMLDYGLPVEACNPETGPGQFE
FT                   ITLRYGNSLKSADDAFLFKSAVKEVAAQNDLLATFMAKPVTDWAGNSCHVHLSLRDIAG
FT                   GGVFFDQDAPDQLSTALRHFAGGILHTMREFTALMAPTPNSYRRFVPYSWAGTTATWGV
FT                   DNRSVGLRVIREGDHGTRVEHRQPGGDANPYLATAAALAGGLHGLLNEIEPRELSTTDI
FT                   YSQPSEDLPVLPATLAEAVDLLADSAAAREWFGDDFVDHYVLMKRAEIAAQSVAVTDWE
FT                   VARYLEAM"
FT   gene            554426..555904
FT                   /locus_tag="Mjls_0502"
FT   CDS_pept        554426..555904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0502"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mmc:Mmcs_0513 amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96314"
FT                   /protein_id="ABN96314.1"
FT                   /translation="MADSSETRSYGDVGSAPHGELTPEQERGLRRGAINWRQVAVLSVA
FT                   GCGPASVIALNLQFMGQFAGAALVLAFVLVWPGILLLVNTFAEFSKRLPTSGGLYTWNS
FT                   KAWGPNVGFVYGWTFIGAYLVFSAAGFAVFGGWVQEWLQTQFGISVPWWLFTFAALAYV
FT                   CVLAYLGITQSLHAALGLLAFEIIVLLALAAWIFITGPQSGSGFGVAPFQVSSAGALAL
FT                   GGVGLAMTYGVLSHVGIEEGATLGQEVKDPKRQIPRGLWVAAVVVPVFYIVVAYAMVYG
FT                   YGIDDMTAFGEDPAPLQTIAQTYWGQVGLTVIVLATLSSILAFSQTAFLAGARVLYTLG
FT                   REGVLPTRLGAVSRRQTPAVGIAVMGVLSMLLGVPLAFLVGPFNVWGYFGFLISIAFLV
FT                   SYIFTNIGLVRYMLRIGEFHWFRHGVLGALGSLVFLYPLYKTVWPLQTGIYGALPFVYL
FT                   AWIVLGIGLLIYTLRRRPEVMSRIGTSLADDDVS"
FT   gene            complement(555897..556523)
FT                   /locus_tag="Mjls_0503"
FT   CDS_pept        complement(555897..556523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96315"
FT                   /protein_id="ABN96315.1"
FT                   /translation="MSARDRAAGGGDGMVVLRFGGHRAPRGLTGLDTVDVTGAPDVDAA
FT                   AAGARRLVVVGSDADLATVLTRLMRTERLGVELAAARGLFPARTALSGTARRVPLIRDD
FT                   AGIALVGSAQWRGTEGALFGEAVVDDTTLFSGEVAGVRIEPTAEMPGLRAAVLSGRGRP
FT                   QRWVAGRAAQLGTTGARVVRDGVEGTREVKRSTFYRHTEGWLRVS"
FT   gene            556595..557890
FT                   /locus_tag="Mjls_0504"
FT   CDS_pept        556595..557890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0504"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   mmc:Mmcs_0515 adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96316"
FT                   /db_xref="GOA:A3PTT9"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PTT9"
FT                   /protein_id="ABN96316.1"
FT                   /translation="MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVL
FT                   PTGENFALHLIPSGILTPGVTNVIGNGVVVDPGVLLTELRGLEERGVDTERLLISADAH
FT                   LLMPYHVAIDKVVERYAGSKKIGTTGRGIGPCYQDKIARQGIRVADVLDPTVLAEKIEG
FT                   ALELKNQVLVKIYNRKALEPAEVVENLLEQAEGFKHRIADARLLLNQALERDEIVLLEG
FT                   SQGTLLDVDHGTYPYVTSSNPTAGGASVGSGIGPTRITTVLGILKAYTTRVGSGPFPTE
FT                   LFDEHGAYLAKTGGEVGVTTGRARRCGWFDAVIARYATRVNGITDYFLTKLDVLSSLET
FT                   VPICVGYTIDGKRTDEMPMTQSDIARAEPVYEELPGWWEDISGAREFDDLPAKARDYVL
FT                   RLEELAGAHVSCIGVGPGRDQTIVRRDVLAPS"
FT   gene            557887..558534
FT                   /locus_tag="Mjls_0505"
FT   CDS_pept        557887..558534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0505"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mmc:Mmcs_0516 thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96317"
FT                   /protein_id="ABN96317.1"
FT                   /translation="MSSDYGLDPRRVDPEYDRHGGFPVFEAAEPGPGFERFLTAMRRAQ
FT                   DLAVSVNPDPDTWDEAADRVEELVKLLDPYRAGEGVGPANRVPTLPGAGSLLMPPWRVT
FT                   KFESDGVELEVAFSRYHVGGNSAVHGGVLPLMFDSMFGMVIHATGRPISRTAFLHVDYR
FT                   RVTPIDSVLTARGWLREAEGRKAFVNAELLDADGNVLAEANGLMIRLLPGQP"
FT   gene            558643..559287
FT                   /locus_tag="Mjls_0506"
FT   CDS_pept        558643..559287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96318"
FT                   /protein_id="ABN96318.1"
FT                   /translation="MSTPRAAALAGVVFALLFGAALILIRTSLPEGAEPGSQWIDGGSD
FT                   RLQVAAVLMPFAGIAFLWFIGVIRDGFGRYEDKFFATVFLGSGLLFLAMMFVAAGVGAG
FT                   LESMSGHPAESVSGVALLGQTVLLSISKTYALRMAAVFMMSLATIWLRTGLMPRPLVYV
FT                   TYLVAVALIVAAEVSMWLVLTFPAWVLVVSALIYSREVTPRPPAAPSPDTA"
FT   sig_peptide     558643..558744
FT                   /locus_tag="Mjls_0506"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.685 at
FT                   residue 34"
FT   gene            complement(559244..559438)
FT                   /locus_tag="Mjls_0507"
FT   CDS_pept        complement(559244..559438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0507"
FT                   /product="putative ferredoxin"
FT                   /note="KEGG: fra:Francci3_1600 putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96319"
FT                   /protein_id="ABN96319.1"
FT                   /translation="MRIEANRDVCISAGNCVMSAPEVFDQDDDGIVVLLADPVPEIEHE
FT                   HAREAVKLCPATALRVASE"
FT   gene            complement(559443..560663)
FT                   /locus_tag="Mjls_0508"
FT   CDS_pept        complement(559443..560663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0508"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmc:Mmcs_0518
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96320"
FT                   /protein_id="ABN96320.1"
FT                   /translation="MTGTTGASTAPPLPPLHMRRTGFDPTDELRDIRESAGVRLTQNAF
FT                   GMDVYLVTRHDDVKAVLADHTRFSNTRPPGFAGAGSPISDAEQARAQAGNLLANDPPEH
FT                   QRLRRMLTPEFTLRRINRLEPRIVAIVDEHLDAMQQSGPPADLVAGFALPIPSLVICEL
FT                   LGVPYADREDFQRRSARQLDLSLPIPERLDLARQAREYMHTLVGRARRTPGDDILGMLV
FT                   REHGDELTDDELVGIAGLLLLAGHETTSNMLGLGVLALLRHPEQLAAVRDDPDAVGPAV
FT                   EELLRWLSIVHSGIPRITTTDVEVAGVLIPKGQLVFVSLPSANRDPSFLDAPETFDIRR
FT                   GAPGHLAFGHGVHHCLGAPLARMEMRIAFPALLRRFPTLTLAEPFEDVEFRSFHFIYGL
FT                   RSLLVGW"
FT   gene            complement(560700..562724)
FT                   /locus_tag="Mjls_0509"
FT   CDS_pept        complement(560700..562724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0509"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: mmc:Mmcs_0519 MmpL"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96321"
FT                   /protein_id="ABN96321.1"
FT                   /translation="MAGRFSWVVALLVVLVSGGLMGVLSGGESSSQSPVSVPTDAESAK
FT                   VNALRSDFPGGDQAPAILVVTRTDGAALSPADIAATEAARGRMLDAAQSAPAGPPVIVS
FT                   EDDEAAIATVPLATDLSGFGLNDAVKGLREAAADGLPGDLRAEVTGGPAFGADIANSFS
FT                   GANVTLLAVTAAVVALLLIVTYRSPVLFLVPLLVIGFADRVAAVVGTAIAEAVGMSPDG
FT                   STSGITSVLVFGAGTNYALLLISRYREELGRNGDHKQALAVAVRAAGPAILASNATVVL
FT                   ALLTLVFASAPSTRALGVQAAAGLVVAAVFVLLVLPALLRLFGKKLFWPLIPKEGAAPL
FT                   TDSGLWHRIAAGVSRRPAVVAVASIGALAVLCTGLLFTPIGLTQTEQFRVQAESVTGYE
FT                   TLADHFPSGLTDPTRVIGPSDKTAELQRAISETPGVVSADPAGTSPTGLTQWSVVLSAE
FT                   PASDEAFSTVDALRENVRGVDSSALVGGSDAQARDISSAASRDRMVVIPTILAVVLVVL
FT                   YVLLRSALAPLILVAVTVLSALAALGLGGWASVHLFGFPALDDTTPLFAFLFLVALGVD
FT                   YTIFLVTRAREETPDHGTRQGIVRAVSATGAVITSAGIVLAAVFCVLGVLPLIVLTQLG
FT                   IIVGLGILLDTFLVRTVIIPALFTLIGPKIWWPALRASP"
FT   sig_peptide     complement(562629..562724)
FT                   /locus_tag="Mjls_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.471 at
FT                   residue 32"
FT   gene            562783..563256
FT                   /locus_tag="Mjls_0510"
FT   CDS_pept        562783..563256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0510"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mmc:Mmcs_0520
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96322"
FT                   /protein_id="ABN96322.1"
FT                   /translation="MADADRAALEALIAADVRALSAESEHIGRVFAARHSLSANDFRAL
FT                   LHIMVAETAGRPLTAGDLRRQMGMSGAAITYLVERMITSGHLRRDSDPADRRKVILRVA
FT                   EHGMGVAGQFFAPLAEHTTRAMADMPDDDIAVAHRTLTALIDAMAAFRRDLGD"
FT   gene            complement(563268..564869)
FT                   /locus_tag="Mjls_0511"
FT   CDS_pept        complement(563268..564869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0511"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: mmc:Mmcs_0521 Na+/H+ antiporter; TC
FT                   2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96323"
FT                   /protein_id="ABN96323.1"
FT                   /translation="MSASLLAVLVVAVLLAAVARRADVSAPLALVVAGLAVGLIPGVPD
FT                   IQLDPDLVLYVVLPPLLWSAGLESSYVALRRNVRSIGMLAVGLPLATTFAVGVVAYWAV
FT                   PELTIAAALTLGAIVAPPDAVSATAVGRRLGLPRRLMTLLGGESLLNDATALTAYKVAL
FT                   GLAIGGSASWTGGLWTFALAAVGGVVVGGALGAVIVYVRSRLRDPLVESALGLVAPFGI
FT                   YLLAEEVHGSGVLAVVVAALILGQHSTNASYATRLQDSAVWKAVQLLLESFAFLLIGLQ
FT                   LPKVIEELAGISAAVLVVSSLAVLATVIAVRIVWVYLFAYLPRLVSPALRYREPSPRPA
FT                   QVFVVAWAGMRGVVSLAAAFAVPATTLSGAEFPGRPQLVFLTFVVVVGTLLLHGLTLPW
FT                   LIRRLGVQGDEAHTDAVAAAAAQDRAARAAAERLDEVLEQQRTDGTVDDVHERAADVLR
FT                   GWNTRRRNSAWEQLGRDEADIGESPAAAFRRLRLEMLAAERATLIAERDSGHIDDKVLR
FT                   SVLHGLDLEEATLNRR"
FT   sig_peptide     complement(564801..564869)
FT                   /locus_tag="Mjls_0511"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.725 at
FT                   residue 23"
FT   gene            564935..565264
FT                   /locus_tag="Mjls_0512"
FT   CDS_pept        564935..565264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0512"
FT                   /product="zinc finger, UBP-type protein"
FT                   /note="SMART: zinc finger, UBP-type protein; KEGG:
FT                   mmc:Mmcs_0522 zinc finger, UBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96324"
FT                   /protein_id="ABN96324.1"
FT                   /translation="MRSRARRATGRTQDTAAPRTCEHLASTSPEAVNAHPRPNTPGRCE
FT                   DCAELGEATWAHLRMCLTCGHVGCCDSSPHQHATEHFHQTGHPVMRSAEPGESWRWCYI
FT                   DLRVG"
FT   gene            565287..566573
FT                   /locus_tag="Mjls_0513"
FT   CDS_pept        565287..566573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0513"
FT                   /product="formate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number="6.3.4.-"
FT                   /note="PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein, ATP-grasp; KEGG: mmc:Mmcs_0523 ATP-dependent
FT                   carboxylate-amine ligase-like, ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96325"
FT                   /protein_id="ABN96325.1"
FT                   /translation="MTEPTDADTPVTDPEVAVPQVAPAAPDAPAEPAAPRNTVLLLGAG
FT                   ELSRELALAFQRLGAFVVAVDRYADAPAHGVADRSAVVRLTDTEAVTALIEREKPRYVV
FT                   AQSGAIAADALIAVAERGGVDVFPTPRSTRLGQDREGLRRLASDELGLPTAPFWFAGSA
FT                   EELGTVAQHAGFPLVVKPISGAPGEGQSVLLRAEDVEPAWQRAVAAGRITHNRVMAETV
FT                   VEVDYEVTLLTVRSTGATGPTLTFCEPIGHRPGDGDALESWQPQQMTPAALDAAKSIAA
FT                   RMVNSLGGRGVFAVELLVRGDEVYFSDVRTRLQDTGLVTVRSQRLSQFELHARAILGLA
FT                   VDTIMISPGAAEVRYAGTETSVSEPSGADIAAVVADALATQESDVRLFGRPDETDGRRR
FT                   LGVALATAPDVIIARDRARRVGAALRRLW"
FT   gene            566577..567035
FT                   /locus_tag="Mjls_0514"
FT   CDS_pept        566577..567035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96326"
FT                   /protein_id="ABN96326.1"
FT                   /translation="MSAESDPDTGRPSDRPTAAPFMIALVIIVLVVIGIWLVNLFEGDE
FT                   PTPEQLIGRVAAAQNDALQREDYQAFQAYTCRAEHATESEVLERQRNSSAEQGARFIDG
FT                   VSDVVVDGDRATATVTYHFDRSEDDKFGVPTTFVQEDGAWKVCSTGSG"
FT   gene            567055..567468
FT                   /locus_tag="Mjls_0515"
FT   CDS_pept        567055..567468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0515"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: mmc:Mmcs_0525
FT                   rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96327"
FT                   /protein_id="ABN96327.1"
FT                   /translation="MSYAGDITPEQAWQLLDDDPNAVLVDVRTDAEWRFVGVPDLSPLS
FT                   RDAVFIEWNRTDGTRNEGFVDDLKAAGITPGERPVVFLCRSGNRSIGAAEAATEAGIGP
FT                   SYNILDGFEGDLDEQKHRGRTGWKAVGLPWKQS"
FT   gene            567465..568703
FT                   /locus_tag="Mjls_0516"
FT   CDS_pept        567465..568703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0516"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: mmc:Mmcs_0526 O-succinylhomoserine
FT                   sulfhydrylase; TIGRFAM: O-succinylhomoserine sulfhydrylase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96328"
FT                   /protein_id="ABN96328.1"
FT                   /translation="MSSEVPSRTQGADKPSVRRPAELPEGVGQATIGVRGGLLRSGFEE
FT                   TAEALYLTSGYVYASAAEAEKAFTGEIDRYVYSRYGNPTISMFEERLRLIEGAPACFAT
FT                   ATGMAAVFTSLGALLGAGDRLVAARSLFGSCFVVCSEILPRWGVETVFVDGDDLSQWEE
FT                   ALSVPTQAVFFETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFATPLLQQGLPLGVDV
FT                   VVYSGTKHIDGQGRVLGGAILGSQEYIDGPVQKLMRHTGPAISAFNAWTLLKGLETLAV
FT                   RVDYSNRSAERIAEFLEGHSSVSWVKYPFLESHPQYDLAKRQMRGGGTVVTFELAGGKE
FT                   RAFEVLDKLQIIDISNNLGDAKSLITHPATTTHRAMGPEGRAAIGLGDGVVRVSVGLED
FT                   TDDLIRDLDRALG"
FT   gene            568704..569114
FT                   /locus_tag="Mjls_0517"
FT   CDS_pept        568704..569114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96329"
FT                   /protein_id="ABN96329.1"
FT                   /translation="MSRRSEAKKARRRKRQAAQNVAWVPEAVVEQLSTIEDAIVADLAA
FT                   FDERIAERGWTFDEQESDDDYAIWFYEPSGAEVSDGLPVTSLWLDAAEDGEVVRVVLVG
FT                   TTEQHGFTHDELDQHLDAIESYRNGAPVPDFD"
FT   gene            complement(569202..570065)
FT                   /locus_tag="Mjls_0518"
FT   CDS_pept        complement(569202..570065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0518"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0528 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96330"
FT                   /protein_id="ABN96330.1"
FT                   /translation="MDNIRGKTIAITGAARGIGYATAKALLARGARVVIGDRDVALQES
FT                   AVAQLTKLGPVSGYPLDVTDRESFATFLDKARTDGGGHIDVLINNAGVMPIGPFLEQSE
FT                   QAIRSSIEVNLYGVIAGCQLALPDMVARGRGHIINIASLSGVIPVPGQVVYVGAKFGVV
FT                   GLSAALADEVAPHGVHVSVVMPPFTRTELISGTKESGAIKPVEPEDIAAAIVKTLDKPK
FT                   THVSVPPALRFTAQAAQLLGPRGRRWLNKKLGLDNVFLDFDTAKRKSYEDRAQTALGVV
FT                   ESGDRT"
FT   gene            570124..570618
FT                   /locus_tag="Mjls_0519"
FT   CDS_pept        570124..570618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0519"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmc:Mmcs_0529 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96331"
FT                   /protein_id="ABN96331.1"
FT                   /translation="MIDDLRFVAVDQTDPLAEPLLGELAVEYADRYEGRAEAVLAWLRR
FT                   YPAAEFTPPDGAMLIGLLGDTPVTGGAFRRFGVVDGVPTAELKRIWTDSAHRRRGFGRA
FT                   LLAVLEQEIAARGYRRIYLTTGDRQPEAEALYLATGYQRLAEPLPAEGEVYPVAFAKLL
FT                   Q"
FT   gene            570639..570947
FT                   /locus_tag="Mjls_0520"
FT   CDS_pept        570639..570947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96332"
FT                   /protein_id="ABN96332.1"
FT                   /translation="MPLAAGVSQAAVGWLILLAAAAIAAGGVMLRAFIGRRADRHLLGR
FT                   LTRRMRGTALARVLFGPVQHDALDPDELDQMILMPTIVVACGLCLTAVFLLGYRILT"
FT   sig_peptide     570639..570713
FT                   /locus_tag="Mjls_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.950) with cleavage site probability 0.742 at
FT                   residue 25"
FT   gene            complement(570944..571672)
FT                   /locus_tag="Mjls_0521"
FT   CDS_pept        complement(570944..571672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0521"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mmc:Mmcs_0531 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96333"
FT                   /protein_id="ABN96333.1"
FT                   /translation="MAAALTAVTDRVHLARTDLVNWTLVTDGDGVLLIDAGYPGHRDDV
FT                   VDSVRRLGFGIDDIRAILLTHAHIDHFGSAIWFAETHGVPVYTHADEVGHARRDYLEQV
FT                   SPLAVARHAWRPRWLKWSLTISGKGGTHRGGIPTAQALTDEIAATLPGTPAAVPTPGHT
FT                   GGHCSYVVDGVLVSGDALVTGHPLLSDTRPQLLPDLFNHDQARCVASLAALAALDTEVL
FT                   LPGHGPLWRGPIREAAQAAR"
FT   gene            571736..572746
FT                   /locus_tag="Mjls_0522"
FT   CDS_pept        571736..572746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0522"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mmc:Mmcs_0532
FT                   luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96334"
FT                   /protein_id="ABN96334.1"
FT                   /translation="MAELKLGYKASAEQFAPRELVELAVAAEEHGMDSATVSDHFQPWR
FT                   HEGGHAPFSLAWMTAVGERTKRLQLGTSVLTPTFRYNPAVIAQAFATMACLYPDRIFLG
FT                   VGTGEALNEIATGYEGDWPDFKERFARLRESVRLMRELWLGDRVDFDGEYYRTKGASIY
FT                   DVPEGGVPVYIAAGGPVVAKYAGRAGDGFICTSGKGEELYKDKLLPAVAEGADAAGKNV
FT                   DDVDKMIEIKISYDTDPELALENTRFWAPLSLTAEQKHSIDDPIEMEKAADELPIEQVA
FT                   KRWIVASDPDEAVEKVKDYVGWGLNHLVFHAPGHDQRRFLELFKRDLEPRLRKLG"
FT   gene            complement(572750..574402)
FT                   /locus_tag="Mjls_0523"
FT   CDS_pept        complement(572750..574402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96335"
FT                   /protein_id="ABN96335.1"
FT                   /translation="MTAGAPRRIWGVALFAALSALYFTVGAVLVLRFNMFDPDSPSRVA
FT                   NAGYVLMSRQPHLSAIGFVWNPLPSLVEIPVLTLADWWPALKTHGLAGVVQSALFMAGA
FT                   AVMVRRIALDRGVGTVWRWLAVGCFALHPMFVTYGASGMSEAAETFALVWCVRHLMQWA
FT                   HSHRVGDLAWAGIALGVGYLSRYEAVPAACGAALLVAVVAFHRAQRGQRVNSVILNVLI
FT                   VMFPLISAFAIWALTGWVVSGELFATLSSQYGNDSQVAAAMDRASPLAGAASDDWVVIA
FT                   ARLLGMQPFVLIATAGAVAFAVLRRNATALVPVATLGPVLAFAAWGQFTSTTFGWFRFY
FT                   LLAIPLVICVALAFWQPGARRAVTVARSDVRAGRVGAGLLCASLVIGIPVTVTAMSDER
FT                   IGNQQLQFGLKSLTDPQRYPPTEQWYRRLMVNDRALAAYFDRKRLPEGAVLMDTFNTWG
FT                   VWLGSQRPKQFVITSDYDFTATLNRPWDFGVQYLVASNPGISNADALNIRYPTLWQDGA
FT                   GLGTLVHSVYGATGDERFRVYRVTGRPAPPTAG"
FT   gene            complement(574399..576321)
FT                   /locus_tag="Mjls_0524"
FT   CDS_pept        complement(574399..576321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96336"
FT                   /protein_id="ABN96336.1"
FT                   /translation="MKVLTRAVTAVAVAGLALGVSGPPVALADPANTVVAGLGAAGQIR
FT                   WESLGVSERLDLIGENQPVDVSIPVPAGVRPGRLTGQVGSVVNVADGRIEVMDGRDSIL
FT                   GSFPVPREAESKPFSVNVSGAEIVDGTATLRFVLRDRGPVADSCSQPPSLSLTQLGNSF
FT                   TGPTPNPRTVSDFLPGYLDEIVIRVGPSPTPAEQQAALTLVAELTRLYRPMPVRIDLDT
FT                   SGAPSAKGAPGRRVIEISEGGKAAMAVKNPGTQAAVLAIGGTGEELTRQVDLFADRRFT
FT                   LAQTDSAATLYATPNRTESTDIKTFAQLGMTGEASVLGTTTLYAGFDVARFAVGPITGA
FT                   RVHLKARYTPVVGGEASILVRSGSTVLATRRLDESGVLDLTGDIPAESVTSNVGMALEL
FT                   RYVPDQECAPMNDRMTFALDPQSTVTVIPGVHNRGGFPVLPMAFTPDFDVAVDSPGHLR
FT                   YAAQAINLMGQQSSETLRPRITTFDAAVGSGTGLLAVGGGTELADAAMPAPVLPGAPNT
FT                   FGIGGSPETDVDLSGPLGVVQVFTHNARTVLSITGTGDWALVDDTFNHIRGLPNRWASL
FT                   TGDVVATGAAHQTVNLTVREGGALVNEYPGDPWKWWAVLSSAVGVAVAIAAVVIVLMRR
FT                   RRRAR"
FT   sig_peptide     complement(576235..576321)
FT                   /locus_tag="Mjls_0524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(576347..577741)
FT                   /locus_tag="Mjls_0525"
FT   CDS_pept        complement(576347..577741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96337"
FT                   /protein_id="ABN96337.1"
FT                   /translation="MHDPAGTLLPAHMSARGLLGPRALAVVTAVLAALAAVVWAWPSVL
FT                   APVITGVVAFTYLVSTVDRNYLLFKGLRMSSLVTVSAEEARAVPDDDLPVYTVLLPVYD
FT                   EPTIVTNLINGVGRLDYPPDKLEILLLIEEDDIATQEALLGADLQSARIVIVPHSLPKT
FT                   KPKACNYGMSLPDLRGEYLTIYDAEDIPDPLQLRRAVAAFRRLPVEIGCLQARLGYFNE
FT                   RQNLLTRFFSLEYDQWFGVVLPAVENAGCVVPLGGTSNHMSVRVWRQIGGWDEFNVTED
FT                   ADLGVRLARHGYRTLILDSVTLEEANSDVVNWIRQRSRWYKGYLQTMLVHLRAPVRLRR
FT                   ELGTKGFLRLINMTGGVPMTSALNVIFWFTLFVWVLGRPDAIGPLFPPVTYYVCLLLLL
FT                   ICAPLSVFAGLIVTAALGKPQLWWAALLAPLYWMLQSVAAVKAIYQLFARPSFWEKTVH
FT                   GLSPSA"
FT   sig_peptide     complement(577619..577741)
FT                   /locus_tag="Mjls_0525"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.815) with cleavage site probability 0.755 at
FT                   residue 41"
FT   gene            complement(577734..579221)
FT                   /locus_tag="Mjls_0526"
FT   CDS_pept        complement(577734..579221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96338"
FT                   /protein_id="ABN96338.1"
FT                   /translation="MPSEHGVTEVAGAKPLGPLLGISDESLETQPHQGWIARRLAVAVV
FT                   VTAVAYGAGYAAAVAESAAGSRTPHLVALPVLIVLIATGYRTPPRGVGDTESNWIIALM
FT                   VAVPALAGIELLGNRLPTLAALWHLRDFGAIVWFAALLAVLFGVRHVVRMWPLWIFAAS
FT                   FVSPLPWILVTAAAGGSDAAAAAPAAVAGAAAVFLACPEVPRFRRMLAASACLVVATAF
FT                   IVTAGPHLPLPATALFVGAALPVAVTLLYRHRAARSGPTAWAAPHRISARSVTALAAMA
FT                   GVLAVSNPATARPAPLPTAAADWINAAGLTSSSSYGFISRYAGPAATFVRYRPSAPSGS
FT                   SAPAVDVITAPDRAALAAIDDLTWYPTSQPVNYRPAPTGSGLPAGARIAHTNADAARDG
FT                   RNTDWVAIAWEWQAGNVFQRVTIVADQSPTGGRRLPEPSPVSVLDVSLRPALWVARQQP
FT                   DAAGDVDDIVLRDAVALGAELNAAATGHPADGLTTDA"
FT   gene            579416..581530
FT                   /locus_tag="Mjls_0527"
FT   CDS_pept        579416..581530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0527"
FT                   /product="phosphotransacetylase"
FT                   /EC_number="2.3.1.8"
FT                   /note="KEGG: mmc:Mmcs_0537 phosphate acetyltransferase;
FT                   TIGRFAM: phosphate acetyltransferase; PFAM: phosphate
FT                   acetyl/butaryl transferase; DRTGG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96339"
FT                   /protein_id="ABN96339.1"
FT                   /translation="MSLMRQAVRVPDQTDSRVSAIYVASPEGDTGKSTIALGLLDRLTA
FT                   TAPRVGVFRPITRSGPARDYILELLLAHSTAGLTYEDSVGVTYHQLHEDPDSALADIVD
FT                   RFHRVADRCDVVLIVGSDYTDVASPSELSMNARIAANLGAPVVLAVKARGRTPDDVVQV
FT                   VEVCLDEIAAQHAYTAAVVANRCDPDQLTEVREALKRDGAPQVYVLPEEPLLVAPSVAE
FT                   LRDAVDGSMVSGDESLLDREALDVLVAGMTAEHVLERLTEGVTVVTPGDRSDVVLAVVS
FT                   AHAAEGFPSLSSIILNGGLELHPSIAKLVAGLGLRLPIVATGYGTFETASRVAGTRGRV
FT                   TAASVRKIDTALTLMETHVDTAELLSRLAIPIPTVVTPQMFTYQLLDQARSDRKRIVLP
FT                   EGDDDRILKAAGRLLQRGVADLTILGEEGPVRARAAELGVDLAAATVLDPRTSELCDQF
FT                   AEQYAELRRHKGVTVEQAREIIHDVSYFGTMLVHNDMVDGMVSGAAHTTAHTVRPAFEI
FT                   IKTLPDVSTVSSIFLMCLADRVLAYGDCAIVPDPTAEQLADIAISSARTAAQFGIEPRV
FT                   AMLSYSTGTSGTGADVEKVREATDLVHKREPDLLVEGPIQYDAAVEPSVAKTKMPDSPV
FT                   AGRATVLIFPDLNTGNNTYKAVQRSAGAIAIGPVLQGLNKPVNDLSRGALVEDIVNTVA
FT                   ITAIQAQGDR"
FT   gene            581527..582726
FT                   /locus_tag="Mjls_0528"
FT   CDS_pept        581527..582726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0528"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: mmc:Mmcs_0538 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96340"
FT                   /db_xref="GOA:A3PTW3"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PTW3"
FT                   /protein_id="ABN96340.1"
FT                   /translation="MTRTVLVLNSGSSSLKFQLLEPDSGASLADGIVERIGEDSSSASL
FT                   VCGEREVTHSERVPDHEAALRTAYGLFDEAGAELGSVGLVAVGHRVVHGGPDLYQPTLI
FT                   DDALVDTLESLAPLAPLHNPPAVLGIRGARKAFPDLPHVAVFDTAYFHDLPAAAATYAI
FT                   DRDLSEQWHIRRYGFHGTSHQYVSEQAALFLDVPLSSLSQIVLHLGNGASASAILGGRP
FT                   IDTSMGLTPMEGLVMGTRSGDVDPGVLVYLWRTAGMSVDEIETMLNKRSGVRGLGGEID
FT                   FRVLHQRIESGDESDRENAQLAYDVYIHRLRKYIGAYLALLGSTDVIVFTAGVGENDAA
FT                   VRRDALSGMGRLGIELDEHLNESPSHTARRISAETSPTTVLVIPTNEELAIARACVEVI
FT                   "
FT   gene            582833..583507
FT                   /locus_tag="Mjls_0529"
FT   CDS_pept        582833..583507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0529"
FT                   /product="asparagine synthase (glutamine-hydrolyzing),
FT                   putative"
FT                   /note="KEGG: mmc:Mmcs_0539 asparagine synthase
FT                   (glutamine-hydrolyzing), putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96341"
FT                   /protein_id="ABN96341.1"
FT                   /translation="MQVLQAVAANPLQRRIRRDKLTYLGYQKLRSLSRAAEAVREVPGC
FT                   VIECGLALGGSGIMLATELPDRPFHGYDVFAMIPPPGPNDPAKAHDRYEVIASGRSEGL
FT                   GGETYYGYVDDLFDRVSDSFARYGVPTGDRIHLHKGLFEDTLDPQWPVALAHIDCDWYD
FT                   PVKLCLKRLTPWLSPGARVILDDYSDYGGAKKATDEHVAAHSGFSVERDAGHRVLVYKP
FT                   GA"
FT   gene            complement(583504..585783)
FT                   /locus_tag="Mjls_0530"
FT   CDS_pept        complement(583504..585783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0530"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   mmc:Mmcs_0540 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96342"
FT                   /protein_id="ABN96342.1"
FT                   /translation="MAASDHDLDPAVDDEPGTQPASLDDLDLDSASTVRPMATQAVFRP
FT                   DFDDSDSISVHTGDTEAQDHATTAIRTLSPVRRLGGGLVEIPRVPAKDPLEALMTNPVV
FT                   AENKRFCWNCGRPVGRSTSDGKALSEGWCPHCGSQYSFLPQLNPGDMVADQYEIKGCIA
FT                   HGGLGWVYLAFDHNVNERPVVLKGLVHSGDAEAQAIAMAERQFLAEVTHPGIVKIYNFV
FT                   EHEDKHGNPVGYIVMEYVGGTSLKQARGQRLPVAQAIGYMLEILPALGYLHSLGLTYND
FT                   LKPENIMLTEDQVKLIDLGAVSTINSFGYLYGTPGYQAPEIVRTGPTVQSDIYTVGRTL
FT                   AALTLELRTRKGRYVEGLPEDDPVLAQYDSFGRLLRRAIDPDPRRRFASSEEMSSQLLG
FT                   VLREVVARDTGVPRSGLSTVFSPTRSTFGIDLLVAHTDVYVDGQVHSEKLTAQEIVRAL
FT                   PVPLVDPTDVGAAVLSASVLSEPVQTLDQLRAARHGSLDSEGIDLSESVELPLMEARAL
FT                   LDLGDVAKATRKLDDLATRVGWRWRLVWFRAVAELLSADYESATKHFTEVLDTVPGELA
FT                   PKLALAATAELAGSDLDHAPSRKFYETVWGTDHGIISAGFGLARALSAEGDRNGAVRTL
FT                   DEVPATSRHFTTARLTSAVTLLSGRSSNEITEQQIRDAARRVEALPDTEPRVLQIRALV
FT                   LGTAMDWLVDNSANTNHILGFPFTEYGLQLGVEASLRALARVAPTQAHRYALIDLANSV
FT                   RPMSTF"
FT   gene            complement(585783..586778)
FT                   /locus_tag="Mjls_0531"
FT   CDS_pept        complement(585783..586778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0531"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: mmc:Mmcs_0541 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96343"
FT                   /protein_id="ABN96343.1"
FT                   /translation="MSARAKNRQSVMKRLLALLSATVLVLAGCGQAASVVPTPGVTLAP
FT                   PTPAGMEELPPEQARLPIPETDDCNRRASLRPFPTRAEADAAVAYIRERGRLIVGLDIG
FT                   SNLFSFRDPITGDITGFDVDIAGEIARDIFGSPAQVDYRILSSADRIVALQNNQVDVVV
FT                   KTMTITCERKKKVGFSTVYLNADQRILAPRDSAITRAADLSGRRVCVVKGTTSLRRVQQ
FT                   ISPPPIIVSTVTWADCLVALQQRQVDAVSTDDAILAGLVAQDPYLHIVGPSMNQEPYGI
FT                   GVNLENTGLVRFVNGTLQRIRNDGTWYALYRKWLTVLGPAPAPPVARYVD"
FT   sig_peptide     complement(586644..586778)
FT                   /locus_tag="Mjls_0531"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.484 at
FT                   residue 45"
FT   gene            complement(586778..588097)
FT                   /locus_tag="Mjls_0532"
FT   CDS_pept        complement(586778..588097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0532"
FT                   /product="putative conserved membrane protein"
FT                   /note="KEGG: mmc:Mmcs_0542 putative conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96344"
FT                   /protein_id="ABN96344.1"
FT                   /translation="MTVELAHPSTEPLASRSPTTPAHPRWFFLWTTPGRILTIGIVLAA
FT                   LAISSAFATSTTINDRQRALTTVLNHTEPLSFAAGELYSRLSVADAAAATAFIAGTEPR
FT                   DVRQRYEQAITDAAVALTRASSGLTDEELVQLLGRINAELAVYTGLVETARTNNRAGNP
FT                   VGSSYLSEASSLMQTKILPDAERLYERTSAQVDQETGASTRIPAPVILVVLATLLFGLF
FT                   ANRWLARRTRRRVNIGFVAGGLAVLIMVLWVGTALTISTTDSRSARGAGAESLKTITTL
FT                   AITAQQARADETLALIRRGDEEVRKQSYYQRIDGMQKKLADYLAREDAIDSTDLVAAED
FT                   LLARWRAADDRINAYIAVGNYQAATQVALGTGEDDSTPAFDKLNDALTKAIEQSRSQLR
FT                   NDILNARRVLSGATAGAAALSVIAAVAVALGLWPRLSEYR"
FT   gene            588206..588730
FT                   /locus_tag="Mjls_0533"
FT   CDS_pept        588206..588730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0533"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mmc:Mmcs_0543 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96345"
FT                   /protein_id="ABN96345.1"
FT                   /translation="MGAPYPVRVRGDGDGWVFTEGGGRYWGRHGAAGLLLRAPQSDGSA
FT                   AVLLQHRAPWSHQGGTWGLPGGARDSHETPEQAAVREAHEEAGLSVEQLTVRTTVVTAE
FT                   VVGSGGASWTYTTVIADAPALLHTVPNRESAELRWVAEEDVDSLPLHPGFAASWDRLRT
FT                   VTAAFPLLVSD"
FT   gene            complement(588720..589400)
FT                   /locus_tag="Mjls_0534"
FT   CDS_pept        complement(588720..589400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0534"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: mmc:Mmcs_0544 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96346"
FT                   /db_xref="GOA:A3PTW9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PTW9"
FT                   /protein_id="ABN96346.1"
FT                   /translation="MREPLDPLGPALAQASLYLCTDARRERGDLAEFADAALAGGVDLI
FT                   QLRDKGSAGERRFGPLEAREELAALEILAEAARRRGALLAVNDRADIALAAGADVLHLG
FT                   QDDLPLPVARRIIGPRPLIGRSTHDSAQVSAAVAEEVDYFCVGPCWPTPTKPGREAPGL
FT                   GLVREVASRATEKPWFAIGGIDEARLPEVLDAGARRIVVVRAITAADDPKAAARRLKDA
FT                   LVSR"
FT   misc_binding    589436..589552
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 66.40"
FT   gene            589540..590556
FT                   /locus_tag="Mjls_0535"
FT   CDS_pept        589540..590556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0535"
FT                   /product="glycine oxidase"
FT                   /EC_number="1.4.3.19"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: mmc:Mmcs_0545 glycine oxidase ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96347"
FT                   /protein_id="ABN96347.1"
FT                   /translation="MPPDSTLAVIGGGVIGLSVARRAALDGWSVRVHRSPAKGASWVAG
FT                   GMLAPHSEGWPGEHELLRIGLDSLRLWHGGFLEGLPDEVVTARESLVVAVDRADAADLK
FT                   TVGEWLAVQGHPVTFTTAARDIEPLLAQGIRHGFVADTELAVDNRAVVDALEAHCTRLG
FT                   VRWAPPVDDLAAVDDVDLRVLANGVDAPTLWPGLPIRPVKGEVLRLRWRRGCMPAPRRV
FT                   VRARVHGRQVYLVPRADGVVVGATQYEHGRDTAPAVTGVRDLLDDACTVMPALGEYEFA
FT                   ECAAGLRPMTPDGLPLVEWLDERTLVAAGHGRNGFLLAPWTAERVSAELQTTQGART"
FT   gene            590567..590764
FT                   /locus_tag="Mjls_0536"
FT   CDS_pept        590567..590764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0536"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: mmc:Mmcs_0546 thiamine
FT                   biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96348"
FT                   /protein_id="ABN96348.1"
FT                   /translation="MKIVVNNEDVHLDEQTTVAQLVARMGFPEKGIAVAVDWSVLPRTE
FT                   WETPLRDGARVEVVTAVQGG"
FT   gene            590757..591518
FT                   /locus_tag="Mjls_0537"
FT   CDS_pept        590757..591518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0537"
FT                   /product="thiazole-phosphate synthase"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   mmc:Mmcs_0547 thiazole biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96349"
FT                   /protein_id="ABN96349.1"
FT                   /translation="MAEAAKLTIAGREFGSRLILGTGGAANLAVLEQALMASGTELTTV
FT                   AMRRVDAETGTGVLELLNRLGISPLPNTAGCRGAAEAVLTAQLGREALGTDWVKLEVIA
FT                   DERTLLPDAVELVRAAEQLVDDGFTVLPYTNDDPVLARRLEDIGCAAVMPLGSPIGTGL
FT                   GIANPHHIEMIVDAANVPVILDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAA
FT                   AMAAAVTAGHLARHAGRIPKRFWAQASSPAL"
FT   gene            591527..592276
FT                   /locus_tag="Mjls_0538"
FT   CDS_pept        591527..592276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96350"
FT                   /protein_id="ABN96350.1"
FT                   /translation="MALGSSMAAGPGIRPPADGAPFRAGRSARNYAHLVAERLGLDLTD
FT                   VTYSGATTANILDEPQHGTPPQFLALDGTETLVTVTIGGNDVGYVPMLMAAGLPRVVRW
FT                   LPPVSTLFDPTARDRALVEVGESLHRVARTVRARAPRARVLFVDYLTLLPPPGEPVAPL
FT                   SDADAALGRRIADTLERLTGRAAADTGCGWIRAAQASRAHHAWSSEPWTTGPGLPWPGR
FT                   PAPLHPNAAGMRAVADLIVDAVESRDD"
FT   gene            592269..593171
FT                   /locus_tag="Mjls_0539"
FT   CDS_pept        592269..593171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0539"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmc:Mmcs_0549 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96351"
FT                   /protein_id="ABN96351.1"
FT                   /translation="MIELTGLTKRFGRVRAVDDLTCTVEPGVVTGFLGPNGAGKSTTMR
FT                   MILGLDRPSAGTATVMGRPYREHRHPLRTVGALLDARQVHPNRTARSHLRWIAASNRLP
FT                   DKRVDEVLGMVGLADVAGKPAGAFSLGMSQRLGIAAALLGDPQVLLFDEPVNGLDPEGI
FT                   RWIRTLMRDLAGEGRTVFVSSHLLAEMAQTADRLLVIGRGRLIAATTVGDFVNRAGLDT
FT                   VRVRTPDRDRLCDALTAAGLSTTVEDSAVLVHGASTEQVGELAARTGATLHELSIQRAS
FT                   LEEAYMALTDEAVDFRARR"
FT   gene            593171..593911
FT                   /locus_tag="Mjls_0540"
FT   CDS_pept        593171..593911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0540"
FT                   /product="putative ABC transporter membrane protein"
FT                   /note="KEGG: mmc:Mmcs_0550 putative ABC transporter
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96352"
FT                   /protein_id="ABN96352.1"
FT                   /translation="MLRAEQIKLRTTRSPLWTLFAVVVVSLGFAVIQASVGSTAVPLAP
FT                   ERAAIGVAGFAVPVLMVLSALTVTGEYRTGMIRTTFLAMPGRTRVLAAKAVVTAVFSGI
FT                   CAVIMVLASALAVRLVGTPAQGAELSFTEFAVWRTAGAIGLYAVLGAVLAVGLGTLIRH
FT                   SAGVIAILLLLPFVIEPLLGSIPRVGARVGPLMPFANVNTFTEVEWVQTFSMWWGPLGA
FT                   LLYFTGVVAVVFVAAAVDINRRDP"
FT   sig_peptide     593171..593275
FT                   /locus_tag="Mjls_0540"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.191 at
FT                   residue 35"
FT   gene            complement(594686..596437)
FT                   /locus_tag="Mjls_0541"
FT   CDS_pept        complement(594686..596437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96353"
FT                   /protein_id="ABN96353.1"
FT                   /translation="MGLIFWSNSNLRTVFGSPSPGRGSVSVCTTIRTRTARSPGSVTSR
FT                   TTYLASPGRNLLCRITSSFSLRHRYPGSERSASRRHTRSSPSLMMTWTSTSVSFRGGFG
FT                   ENTPQLWSRPVARVRGWSIGASVSLIAESGSDPTTATTTSSATMTLMAMSPARLVLEAD
FT                   SPSCVDIGAYSSHQPSRPTGPPPKRTSTNRETRSSKKCTTRQKRSERNLKKRAIGLGVG
FT                   RSDGFVASTASVESEPSLKSSVESTASSVESTASPRPSAVVSRMSVRSDPSTTSVRSRL
FT                   SAAPSTVSSTPSTAVSRTSLTPSESTASSVESTVSPRPSTVTSTVSVRSVPSTTSVRSR
FT                   LSAAPSTVSSTPSTAESTTSLTPSASEAASSVESTVSPRPSTVTSTVSVRSVPSTTSVR
FT                   SRLSAAPSTVSSTPSTAVSRTSLTPSASEAVSLTSSVESTASKVESTASPSPSAAVSTT
FT                   SVRSVRSAASVRSSASSRPSTVVSRVSVTPSTVSSTVSSTPSTRSLISRLPRSSPPPPP
FT                   RSSNPLVPIRDPASGSSADGDSPSDVADEPPSEPGEPSDPSSPSFSPASPPTGASGTIP
FT                   APGVESN"
FT   gene            596483..597481
FT                   /locus_tag="Mjls_0542"
FT   CDS_pept        596483..597481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0542"
FT                   /product="HTTM domain protein"
FT                   /note="SMART: HTTM domain protein; KEGG: mmc:Mmcs_0552
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96354"
FT                   /protein_id="ABN96354.1"
FT                   /translation="MTADLWSRLRQTGGDSARAWRRFWFSYDSAYPLGFIRIAFGVLMM
FT                   VWTVSLYPGLHDRFGTDGVVPRPPTADFTWSVFRVFPDDDAVFAGWVLLLVASIALTVG
FT                   WHSRLAAVLVFVMVVSFERRNPFVMNAGDVLLRVEALFIALAASGAALSLDQRRRTGSF
FT                   WTAEQRRIWPVRLMQIQVSVIYVSTVVAKLHGETWQDGTAVSYSLRQNDLLFFTTPRWI
FT                   TDNLLVSNVLSWSTLLIELSIGLLVWNRRCRPWVLAAGVVLHLSIFVSMSIGLFSLAMF
FT                   VLYLAFLPSGRAEALGNRLAQRSAARCGRHSGRHSRQRSADMTRDLARSGG"
FT   gene            597518..599023
FT                   /locus_tag="Mjls_0543"
FT   CDS_pept        597518..599023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0543"
FT                   /product="aminopeptidase Y, Metallo peptidase, MEROPS
FT                   family M28A"
FT                   /EC_number="3.4.11.15"
FT                   /note="PFAM: peptidase M20; protease-associated PA domain
FT                   protein; peptidase M28; KEGG: mmc:Mmcs_0553 lysyl
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96355"
FT                   /protein_id="ABN96355.1"
FT                   /translation="MVREMLAVLSIVAVTAGLTGCGDDEKGNPVPAPSTQETAPEAKEF
FT                   GAALKDKVTVDAMMGHLDELQKIADAHGGNRALGTPGYDASVDYVANTLRDKGFDVQTP
FT                   DFEVRLPFAEKPQLTVGGRAVEAKALEYTIGTAPQGVEGPLVPARVEDSPGCTASDYDG
FT                   LPVQGAVVLVDRGECPFGVKQAVAAQRGAVALVVVNNVDGEVVSGTLGDDTDVKIPAVS
FT                   VTKAVGGELRDAPGQTTLRLEAGVRTDRTRNVIAQTKTGSTSDVVMVGAHLDSVPEGPG
FT                   INDNGSGVAAILETALQLGVDPDVRNTVRFGFWGAEEQGLLGSMDYVQSLNEEQLKDIS
FT                   LYLNFDMLGSPNPGYFTYDGDQSAPPNPEAGSPRVPEGSAGIERTLMQYLDDAGKPGED
FT                   TSFDGRSDYDGFTLAGIPAGGLFSGAEEEKTPEQAERWGGEADRPFDPNYHKKEDDLTH
FT                   IDRTAMEINGGGVAYAVGLYAQDQRGRNGIPIRDDRTRHPVES"
FT   sig_peptide     597518..597601
FT                   /locus_tag="Mjls_0543"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.950) with cleavage site probability 0.681 at
FT                   residue 28"
FT   gene            599023..600462
FT                   /locus_tag="Mjls_0544"
FT   CDS_pept        599023..600462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0544"
FT                   /product="aminopeptidase Y, Metallo peptidase, MEROPS
FT                   family M28A"
FT                   /EC_number="3.4.11.15"
FT                   /note="PFAM: peptidase M20; protease-associated PA domain
FT                   protein; peptidase M28; KEGG: mmc:Mmcs_0554 lysyl
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96356"
FT                   /protein_id="ABN96356.1"
FT                   /translation="MRISRAVTALVAALVAACSSPAPPPDVTGGDLAGKVTVDALYTHL
FT                   EALQDIAERHGGNRAQGTAGFDASVDYVANLLRDSGFDVQTPEFDRYGGTRGGAPRLTV
FT                   NGRAHAVEKASLLVDTGPEGLDAVTLRPGRPAGCSAGDYGGVDVRRSIVVVDDTGCSVV
FT                   VKQDVAVARGAVGVLVVTGSGGGSPPGLFTPGYYRELTVPVGIINSDANAALRRTTAPV
FT                   RLRLDGQPVLVKSRNVLAQTKTGDTRNVVMAGAHLDSVSSGPGINDNATGVAAVLETAL
FT                   QLGSSPRVANAVRFAFWGSEEIGLEGSRAYLRDLDGEQLDDIALYLNFDMLGSTNAGYF
FT                   TYDGDQSAATEPVSVPEGSAGVERLLAGYLNEAGVRPADMPLSDRTDYHSFLAAGVPFG
FT                   GTTTGAAQQKTEVQARLWGGRAGAAFDPNYHTRRDTIDNVDRHALGIMGPAVAFAVGTY
FT                   AHSIEGVNGVPPRDRRDRDRP"
FT   sig_peptide     599023..599112
FT                   /locus_tag="Mjls_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.856 at
FT                   residue 30"
FT   gene            600952..602256
FT                   /locus_tag="Mjls_0545"
FT   CDS_pept        600952..602256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96357"
FT                   /protein_id="ABN96357.1"
FT                   /translation="MQTAVRSYVSAGVALAGVGAIAFSPVVPIPDVEVPAISSSAVELN
FT                   ALVNPIELFVPIFEKAFADTGALGQRVFANPAPILEQILANQVASAQTLGEIAGVFGES
FT                   FQTAFAAAPGLLETAFDQFAAGEITLALNTLFDLALSPVIGPLLDSIFMGDGVLQDLVG
FT                   VLQKPLVNAQNVIGLLGDPDFLLTIGLLPLQTAYALNTAVGGAAEALLAAAEAGDPEGF
FT                   VNAITTGSANVTAAVLDLLLNPGTPPYNYDQGLVAALLSARDMIAQAIGAPAPSPALLA
FT                   TVSSEVTDPALTTITLDVAPASDAIEAPKPAAETDVSAVSLSADAVDATEPATAVAEET
FT                   AAVEAGVDEVVAESEVVTPKKSDPLNELRKGVEGAVNDIRNGFKHAAASLTGKASKPAK
FT                   SESSPASDSGSASESDSGSDSGSGSGSDSTSGDAE"
FT   sig_peptide     600952..601062
FT                   /locus_tag="Mjls_0545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.378 at
FT                   residue 37"
FT   gene            complement(602274..603575)
FT                   /locus_tag="Mjls_0546"
FT   CDS_pept        complement(602274..603575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0546"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: mmc:Mmcs_0556
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96358"
FT                   /protein_id="ABN96358.1"
FT                   /translation="MIPAKTGRSANWKWKPVEARADADFVVAPDERLSWPRTIGLGAQH
FT                   VVAMFGATFLVPVLTGFPPATTLLFSGVGTILFLIITGNRLPSYLGSSFSVIAPVTAAV
FT                   ASEGTGSALGGIVALGLVLIVIGGVVHLVGTRWLDVTLPPVVTGAIVALIGFNLAPAAK
FT                   TNFEAGPVVATVTLVLLVATLAFFRGMIGRLAIFLAVLIGYLLALAMGDVDTSAIAAAP
FT                   WVGLPDFEAPSFSLAVLPMFLPAVVALIAENIGHVKSVGQMTRTDMDPLIGRALAADGV
FT                   ATTLAGFGGGSATTTYAENIGVMAATRVYSTAAYWVAAVVAIALSLCPKIGAAISATPA
FT                   GVLGGATVVLYGLVGVLGVRIWLTNHVDFSLPVNQMTAAIPLIIGIADFTWQAGELTFT
FT                   GIALGSIAALLVYHGMRLLGLRTSRSAEPSTSTV"
FT   gene            complement(603582..604829)
FT                   /locus_tag="Mjls_0547"
FT   CDS_pept        complement(603582..604829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0547"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; Amino
FT                   acid transporter, transmembrane; KEGG: mmc:Mmcs_0557 amino
FT                   acid permease-associated region; TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96359"
FT                   /protein_id="ABN96359.1"
FT                   /translation="MNPPGGPALSRRLGLVDAIVIGLGAMIGAGIFTALAPAAAAAGGG
FT                   LLVGLAVAAVVAYCNATSSARLAARYPESGGTYVYGRERLGPFWGYLAGWGFVAGKTAS
FT                   CAAMALTVGVYVWPGGARLIAVAAVVALTAVNYAGIRKSALLTRLIVAVVLAVLAVVVV
FT                   IVLGFGDPVGDRLDFGADVTVGGALQSAGLLFFAFAGYARIATLGEEVCDPARTIPRAI
FT                   PIALGLTLAVYAVVAVTVLAQLGPAALAGSTAPLADAVRAAGFPGWVPVVGAGAAVAAL
FT                   GSLLALILGVSRTALAMARDRHLPSGLAAVHARHGTPHRAEVAVGVLVAALAATVDLRD
FT                   AIGFSSFAVLMYYAIANASAWTLGARVVPAVGLAGCLLLAFALPWTSVLAGVAVLAVGA
FT                   LAYAVRRARSTGNGAR"
FT   sig_peptide     complement(604704..604829)
FT                   /locus_tag="Mjls_0547"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.853 at
FT                   residue 42"
FT   gene            complement(604839..605177)
FT                   /locus_tag="Mjls_0548"
FT   CDS_pept        complement(604839..605177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96360"
FT                   /protein_id="ABN96360.1"
FT                   /translation="MSARAWYIGIGGAILMAIGLFALRFPVLIDGYDQWGWQVECGSGF
FT                   VANLTQAENAAVDGTDFVASCQNALLTRRLWTIPLIAAGVVAMVAVLLTATVAHEDEDT
FT                   LAGDRETS"
FT   gene            605204..606559
FT                   /locus_tag="Mjls_0549"
FT   CDS_pept        605204..606559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0549"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0559
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96361"
FT                   /protein_id="ABN96361.1"
FT                   /translation="MLTLILSPRRHRMTISAVAPSCAVCGISVFGMAPTPPGRGDGVRR
FT                   RPKDRKAQIARASAEAFSSLGYHGVSMDAIASRVGISAAALYRHYTGKYELFRDAVLAL
FT                   GQQLVDATAFVDGEISDDGFGAHITEDPERTLVHLATAVCDAALANRESGGLYRWEARF
FT                   LRGDDQATLDSQIRTVHRRFQQPLRMLRPELDSRQRWTLSTAMISVLGSIVDHRAKLPA
FT                   GQIRPLLAELVVALVPAEFPDLPDDPEPPAPTAAAHRSKYEALLMESMRLFNLKGYRDT
FT                   SMEDIAAATGMPASGIYRYFSGKSDILAGAFRRSADRWSAEMSAILDTTADREEALAKL
FT                   IDGHVARSFSEPELDYVYYTERLNMSPADQQILRNLQRSTVETWADLVVTLRPEWTAGQ
FT                   ARFAVYAALAVTTDLGRLVHYRNSPYTRALVAGLMDLTLLGRYRLRTVLPAK"
FT   sig_peptide     605204..605326
FT                   /locus_tag="Mjls_0549"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.317 at
FT                   residue 41"
FT   gene            complement(606526..606792)
FT                   /locus_tag="Mjls_0550"
FT   CDS_pept        complement(606526..606792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96362"
FT                   /protein_id="ABN96362.1"
FT                   /translation="MPQQDNRAAKLTGLAIAGTGLAHFVRPQVFEPITVAAFPQNTRRH
FT                   IYTNGSLETAIGLALAGRRTRKFGLAGLLGYAVYLAGNTVRKR"
FT   gene            complement(606806..608296)
FT                   /locus_tag="Mjls_0551"
FT   CDS_pept        complement(606806..608296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0551"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmc:Mmcs_0561 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96363"
FT                   /protein_id="ABN96363.1"
FT                   /translation="MTSEQYDAVIVGAGFAGIGAAIQLKRMGYANFVILDREDDLGGTW
FT                   YVNHYPGLAVDVPTTTYSYFFEPNPKWSRLFSTGAEIKQYADEVADKYDVRRHIRFNTA
FT                   VEGARWDEEAKLWRVALDGGETLSTRYLITATGFLSQPRTPDIPGITSFEGKVIHTTDW
FT                   DDSFDPSGRRIAIIGTGATAVQLIPELARNAADLTVYQRTPIWVAPKVDIRFSERTKRL
FT                   FARVPLLQRTVRLITDTIYEAMINIGVVHYKVPLFRRLNMSAMDLCKINQFVAIRDKEL
FT                   RRKLTPDYDIGCKRPTFSNSYFRTFTKPHVHLQADGIDHVEADGIVNADGTKTVIDTLV
FT                   LATGFDLWEANFPAIEIIGRGGRNLGKWWRETRFQAYQGVSMPYFPNYLSLASPYAFLG
FT                   LNFFNTMEYQMRLMDRLFSEVHRRGATTFEVTEEANTRYLDRMTEALGSSLWTLGNCAS
FT                   SRSYYFNPSGEPSLLRPMSTRDAIKEASEFPLSDYQIA"
FT   gene            complement(608352..608969)
FT                   /locus_tag="Mjls_0552"
FT   CDS_pept        complement(608352..608969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96364"
FT                   /protein_id="ABN96364.1"
FT                   /translation="MSMPPGPPPPPPGQPPYGQQPYGQPAYGQPAYGQPYFPPPPPQPY
FT                   AEMRPAGPPPPPKKSKLWLILGLVALTVVVIAIAVVLFVVLVVREGTVTATQVKLGDCL
FT                   SEIPDGSEVRTLKTVDCAEPHAGEVFAVLQMPDGDFPGQDAMVEYANRCAPELASYSPS
FT                   AVTDDTVRLFVLFPTDETWSDGDRAVTCVATLNPPRAGSLKG"
FT   gene            complement(608980..609603)
FT                   /locus_tag="Mjls_0553"
FT   CDS_pept        complement(608980..609603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96365"
FT                   /protein_id="ABN96365.1"
FT                   /translation="MNLDDIAGVAHEPAGTPRGVVLLTHGAGGNRDAPLLVRFCDEWAG
FT                   RGWLAVRYNLPYRRRRPKGPPSGSATADRAGVADAVAAARELTDGPVIAGGHSYGGRMT
FT                   SMAVADDGVALDVMTLSSYPLHPPGKPDRARTEHLPRIGVPTVFVHGTADPFGSIDELT
FT                   AAAALVAGPTELVEITGARHDLGSKALDVPKLAVDAALRLLATG"
FT   gene            complement(609590..610438)
FT                   /locus_tag="Mjls_0554"
FT   CDS_pept        complement(609590..610438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0554"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: mmc:Mmcs_0564 phosphomethylpyrimidine kinase
FT                   type-2; TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96366"
FT                   /protein_id="ABN96366.1"
FT                   /translation="MTDTRYLPLAPPGQTPARVMTIAGTDSGGGAGIQADSRTFAMLGV
FT                   HGCVAVVAVTVQNSVGVKGFHEIPIDVITGQIEAVVSDIGIQAAKTGMLASSEIITAVA
FT                   ETWRRLRPAPLVVDPVCASMHGDPLLHPSALDALRSELFPLATLVTPNLDEVRLITGID
FT                   VTDAASQRDAARALHALGPQWALVKGGHLRSSAYSPDLLFDGSEFHEFGADRIDTGHDH
FT                   GAGDTLAAATASALAHGYSVPDAVAFAKQWVTECLRAAYPLGHGHGPVSALFRLSADEP
FT                   R"
FT   misc_binding    complement(610429..610537)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 69.91"
FT   gene            610614..612377
FT                   /locus_tag="Mjls_0555"
FT   CDS_pept        610614..612377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0555"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmc:Mmcs_0565 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96367"
FT                   /protein_id="ABN96367.1"
FT                   /translation="MCSAASARRCAPSDTKRTRLQMTTELTGRRRIATDRDHPLYKWVV
FT                   LSNTTLGMLLATVNSSIVLISLPAIFRGIGLNPLQPANVTYLLWLLMGYMVVTAVLVVL
FT                   FGRLGDMFGRVRIYNLGFVIFTLCALALSFQPFDLDAGAWWLIGWRVVQGVGGAMLIAS
FT                   SAAILTDAFPAHQRGMALGVNMVAAVAGSFLGLVIGGALSEWHWQAIFWVGVPIGVLGT
FT                   VWAMRSLREGGERSPGRLDWAGAVTLGLGLTVLLTGITYSIQPYGGSPTGWGNPWVLGA
FT                   IAFGVLALVAFCVIELRVDQPLVDILLFRITAFGMGNLAGLMSSVGRGGLQFMLIIWLQ
FT                   GIWLPLRGYDFEATPLWAAIYMLPLTFGFLVAGPLSGWLSDRYGARPFTVGGMLLMCAT
FT                   FVALVLIPVDFDYWLFATLIFLNGVGGGVFTSPNSAAIMSSVPASARGAASGVRATFFN
FT                   AGGSLSIGIFFSLMIVGLANTLPGAMSAGLQAQGVSAAVADEVAGTPPVGSLFAAFLGY
FT                   NPIGELLEPSHALQQPGVNAEVLTGQTFFPHLIIEPFHTGLVVVFVAAAVMMLIGAVAS
FT                   LFNAGRYAEQT"
FT   gene            612422..615181
FT                   /locus_tag="Mjls_0556"
FT   CDS_pept        612422..615181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0556"
FT                   /product="regulatory protein, LuxR"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: mmc:Mmcs_0566
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96368"
FT                   /protein_id="ABN96368.1"
FT                   /translation="MPLQLISRDAELSAVDDLLSAVPTGTCVLVLEGDVGIGKSTVWRA
FT                   GIERARTRGFRVLAAHPVSSESVAAYSSLAELLADVDTEVLDHLPAPQRVAIDRVLSRA
FT                   DDTGPGTDQRAVAAAVRSVLERLAHDSPVLVAIDDLQWLDPPTAAVLASVARRSAGAIG
FT                   FLVTVRSGAGDHTETLLEPSRPERLHRARVHPMTVGGLHAMISHQLGRSLTRPRMDWVY
FT                   EVSAGNPLYALELARALDRDATGVGPLPATLADLVRTRISGLPDHTREVLLATACIASP
FT                   TVDLVARAVGDNVEWTVAALEEAERHGVVEITGYKVTFSHPLLARGVYAEASADERRWM
FT                   HRRLADIVESPESRARHRALSSDGADEQTVKALDEAAESVHLRGAPATAAELLDMARAR
FT                   GGDTPERTLRAAACHFEAGDAARARVLLEHALSEIPPGELRARALQLLGLVRLYANSSS
FT                   EAVPMLEQAIAEPGVNPDRRVHMLVMLAFIEFNAGRADRAVQRAEEAVTQAMTLHRPDL
FT                   ITQAKPIRALLRFLLGEGFDEAELDGVFDFDEPEGLPLAAQPRTLHALLMLWTDRLDEA
FT                   ADQFNAIAQRCIERGDESERAFVDFHLGQVNVWRADLAAAERVAEDSVERALQSHGDLP
FT                   LFVALIVRVMVSAHFGREDQTRRFAAQARTVGERCESSRLGVWLTTSLGFLELSLGDHR
FT                   AAVDVLSPAVEGWSSAATGIPAPTELVTAPFLPDAAEALIGIGSLDEAERLVEALEANG
FT                   TRLDRPWMLALGARCRALLLAARGDLTAAVSSGERALTEHGRLSMPFELARTQLVVGRL
FT                   QHRRRQYDAATAIVSTALAAFERIGAELWARQARAELDALTGRQTAAGLAESERRFADL
FT                   AVQGMTNREIAATLYVSEKTVEANLSRVYRRLGIRSRGELARVLNADS"
FT   gene            complement(615191..615994)
FT                   /locus_tag="Mjls_0557"
FT   CDS_pept        complement(615191..615994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0557"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="TIGRFAM: exodeoxyribonuclease III;
FT                   exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: mmc:Mmcs_0567
FT                   exodeoxyribonuclease III (xth)"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96369"
FT                   /protein_id="ABN96369.1"
FT                   /translation="MRLATWNVNSIRARVDRVTDWLERADVDVLAMQETKCNDEQFPTM
FT                   PFAALGYDVVHCGFNQWNGVAIASRVGLDDVAVGFDGQPTWCDKPDIEAAAEARALGAT
FT                   CAGVRVWSLYVPNGRFVGSPHYAYKLEWLAALRKTAHGWLTENPALPIAMVGDWNIAPT
FT                   DDDVWSVEAYQDSTHVTPPERQAFTEIVDAGYADVVRPFTPGPGVYTYWDYTRLAFQKR
FT                   RGMRIDFILGSPAFADRVTHAEIVREERKGKGASDHAPVLVDLRD"
FT   gene            complement(615998..616888)
FT                   /locus_tag="Mjls_0558"
FT   CDS_pept        complement(615998..616888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0558"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmc:Mmcs_0568 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96370"
FT                   /protein_id="ABN96370.1"
FT                   /translation="MPELPRAGTRVSLRYRLPAGSVPPLNDVVGHLLERDPVVRVRTKT
FT                   GESVTISPADVVTVRVLTDVPVKASQIRAVEHAAALAWPGLHREWVDGWLLRASDGYTH
FT                   RGNSAVPLDINANAATVPAIRDWYARRGLTPWLAVPDRLVRLPLRDVHLESIVMVRALP
FT                   AEAAAEVTVTPQPDPAWLAVYEREVPIEVLTAVVDGQVAFGRIDDAAVGRAAVTPARDG
FT                   TRWVGLSAVRVAEDRRRRGHARALCAALLQWGARGGATHAYVQVLADNHGAIALYESMG
FT                   FTAQHRERYVDASKL"
FT   gene            complement(616897..617490)
FT                   /locus_tag="Mjls_0559"
FT   CDS_pept        complement(616897..617490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0559"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: mmc:Mmcs_0569 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96371"
FT                   /db_xref="GOA:A3PTZ4"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PTZ4"
FT                   /protein_id="ABN96371.1"
FT                   /translation="MAVVPIRIVGDPVLRTETTPIPVGDDGSLPAEVADLIRDLYETMD
FT                   AANGVGLAANQIGVSQRVFVYDCPDSRGRAGRRRGVVINPVLETSDIPETMPDPDDDEE
FT                   GCLSVPGEQFPTGRADWARVTGLDADGSPITVEGTGLFARMLQHETGHLDGFLYLDRLI
FT                   GRHARAAKRAVKHNGWGVPGLSWTPGEDPDPFGH"
FT   gene            617628..617936
FT                   /locus_tag="Mjls_0560"
FT   CDS_pept        617628..617936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0560"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="KEGG: mmc:Mmcs_0570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96372"
FT                   /protein_id="ABN96372.1"
FT                   /translation="MDGAMAQTEQSGDDSDLPAGLTRREFDILAFERQWWKYAGSKEDA
FT                   IKELFSMSATRYYQVLNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFEVT"
FT   gene            617965..618423
FT                   /locus_tag="Mjls_0561"
FT   CDS_pept        617965..618423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0561"
FT                   /product="putative tuberculin related peptide"
FT                   /note="KEGG: mmc:Mmcs_0571 putative tuberculin related
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96373"
FT                   /protein_id="ABN96373.1"
FT                   /translation="MNQRESSGLPLRAIVMVLLFLGIVFLLVGFQALRSDDSSADETTV
FT                   ATTTSSTPSPKPAPEADARPEVRVFNISDVAGAAEGVATRLRDEGWNVTETGNLTLEGV
FT                   TATTVYFGEAPGEREAADEVGRLLEAPVEPRVPPLAEQPPGVVVAVTG"
FT   sig_peptide     617965..618087
FT                   /locus_tag="Mjls_0561"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.988 at
FT                   residue 41"
FT   gene            618473..619159
FT                   /locus_tag="Mjls_0562"
FT   CDS_pept        618473..619159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0562"
FT                   /product="superoxide dismutase, copper/zinc binding
FT                   protein"
FT                   /note="PFAM: superoxide dismutase, copper/zinc binding;
FT                   KEGG: mmc:Mmcs_0572 superoxide dismutase, copper/zinc
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96374"
FT                   /protein_id="ABN96374.1"
FT                   /translation="MFAVPALALSACSPNEPVSSEPGTTPSVWTGSPSPSAAPGQGEEG
FT                   GSGSEGQGEGGQKLTAELKSPDGTTVANAEFDFSGGYATVTVQTVASGQLEPGFHGMHV
FT                   HQVGKCEPNSVAPSGGAPGNFNSAGGHFQTEGKTGHPASGDLTSLQVREDGSAMVVTTT
FT                   DAFTAEDLTGGEGTAIIIHEKADNFANIPPEKYNQVNGTPGPDQATMATGDAGGRVACG
FT                   VIRSGQ"
FT   gene            619137..620267
FT                   /locus_tag="Mjls_0563"
FT   CDS_pept        619137..620267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0563"
FT                   /product="uncharacterized enzyme"
FT                   /note="TIGRFAM: uncharacterized enzyme; PFAM:
FT                   glutamate--cysteine ligase, GCS2; KEGG: mmc:Mmcs_0573
FT                   enzymatic protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96375"
FT                   /db_xref="GOA:A3PTZ8"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PTZ8"
FT                   /protein_id="ABN96375.1"
FT                   /translation="MLSVPASSRIDFAGSPRPTVGVEWEFALVDAHTRDLSNEAATVIA
FT                   EIGETPHVHKELLRNTVEVVTGICENTGEAMADLHDTLQVVRRIVRDRGMELFCAGTHP
FT                   FANWSTQQLTDAPRYAELIKRTQWWGRQMLIWGVHVHVGISSAHKVMPIISSLLNQYPH
FT                   LLALSASSPYWDGSDTGYASNRAMMFQQLPTAGLPFQFQSWPEFERFVHDQKKTGIIDH
FT                   MNEIRWDIRPSPHLGTVEIRVFDGVSNIAELGSLVALTHCLVVDLDRRLDAGEQLPVMP
FT                   PWHVQENKWRAARYGLDAEIILDADSNERLVTEDLDDLLTRLQPVARSLDCADELAGVA
FT                   EIYRHGASYQRQRRVAEEHDGDLLAVVDALVAELEL"
FT   gene            620364..620702
FT                   /locus_tag="Mjls_0564"
FT   CDS_pept        620364..620702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96376"
FT                   /protein_id="ABN96376.1"
FT                   /translation="MADPDQVAMNTTAPSTTTTSPSPTTRARVPDPTPSAPRSPGVPAP
FT                   GGLAATTCGEYVDMDEATQRQVIEAIGEQNELVALNPELWITMASAMCTFADPATLVSD
FT                   AVVGGGFN"
FT   gene            620721..621332
FT                   /locus_tag="Mjls_0565"
FT   CDS_pept        620721..621332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0565"
FT                   /product="peptidase S16, lon domain protein"
FT                   /note="PFAM: peptidase S16, lon domain protein; KEGG:
FT                   mmc:Mmcs_0575 peptidase S16, lon-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96377"
FT                   /protein_id="ABN96377.1"
FT                   /translation="MFPLEVTMLPGEELPLRIFEPRYVALVQDCLAMTDPAFGVVLIEA
FT                   GREVGGGDRRSTVGALARIVDYADLGVGRFRLRCLMGERIRVRQWLDDAPYPRADIEVW
FT                   EDEPGAVDSAAVFDVEDRVVALYERIAAARGSEFGGRSAVLGPEESDVVKRLYGLAARV
FT                   PMGQADKYAVLSAPTVSARLSALSEAVDTVTAMVEFQLSE"
FT   gene            complement(621386..622390)
FT                   /locus_tag="Mjls_0566"
FT   CDS_pept        complement(621386..622390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0576 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96378"
FT                   /protein_id="ABN96378.1"
FT                   /translation="MTTARTYNQEHVPRRRDGRRRISIYWTWSYPWEAQRNPAEVYNRF
FT                   STMTEVRNALWPSYETTEYDDAHFLQGIAGTLELFHRSTLAFQELAGEVTGHPVAVFQR
FT                   IDQAGYLLPIDERILADTDTLMVFGLDHILSEQEATADEIAAIKQWLQREGTCLLLAPH
FT                   HDVGFTDDFDQRAAEFAHHGDPLVPRQQRFGQYTRSLMKALDVPVHNTWGLRPAVVERT
FT                   REIAPLNGFRDLDTARLLDNVTTFNFHPHLPHYELTAPESDTLRVLGRQRVDPHRPHPF
FT                   TDGGNTEFNALIWMPPTGHRSGDVVLIDSTHFTTLFGGTDSLRNLWHNLATMR"
FT   gene            complement(622387..623730)
FT                   /locus_tag="Mjls_0567"
FT   CDS_pept        complement(622387..623730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0567"
FT                   /product="Dyp-type peroxidase family"
FT                   /note="TIGRFAM: Dyp-type peroxidase family; KEGG:
FT                   mmc:Mmcs_0577 Dyp-type peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96379"
FT                   /protein_id="ABN96379.1"
FT                   /translation="MTFTLTELELDDIQHILLTRTPAITGRYEFLTFDAPAGGRAWVTA
FT                   LLDKVQSAADVRAAMDTSDRWVTLAFTWQGLRALGVPDTSLATFPDAFREGMAARARIL
FT                   GDTGAAAPEHWLGGLAGDDLHAIAILFSRTDEQYRASVANHDALLDSLAGVRSLSHLDL
FT                   NATPPFNYAHDHFGFRDRLSQPVIKGSGEEPTPGSGAPLAPGEFILGYPDENGPVADSL
FT                   QPEALARNGSYMAYRRLEEHVGLFRDYLRANSKDAGEEELLAAKFMGRWRSGAPLVLAP
FT                   DQDDPELGADPMRNNDFNYKKMDPFGYACPLGSHARRLNPRDTAHYMNRRRMIRRGATY
FT                   GPALPEGAPDDGVERGIAAFIICADLVRQFEFAQNVWINDKTFHELDNEHDPIAGTQDN
FT                   TLDFTVPKRPIRRVHKGIPAFTTLRGGAYFFLPGLRGLRYLATLGDTS"
FT   gene            complement(623727..624131)
FT                   /locus_tag="Mjls_0568"
FT   CDS_pept        complement(623727..624131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96380"
FT                   /protein_id="ABN96380.1"
FT                   /translation="MGTSDPLVTVTRYIEAFNRGDAAVMASMFDTEGVILDGMAPHVWL
FT                   GPSAAQDWYRDVLVEGEHHGASDYAVTLGEPLHHNVTGDRAYLAIPARMTFRVRGTPVT
FT                   QTGAFFTVALRQVAEGWRITAWAWTKGTQQ"
FT   gene            complement(624137..624697)
FT                   /locus_tag="Mjls_0569"
FT   CDS_pept        complement(624137..624697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96381"
FT                   /protein_id="ABN96381.1"
FT                   /translation="MSADNQHWSKPAAMAIPREGYFELEQGRYGPVYPRTPACYGFSII
FT                   AKVKEGREEAVRAYGKTIEETIAASPDALAPLRLHYLRWQLFDVGSGLHFQYQGIFDTD
FT                   FDKYTEDAVQLFSATGITTVFTNLEGFPEDWKENPESFVNFVREHQVPSFLEYGEYPYV
FT                   TADEIKKALRLKAAFSDMLDQMQ"
FT   gene            complement(624995..625744)
FT                   /locus_tag="Mjls_0570"
FT   CDS_pept        complement(624995..625744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0570"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: mmc:Mmcs_0580
FT                   protein of unknown function Mtu_121"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96382"
FT                   /db_xref="GOA:A3PU05"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PU05"
FT                   /protein_id="ABN96382.1"
FT                   /translation="MTTPDGIVSALAVALARQSESHADCPLFNDPYAQVFIDAALSRGC
FT                   QLPSDETSERINGIANYASSRTKWFDEYFIAAGAHGLEQMVIVAAGLDARAWRLPWVAG
FT                   TTLFEIDHPGVLKFKNEALHEHGESPSVSRYVPVPADLSDGWSERLRDAGFDVSEPTAW
FT                   AVEGLLPYVADGPHLLFDRIHEISPAGSRLAVEAVGTGVADWLSTQGWQVTVIGAQELM
FT                   TRYGRCGDHSDTDAGMDTVFVNATRDR"
FT   gene            complement(625731..626093)
FT                   /locus_tag="Mjls_0571"
FT   CDS_pept        complement(625731..626093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0571"
FT                   /product="multisubunit sodium/proton antiporter, MrpG
FT                   subunit"
FT                   /note="TIGRFAM: monovalent cation/proton antiporter,
FT                   MnhG/PhaG subunit; KEGG: mmc:Mmcs_0581 Na+/H+ antiporter
FT                   subunit; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96383"
FT                   /protein_id="ABN96383.1"
FT                   /translation="MNAFDIVASVLVLGGSTLALTAAIGVVRFPDTLSRMHAATKPQVL
FT                   GLLLVLAGAAIRLRGNIDVGMLILAGLFTIITAPVIANRVGQLAYHEQNIRDDLLTRDE
FT                   MLEVAAEGEHRRHDDS"
FT   sig_peptide     complement(626022..626093)
FT                   /locus_tag="Mjls_0571"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.691) with cleavage site probability 0.397 at
FT                   residue 24"
FT   gene            complement(626090..626377)
FT                   /locus_tag="Mjls_0572"
FT   CDS_pept        complement(626090..626377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0572"
FT                   /product="multisubunit sodium/proton antiporter, MrpF
FT                   subunit"
FT                   /note="PFAM: multiple resistance and pH regulation protein
FT                   F; KEGG: mmc:Mmcs_0582 multiple resistance and pH
FT                   regulation protein F; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96384"
FT                   /protein_id="ABN96384.1"
FT                   /translation="MNTVWIIAGVMLSTAAAATMFRLLAGPSTLDRLVALDTLVAVTMC
FT                   AIGTWAAFSLNTTVTYSLTALALISFVGSVSVARFRVPDVQRPDRTRRIS"
FT   sig_peptide     complement(626300..626377)
FT                   /locus_tag="Mjls_0572"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.791) with cleavage site probability 0.638 at
FT                   residue 26"
FT   gene            complement(626374..626943)
FT                   /locus_tag="Mjls_0573"
FT   CDS_pept        complement(626374..626943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0573"
FT                   /product="multisubunit sodium/proton antiporter, MrpE
FT                   subunit"
FT                   /note="PFAM: cation antiporter; KEGG: mmc:Mmcs_0583 cation
FT                   antiporter; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96385"
FT                   /protein_id="ABN96385.1"
FT                   /translation="MKVIEGTRWSPRRLALRAWVLCWLTLVWVLLWGTLSAANVVSGLA
FT                   VALMITLLLPLPPVPVEGRVHLLSLLRLVATVAYYLVVSSVQVAWLAVKPGPPPLTAVL
FT                   RAHFAVKSDLVLALAVNIVNLTPGTIALEIDQTRRVVYVHVIDVGSDRALSRFYRQIGQ
FT                   FERLLIAAFERESDWRPSTEKEADPA"
FT   sig_peptide     complement(626830..626943)
FT                   /locus_tag="Mjls_0573"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.883) with cleavage site probability 0.362 at
FT                   residue 38"
FT   gene            complement(626940..628547)
FT                   /locus_tag="Mjls_0574"
FT   CDS_pept        complement(626940..628547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0574"
FT                   /product="multisubunit sodium/proton antiporter, MrpD
FT                   subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: mmc:Mmcs_0584 NADH dehydrogenase (quinone); TC
FT                   2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96386"
FT                   /protein_id="ABN96386.1"
FT                   /translation="MSLSSVLTPLPVLIPTIAAALTLFAGRRPVLQRVIAQLALVAVVV
FT                   VCAALVYLTDRDGTLALHVGGWGQSVPGMGPLGITLVVDRLSALMLMVSSIVLLAVVAY
FT                   AIGQGIRDGDGRQPVSIFLPTYLVLSAGVCTAFLAGDLFNLYVGFEVLLSASFVLLTIG
FT                   ASAERVRAGISYVMVSMVSSLIFLLGIGLVYAATGTLNMAELAVRLDDVSEGTRMALFA
FT                   VLMVAFGIKAAVFPLSTWLPDSYPTAPAPVTAVFAGLLTKVGVYAIIRAHSLLFPGGGL
FT                   DQVLLWAALLTMVVGVLGAIAQSDIKRLLSFTLVSHIGYMVFGIALSNDIGMAGAIYYV
FT                   AHHIVVQTTLFLVVGLIERQAGASTMTRLGGLAAASPLLAFVFVVPALNLGGIPPFSGF
FT                   IGKVALLEAGAANGTPLAWALVAGGVVTSLLTLYVVARVWTKAFWRSREDAPEGHLSST
FT                   APAALLDDTAESDDIQFVDRDHVGRMPAGMLVPTGLLIAVGLALTVAAGPIFAYSGRAA
FT                   DEVIQRDNYITAVVGERP"
FT   sig_peptide     complement(628401..628547)
FT                   /locus_tag="Mjls_0574"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.838) with cleavage site probability 0.474 at
FT                   residue 49"
FT   gene            complement(628544..629017)
FT                   /locus_tag="Mjls_0575"
FT   CDS_pept        complement(628544..629017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0575"
FT                   /product="multisubunit sodium/proton antiporter, MrpC
FT                   subunit"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 4L;
FT                   KEGG: mmc:Mmcs_0585 NADH-ubiquinone oxidoreductase, chain
FT                   4L; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96387"
FT                   /protein_id="ABN96387.1"
FT                   /translation="MTTFLVPLILIGGLTSVGVYLLLERNLTRMLLGLLLIGNAINLLI
FT                   LTVAGPSGNPPVRGRTKAGETTTADPLAQGMILTAIVISMGIAAFVLALTYRSYRLTTA
FT                   EDVGNDPEDTRVSSMAAKEAAALDEDRPPEPDLAIDTDLPDELDALPGREGSR"
FT   gene            complement(629014..631914)
FT                   /locus_tag="Mjls_0576"
FT   CDS_pept        complement(629014..631914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0576"
FT                   /product="multisubunit sodium/proton antiporter, MrpA
FT                   subunit / multisubunit sodium/proton antiporter, MrpB
FT                   subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   Na+/H+ antiporter MnhB subunit-related protein; KEGG:
FT                   mmc:Mmcs_0586 NADH dehydrogenase (quinone); TC 2.A.63.1; TC
FT                   2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96388"
FT                   /protein_id="ABN96388.1"
FT                   /translation="MLAILCAHAIATALAPLMVARWGRIAFYPLAVVPLVSLVWVALNW
FT                   PEPGGAQTVNLVWLPELSMDITLRFDTLAAIMSVLILGIGALVLFYCGTYFHHRDGHIE
FT                   KRLPSFAAEMVAFAGSMFGLVISDNMLILYVFWETTTVLSFLLVGHYAERATSRRAATQ
FT                   ALLVTTFGGLAMLVGIIILGNLAGTYLLSELVAAPPGGVAAGVGVALILVGALSKSAIV
FT                   PLHFWLPGAMAAPTPVSAYLHAAAMVKAGVFLVARMTPGFADSPVWRPMIIILGLATML
FT                   LAGWRAVREYDLKLILAFGTVSQLGLITIMVGTGGRDMMLAGLAMLVAHAMFKASLFMV
FT                   VGVIDHSTGTRDIRRLAWLGDRSRPMLIIAVGATASMAALPPFLGFVAKEADFETVLHS
FT                   AALGPAAPWVLAGIALGSVFTTIYSLRFLWGAFSRKGLHEPSLRVREMHRPSAAFLAAP
FT                   AVLAAAGLVSGLWPAPLDAVLGDYADTVPGGSDYHLALWHGLNLPLLLSAVVIATGVTA
FT                   FFERSKLRRARVAYLPLGNADHVYDALIRGLDMVSVRLTATTQRGSIPATQSVILCTLV
FT                   VVPAAALALGARDRPDFALWDSPWQVVVGLLMLAAAVGAAVMRNRLAAVLLIGVTGYGC
FT                   GAIFALHGAPDLALTQFLVETLVLVIFVLVLRTLPAEAEKAHIRHKRLPRALLSLAVGA
FT                   TVTSLAVYAMAARTGVGIAELIPDAAYYRGQGANAVNVLLVDIRAWDTMGEISVLLVAA
FT                   TGVASLVFRNRRFGTAPRVSDAGQPDIGRIGNFATSPAVGEITWLRGSELRDPRHRSLV
FT                   LEVATRVIFPLIMVLSAYFFFAGHNTPGGGFAGGLTAGLALVLRYLAGGRYELGETLPL
FT                   DAGKILGVGLALSAGTAVTSLFLGAPVLSSAVIEFDLPVLGTVKLVTALFFDLGVYLIV
FT                   VGLVLDVLRSLGAQVDVEMSQPNPGSGGSAAKVGAR"
FT   gene            complement(632025..633338)
FT                   /locus_tag="Mjls_0577"
FT   CDS_pept        complement(632025..633338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0577"
FT                   /product="possible tyrosine transporter P-protein"
FT                   /note="PFAM: Arsenical pump membrane protein; Citrate
FT                   transporter; KEGG: mmc:Mmcs_0587 citrate transporter; TC
FT                   2.A.45.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96389"
FT                   /protein_id="ABN96389.1"
FT                   /translation="MSAAPAVSFSPAPVLALAIFVVAFWFIATERADKVKTVLVAAGLM
FT                   ALLGLIPGEQVFYSEHAGIDWNVIFLLLGMMVIVGVVKQTGLFDFLAIWAAKRSQGKPF
FT                   RLMVMLMLITAFASPVLDNVTIILLIAPVTLVICDRLRIAPQPYLIAEVLASNIGGAAT
FT                   LIGDPPNIIIGSRAGLTFNDFLVHMAPIVLIIFALFVVFTRVLFRKDLRTDDIHLDEVM
FT                   ALQERRAIKDTRLLVRSLVVLNLVIVGFALHSVLHVAPSVVALLGAGAMLLVTDMDVGE
FT                   VLPEVEWPTLVFFMGLFVMVAGLTHTGVIGALGSVAQSAFGDNWFAAATALLFGSSIVG
FT                   AFVDNIPYTATMTPVVGSMVAETPDPGTGQALWWAFALGACFSGNGTAIAASANVVAIG
FT                   IAARAGHPISFWRFTRYGIVVTLLSTTLAWGYVWLRYF"
FT   sig_peptide     complement(633240..633338)
FT                   /locus_tag="Mjls_0577"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.731) with cleavage site probability 0.728 at
FT                   residue 33"
FT   gene            complement(633357..633815)
FT                   /locus_tag="Mjls_0578"
FT   CDS_pept        complement(633357..633815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0578"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmc:Mmcs_0588 putative signal transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96390"
FT                   /protein_id="ABN96390.1"
FT                   /translation="MQAHEIAVSPPTVRMDDPVSKAVQLMVVNRLPGLVVVDDADHPIA
FT                   VLPGTQVLRLTIPETYRDDPALVRTVDEIHADLFWHGPGRLTVGDCLPSPVAKPATVAP
FT                   DATLLEVATVMATKRSPLIAIVDGAGRLTGAVTLERLLTSLAVAGPGD"
FT   gene            complement(633863..634135)
FT                   /locus_tag="Mjls_0579"
FT   CDS_pept        complement(633863..634135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa7830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96391"
FT                   /protein_id="ABN96391.1"
FT                   /translation="MRIDRTTVPGGGMLHHIVTRAGGRLCVLVTRDGERQVFVYDDDSD
FT                   EPAKELVLAPDEADGVAEILHSRPIADRVRSLERRVDALIGERAS"
FT   gene            634265..635245
FT                   /locus_tag="Mjls_0580"
FT   CDS_pept        634265..635245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0580"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase, dimerisation and phosphoacceptor
FT                   region; KEGG: mmc:Mmcs_0589 putative signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96392"
FT                   /protein_id="ABN96392.1"
FT                   /translation="MNRARTPAAALFRRVFLINGLIFTLGTLVLAVSPASVSSRIRLTE
FT                   IPVLVVGLAVILSANALLLRSSLAPLDRLTASMRRVDPPRRSDRVDDRGSGDLHHLIES
FT                   FNAMLDRLETERTTASASALAAQENERQRIARELHDEIGQTLTVALLTLKRAVDRAPAE
FT                   IRGELEETQETVRASLDEVRGIARRLRPDALEDLGLQSALNALCNEFAQATGLPVVKHI
FT                   ALPAARLAPDVELVCYRIAQESLTNVARHADARKVWVDLHVADDQVTLRIADDGAGGAG
FT                   DAGEGAGISGMRERALLVNATLTIASPPGEGTEVRLTIPYRDGSR"
FT   sig_peptide     634265..634384
FT                   /locus_tag="Mjls_0580"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.668 at
FT                   residue 40"
FT   gene            635245..635892
FT                   /locus_tag="Mjls_0581"
FT   CDS_pept        635245..635892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0581"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2; KEGG: mmc:Mmcs_0590
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96393"
FT                   /protein_id="ABN96393.1"
FT                   /translation="MPARILLADDHALVRSGLRLIIDAEPDLQVVAEAADGHEALEALE
FT                   RTPTDLAILDIAMPRMTGLQAAREISRMHPHVRILILSMHDNEQYFFEALKAGASGYVL
FT                   KSVADRDLLAACRATLRGEPFLYAGAVTALIRDYLHRARSGDELPDTILTPREEEVLKL
FT                   VAEGYSTREIAATLSISAKTVDRHRANILAKLGLRDRLALTRYAIRAGLIEP"
FT   gene            complement(635852..636319)
FT                   /locus_tag="Mjls_0582"
FT   CDS_pept        complement(635852..636319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0582"
FT                   /product="protein of unknown function DUF1707"
FT                   /note="PFAM: protein of unknown function DUF1707; KEGG:
FT                   mmc:Mmcs_0591 protein of unknown function DUF1707"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96394"
FT                   /protein_id="ABN96394.1"
FT                   /translation="MTVPTTVRVGDDDRTRTANLLGLALAQGYLDMPDYEQRLQAAFAA
FT                   QTNTELHSLTADLPVATLRRNDPARRAERRRAARRGVRWHLAGYLAMVVIVLTVWLAVG
FT                   LAAGAWYFWPIWPILGAGIGVLGHALPVRYVGGSPCGRLTARSVPPGWRIG"
FT   gene            complement(636413..638638)
FT                   /locus_tag="Mjls_0583"
FT   CDS_pept        complement(636413..638638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0583"
FT                   /product="Vesicle-fusing ATPase"
FT                   /EC_number="3.6.4.6"
FT                   /note="KEGG: mmc:Mmcs_0592 vesicle-fusing ATPase; PFAM: AAA
FT                   ATPase, central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96395"
FT                   /protein_id="ABN96395.1"
FT                   /translation="MTEAGLSEREPNLSHLRLTARLNTAALDSRRGVVRLHPEVIAALG
FT                   IREWDAVSLTGARTTAAVVGIAPPGTPTGTALLDDVTLSNAGLPENSSVIVAPVTVYGA
FT                   RSVTVSGSRLATNSISPATLRQALLGKVMTVGDTVSLLPRDLGPGTSTSSATTALASSV
FT                   GITWTSELLTVTSVDPPGTVSIQPNSSVTWGDGPAPKAASARPTDGAAVGEATVTTPSV
FT                   DRPAVSFDDLKGSHAQAGRLTEWLKLSLDEPSLLETLGATAHLGVLVSGPAGVGKATLV
FT                   RTVCAQRRLVELDGPEVGALHAEDRLNRVSSAVSTVRDGGGVLLITDIDALLPATPEPV
FT                   GTLILTELRTAVATPGVAFVATSARPDGVDARLRDPDLCDRELGLSLPDAATRKELLEV
FT                   LLRSVPAQELHLDEIAGRTPGFVIADLCALVREAALRAAARASADGAPPQLTQADLTGA
FT                   LTVIRPLSRSATEEVSVGSVTLADVGDMTETKQALTEAVLWPLQHPDTFERLGIEPPRG
FT                   VLLYGPPGCGKTFVVRALASSGRLSVHAVKGAELMDKWVGASEKAVRELFRRARDSAPS
FT                   LVFLDEIDALAPRRGQSFDSGVTDRVVASLLTELDGIEPMRNVVVLGATNRPDLIDPAL
FT                   LRPGRLERLVFVEPPDAEARREILRTAGKSVPLADDVDLDTLAAGLDGYSAADCVALLR
FT                   EAAMTAMRRSIDAADVTAADVEAARQTVRPSLDPLQVDTLRAFAENR"
FT   gene            complement(638640..639506)
FT                   /locus_tag="Mjls_0584"
FT   CDS_pept        complement(638640..639506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0584"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="KEGG: mmc:Mmcs_0593 CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase; TIGRFAM:
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96396"
FT                   /protein_id="ABN96396.1"
FT                   /translation="MIQPRSIPKRVVSLRMLPSAMTVAAICLGLSSVKFALDGRPTEAM
FT                   AFLAVAAILDALDGRIARMLKATSKMGEEIDSLADAVNFGVAPAFIVYGTLLSQSRIGW
FT                   IVVLLYAVCIVLRLARFNAMLAEDLPAYTKEFFVGMPAPAGAIGAIGPLAAKMQFGDGW
FT                   WTSEIAVVIWMVGVSLLVVSTIPMRKIHTFSVPPNMVAPLLALLAIGVTASILYGYLVI
FT                   LVIILAYVIHIPFAVRTERWLAAHPETWDDKPRQRRAIRRASRREIRRTQPHRRSVARL
FT                   GLRKPGR"
FT   sig_peptide     complement(639366..639506)
FT                   /locus_tag="Mjls_0584"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.804 at
FT                   residue 47"
FT   gene            complement(639503..640210)
FT                   /locus_tag="Mjls_0585"
FT   CDS_pept        complement(639503..640210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0585"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: mmc:Mmcs_0594 phosphatidylserine
FT                   decarboxylase-related protein; TIGRFAM: phosphatidylserine
FT                   decarboxylase related protein; PFAM: phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96397"
FT                   /db_xref="GOA:A3PU20"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PU20"
FT                   /protein_id="ABN96397.1"
FT                   /translation="MARRPSTDDLRSGPERFMALVKTTVPPVHPAGLPFIGASLALAAA
FT                   GRRNRWVRGAGLVAAGANAAFFRHPPRVPPTRPGVVVAPADGLICLVEDAEPPAELNLP
FT                   ARPVPRVSIFLSIFDAHVQRIPISGEVVAVEHRPGLFGSAELAAASEDNERNSVVIRTD
FT                   TGAQVIAVQIAGLVARRIVCDLTTGDKVTIGDTYGLIRYGSRLDTYLPEGTDIQVLPGQ
FT                   RAVGGETILAELP"
FT   gene            complement(640246..641442)
FT                   /locus_tag="Mjls_0586"
FT   CDS_pept        complement(640246..641442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0586"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG: mmc:Mmcs_0595
FT                   MoeA-like, domain I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96398"
FT                   /protein_id="ABN96398.1"
FT                   /translation="MRTVEEHQRVVAGLIQRRPPVRLPIAATLGLTLAEDIVAPLSLPG
FT                   FDNSAMDGYAVVAEDVADATEDRPVYLPVAEDIPAGRTDPLVLQPGTAHRIMTGAPLPR
FT                   GATAVVPVEATNAATDTVAIRSAAKAGQHVRTAGEDVTAGTTVLRAGVALTPAALGLAA
FT                   ALGLGELSVIAPQRVLVMSTGTELVAPGIPLLPGQIYESNAVMLAAAVREAGGEVVAST
FT                   MTGDDVDAFRATLDRYAGQADLIVTTGGVSAGAYEVVKDTLGSSEVEFAKVAMQPGMPQ
FT                   GAGRVGETPVITLPGNPVSALVSFEVFLRAPLRAAMGADRPERPRRSAVLTEDLTSPRG
FT                   KRQFRRGVFDQHTGEVTSYGPPASHHLRWLASANCLLEIPEDVSELPAGSRVEVWDLS"
FT   gene            complement(641445..642365)
FT                   /locus_tag="Mjls_0587"
FT   CDS_pept        complement(641445..642365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0587"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0596 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96399"
FT                   /protein_id="ABN96399.1"
FT                   /translation="MSANTKWTAADVPDQEGRVAVITGANTGIGYEAAAVLAAKGAHVV
FT                   LAVRNTDKGGAAAERIRSALPHADVTVRELDLTSLDSIRAAADGLRADYPRIDLLINNA
FT                   GVMMTQKGTTKDGFELQLGTNHLGHFALTGQLLDNLLPVEGSRVVTVSSNAHRWGRVNF
FT                   DDLQSERSYNRVTAYGQSKLANLLFTYELNRRLSAKGAPTIAVAAHPGTSSTELTRNLW
FT                   PVARRPVELVWGLVSQTPEMGALPTLRAATDPDVRGGQYYGPDGIGEQRGHPKLVQSNA
FT                   RSYDEAAQRGLWSVSEELTGVTFPV"
FT   gene            642420..642917
FT                   /locus_tag="Mjls_0588"
FT   CDS_pept        642420..642917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0588"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: mmc:Mmcs_0597
FT                   membrane-flanked domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96400"
FT                   /protein_id="ABN96400.1"
FT                   /translation="MEYAPLVLADPEHRPSAKAPLLWAASAALPWLVLVVAQVAWWVTD
FT                   PASGWLHAVAAAGTVLGIVLFVGVVPVWRYRVHRWAVDARAVYTRTGWLTQERRIAPIS
FT                   RVQTVDTQRGPLDRMFGLSSVTVTTASSAGAVRIVALDAPVAERIVAQLTDIAALGEQD
FT                   AT"
FT   gene            642914..644374
FT                   /locus_tag="Mjls_0589"
FT   CDS_pept        642914..644374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0589"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: mmc:Mmcs_0598
FT                   membrane-flanked domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96401"
FT                   /protein_id="ABN96401.1"
FT                   /translation="MTAPAPQPQWLRLSPRMLLVHPVHEVLRQVPVLIGSVVLGSATGN
FT                   PWWAVAALVGTVGVGIARWFTTTYRIDAEEVQLRAGVLQRRVLSVPRNRIRSVSTDARL
FT                   LHRVLGLAVLRVSTGQEARGDDAFALDAVEAAQVPHLRAELLAESLTIAADSEHRGRVL
FT                   ASWQPAWLRYSPLSFTGLAMIAAAAGLLYQAGAGVLLRDSSLAEGGRGVAERFGVAATV
FT                   AVVVLAVLVGSVVLSVLRSLVTYGNLLLRRDGEVLHLEHGLLRRQEHTYDMRRLRGGTL
FT                   REPLLVRAFGGARLDAVMTGVGGEGEASLLLPPCPAATARAVLSDLIADEEEVAGPLRS
FT                   HGVAAARRRWTRALAVPVAMGVALVVATVLTAPPIWLWAVWAVLAVCCALLAADRVRSL
FT                   GHRAGDGWLVARTGSLERRRDCIAGPGIIGWTVQQTFFQRRSGVATLIAATAAGEKAYR
FT                   VVDVPADAAWSIVAAASPWVRDVPWARD"
FT   gene            644420..645235
FT                   /locus_tag="Mjls_0590"
FT   CDS_pept        644420..645235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0590"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   mmc:Mmcs_0599 HAD-superfamily hydrolase, subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96402"
FT                   /protein_id="ABN96402.1"
FT                   /translation="MAIGGVLFDIDGVLVTSWRPIDGAAEALRVLSDHQIARSYLTNTT
FT                   TKTRRQIADLLVDAGMAVTADEVITAAVLTAEYVRDRYPGARCFLVNSGRIGEDMPGVD
FT                   LVYAGEFGPDHVPETPDVVLLGGAGPEYDHLTLSWVYDWMARGVPVVAMHRSTSWNTAD
FT                   GLRIDTGMYLIGMEETSGRKATAVGKPAPEGFLAAAGRLGVDPEEMYIVGDDLNNDVLA
FT                   GQVVGMTGVLVRTGKFRQDTLDRWAADEFAMQPNHVIDSVADLPGLLGL"
FT   gene            645349..646731
FT                   /locus_tag="Mjls_0591"
FT   CDS_pept        645349..646731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96403"
FT                   /protein_id="ABN96403.1"
FT                   /translation="MPRTGAHAVVCGASMAGLLAARVLTEHYDRVTVVERDRLVDEPVA
FT                   RRGVPQSCQPHALLARCAQILDELFPGYLDELVAAGAHRWDDGDMSKFDISFGGHVMLQ
FT                   NAMMPKPESLVQHYASRPMLEHHVWRRVRELPRVDILDGHHVDRLLGSGPRVTGVRLSH
FT                   KCGATIDLDADLIVDASGRGSRTPALLAELGYQRPEVDELVIRVAYASMPVRIPPDTLR
FT                   QNLIVRMFEPGRPRGFVMFRCERDVWLVAAGTLGPIRPPTTPAELLDFGEGIAPAYALA
FT                   AARAAEPLAGVRVHQYPSNRWRRYDKLKRFPAGFVVLGDAFCSFNPIYGQGMTVAAIEA
FT                   TILRDCLRAGDADLPRRFHRAAAKTIRIAWQTAVGSDLALPEVQGRPSLSMRLTNAYTD
FT                   RVLRAAETDPVVTRDFLRVVGMVAPPAQLVHPATLARVARGQRRRATPVGDGAPVLTAA
FT                   GR"
FT   gene            complement(646712..647800)
FT                   /locus_tag="Mjls_0592"
FT   CDS_pept        complement(646712..647800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0592"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: mmc:Mmcs_0601
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96404"
FT                   /protein_id="ABN96404.1"
FT                   /translation="MVTLDEFSRLVSAIHDAAVTPDHWVDTMTDVRHSLGAITGAMLIA
FT                   DDVGRAADRASLPPDAHRTYREYYHRIDYVLEAVERGPVGLIHSGRQLIEQDERSEFNV
FT                   DWIRPNHMDDGMFVRLTGNDHPACFIVANPRRDESFVTTERAELVAALVPHFQQALRTE
FT                   KHLAELRRDAGDLAGAIDSMRQAVLVTGVNGIVLHSNAACDALLHRADGLTVRSGRLCA
FT                   FRSDVDCAVQRALADALGMNEAGARFGTSVLCPRPSGDRAYVAHAFPFPNREGEPRAIV
FT                   VIVDPDHRPQPPKDMLRNLFGLTNGEADVALRVANGQGLAPISDELSVSLATVKTHLQH
FT                   VFDKTDTHRQAELVRLLTALLP"
FT   gene            complement(647933..649615)
FT                   /locus_tag="Mjls_0593"
FT   CDS_pept        complement(647933..649615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0593"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="PFAM: type III restriction enzyme, res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases-like; KEGG: mmc:Mmcs_0602 type III restriction
FT                   enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96405"
FT                   /protein_id="ABN96405.1"
FT                   /translation="MRAYAAPDTQALRGWQRRALVRYLGAKPRDFLAVATPGAGKTTFA
FT                   LRIAGELLADGTVERVTVVVPTEHLKIQWAQAAARSGIALDPKFSNSSAQTSSEYHGVV
FT                   VTYAQVASHPTRHRVRTENYRTLVIFDEIHHGGDAKTWGDAMREAFSDATRRLSLTGTP
FT                   FRSDDSPIPFVNYVPDAEGLLRSESDHTYGYADALADGVVRPVIFLAYSGEARWRSSAG
FT                   EEHAARLGEPLNAEQTARAWRTVLDANGEWIPAVLKAADTRLRQLRAGGMPDAGAMIIA
FT                   TDQTAARQYAALLTKMTGEAPTLVLSDDPGSSARIAEYSAGDTPWLVAVRMVSEGVDVP
FT                   RLAVGVYATSASTPLFFAQAIGRFVRSRRPGETASIFVPSVPTLLDLASQMEAQRDHVL
FT                   GKPHRESMGDEELVEHRRSEPTEEDRGFESLGASAELDQVIFDGASFGTATPAGSEEEA
FT                   DYLGIPGLLDADQMRDLLRRRQEEQLTRRTASGEPPPVTPYGQLRELRQELNTLVSLAH
FT                   HRLNKPHGWIHNELRRICGGPPVAAATSDQLQARIAAVRTLKA"
FT   gene            649805..652351
FT                   /locus_tag="Mjls_0594"
FT   CDS_pept        649805..652351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0594"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; KEGG: mmc:Mmcs_0603
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96406"
FT                   /protein_id="ABN96406.1"
FT                   /translation="MTATSDARDDEHDPCVRVFGTRVHNLKGVDVAAPRDALVAFTGIS
FT                   GSGKSSLAFGTIYAEAQRRYFESVAPYARRLLLPTGAPKVDDITGLPPAVALQQRRGTA
FT                   TSRSTVGTVTTLSNLLRMLFSRAGTYPRGATERLDSDAFSPNTAVGACPECHGLGRIHQ
FT                   VTEQTLVPDPSLTIREGAVAAWPGAWQGQNLRDILITLGYDIDRPWHKLPKRQRNWILF
FT                   TDEQPTVEIDPSQHPVTADYYYNGTFSSAERHVRHTLANSQSATMRRRVLQYVDTVECG
FT                   MCGGSGLRPEALKVTFAGRTIADYVAMPLAGLAEALRPVAARTDAAAAYESTASGEFTE
FT                   VATMIATDLVARLQVLIDLGLGYLTLNRRTPTVSPGELQRLRLATQLRAGLFGVLYVLD
FT                   EPSAGLHPADAEPLLEVLDRLRRAGNSVFVVEHDMDVVRRADWIVDVGPGAGELGGQVL
FT                   YSGPVPGLAEIGESVTGRYLFDSAPTATRTPRPPSGWLRLGGISSHNLRGLDVDLPLGV
FT                   FAAVTGVSGSGKSTLVVKVLGDVVNRHLGRAVNQPDADAADGEDSDAEIVDLDHDASVG
FT                   VSVEGVEAITRLVAVDQRPIGRTPRSTLATYTGLFDAVRREFAATSAARRRGWTAGRFS
FT                   FNVADGRCPTCQGEGFVSVELLFLPGTYATCPTCHGARYNEATLGVRYRGRTIAEVLAM
FT                   TVDEAGEFFADIAGASRSLATLHEVGLGYLRLGQPATELSGGEAQRIKLASELQRPKRG
FT                   HTLYVLDEPTTGLHPADVDLLDAQLHRLVDAGNTVVVAEHDMRMVAGSDWVVDLGPGAG
FT                   ADGGQVVAAGTPAEVSRAERSRTAPYLAARLGHSTK"
FT   gene            complement(652336..652833)
FT                   /locus_tag="Mjls_0595"
FT   CDS_pept        complement(652336..652833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0595"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: mmc:Mmcs_0604 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96407"
FT                   /protein_id="ABN96407.1"
FT                   /translation="MSLVVPPYPPPRYTEDEPAVSAWVRRGDEPPDYDAFGLVRYHYLA
FT                   DQKATGGDYGLYRVEIAPRGGGPGPHYHRAMSEAFFVLSGSIKLYDGTEWSDGNPNDFL
FT                   YVPPGGIHGFRNDSDEPASILMLFAPGAPREHYFEGLAHLGELTDDERREWFVENDNYF
FT                   VE"
FT   gene            complement(652845..653747)
FT                   /locus_tag="Mjls_0596"
FT   CDS_pept        complement(652845..653747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0596"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0605 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96408"
FT                   /protein_id="ABN96408.1"
FT                   /translation="MTKWTTADIPSQSGRTAVVTGANTGLGLETAKALAARGAHVVLAV
FT                   RDTEKGKRAADEIAAAHPEAAVSVQSLDLGSLRSVRAAAEALKADFPRIDLLINNAGVM
FT                   YPPKQTTEDGFELTFGTNHLGHFALTGLLLENVLAAPNSRVVTVSSQGHRIRAAIHFDD
FT                   LQWERSYSRVGAYGQSKLSNLLFTYELQRRLDTRDAIAVAAHPGVSNTELMRHLHLPSV
FT                   FNPLVGVLTQSPTMGALPTLRAATDPTVRGGQYFGPSGLGEIRGYPELVTSSAQSRDVD
FT                   LARRLWTVSEELTGVAFPL"
FT   gene            653845..654429
FT                   /locus_tag="Mjls_0597"
FT   CDS_pept        653845..654429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0597"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0606
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96409"
FT                   /protein_id="ABN96409.1"
FT                   /translation="MARDAVGARPLRADAARNRDRVLRVAYETFAADGLTVPVDEIARR
FT                   AGVGAGTIYRHFPTKEALYTAVVEHRLYEMIERGRELLASGDPGEALFDFLRAIAVEWG
FT                   AADRVLIDGLAGWGLDVHTVAPEADAAARALLAELLAAGQRAGTVRADLTAPELKSILV
FT                   GLQAIGAYDAAVAARATAVVADGLRPPPSRH"
FT   gene            654609..656234
FT                   /locus_tag="Mjls_0598"
FT   CDS_pept        654609..656234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0598"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: mmc:Mmcs_0607 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96410"
FT                   /db_xref="GOA:A3PU33"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PU33"
FT                   /protein_id="ABN96410.1"
FT                   /translation="MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLR
FT                   NVAAGANPLGLKRGIEKAVEKVTETLLKSAKEVETKEQIAATAGISAGDQSIGDLIAEA
FT                   MDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDAERQEAVLEDPYILLVS
FT                   SKISTVKDLLPLLEKVIQSGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGD
FT                   RRKAMLQDMAILTGGQVISEEVGLSLETADISLLGQARKVVITKDETTIVEGAGDAEAI
FT                   QGRVAQIRAEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIVAGGGVALLQAAPSLEELNLTGDEATGANIVRVALEAPLKQIAFNGGLE
FT                   PGVVAEKVRNSAAGTGLNAATGEYEDLLAAGVADPVKVTRSALQNAASIAALFLTTEAV
FT                   VADKPEKSAAPAGDPTGGMGGMDF"
FT   gene            656424..657296
FT                   /locus_tag="Mjls_0599"
FT   CDS_pept        656424..657296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0599"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96411"
FT                   /protein_id="ABN96411.1"
FT                   /translation="MHHVNGPFLAREALDDGLLTFRELRRFHRADFPGVWMLRGSDLSM
FT                   DQLAHAAWLWSGRKAVVAGLAASALHGAKWIEPGAPVELVHTNRRPPTGIVVRTETLAP
FT                   EEMQRVGTLPVTSACRTVFDLGRRLRLGDGVQRIDALLNATDVKIADVEAVIARHPGVR
FT                   GLRQLRETLALVDGGAESPYESLTRLVLVQAGFPPPQTQIRVCDENGYVFARVDMGWPE
FT                   YLVGVDFEGAQHWTDPKQRSGDVVRYTRLAEMGWIDVRLTSGILHTRRQWFLDQVGAAL
FT                   ESRRCPKTW"
FT   gene            complement(657367..659088)
FT                   /locus_tag="Mjls_0600"
FT   CDS_pept        complement(657367..659088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0600"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: D-aminoacylase domain protein; Amidohydrolase
FT                   3; KEGG: mmc:Mmcs_0609 amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96412"
FT                   /protein_id="ABN96412.1"
FT                   /translation="MTFELVIRNGTIVDGLGGEPYAGDVAVSGGAIAAVGAVTERGDRE
FT                   IDATGLLVTPGFVDLHTHYDGQAIWSDRMTPSSAHGVTTAVMGNCGVGFAPCRPQDHDV
FT                   LVDVMAGVEDIPGVVMVDGLPWDWETFPEYLDAVDSRSRDIDVAAYLPHSPLRVYTMGQ
FT                   RGADREPATGEDLARMRALAKEAVEAGALGFASSRFALHKTSSGSPIPTYDAAQAEIAA
FT                   IAAGVADGGGGLLQFVPDIPAGGYETVLRQVFEVAADVGLPVTFSLLTGNTGDPVWPQA
FT                   MNLVEKFNAAGGSITAQMFPRPIGMVIGLEVTGNPFIMYPSYQEIADLPLAERVAEMRK
FT                   PEVRERILNDTPSAPGHPLMFMVQAWNWIFPLGENPDYEPAASTSIAARAAARGVSPLE
FT                   EAYDRLLDEDGHAMMLVALGNYENNSLDTVGELMHRDDVVLGLGDGGAHYGMICDASFP
FT                   TFMLTHWTRDRATGRLSVAEAVRELTSVPAGVAGLADRGRIAVGYKADLNVIDHAALHL
FT                   HKPVVVHDLPAGGKRLDQTADGYVATVVSGVVIAERGVPTAARPGKLVRGRQPAPA"
FT   gene            659111..659500
FT                   /locus_tag="Mjls_0601"
FT   CDS_pept        659111..659500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0601"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mmc:Mmcs_0610
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96413"
FT                   /protein_id="ABN96413.1"
FT                   /translation="MIDHFGINCADLDRSKEFYDKVLGVLGYTRQMDFGVAVGYGTEGH
FT                   PDFWIADMSEGNVAGPNREIHVGFAAKDAESVQAFYRTALALGAEPLHEPRLWPEYHEN
FT                   YYGAFVRDPDGNNVEAVFHGGGPRA"
FT   gene            659524..660042
FT                   /locus_tag="Mjls_0602"
FT   CDS_pept        659524..660042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0611 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96414"
FT                   /protein_id="ABN96414.1"
FT                   /translation="MPDSDAAAARELLRDSFTRLIEHVEDLTDELTDEVALYRPTATAN
FT                   SIAWLLWHSARVQDAQVCDIAGTEQVWTREGYVDQFALDLPRDDTGYGHSPDDVGKVRV
FT                   SADLLAGYYSAVHKMTLAYIASVTPEDLGQIVDRRWDPPVTASARLVSIIDDCAQHLGQ
FT                   AAYVQGISR"
FT   gene            660043..660582
FT                   /locus_tag="Mjls_0603"
FT   CDS_pept        660043..660582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0603"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   mmc:Mmcs_0612 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96415"
FT                   /protein_id="ABN96415.1"
FT                   /translation="MRSALHWWPVVAVAMMFALGLLVGRGSTPLDSRLLEIDIPDRLLV
FT                   FVQAPAQVAVLGAAVAYALWRKRWRLAAVTALCPPVAVVSAQLLKRVFGRTRDGELAYP
FT                   SGHITALVVVAGMVVLVAGGRLWAVAAAAVAVVVGMVLVGMSFHYFTDTVGALLLGSAW
FT                   VAVAARLVARTPSRAT"
FT   gene            660636..662153
FT                   /locus_tag="Mjls_0604"
FT   CDS_pept        660636..662153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0604"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0613
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96416"
FT                   /protein_id="ABN96416.1"
FT                   /translation="MTATPEVDARDSSTIRNPATGAVAGQVRWTDPADVTRIAAGLRAA
FT                   QTDWEARGAKGRAKVLARYAVWLGEHRAEIEDLLIKETGKSAVDAAQEVPLILMITSYY
FT                   VRTMEKALAPDSRPAALPFLSIKKITVHYRPRPVVGIIAPWNYPVANALMDAIGALAAG
FT                   CAVLLKPSERTPLTAELLLRGWQDSGAPEVLALAQGAREVSEAVIDNSDFIQFTGSSAT
FT                   GAKVMERAARRLTPVSLELGGKDPMIVLEDADVELAAHAAVWGAMFNAGQTCVSVERVY
FT                   VLESVYDQFVDAVVRDVKNLKMGAGEGNDFGALIDDGQVSVTERHVEDAIAKGAKALTG
FT                   GERRNGPGSFYEPTVLVDVDHSMACMTEETFGPTLPIMKVKSVEEAVRLANDSPYGLSA
FT                   AVFSKDVDRAKAVALQLDCGGVNVNDVISNLMCTTAPMGGWKTSGIGARFGGPEGLRKY
FT                   CRVETVVAPRTNVGAGGNYYNNSPKALKRMNTMMTKLALIRPRRMAK"
FT   gene            662171..663040
FT                   /locus_tag="Mjls_0605"
FT   CDS_pept        662171..663040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96417"
FT                   /protein_id="ABN96417.1"
FT                   /translation="MRFVLTALLWLLTTVLLAAAVPAVWAQQNLVSEQGYTEFAESAAT
FT                   DTRLRDAMADELTTQIVALAADRGYGLNEMLVHQVTSAYTGNAGFPGQFAQANRIAHRW
FT                   MFSDGVPQANADDQWLIDIAPMLSDPSLAATLGNLDLDVPDSLMVPVTVPSPELRPGRL
FT                   QAVATWGPWVSIGLAVLTAVFALLTLASSRRRGKGLAALGVSALLVGAAGWAGLEVANG
FT                   YIDDALNRTEGNFRRIADEMVRHAEDSLHHWLNLTLAAGGALVAVGVVVSLLGGLGRPP
FT                   ERSGIDRV"
FT   sig_peptide     662171..662251
FT                   /locus_tag="Mjls_0605"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 27"
FT   gene            complement(663020..663922)
FT                   /locus_tag="Mjls_0606"
FT   CDS_pept        complement(663020..663922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0606"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mmc:Mmcs_0615 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96418"
FT                   /protein_id="ABN96418.1"
FT                   /translation="MTEFETLLYRTDTDAAVATITLNRPDQLNTIVPPMPDEIESAIGL
FT                   AERDPQVKVIVLRGAGRAFSGGYDFGGGFAHWDESMNSDGRWDPGKDFAFVTGRATSPT
FT                   GKFMSIWRASKPVIAQVHGWCVGGASDYALCADIVIASDDAVIGTPYARMWGAYLTGMW
FT                   LYRLSLAKVKWHSLTGEPLTGVEAAAVELINESVPFERLEARVAEVAGRLARIPLSQLQ
FT                   AQKLIVNQAYENMGLASTQTLGGILDGLMRNTPEALEFIATAESHGVRAAVERRDGPWG
FT                   DYSQAPPHRRPDPSHSIDP"
FT   gene            663965..665188
FT                   /locus_tag="Mjls_0607"
FT   CDS_pept        663965..665188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0607"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmc:Mmcs_0616
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96419"
FT                   /protein_id="ABN96419.1"
FT                   /translation="MGASGRRLTGARAAATLADLGPASTAARAVRRMQQLREQFGAGPV
FT                   ELVLPGRRMVVVLDPDDVRRVLAGAPEPFHPANREERKSLEWSQRRDLDDAALDSGAEM
FT                   HRLAGAFGDVIAAEARELTDEVTARGTMDANQFMAAWWRIVRRIALGDRARDDDEITDA
FT                   LLRLRRARNWSFLSMPHYRTRARFLERLYDYVEDPQIGTLAAAVPASGAVDPVGPLPQW
FT                   LFAFDAAGIAQLRALAVLATHPAAMARAIEDAAEPDRLRLRPFLRACVLESVRLWPTTP
FT                   TILRETTEKGAGLMIVTPAFHRDPKLLPFANDFVPDIWLDGRARSYPQLVPFSAGPAEC
FT                   PGRNLALFTTSTLLANLLSALDFRISSMPHLSPDEPLPVTLNQHGLEFAVVTAPRWRHH
FT                   RAGSAVRS"
FT   gene            complement(665136..665990)
FT                   /locus_tag="Mjls_0608"
FT   CDS_pept        complement(665136..665990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0608"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0617 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96420"
FT                   /protein_id="ABN96420.1"
FT                   /translation="MSTDFDRRERKAFDLTGKVVVVVGAGQSPGPGMGNGRAISLLAAR
FT                   HGAEVVAVDLNPAAVKETVEMILAEGGKAYAIEADVAEKDDCRRIFDTAMATSGRVDGM
FT                   VYSVATNPPFDIETNSMTVENFNRGINVNMLGCYYCNLYAAQCMERNDGDSTGSIVNLS
FT                   SIASVKNELGLNIGIMPYALGKSGLNQITELTAVQYAAAGIRANTLMLGPIDSVLAKND
FT                   SQSLFGLDAEEATQRHNEVVKLKMGRGSVWESAYAAVYLLADESRFMTGQQIRLDGGAT
FT                   LVR"
FT   gene            complement(665980..666186)
FT                   /locus_tag="Mjls_0609"
FT   CDS_pept        complement(665980..666186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0609"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmc:Mmcs_0618 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96421"
FT                   /protein_id="ABN96421.1"
FT                   /translation="MRVTVDDDLCRGHGVCAAVCPSVFVITDGGYAEATADGIPPDLEA
FT                   SVREAVDGCPEHAIHIKEENHVN"
FT   gene            complement(666183..667454)
FT                   /locus_tag="Mjls_0610"
FT   CDS_pept        complement(666183..667454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0610"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmc:Mmcs_0619
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96422"
FT                   /protein_id="ABN96422.1"
FT                   /translation="MTTLESLDFFHDETLIDDPYPVLNQMREAGPVLREPVHGVMIVTG
FT                   YDEALAVLGDPETFSSCNSVTGPIPGFPVPLEGLDGAEVSALIDAHREELPFSDQLPSF
FT                   DPPKHTAHRSLLSRLITPKRLKENEEFMWTLADRVLDPFLAQGGGEFIRQVAGKFALLV
FT                   VADLLGVPEEDHAELTARLTGDMALGSTDDTVMEHAPLEYLYTRFTDYIDDRRKAPRDD
FT                   IMTGMALATFPDGSTPEVIDVVRVAANLFSAGQETTVRLLSTALQLVAENAELQAALRD
FT                   SPDKISNFNEECLRFESPIKGDFRLARATTTLGGVEIPAGTTLMVHLGAANRDPRHFDN
FT                   PNVFDPDRPNARRHIGFGRGVHSCIGAPLARAEGRVLLERLLARTTAITIDEAAHGPAG
FT                   ARRYAYVPTYVLRGLTDLHVKVTR"
FT   gene            667567..668148
FT                   /locus_tag="Mjls_0611"
FT   CDS_pept        667567..668148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0611"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0620
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96423"
FT                   /protein_id="ABN96423.1"
FT                   /translation="MSSQTIAHGGPTRQRLIDVAIELFKQHSVAGTSLQMISDELGLTK
FT                   SAIYHHFRTRDELLSAVMEPLIAEVTALVEAAEARTGVRARADHLLCGYAALAAAHRDL
FT                   IPLLTGDPGVVALLRIRADWGAVVERQMAVFAAVEPGLGGQVKAAVVMSGIASAAGADY
FT                   GDADDAELRDQLIAAGRRALGLRAPHGRSR"
FT   gene            complement(668156..669631)
FT                   /locus_tag="Mjls_0612"
FT   CDS_pept        complement(668156..669631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0612"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: HNH endonuclease; protein of unknown function
FT                   DUF222; SMART: HNH nuclease; KEGG: mmc:Mmcs_0621 protein of
FT                   unknown function DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96424"
FT                   /protein_id="ABN96424.1"
FT                   /translation="MFDTVFAGLEESALLAAIEQSAREEAQAGARKLAAIAQLVHLTVT
FT                   CDEECDGWVYDSWAAAASEIGAVLNIGHKRASGQMRIAVALRDRLPKVAALYLQGRLSA
FT                   RLISEISWRTRLVDDEQVLGLLDAALAEAALRWGPLSEARLARALDAVIHRYDRDAVIR
FT                   AKDTVKTRDFHIGSVDDPDELVLVWGQLLGCDAAALSARIAALLKGICDNDPRSVGERR
FT                   SCAVGAIVQGHDHLPCRCGSPACAAAAPEKSNVVISVIADPAAIEAAQKLIAAEDEHHA
FT                   AKDEPEPAACPQDSGVALLPGVKLLPIVALAEAIRGGAAIKPLWLPGPDPEPHYRPSAT
FT                   LAAFVRARDLFCRFPGCDVPAERCDIDHVVPWPYGPTHASNLNCKCRTHHLGKTFWDGW
FT                   HDEQSPDGTVTWTTPTGKRHTTVPGSRLFFPEWDTTTAELPPLAQPPPDPGRTAKMPKR
FT                   RRTRAADNAARVKAEREHNAAQRNSRAERPPPF"
FT   gene            complement(669727..670134)
FT                   /pseudo
FT                   /locus_tag="Mjls_0613"
FT   gene            670176..671735
FT                   /locus_tag="Mjls_0614"
FT   CDS_pept        670176..671735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0614"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mmc:Mmcs_4037 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96425"
FT                   /protein_id="ABN96425.1"
FT                   /translation="MSFSEDCVRFGDRLARLVDAGVPVKEAAVATGVSRDRCYAILRAI
FT                   GRPVGQARGRGERADQRGVADLGVVVAVFKDTGSILQAATACGVSHSTARKLLVAEGLV
FT                   TSGKIPWGKPEAKRRCLELFEQGWSTGAAAREVGVNVRTARDWRKGIRHTNNTRVHPDG
FT                   RVVDYTDRTVYKQSVSNLICDDTGRPAIDDRYLSVQDRVAIADGLLGKESLRTIAGRIG
FT                   KNVSTVSREIRARSIDGRYLPYHADRAAASARARPKQSKLVVNVVLRGAVEEGLSRKLS
FT                   PEQISNRLRRDHPDDESMQVSHETIYQALYFQARGGLKKEVQQALRTGRTRRKPHRKEG
FT                   ERYQRFTDPMVMISDRPAEVDDRAVPGHWEGDLITGEKNQTAIGTLVERSTRYTMLVHL
FT                   PGGHDAESVRDALIATISTLPAHLRGSLTWDQGCEMAGHKQFTMATDMAVYFCDPASPW
FT                   QRGSNENTNGLLRQYFPKGTDLSIYGPENLEHVAQELNGRPRKTLGWDTPAERLRDLLL
FT                   TN"
FT   gene            complement(671732..672655)
FT                   /locus_tag="Mjls_0615"
FT   CDS_pept        complement(671732..672655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0615"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mmc:Mmcs_1731 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96426"
FT                   /protein_id="ABN96426.1"
FT                   /translation="MVAVNEPIDPLVRLAISQWPDNAPRGAVSTFCAEYGISRKSFYEL
FT                   RKRVKTEGPAAVLEPMTRRPKSSPSKLSDEVKEQALAVRAALEATGLDHGPISVHDKMH
FT                   AMGLERVPSTASLARVFREAGVARLEPKKKPRSAWRRFVYPAPNACWQLDATEYVLSGG
FT                   RRCVIFQLIDDHSRYALASHVALSETAKEAIAVVDKAIAAHGVPQRLLSDNGIALNPSR
FT                   RGHVGQLVAHLAALGVEAITGKPYKPTTQGKNERFHQTLFRYLDKQPIAESLAELQCHV
FT                   DAFDGIYNTERPHQGAVSRGRRNTAG"
FT   gene            complement(672786..674777)
FT                   /locus_tag="Mjls_0616"
FT   CDS_pept        complement(672786..674777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0616"
FT                   /product="Prolyl oligopeptidase"
FT                   /EC_number="3.4.21.26"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site domain protein; peptidase S9A, prolyl oligopeptidase
FT                   domain protein beta-propeller; KEGG: mmc:Mmcs_0623 prolyl
FT                   oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96427"
FT                   /protein_id="ABN96427.1"
FT                   /translation="MTVDDAHLWLEDITGDDALDWVRRHNEPTLADLGGERFEQMRAEA
FT                   LEVLDTDARIPYVRRRGEYLYNFWRDAANPRGLWRRTTLESYRTEEPDWEVVIDVDALA
FT                   RADDENWVWAGADVIDPDHTRALISLSRGGADAAIVREFDMVSMEFVDGGFELPEAKTA
FT                   ITWEDEDTVLVGTDFGEGALTESGYPRLVKRWRRGTPLTEAETVYSGEPADVIVTASVD
FT                   RTPGFERTVVRRAVDFFNDEVYELRAGELSRIDAPTDATVSAHRDWLLIELRSDWDGYR
FT                   AGSLLAAKYDEYLDGTRALQVVFEPDEHTCLHHYAWTKDRLVVVTLADVASRVEVYTPG
FT                   EWTAQPVPGLPDNTNTVIVAADDLGDEIFLDSSGFDTPSRLLQGAAGGELTEIKRAPSF
FT                   FDAADLKVDQHFATSADGTKIPYFVVGHRHQQAPGPTLLGGYGGFEVARTPGYDGVLGR
FT                   LWLSRGGTYVLANIRGGGEYGPTWHTQAMREGRHLVGEDFAAVAADLVERGITTVDRLG
FT                   AQGGSNGGLLMGIMLTQYPELFGALVCSVPLLDMRRFHLLLAGASWVAEYGNPDDPDDW
FT                   EFISKYSPYQNISAERRYPPVLITTSTRDDRVHPGHARKMTAALEDAGQPVQYYENIEG
FT                   GHGGAADNSQAAFRAALIYEFLWRKLGG"
FT   gene            complement(674802..676640)
FT                   /locus_tag="Mjls_0617"
FT   CDS_pept        complement(674802..676640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0617"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96428"
FT                   /protein_id="ABN96428.1"
FT                   /translation="MTQTLADPREPTTDLTPQQRVDAWLADFEAALAVRDIERVVAKFA
FT                   TDSFWRDLVAFTWNIKTLEGRDGIADMLTARLTETDPARFRTREAPTVDGDVTTAFIEF
FT                   ETGVGRGVGHLRLRGDECWTLLTTMQEIKGHEERKGPSRVLGAVHGSDPDPRSWAEKRA
FT                   EEDAALGRTVQPYALVIGGGQGGIALGARLRQLGVPAIVVDRHERPGDQWRKRYKSLCL
FT                   HDPVWYDHLPYLPFPQNWPVFAPKDKIGDWLEFYTRVMEVPYWSKTTCLSAVFNPGSDG
FT                   APDTWTVEVDRDGERLTLRPTQLILATGMSGKPSVPTLPGQDVFRGEQHHSSAHPGPDR
FT                   YVGKRAVVIGSNNSAHDICKALVENGVDTTMVQRSSTHIVKSDSLMDLGLGDLYSERAL
FT                   AAGMTTEKADLTFASLPYRIMHEFQTPIYDAIRERDKDFYERLTAAGFELDWGDDGSGL
FT                   FMKYLRRGSGYYIDVGACDLVADGTIKLAHGQVSHLTEDTVVLADGTELPADVVVYATG
FT                   YGSMNGWAADLIGQDVADKVGKVWGLGSSTTKDPGPWEGEQRNMWKPTQQENLWFHGGN
FT                   LHQSRHYSLYLALQLKARFEGIPTPVYGLQEVHHLS"
FT   gene            676757..677569
FT                   /locus_tag="Mjls_0618"
FT   CDS_pept        676757..677569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0618"
FT                   /product="acetoin reductase"
FT                   /note="TIGRFAM: acetoin reductases; PFAM: NAD-dependent
FT                   epimerase/dehydratase; short-chain dehydrogenase/reductase
FT                   SDR; KR; KEGG: mmc:Mmcs_0625 insect alcohol dehydrogenase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96429"
FT                   /protein_id="ABN96429.1"
FT                   /translation="MATQIPAPLSGKVALVTGAGRGIGRGIAVELARQGADIALVDVSE
FT                   AGLPDAAAEISEIGSKTTTFVADVRDRDAVFAAVDHAAAALGGFDVMVNNAGIALVGPI
FT                   AEVTAEDLARLWAINVDGVLWGIQAAAAKFKELGNQAEGKVSKIINASSIAGHEGFAML
FT                   GPYSATKFAVRALTQAAAKEYAADGITVNAYCPGVVGTDMWVEIDKRFAELTGAAEGET
FT                   FEKFSETIALGRPETPQDVAGFVAYLAGPGADYMTGQAGLIDGGMVYR"
FT   gene            677613..678926
FT                   /locus_tag="Mjls_0619"
FT   CDS_pept        677613..678926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0619"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; KEGG: mmc:Mmcs_0626
FT                   putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96430"
FT                   /protein_id="ABN96430.1"
FT                   /translation="MPRPPVPEPAVAAGEDPRQYARLMSAVYDATMAGGRAPARPRKVI
FT                   EDSWRRLMARGIEPDTLPDPEVEGATLEEMRHSSGLMSVLEDLSRGLESLIVEGDNILV
FT                   VADARGRVLWRAGSRAVLGSADRLGFIEGAHWGENAVGTNAIGTALMSNAAVQVFSAEH
FT                   FSRSHHPWTCAGAPIKDPRTGHVIGVVDVSGPAATVHPTTVALVDAVARLAESHLREQH
FT                   NRTLNSLRMVAAPILARIGSPALAVDPDGWVAAVDSLPPHNRIALPREVTPGRLLVPAL
FT                   GLCDVDPLPGGWLVRLAGDREADSGSQVALDLRNPEAPVLKMVGQAGGWRRDLSLRHAE
FT                   ILLALAVQRQGRSAPELAADLYGDASRVVTVRAEVSRMRKQFIGLLAAQPYRITDTVHL
FT                   DVQYPADRMRLLPTSTAPVVRAARIGPTNSQPHQGGNA"
FT   gene            678923..680446
FT                   /locus_tag="Mjls_0620"
FT   CDS_pept        678923..680446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0620"
FT                   /product="Aldehyde dehydrogenase (NAD(+))"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0627
FT                   aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96431"
FT                   /protein_id="ABN96431.1"
FT                   /translation="MTVYARPGAADALMAFESRYGNFIGGEWVAPAGGEYFENLTPVTG
FT                   QTFCEIPRSTEADIDKALDAAHGAATAWGKTSPGERAQILIKIADRLEANLESLALAES
FT                   WDNGKPIRETLNADIPLAIDHFRYFAGAIRAQEGALSQIDEDTVAYHFHEPLGVVGQII
FT                   PWNFPILMATWKLAPALAAGNAVVLKPAEQTPASILYLMSLIADLLPAGVVNVVNGFGV
FT                   EAGKPLASSNRIAKIAFTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFSDVMAAND
FT                   DYQDKALEGFTMFALNQGEVCTCPSRSLVQADIYDEFLELAAIRTKAVRQGDPLDTETM
FT                   IGSQASNDQLEKVLSYIEIGKDEGARVVTGGERAELGGDLNGGFYVQPTIFEGKNSMRV
FT                   FQEEIFGPVVAVTSFKDYDDAISMANDTLYGLGAGVWSRDGNTAYRAGRDIKAGRVWTN
FT                   CYHMYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKNLLVSYSNKAQGFF"
FT   gene            680447..680941
FT                   /locus_tag="Mjls_0621"
FT   CDS_pept        680447..680941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0621"
FT                   /product="protein of unknown function DUF779"
FT                   /note="PFAM: protein of unknown function DUF779; KEGG:
FT                   mmc:Mmcs_0628 protein of unknown function DUF779"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96432"
FT                   /protein_id="ABN96432.1"
FT                   /translation="MTPPRALITQAAADLLTRLQGRHGALMFHQSGGCCDGSSPMCYPD
FT                   GDFIVGDRDVLLAVLDVGADGVPVWISGPQFDTWKHTQLVIDVVPGRGGGFSLEAPEGM
FT                   RFLSRARAFTDAENAELAQDPPVTGARYADGDRPAGRAPVVARAEDACPIPGRRAARVQ
FT                   G"
FT   gene            680971..681249
FT                   /locus_tag="Mjls_0622"
FT   CDS_pept        680971..681249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0622"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96433"
FT                   /protein_id="ABN96433.1"
FT                   /translation="MIPLPRAWLLTSAMLVGAAIGLVAAVTSTLLITATVRPDLVIALV
FT                   VGVPGAVGVVTILCSARRWVTTVGAFILAIGPGWLGTLALIEVVNGG"
FT   sig_peptide     680971..681048
FT                   /locus_tag="Mjls_0622"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.957 at
FT                   residue 26"
FT   gene            681242..681784
FT                   /locus_tag="Mjls_0623"
FT   CDS_pept        681242..681784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0623"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96434"
FT                   /protein_id="ABN96434.1"
FT                   /translation="MADNGNEHPTGEHTSPYLPTFDTGGFSQPDPVTPLAARPEPTLTL
FT                   DREPDPLAYEALDFEPDSEPMVVPPAQPIVLPGSYQFLKRWLFALVLSAVWVVAAAVGA
FT                   GLYYWWVGDLDPDKTWPVYVVLVYLLGCTVAGLIVAMVARKPVVTALAIALMSAPPAST
FT                   AGAAALYGAYVFGWIAH"
FT   gene            681816..683216
FT                   /locus_tag="Mjls_0624"
FT   CDS_pept        681816..683216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0624"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; HI0933 family protein; KEGG: mmc:Mmcs_0631
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96435"
FT                   /protein_id="ABN96435.1"
FT                   /translation="MTHYDVVVLGAGPGGYVAAIRAAQLGLNTAIVEPKYWGGVCLNVG
FT                   CIPSKALLRNAELAHIFTKETKTFGISGEATFDYGAAFDRSRKVAEGRVAGVHFLMKKN
FT                   KITEVHGYAKFTDDHTIEVDLNEGGTETLTFDNAIISTGASTKLVPNTSLSENVVTYEE
FT                   QIMERELPGSIVIAGAGAIGMEFGYVMKNYGVDVTIVEFLPRALPNEDAEVSKEIEKQF
FT                   KKLGVKIMTGTKVESIKDEGGDGSVTVTVSKDGKSQELKTDKVLQAIGFAPNVEGYGLD
FT                   KAGVELTDRKAIGIDDYMRTNKPHIYAIGDVTGKLQLAHVAEAMGVVAAETIAGAETLP
FT                   LGDYRMMPRATFCQPQVASFGLTEEQAREEGYDVKVAKFPFTANGKAHGMGAPGGFVKL
FT                   IADAKYGELIGGHLIGHDVSELLPELTLAQKWDLTANELARNVHTHPTLSEALQEAFHG
FT                   LAGHMINF"
FT   gene            683213..683482
FT                   /locus_tag="Mjls_0625"
FT   CDS_pept        683213..683482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96436"
FT                   /protein_id="ABN96436.1"
FT                   /translation="MRNEIVAGVGGFVIGHILWLIAITLATNTSDVSTWVLVVAALSFV
FT                   VGAALGYLGWRRFQRKEHVWSSFVWGLAVSPVLFSIVVLGVTYL"
FT   gene            complement(683487..684023)
FT                   /locus_tag="Mjls_0626"
FT   CDS_pept        complement(683487..684023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0626"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mmc:Mmcs_0633 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96437"
FT                   /protein_id="ABN96437.1"
FT                   /translation="MTRIAPGGFRELGPLNWAIAKAGARAIRAPRFSLFNVLGQHRLLF
FT                   LAFLPYSGVLLGRLGKLSRQDAELVILRVGHLRECEYELQQHRRLARSRGVGADLQARI
FT                   FEGPDAEGLTDRQRVLVTATDEFVVTRGVSPQTWSVLARHLTKPQLIEFCLLAAHYDGL
FT                   AATISTLQVPLDFPD"
FT   gene            complement(684020..685447)
FT                   /locus_tag="Mjls_0627"
FT   CDS_pept        complement(684020..685447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0627"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; KEGG: mmc:Mmcs_0634
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96438"
FT                   /protein_id="ABN96438.1"
FT                   /translation="MAKTFVGSRVRQLRNERGYSQAALAQMLEISPSYLNQIEHDVRPL
FT                   TVAVLLRITEVFGVDATFFASQDDTRLVAELREVTMDRELGVEVDVSEIADMVAAHPTL
FT                   ARAMVNLHRRYRLTTTQLAAATEDRYSDGTGSSSGSGSISMPHEEVRDYFYQRQNYLHE
FT                   LDSAAEDLTVRMRMHRGDLAGELSNRLSTVHGVHIVRRIDLGETVLHRFEPGTKTLEMS
FT                   THLSVGQQVFKMAAELAYLEFGDLIDKMVDEGMFTSDESRTLARLGLANYFAAATVLPY
FT                   RQFHDVAENFRYDVERLSAFYQVSYETIGHRLSTLQRPSMRGVPFSFVRVDRAGNMSKR
FT                   QSATGFHFSSSGGTCPLWNVYETFANPGKILVQIAQMPDGRNYMWVARTVERRASRYGQ
FT                   PGKTFAIGLGCELRHAHRLVYSEGLDLSGENATPIGAGCRVCERDNCPQRAFPALGRAL
FT                   DLDEHRSTVSPYLVKQS"
FT   gene            685567..686382
FT                   /locus_tag="Mjls_0628"
FT   CDS_pept        685567..686382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0628"
FT                   /product="acyl-ACP thioesterase"
FT                   /note="PFAM: acyl-ACP thioesterase; KEGG: mmc:Mmcs_0635
FT                   acyl-ACP thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96439"
FT                   /protein_id="ABN96439.1"
FT                   /translation="MSGTTTGTGLSKTMMPVPDPHPDVFDTGWPLRVADVDRTGRLKFD
FT                   AATRHIQDIGSDHLRELGYEKTHPLWIVRRTMIDLIRPIEFQDMLRLRRWCSGTSNRWC
FT                   EMRVRIDGRKGGLMESEAFWININRETQGPARISDDFIAGLQRTTDVNRLRWKAYLSAG
FT                   SRDDAEEIREYPVRVSDIDIFDHMNNSVYWSVVEDYLYNHPELLTAPLRVTIEHDLPVA
FT                   LGDKLEIISHVHPPGSTDKFGADLTDRTVRTLTYVVGDETKAVACIFPL"
FT   gene            686649..687935
FT                   /locus_tag="Mjls_0629"
FT   CDS_pept        686649..687935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0629"
FT                   /product="isocitrate lyase"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: mmc:Mmcs_0636 isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96440"
FT                   /protein_id="ABN96440.1"
FT                   /translation="MSTVGTPKSPEEIQKDWDTNPRWKGITRDYSPADVVALQGSVVEE
FT                   QTLARRGAEVLWNQLHDMEFVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGH
FT                   TYPDQSLYPANSVPQVVRRINNALLRADEIAKVEGDTSVENWLVPIVADGEAGFGGALN
FT                   VYELQKAMIAAGVAGSHWEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVP
FT                   TVVIARTDAEAATLITSDVDERDQPFITGERTKEGFYRVKNGIEPCIARAKAYAPYSDL
FT                   IWMETGTPDLELARKFAEGVQAEFPDQMLAYNCSPSFNWKKHLDDATIAKFQKELGAMG
FT                   FKFQFITLAGFHALNYSMFDLAYGYARNQMTAYVELQEREFAAEERGYTATKHQREVGA
FT                   GYFDRIATTVDPTSSTTALTGSTEEGQFH"
FT   gene            688026..688886
FT                   /locus_tag="Mjls_0630"
FT   CDS_pept        688026..688886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0630"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding;
FT                   KEGG: mmc:Mmcs_0637 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96441"
FT                   /protein_id="ABN96441.1"
FT                   /translation="MSNPIERVGVIGAGQMGAGIAEVSARAGVEVLVFETTDALVTAGR
FT                   NRITKSLERGVSAGKVTDREKSAALGKLSFTTDLADMADRQLVIEAIIEDVAIKAKVFA
FT                   ELDKVITDPDAVLASNTSSIPIMKLAAATQNSGRVLGLHFFNPVPVLPLVELVSTLTTT
FT                   DAAIARTEAFASDVLGKQVVRCSDRSGFVVNALLVPYLLSAIRMVEAGFATVEDVDKAV
FT                   VAGLSHPMGPLRLSDLIGLDTMKLIADAMFDELKDAHYAPPPLLLRMVEAGQLGKKSGQ
FT                   GFYSY"
FT   gene            complement(688930..689784)
FT                   /locus_tag="Mjls_0631"
FT   CDS_pept        complement(688930..689784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0631"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96442"
FT                   /protein_id="ABN96442.1"
FT                   /translation="MGAALIIATEALESGELTRRDLRRRYTMVYRNVYIRNGLQLTAED
FT                   RARAAWLWSGRRATLTGHCAAALLGSRWIPPDAPVEIAHTRRPAARGMIARCNTFHDNE
FT                   VCVVDGIRCTTVARTAYDLGRRLTEQMGVVRIDALLNATGVAPSTVAAVAARHPGARGI
FT                   RRLRKTLTLVDAGAESPQETRLRLLIIRSGLPRPVTQIPVHNELGRVVRRIDMGWPDAM
FT                   VGIEYDGEQHFTNPDDYAADIERLEFLAARGWLIVRVSATQLRHRRAEIIDRVTAARRA
FT                   HGC"
FT   gene            complement(689918..690784)
FT                   /locus_tag="Mjls_0632"
FT   CDS_pept        complement(689918..690784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0632"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   mmc:Mmcs_0639 protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96443"
FT                   /protein_id="ABN96443.1"
FT                   /translation="MSREPELPALWSHDPHVHLRFRTGDKVGDIETDATPGFIGSKSDA
FT                   PVLQAERSMRLGELQEKLYANSRAGDTRSVLLILQGMDTAGKGGIVKHVVGAANPQGVK
FT                   YTSFGKPTAEELAHHYLWRIRNALPTPGHIGVFDRSHYEDVLVVRVHNLVPPDVWGARY
FT                   DEINAFEREIVDSGTSIVKVAMFVSLQEQKRRLAERLERPDKYWKYNPADIDERLLWPQ
FT                   YEQAYQAVLDRTSTDYAPWHVVPCDRKWYSRLAITELLIEALKRLNMSWPPPDFDVKAE
FT                   KKRLANA"
FT   gene            complement(690781..691488)
FT                   /locus_tag="Mjls_0633"
FT   CDS_pept        complement(690781..691488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0633"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0640
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96444"
FT                   /protein_id="ABN96444.1"
FT                   /translation="MAQQTPPLAVKTDGRKRRWHQHKVERRNELVDGTLEAIRRRGSNV
FT                   SMDEIAAEIGVSKTVLYRYFVDKNDLTTAVMMRFAQTTLIPNMAAALMSNLDGYDLTRE
FT                   IIKVYVETVANEPEPYRFVMANNSASKSKAVADSERIIARMLAVMLRRRMAQAGMDTGG
FT                   VEPWAYHIVGGVQLATHSWMSHPRMSADELIDYLTMLSWSALCGIVEVGGSLEKFRSEP
FT                   HPSPILPPQLMEQ"
FT   gene            691581..692903
FT                   /locus_tag="Mjls_0634"
FT   CDS_pept        691581..692903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0634"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   mmc:Mmcs_0641 protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96445"
FT                   /protein_id="ABN96445.1"
FT                   /translation="MMEPVVSTQQSERPSFAEAIAGADSAADAERRRGLRRMKTVALGF
FT                   LLGATVIFLVCTWAQSQGAAAPWIGYVRAAAEAGMVGALADWFAVTALFKHPLGIPIPH
FT                   TAIIKRKKDQLGEGLGEFIRENFLSRENVETKLRSAEVAGRLGKWLSDRSHAERVATEA
FT                   SNVLRVLVEMLRDEDVQQVLDRMIVKRIAEPQWGPPVGRVLSQLLQEGRQEALIQLLAD
FT                   RAFEWSLNAGEVIERVIERDSPTWSPRWVDHLVGDRIHRELMDFTDKVRRNPDHELRRS
FT                   ATKFLFEFADDLQNDDATIERAENVKEQIMARDEVARAAETAWSAAKRIILESVDDPSS
FT                   TLRARISDSVMRIGESLRDDAELRDKVDNWIIRGAQHVVGEYGAEITTIVTDTIERWDA
FT                   DEASSRIELHVGRDLQFIRINGTVVGSLAGLVIYSIAQLLF"
FT   gene            692999..693484
FT                   /locus_tag="Mjls_0635"
FT   CDS_pept        692999..693484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0635"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mmc:Mmcs_0642 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96446"
FT                   /protein_id="ABN96446.1"
FT                   /translation="MSQDENLAAVVTNAAQDIGSFIRSQREAAQVSVRQLAEKAGVSNP
FT                   YLSQIERGLRKPSADVLNQIAKALRVSAEVLYVRAGILEPSEAGQVRDAILSDTAITER
FT                   QKQVLLDIYTSFCQQNEVAGSEVDEEPTTAHTPISGDPIQRALETTPEDSRKDIHHG"
FT   gene            693477..694088
FT                   /locus_tag="Mjls_0636"
FT   CDS_pept        693477..694088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0636"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96447"
FT                   /protein_id="ABN96447.1"
FT                   /translation="MAEKNPQVDIEDLKAPLLAAVGAADLALATVNEIVASLRDRAEEA
FT                   RTDANSRVEESRARINKLQEELPTQVTELRERLTADELRRAAEGYAEAAQSTYAKLVER
FT                   GEAALERLRSQPGFTDAANRVETYTDQAVELTEQALGNVATQTRAVGERAAKLVGVELP
FT                   KKTEETAEPVKAAAKKAPAKKAPAKKAPAKKAPAKKVTQK"
FT   gene            694131..694415
FT                   /locus_tag="Mjls_0637"
FT   CDS_pept        694131..694415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0637"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96448"
FT                   /protein_id="ABN96448.1"
FT                   /translation="MILADLAGVIVLGLVLIVLVVGVYSFVHAAIQRPDAYTAAGKLTK
FT                   PVWLAILGGGVLILLLFRDAFGAAVCACAAGVYLVDVRPKILEIQGKSR"
FT   sig_peptide     694131..694220
FT                   /locus_tag="Mjls_0637"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.947) with cleavage site probability 0.875 at
FT                   residue 30"
FT   gene            694420..694836
FT                   /locus_tag="Mjls_0638"
FT   CDS_pept        694420..694836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0638"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96449"
FT                   /protein_id="ABN96449.1"
FT                   /translation="MRYFLAAVTAALVLPLSMSLSPVAAAQPAPPPPYIDHVTWAKWGD
FT                   LSSLRVYPTTAGRQAAGQVGTVAEAEHAWAEVLAASPDAAIPGMREQFDCHWQFAEFAA
FT                   PGKTSWNLEPWRPEVPVEQMVAAGCNPGGTEEPF"
FT   sig_peptide     694420..694500
FT                   /locus_tag="Mjls_0638"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.734 at
FT                   residue 27"
FT   gene            694836..695516
FT                   /locus_tag="Mjls_0639"
FT   CDS_pept        694836..695516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0639"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="KEGG: mmc:Mmcs_0646 deoxyribose-phosphate aldolase;
FT                   TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96450"
FT                   /protein_id="ABN96450.1"
FT                   /translation="MGGWTRERVAGLVDHTLLKPEAGEGDVEALVEEAEALGVYAACVS
FT                   PSMVPAAVRMRPFSTKIAAVVGFPSGKHLPAVKAHEAALAVAAGADEIDMVIDVGAALA
FT                   GDIDAVRADIAAVRAAIGERTLLKVIVESAALLELGGRDVLVDTCLAAKAVGAEYVKTS
FT                   TGFHPLGGASAGAVEIMVAAVGPQVEVKASGGIRTAADAIAMLDAGATRLGLSATRAVL
FT                   DDLD"
FT   gene            complement(695524..696396)
FT                   /locus_tag="Mjls_0640"
FT   CDS_pept        complement(695524..696396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96451"
FT                   /protein_id="ABN96451.1"
FT                   /translation="MTDPWARPADQQPVPPPPPFPQGAPPSAPGPGAEPPKERGSLLAK
FT                   VKDMFSDPLSIVLAVVIVVALTAAGLLGGELYARNRADDVVSRVVSCVVEDEATASFGA
FT                   MPPFLLQHMTGHYTNIDIETAGNQIRDAKGMKVGIDIQDVRLEDTANSSGTIGSLAANI
FT                   TWSSEGITQTVQDAIPLFGSFLNGVSTNPSAGTIELEGALGSIVAKPQVSNGGITLQVQ
FT                   QLSGLGFTLPREAVQPALDAFTSGLTQNYPMDIKAQSVEVTDTGVTALFSTQNAEIPKS
FT                   GEDPCFNGL"
FT   gene            complement(696393..697220)
FT                   /locus_tag="Mjls_0641"
FT   CDS_pept        complement(696393..697220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0641"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: mmc:Mmcs_0648 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96452"
FT                   /protein_id="ABN96452.1"
FT                   /translation="MSGAMRIACAQIAAGTDPAANLEVLEDHTGRAVDAGAQLVLFPEA
FT                   TMCRFGVPLAPVAEPLDGPWASAVRSIAERAGVTVVAGMFTPSGDGRVLNTLIATGGGV
FT                   DTHYHKIHLYDAFGFRESRTVAPGSEPATITVAGVEVGLTTCYDIRFPELYVELARRGA
FT                   QLITVHASWGAGPGKLDQWTLLARARALDTTGYLAAVDQAYPGDEVAASGPTGIGGSLV
FT                   ASATGEVVVSAGADPQLMVADLDLDAARNVRETIAVLNNRAEVDSPGRAESRA"
FT   gene            697308..698825
FT                   /locus_tag="Mjls_0642"
FT   CDS_pept        697308..698825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0642"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: mmc:Mmcs_0649
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96453"
FT                   /protein_id="ABN96453.1"
FT                   /translation="MVLFGVGVSIAVVVLVGFLVSRRIAGDSANFLVGGRTLPLILVGG
FT                   ALMGSAVDTNATLGNTDLASEFGFWAGACLPLGLALCLLFTGLFFAKPMNRMGLTSFPD
FT                   YYRLRFGRGVEVAASVMLMIGFCILVAGNLVAGGFLFNYFLGIPYWLGTVVIAALAVAY
FT                   TGTGGLLADAYTAIIQMAMILVGAVGLLIWMVLTHGLAIEEGMGPLDLGQMTDPAQGAT
FT                   VNWATLIALGIGDIVAIDFMQRVFAAKSPETARRACFGAAAGVVAICVPFGLVVLSARA
FT                   FLPDDLDGPILLVLLDGYAPLALTILVLCGLVGASMSTANGAILAISNVCVRNLGGVRR
FT                   THVPGQPDPLLRATRIAMVPVTLLAIAIAIYVKQTGILLTLAFDLLLACLVVPFILGLV
FT                   WRKGTSTAALASIVVGLSVRLVLFVMTPTMYGLDNTILYIPNGVFDATFDGWPTFIAFA
FT                   ASLATYVVVALVTPAAPIRGLDIQMAEDLDDALAAEPVTARPLTTAR"
FT   sig_peptide     697308..697388
FT                   /locus_tag="Mjls_0642"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.969) with cleavage site probability 0.617 at
FT                   residue 27"
FT   gene            complement(698794..699585)
FT                   /locus_tag="Mjls_0643"
FT   CDS_pept        complement(698794..699585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0643"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96454"
FT                   /protein_id="ABN96454.1"
FT                   /translation="MTQSPNAPIGVLTRGTTGHNRLRRSDRWLVHSPRVRTALRSAADP
FT                   LVVDLGYGALPITTLELASRLRSVRPDARVVGLEIHPERVAAARAAAPSDVEFALGGFE
FT                   LAGLRPVLVRAFNVLRQYPVDAVAGAWEVMRSRLAPGGLIVDGTCDELGRRCAWVLLDA
FT                   VGPVSFTLACDPFAIERPSDLAERLPKVLIHHNVPGQPIHRLLAAADRAWAGVAGHGVF
FT                   GPRIRWRAMLDLLAAEGFPVEPPRRRMRDGVLTVPWSTVAP"
FT   gene            complement(699592..700095)
FT                   /locus_tag="Mjls_0644"
FT   CDS_pept        complement(699592..700095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0644"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96455"
FT                   /protein_id="ABN96455.1"
FT                   /translation="MEHTVAFDAPAAHVHAQFTSEDYWRELTDVYRALNPRTELTLFRS
FT                   DARGTDIALRQVMPRDDLPPVARKVMPVDLVITREQHFDPFDDGAACAHGRFAATMPRA
FT                   PGRLEGRYELSDTPAGSRLLVHSTCKVSIPLVGGTLEDLILTNMRTLFDGEQRFTAERV
FT                   SGRR"
FT   gene            complement(700131..700640)
FT                   /locus_tag="Mjls_0645"
FT   CDS_pept        complement(700131..700640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0645"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96456"
FT                   /protein_id="ABN96456.1"
FT                   /translation="MPRSFDLAADYEGTVEDVHRAFSDQRYWLARLADSGADHATLDGM
FT                   TVGEDGSIDVTTTQTLRADRLPGVVAQFHRGDLEIQREETWTGLRDGRATATVTGSIPG
FT                   APVTLNGTAVLSPGASGGSRLELKATVEVRVPLVGGKIENFIGNGLVDLIIAEQRFTTV
FT                   WITENV"
FT   gene            700667..701719
FT                   /locus_tag="Mjls_0646"
FT   CDS_pept        700667..701719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0646"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; KEGG: mmc:Mmcs_0653 UDP-N-acetylmuramate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96457"
FT                   /db_xref="GOA:A3PU80"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PU80"
FT                   /protein_id="ABN96457.1"
FT                   /translation="MTGQELAGAEVEADVALAPLTTLRVGPVARRLITATSTEQLVAAL
FT                   RAPVGRDALILAGGSNVVLADDMADLTVIRVANSEITVHDGIVRAEAGANWDDVVVTAL
FT                   AHGLGGLECLSGIPGSAGATPVQNVGAYGSEVADTIRRVRLFDRRTGRDDWVTPQDMAF
FT                   GYRTSVLKHSDHAVVLEVEFALDVGGRSAPLRYGELARALDVEPGGRADPVAVRDAVLA
FT                   LRRGKGMVLDEPDRDTWSVGSFFTNPVVTTADHERLAAEVDGPVPSYPAPDGVKLAAGW
FT                   LVEHAGFGKGYPGDDAPARLSTKHALAVTNRGHATTADVIALARTVRDGVRTTFGIELT
FT                   PEPTLVGCTL"
FT   gene            701735..703027
FT                   /locus_tag="Mjls_0647"
FT   CDS_pept        701735..703027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0647"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mmc:Mmcs_0654 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96458"
FT                   /protein_id="ABN96458.1"
FT                   /translation="MSAADKLPPMNRRRALTALAVGLVAPGALAACSRSISNPGEAAQA
FT                   PASASLAFEPATSATDVSPTEPVRVEVSGGWFQRVALMNAQGKPVAGALNQDRNVFTVS
FT                   EPLGYGVTYSWSGSAVGEDGKAVPVSGKFTTLDPATQVNGQFQLSDGQTVGVAAPVILQ
FT                   FDASIGDEDRATVEKALSVTTNPPTEGSWAWLPDEAAGSRLHWRSKEYFAPGTTVRVDA
FT                   RFYGVKFGEDAYGAADSSLDFTIGRRQVVRAEASSHRIQVIDEAGAVIMDFPCSYGEGD
FT                   LDRNVTRSGIHVVTEKYEDFYMTNPAAGYANVRERFAVRISNNGEFIHANPASLGSQGN
FT                   SNVTNGCINLSESDAEQYFRTALYGDPVEVTGTRIQLSYADGDIWDWAVPWEEWKSMSA
FT                   LSDQASPAGIPSTAPVTPTGAPQPVNGRPGG"
FT   sig_peptide     701735..701863
FT                   /locus_tag="Mjls_0647"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.352 at
FT                   residue 43"
FT   gene            complement(703036..703791)
FT                   /locus_tag="Mjls_0648"
FT   CDS_pept        complement(703036..703791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0648"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0655 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96459"
FT                   /protein_id="ABN96459.1"
FT                   /translation="MTTSRGDQRVAVVTGASAGIGEATARTLAAQGFHVVCVARREEPI
FT                   KALADEIGGTAIVADVTSTEAVDALAAALDRVDVLVNNAGGARGLDPIAEADIEHWRWM
FT                   WESNVLGTLLVTRALLPKLIDSGDGLIVTVTSIAAVEIYDNGGGYTSAKHAQGVLHRTL
FT                   RSELLGKPVRLTEVAPGMVKTDFSLNRFEGDEERAEKVYEGVTPLVAEDIAEVIGFVAS
FT                   RPSHVDLDLIVIRPRDQVSGASGSRFNRR"
FT   gene            703974..705284
FT                   /locus_tag="Mjls_0649"
FT   CDS_pept        703974..705284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0649"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: mmc:Mmcs_0656 ROK
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96460"
FT                   /protein_id="ABN96460.1"
FT                   /translation="MRATLDSAPAASVAVRRLPASKRPLAAAPPRITHQRHVVAPALKV
FT                   ADAAASSVFAAARMRGPIARDAIARVTGLSIATVNRQVSALLDAAILRERADLAVSGAI
FT                   GRPRVPVEVNHEPFLTLGIHIGAKTTSIVATDLFGRTLDVVETPTPRGPQDAALAVLSA
FT                   SARKYLSRWHRRRALWVGVAAGGVVDGVTGHLDHPRLGWSHAPVGPVLAESLGLPVSVA
FT                   SHVDAMAGAELLLGARRPTVAPSSTSLYVYARETVGFALSIDGRVHSPTSGPGTIAALP
FT                   AQSELLGGSGQLESTVSDEAVLTAARRQRIIAADGPTSTMAAVLRAARQGNDAAQALLA
FT                   ERARVLGEAVALLRDMLNPDDLVVGGQAFTEYPEAMPLVEAAFTARSVLPGRDIRLTTF
FT                   GNRVQEAGAGVVSLGGLYADPIAAMRRSGARRPEAAS"
FT   gene            705320..706639
FT                   /locus_tag="Mjls_0650"
FT   CDS_pept        705320..706639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0650"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mmc:Mmcs_0657 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96461"
FT                   /db_xref="GOA:A3PU84"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PU84"
FT                   /protein_id="ABN96461.1"
FT                   /translation="MRLATDQLGRPPQRVAVLSVHTSPLAQPGTGDAGGMNVYVLQSAL
FT                   HMARRGVEVEIFTRATTSADPPVVRVAPGVLVRNVVAGPFEGLDKYDLPTQLCAFTAGV
FT                   LRAEATHEPGYYDIVHSHYWLSGQVGWLARDRWAVPLVHTAHTLAAVKNAALAEGDSPE
FT                   PPLRAVGEQQVVDEADRLIVNTELEAEQLVSLHNADPSRIDVVHPGVDLDTFTPGDQAA
FT                   ARAALGLDPRETVVAFVGRIQPLKAPDILLRAAAKLPDVRVLVAGGPSGSGLAAPDNLV
FT                   ALADELGISERVTFLPPQSREDLVRVYRAADLVAVPSYSESFGLVAVEAQACGTPVVAA
FT                   AVGGLPVAVRDGVTGALVDGHDVGDWAHTIDSLLSRGPATMRRAAVEHAATFSWAHTVD
FT                   DLLASYGRAISDYRDRHPHADETLSRRTARRFSRRRGVRA"
FT   gene            706636..707169
FT                   /locus_tag="Mjls_0651"
FT   CDS_pept        706636..707169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0651"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96462"
FT                   /protein_id="ABN96462.1"
FT                   /translation="MSDDGPLGQRTDDTVQRTIVDTLEEHDLAYTFHEGAHGGLPGIIV
FT                   ELPGERRLKTNTILSIGEHSVRIEAFVCRKPDENHEGVYRFLLKRNRRLYGVAYTLDNV
FT                   GDIYLVGRMALHSVTADEIDRILGQVLEAVDNDFNTLLELGFKSSIQREWEWRVSRGES
FT                   LKNLRAFEHLIDDD"
FT   gene            707211..707957
FT                   /locus_tag="Mjls_0652"
FT   CDS_pept        707211..707957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0652"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: mmc:Mmcs_0659 phosphoglycerate mutase 1
FT                   family; TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96463"
FT                   /protein_id="ABN96463.1"
FT                   /translation="MGDSTLILLRHGESEWNAKNLFTGWVDVDLTDKGRAEATRAGELI
FT                   ADLDRLPDELYTSLLRRAITTANIALDKADRHWIPVHRDWRLNERHYGALQGLNKAETK
FT                   EKYGEEQFMAWRRSYDTPPPPIEAGSEYSQDRDPRYADIDGGPLTECLADVVARFVPYF
FT                   EQTIVPDLREGKTVLIAAHGNSLRALVKYLDGMSDEDVVGLNIPTGIPLRYDLDSDLKP
FT                   TVAGGTYLDPEAAAAGAAAVASQGAK"
FT   gene            708091..709269
FT                   /locus_tag="Mjls_0653"
FT   CDS_pept        708091..709269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0653"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: mmc:Mmcs_0660 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96464"
FT                   /protein_id="ABN96464.1"
FT                   /translation="MSVASALLMTAVVALLTLLVGVGVGVALTPRVAERRRRRAAETAG
FT                   ITVSQMLAHIVSSSPVGIVVVDKFRDVVYSNVRAEELGLVRDRLLDERAWEAAQHTLST
FT                   GEDVQVDLSPRKVAHPGRSGLSVRGAARLLTKADRRFAVVYVDDHSEYARMEATRRDFV
FT                   ANVSHELKTPVGAMGLLAEALLASADDPETVRRFAGKMVDEAHRLADMIGELIELSRLQ
FT                   GGERLPDLGVVDVDTVVSEALSRHKVAADNADIAITTDAPTGFKVLGDQTLLVAALANL
FT                   VSNAIAYSPRGTPVSVSRRRRGDNIEISVTDRGIGIDKDDQERVFERFFRVDKARSRAT
FT                   GGTGLGLAIVKHVAANHNGAIRLWSQPGTGSTFTLSIPAYPRPQEVDDEPSQ"
FT   sig_peptide     708091..708174
FT                   /locus_tag="Mjls_0653"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.664 at
FT                   residue 28"
FT   gene            709285..709971
FT                   /locus_tag="Mjls_0654"
FT   CDS_pept        709285..709971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0654"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mmc:Mmcs_0661 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96465"
FT                   /protein_id="ABN96465.1"
FT                   /translation="MTSVLIVEDEESLADPLAFLLRKEGFETTVVADGPSALAEFDRAG
FT                   ADIVLLDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   ARELIARIRAVLRRGTDVDDPGVPDGVLEAGPVRMDVERHVVSVNGQSITLPLKEFDLL
FT                   EYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGL
FT                   GYKLEG"
FT   gene            complement(709993..710280)
FT                   /locus_tag="Mjls_0655"
FT   CDS_pept        complement(709993..710280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0655"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: mmc:Mmcs_0662
FT                   YCII-related"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96466"
FT                   /protein_id="ABN96466.1"
FT                   /translation="MFLFKLVPPRADFAQTMTADEQQAMAGHQDYWRDLLAAGKVVVYG
FT                   PVADPEGVWGLGVLRAADRAEVLEIGRHDPSVLAGVNTFEVFEIMGGTTG"
FT   gene            complement(710292..711065)
FT                   /locus_tag="Mjls_0656"
FT   CDS_pept        complement(710292..711065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0656"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96467"
FT                   /protein_id="ABN96467.1"
FT                   /translation="MPAHPGEVELDFAREWVEFYDPDNPEHLIAADMTWLLSRWTCVFG
FT                   TPACQGTVEGRPDDGCCSHGAFLSDDDDRARLDAAVEQLTADDWQFRDKGLGKKGYLEM
FT                   DEYDDKPNLRTRKYKGACIFLNRPGFAGGIGCALHTKALKLGVEPLTMKPDVCWQLPIR
FT                   RTQDWVTRPDGSEILKTTITEYDRRGWGEGGADLHWYCTGDPAAHVGARQVYESYGPEL
FT                   TELLGEKAYAELAAMCRRRSGLGLVAVHPATRAAQ"
FT   gene            711163..712242
FT                   /locus_tag="Mjls_0657"
FT   CDS_pept        711163..712242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0657"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: mmc:Mmcs_0664
FT                   Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96468"
FT                   /protein_id="ABN96468.1"
FT                   /translation="MRLGVLDVGSNTVHLLVVDARRGGHPTPMSSTKASLRLAEAIDDS
FT                   GKLTRKGADRLVATVDEFAKIATSSGCAEMMAFATSAVRDATNSDDVLARVLAETGVRL
FT                   RVLSGVDESRLTFLAVRRWYGWSAGRIINIDIGGGSLELSNGGDEEPEVALSLPLGAGR
FT                   LTREWLPDDPPGRRRVAMLREWLANELSDASTELLEAGSPDLAVATSKTFRSLARLTGA
FT                   APSGAGPRVKRTLTATGLRQLIAFISRMTAADRAELEGVSAERAPQIVAGALVAEASMR
FT                   ALGIESVDICPWALREGLILRKLDSEADGSAFVGGTEVGGADDLTRVSGMDDLAAVETP
FT                   VRDAGPKALSPTATKGNTR"
FT   gene            712239..713213
FT                   /locus_tag="Mjls_0658"
FT   CDS_pept        712239..713213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0658"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96469"
FT                   /protein_id="ABN96469.1"
FT                   /translation="MTEPDNSSSSTRPISVAELLAKNGTIGAPPVGGRRRRRRGNADAV
FT                   TVAELTGEIPIVTDRASDTREERADETARIPVNGATQEQETVTEPAPEDVVEPEVTEVA
FT                   EFETEELDDVDVDEDIPLEQDTVEQDTVGAEDMSPDPLLDDDEEPADLLDSDLDEPARE
FT                   RSETDDDELPSYLRSSAGPLFGGGTVADDLARRGKDADTATIDEHDDEDELDEHDLRDD
FT                   TRDDLRDDDVEAGGRMSAFLRGAWIVGQCIIAVAFGAGLFIAFDQLWKWNNIVALVLSV
FT                   LVILGLVVGVRVVRKTEDIGSTLIAVAVGALVTLGPLALLQSG"
FT   gene            713221..714066
FT                   /locus_tag="Mjls_0659"
FT   CDS_pept        713221..714066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0659"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: mmc:Mmcs_0666 xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96470"
FT                   /protein_id="ABN96470.1"
FT                   /translation="MRPAIKVGLSTASVYPLRTEAAFEYAARLGYDGVELMVWAEAVSQ
FT                   DIDAVARLSAQYGVPVLSVHAPCLLISQRVWGANPIPKLDRSVRAAEQLGAQTVVVHPP
FT                   FRWQRRYAEGFSEQVAELEAGSDVMVAVENMFPFRADRFFGAGQTSIERMRKRGGRPGP
FT                   GISAFAPSYDPLDGDHAHYTLDLSHTATAGTDAIEMAQRMADGLVHLHLADGSGASADE
FT                   HLVPGRGTQPTAEVCQMLANGDFSGHVILEVTTSGARTANEREALLRESLQYARAHLLR
FT                   "
FT   gene            714098..714949
FT                   /locus_tag="Mjls_0660"
FT   CDS_pept        714098..714949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0660"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0667 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96471"
FT                   /protein_id="ABN96471.1"
FT                   /translation="MSGSTLFTDAMALTALGEGRYRGELNEHWTIGPKVHGGAMLALCA
FT                   NAARLEHGTAGQERNDSGGGESGVEPIAVSANFLWAPDPGPMDVVTTVRKRGRRVSLID
FT                   VELQQGDRVAVRAAITLGEPEHQTPPLLSVNPVVPLMTPEPPPGLEPIGPGHHMADIVH
FT                   LAHGCDIRPSLTTMAPRSDGGAPVIEYWVRPRDAAPDVLFALLCGDVSAPVTFGVNRFG
FT                   WAPTVQLTAYLRARPADGWLRVICTTTQIGQEWFDEDHVVVDCEGRIVVQSRQLAMVPA
FT                   AQ"
FT   gene            714986..715870
FT                   /locus_tag="Mjls_0661"
FT   CDS_pept        714986..715870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0661"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: mmc:Mmcs_0668 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding; Ketopantoate
FT                   reductase ApbA/PanE, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96472"
FT                   /protein_id="ABN96472.1"
FT                   /translation="MLWRMARIAIIGGGSMGEALLSGLLRAGRQVKDLVVAEKHPDRAK
FT                   FLAEKHSVLVTSVVEAIDNAHYVIVAVKPADVEHVIDDIAEAAANADTDTAEQVFVTVA
FT                   AGVSTAYYENKLPAGAPVIRAMPNAPVVVGGGVSALAPGRFATPEHLKEVSAIFDSVGG
FT                   VLTVPESQLDAVTAVSGSGPAYFFLMVEALVDAAVASGLSRTVATDLVVQTMAGSAAML
FT                   LERLDEAQPVGDAAMGTAMDTTAAQLRATVTSPAGTTAAGLRELERGGLRSAVANAVEA
FT                   AKTRSEQLGITSE"
FT   gene            716009..716263
FT                   /locus_tag="Mjls_0662"
FT   CDS_pept        716009..716263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0662"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   KEGG: mmc:Mmcs_0669 excisionase/Xis, DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96473"
FT                   /protein_id="ABN96473.1"
FT                   /translation="MTSMNGPSARDSAGGKRESGADGQQPRAQFLTVAEVASLMRVSKM
FT                   TVYRLVHNGELPAVRVGRSFRVHAKAVHDMLESSYFDAG"
FT   gene            716414..716515
FT                   /locus_tag="Mjls_0663"
FT   CDS_pept        716414..716515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0663"
FT                   /product="Protein of unknown function DUF1713"
FT                   /note="PFAM: Protein of unknown function DUF1713"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96474"
FT                   /protein_id="ABN96474.1"
FT                   /translation="MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK"
FT   gene            716565..717638
FT                   /locus_tag="Mjls_0664"
FT   CDS_pept        716565..717638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0664"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   C-terminal domain; KEGG: mmc:Mmcs_0671 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96475"
FT                   /protein_id="ABN96475.1"
FT                   /translation="MVDSSTSGDVGSYPKVVLVTGACRFLGGYLIARLAQNPLINHVIA
FT                   VDAIAPSKDLLRRMGRAEFVRADIRNPFIAKVIRNGDVDTVVHAAAASYAPRAGGRAAL
FT                   KELNVMGAIQLFAACQKAPAVRRVILKSTSEVYGSSPRDPVMFTEDSDARRPPGEGFAR
FT                   DSIDIEGYARGLGRRRPDIGVTILRLANMIGPAMDTALSRYLAGPVVPTVLGQDPRLQL
FT                   LHEQDALGALERATTAGKSGTFNIGASGIIMMSQAIRRSGRVALPVPRSALSLVDSLRR
FT                   ATRYTELDREQLNYLSYGRVMDTTRMREVLEYHPKWTTAEAFDDYVRGRGLTPIVDPRW
FT                   VRSVEDRAVGVAQRWGR"
FT   gene            717672..718733
FT                   /locus_tag="Mjls_0665"
FT   CDS_pept        717672..718733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0665"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   mmc:Mmcs_0672 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96476"
FT                   /protein_id="ABN96476.1"
FT                   /translation="MSGESKAKVIPLHGTSGRNAARRAAQRADSARRHPSLLSDPGSRA
FT                   SAEQIAAVVREIDQHRAGGLGAGVEETPTELAKRIAAVAEFVRKRMSGDYTVDEFGFDS
FT                   HLNSAVFLPILRVLFNSWFRVEVSGTENLPAEGAALVVANHAGVLPFDGMMLSVAVKDH
FT                   HPVHRDLRLLAADLVFDLPMVGQAARKAGHTMACTSDAHRLLAAGELTAVFPEGYKGLG
FT                   KQFKDRYKLQRFGRGGFVSAALRTKAPIVPCSIVGSEEIYPMMADVKLLARLLGLPYFP
FT                   VTPLFPVAGPLGLVPLPSKWHIQFGEPISTEDYDESAADDPMITFELTDQVRETIQHTL
FT                   YQLLAGRRNMFFG"
FT   gene            complement(718755..719288)
FT                   /locus_tag="Mjls_0666"
FT   CDS_pept        complement(718755..719288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0666"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mmc:Mmcs_0673 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96477"
FT                   /protein_id="ABN96477.1"
FT                   /translation="MAIAEEIIGTHYRYPDYFEVDREKIREFARAVKDDHPAHHDEAAA
FT                   KESGYDALIASLTFLAVAGRKVQAEIFNQFDVPINMERVLHRDQKITFHRPIVAGDKLF
FT                   FDSYLDSVIEAHGTVVTEVRGEVSDEAGKPVLTSVVTVIGEAAHDNEADEISATIKARR
FT                   DAAIAKMVSGQNAK"
FT   gene            complement(719334..720236)
FT                   /locus_tag="Mjls_0667"
FT   CDS_pept        complement(719334..720236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0667"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: mmc:Mmcs_0674 HAD-superfamily subfamily
FT                   IB, PSPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96478"
FT                   /protein_id="ABN96478.1"
FT                   /translation="MSETGGTHAERQQIAGDASAAAAVTELETEPVPAPPAPPPDLTAA
FT                   AFFDVDNTLVHGSSLVHFARGLAARKYFTYGDVLGFVYAQAKFQLTGRENSDDVAAGRS
FT                   KALSFIEGRSTAELVALGEEIYDEIIASKIWPGTRALAQMHLDAGQQVWLVTATPYELA
FT                   ATIARKLGLTGALGTVAESVDGVFTGRLVGDILHGTGKAHAVRSLAIREGLNLRRCTAY
FT                   SDSYNDVPMLSLVGTAVAINPDAALRSLARERGWEIRDFRTARKAARIGVPSAVALGAL
FT                   GGALAAVVSRRQDGRTGWR"
FT   gene            720272..720526
FT                   /locus_tag="Mjls_0668"
FT   CDS_pept        720272..720526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0668"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin 2; KEGG: mmc:Mmcs_0675
FT                   glutaredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96479"
FT                   /protein_id="ABN96479.1"
FT                   /translation="MVDHAIELLTRAGCGLCEQAAARLAELSGELGFGLTITDVDAAAA
FT                   GGDAALRAEYGDRLPVVLLDGAEHSYWEIDEPRLRADLG"
FT   gene            720617..721960
FT                   /locus_tag="Mjls_0669"
FT   CDS_pept        720617..721960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0669"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="PFAM: glutamyl-tRNA reductase; Shikimate/quinate
FT                   5-dehydrogenase; KEGG: mmc:Mmcs_0676 shikimate/quinate
FT                   5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96480"
FT                   /db_xref="GOA:A3PUA3"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PUA3"
FT                   /protein_id="ABN96480.1"
FT                   /translation="MSVLLFGVSHRSAPVSVLEQLSTDESDQAKIVDQVLQSSLVTEAM
FT                   VLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHCGMSLNDLTKYAYVRYAEAAVEHLFAVA
FT                   SGLDSAVIGEQQVLGQVRRAYTSAEANHTVGRTLHELSQRALSVGKRVHSETGIDAAGA
FT                   SVVSVALDIAEAKLGSLAGRTAVVIGAGSMGALSAKHLVRAGIERVHVVNRSLPRARRL
FT                   AQSLLDQGVTADAHTLDDIAHALADADVVITSTGAVRPVVSLADAHRGLTGRPEHRRLV
FT                   ICDLGMPRDVEPAIAGLPGVNVIDMERIQREPSARAAASDADAARSIVAAEVANYLAGQ
FT                   RMAEVTPTVTALRQRAADVVEAELLRLDNRLPELDAAHRAEVAKTVRRVVDKLLHAPTV
FT                   RVKQLASAPGGDSYAEALRELFELDQQAVDAVAAGELPLLPIELDKSE"
FT   gene            721964..722908
FT                   /locus_tag="Mjls_0670"
FT   CDS_pept        721964..722908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0670"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: mmc:Mmcs_0677 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96481"
FT                   /protein_id="ABN96481.1"
FT                   /translation="MSNADTPIRIGTRASLLATTQAGTIRDALIGRGHAAELVLISTEG
FT                   DRNQGPIADIGVGVFTAALREAIHDGRVDAAVHSYKDLPTAADERFTIPAIPRREDPRD
FT                   ALVARDGLVLGELPAGSTVGTSSPRRAAQLRALGLGLEIRPLRGNLDTRLNRVGNGELD
FT                   GIVVARAGLARIGRLGDVTETLEPVQMLPAPAQGALAVECRAGDTGLIALLAELDDADT
FT                   RAAVTAERVLLAELEAGCSAPVGAIAEVVESIDEDGRVFEEVSLRGCVAALDGSDVIRA
FT                   SGIGTPGRAADLGVSVAAELFELGARELIADHH"
FT   gene            722933..724597
FT                   /locus_tag="Mjls_0671"
FT   CDS_pept        722933..724597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0671"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; Uroporphyrinogen III
FT                   synthase HEM4; KEGG: mmc:Mmcs_0678 uroporphyrinogen III
FT                   synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96482"
FT                   /protein_id="ABN96482.1"
FT                   /translation="MTRQESGRGRKMKPGRITFVGSGPGDPGLLTARAHSVLVNAALVF
FT                   TDPDVPEAVLSLVGAHLPPPSGPEPAEPADAADEQAGSTIPGGPDIRPALGDPAEVAKV
FT                   LAGEAKHGVDVVRLVAGDPLSVDAVIAEVNALAKSHANFEIVPGLPNTTAVPTYAGLPL
FT                   GSTHTVADVRDPNVDWAALAAAPGPLILHATASHLPDAARTLIEYGLAETTPAVVTANG
FT                   TTCQQRSVESTLFGLLDKAALTAPDATGAPAAPLAGPLVVTLGRTVTNRARLNWWESRA
FT                   LYGWTVLVPRTKDQAGEMSDKLVGHGALPIEVPTIAVEPPRSPAQMERAVKGLVDGRFQ
FT                   WVVFTSTNAVRAVWEKFNEFGLDARAFSGVKIACVGQATAERVRAFGINPELVPTGEQS
FT                   SLGLLDEFPPYDDIFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPP
FT                   ASTREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTIVACIGPKTAETAAEFGLRVDV
FT                   QPEVAAVGPLVEALAEHAARLRAEGALPPPRKKSRRR"
FT   gene            724600..725571
FT                   /locus_tag="Mjls_0672"
FT   CDS_pept        724600..725571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0672"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   mmc:Mmcs_0679 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96483"
FT                   /protein_id="ABN96483.1"
FT                   /translation="MRQRPRRLRSTPAMRRLVAETSLEPRHLVLPMFVADGIDEPRPIS
FT                   SMPGVVQHTRDSLRRAAADAVAAGVGGLMLFGVPRDEDKDPRGSIGMDPEGILNVALRD
FT                   LAKDLGEDTVIMADTCLDEFTDHGHCGVLDDRGRVDNDATNQQYVKLAVAQAQSGAHVV
FT                   APSGMMDGQVAAIRDGLDGAGHTDVAILAYAAKFASAFYGPFREAVGSSLQGDRRTYQQ
FT                   DSGNAREALREIELDLAEGADMVMVKPAMSYLDVVRACADISPVPVAAYQISGEYAMIS
FT                   AAAANGWIDLQASALEALTGIRRAGADIVLTYWAADVAGWLG"
FT   gene            725568..725981
FT                   /locus_tag="Mjls_0673"
FT   CDS_pept        725568..725981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0673"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96484"
FT                   /protein_id="ABN96484.1"
FT                   /translation="MTGSAPTRPPDVDTGFWLWVAALPLLVIGYLIDNLMVPVAGASVF
FT                   LKGMAVMIVVVVSAIVVTFLVLLRQGYRWTRTLLTAGGFGSVAYTVTNLFTVERESPVA
FT                   AFGYAVTAIIGSVLIAGGIFLLHRKDANAFFTR"
FT   gene            726002..726448
FT                   /locus_tag="Mjls_0674"
FT   CDS_pept        726002..726448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0674"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96485"
FT                   /protein_id="ABN96485.1"
FT                   /translation="MTASPTPSRPRVVEFGFWALVAGAALLVFGGLIATTVTFETARSA
FT                   VDPEMSNDQLRDYLTVYRGVGIGAAVAGGVLAFLASRARRGDPKFRRATIGLSLAIAVV
FT                   LVLLAAGAGLGQPVMLLALVPIAVGTVLLTRRSAAGWFDQGEAR"
FT   sig_peptide     726002..726139
FT                   /locus_tag="Mjls_0674"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.936) with cleavage site probability 0.472 at
FT                   residue 46"
FT   gene            726445..726927
FT                   /locus_tag="Mjls_0675"
FT   CDS_pept        726445..726927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0675"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0682 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96486"
FT                   /protein_id="ABN96486.1"
FT                   /translation="MTNPSGDPSTERLFYEPGASWAWLLAGPAAGGAMLAIQISAGYGL
FT                   QPLVPGLFLVLVSGFLAVQVKAARIHTSVELTPETLRQGAEITKLSEIVAVYPPATGSE
FT                   MQKWQSARALGELTGVPRGRTGIGLKLSGSRTAQAWARRHATLRAELTRLVEERVP"
FT   gene            726924..727160
FT                   /locus_tag="Mjls_0676"
FT   CDS_pept        726924..727160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96487"
FT                   /protein_id="ABN96487.1"
FT                   /translation="MSARSRALFELALAAAAAVGCVLSWAAAGRPATAAPVMPGEPETV
FT                   VTVYSAPLLVLALLLATVAGVLLVLGVARLRRR"
FT   sig_peptide     726924..727028
FT                   /locus_tag="Mjls_0676"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.961 at
FT                   residue 35"
FT   gene            727182..727640
FT                   /locus_tag="Mjls_0677"
FT   CDS_pept        727182..727640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0677"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96488"
FT                   /protein_id="ABN96488.1"
FT                   /translation="MRDRSPLSRQILVQSTLAGLINLLVNPAIDYLTSRHEPPQRVWGV
FT                   DGLVVGFVLTSLILSTLVGVFSARAARRLDADGMATPRWLRRLPRRGWSAGLALGAGAA
FT                   VFAIAGSWLLSVAGVTTLSLPALMAVKAVYCGTLGFWVARLVILRTLA"
FT   gene            727640..728551
FT                   /locus_tag="Mjls_0678"
FT   CDS_pept        727640..728551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0678"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96489"
FT                   /protein_id="ABN96489.1"
FT                   /translation="MLVTEPLVQSSESVTLLHMTELAENRTEIDALPLGPQSLVWRYFG
FT                   DNRMYLIGPRPAVLQNMLAELGQGVLDHSVFFSDTAARVKRSLPPIFMTVYGSDDRNEG
FT                   FNVRDFHHDIKGEMPDGSRYHALDPETYFWAHATFVEQVLYFADTFVKRLTRAEKEQIY
FT                   LESKTWYRRYGVSDRPMPATYAEFEQYWERMLDETVIAHQTARYGVGYVTKGFPCPKGV
FT                   HPTVWRVLSIVFDPLAAFLTTGGLPPQARRLLDLPWSEHQERRYQRFAAFWRSRPVNWV
FT                   WDRLPMSVRYNKYAQRGYAQAG"
FT   gene            728535..729128
FT                   /locus_tag="Mjls_0679"
FT   CDS_pept        728535..729128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0679"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0686
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96490"
FT                   /protein_id="ABN96490.1"
FT                   /translation="MHKPDSATEAILDAAVVEFERHGFRRVALDDVARRAGVSRTTIYR
FT                   RFANRDELVAAVVERENVALFADIALELKEAGPQANYYVEAFTLSILKFRGHRILNGML
FT                   AEDPGFVLALAHQHWAAAVERMAEALRVIFPAGFAERIGPRAVNELADVILRYAATVLL
FT                   LPSMQPLDTADDLRAFATQHFLPSLPAALRAVPA"
FT   gene            729175..729528
FT                   /locus_tag="Mjls_0680"
FT   CDS_pept        729175..729528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0680"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96491"
FT                   /protein_id="ABN96491.1"
FT                   /translation="MSSDDKDEEQTGAEANASQKVADDPDAKITEKPEITDEHREVAKE
FT                   MRKEYEEERPTIVMPGTGGTVAGTAVNDWVDENGEPKFGKDEGGEGTGGQDGGQDKAED
FT                   KAENKAEASSESG"
FT   gene            729617..730108
FT                   /locus_tag="Mjls_0681"
FT   CDS_pept        729617..730108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0681"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96492"
FT                   /protein_id="ABN96492.1"
FT                   /translation="MHTLDRTAPAFVEMAHAIVWASVATVDANSRPRSRVLHPIWEWDG
FT                   TDLFGWIATVPSPVKRAHLHANPYVSVNYWTPTQDTCSADCLVEWYTDDETRTAVWQKF
FT                   ADGPEPVGYDPYVIPQWSGGPTSDEFAALRLTPYRLRVMPGTVMTQGAGEVLTWHGRLP
FT                   "
FT   gene            730137..730520
FT                   /locus_tag="Mjls_0682"
FT   CDS_pept        730137..730520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0682"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96493"
FT                   /protein_id="ABN96493.1"
FT                   /translation="MAYLEPPWFTRVVFNRIAKVTGVGGAETLTVSRRRTGGLQSVPVI
FT                   PVEVSGHRYVVSTRGEAQWVKNLRASGTATIGSTAYVAREVAESERPVVLAAYREKAGR
FT                   AVAGYFRRLPGDADHPVFALVPK"
FT   gene            730586..731902
FT                   /locus_tag="Mjls_0683"
FT   CDS_pept        730586..731902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0683"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase, class I and II; aminotransferase
FT                   class-III; KEGG: mmc:Mmcs_0690
FT                   glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96494"
FT                   /db_xref="GOA:A3PUB7"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PUB7"
FT                   /protein_id="ABN96494.1"
FT                   /translation="MGAHHTATEQSARLFADACAVIPGGVNSPVRAFNAVGGTPRFITS
FT                   ANGYWLTDADDNRYVDLVCSWGPMILGHAHPAVVEAVQRVAADGLSFGAPTPSETELAS
FT                   EIISRVAPVERLRMVNSGTEATMSAIRLARGFTGRPKIVKFSGCYHGHSDALLADAGSG
FT                   VATLGLPSSPGVTGAATADTIVLPYNDVDAVDEIFEQVGDQIAAVITEASPGNMGAVPP
FT                   EPGFNAALRRITEEHGALLILDEVMTGFRVSRSGWYGLDPVDGDLFTFGKVMSGGLPAA
FT                   AFGGRAEVMERLAPLGPVYQAGTLSGNPVAMAAGLATLRTADDAVYAALDKNADRLAGL
FT                   LTDALTDAGVTHRVQRGGNMLSVFFTAEPVGDFATARASETWRFPPFFHALLDAGVYPP
FT                   PSAFEAWFVSAALDDEAFDRIAAALPGAARAAAEASRPA"
FT   gene            731899..732507
FT                   /locus_tag="Mjls_0684"
FT   CDS_pept        731899..732507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0684"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: mmc:Mmcs_0691
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96495"
FT                   /protein_id="ABN96495.1"
FT                   /translation="MTEKTIVHVMRHGEVHNPEGILYGRLPDYHLSERGRAQAEAVAAW
FT                   LAHRDVVYVVASPLERAQETAGPIAAAHGLSIDTDDELIESLNVFQGKRVSPGDGALRN
FT                   PANWRHLRNPRTPSWGEPYRDIAERMTAALHRAREKAAGHEAVCVSHQLPVETLRRAVT
FT                   GKPLHHFPTRRLCNLASVTSFYFHGDEYVGWGYAELSGQ"
FT   gene            732504..733115
FT                   /locus_tag="Mjls_0685"
FT   CDS_pept        732504..733115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0685"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mmc:Mmcs_0692 redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96496"
FT                   /protein_id="ABN96496.1"
FT                   /translation="MRRWWIVLASVAVVALAGCSTGDDAVAQGGTFEFVAPGGKTDIFY
FT                   DPPADRGRPGALSGPDLLDPAKTLSLDDFAGQVVVINVWGQWCAPCRTEIGELQQVYDA
FT                   TRAKGVAFLGIDVRDNNREAAVDFVRDRGITFPSIYDPPMRTMIAFGGKYPTTVIPSTV
FT                   VLDREHRVAAVFLRELLAEDLQPVVERLAAEPAADAGAQP"
FT   sig_peptide     732504..732587
FT                   /locus_tag="Mjls_0685"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 28"
FT   gene            733112..733891
FT                   /locus_tag="Mjls_0686"
FT   CDS_pept        733112..733891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0686"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; KEGG: mmc:Mmcs_0693 cytochrome c biogenesis
FT                   protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96497"
FT                   /protein_id="ABN96497.1"
FT                   /translation="MTGFAEIAAAGPVALAMGLCVLAGLVSFASPCVVPLVPGYLSYLA
FT                   AVVGVDTDETGSGAVAVRTRRLKVAGAAGLFVAGFTAVFLLGTVAVLGMTTTLITNQLL
FT                   LQRIGGVVTIIMGLVFIGLIPALQRQARFTPRQLSTVAGAPLLGAVFALGWTPCLGPTL
FT                   TGVITVASATDGASVARGVALVIAYCLGLGIPFVLLAFGSARAVQGLGWLRRHTRTIQI
FT                   FGGVLLLIVGAALVTGVWNDFVAWVRDGFVSDVRLPI"
FT   sig_peptide     733112..733201
FT                   /locus_tag="Mjls_0686"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.994 at
FT                   residue 30"
FT   gene            733891..735501
FT                   /locus_tag="Mjls_0687"
FT   CDS_pept        733891..735501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0687"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: mmc:Mmcs_0694
FT                   ResB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96498"
FT                   /protein_id="ABN96498.1"
FT                   /translation="MPRPFSKLLAYARNTWRTLTSMGTALVLLFLLALAAIPGALLPQR
FT                   SLNEAKVAEYIAERPTLGPWLDRVQAFDVFSSFWFTAIYVLLFISLVGCLTPRLVEHVK
FT                   SLRAVPVPAPRNLGRLPKHHTAEVAGDPQQVAAAMGEELKGWRKTTRTDGEVTEVSAEK
FT                   GYLREFGNIVFHFSLLGLLVAIAAGKLFGYEGNVIVIADGGPGFCSASPAAFDSFRAGN
FT                   TVDGTSLYPICLKVNGFQADYLDNGQATSFSADIAYQAGEDLSTGTWRPYELKVNEPLR
FT                   VGGDRVYLQGHGYAPTFTVTFPDGQTRTQTLQWRPDDQTTFLSSGVMRFDPPAGTYPDA
FT                   DERRKNQIAIQGLFAPTQLLHGSLLSSSFPAMRDPGVAIDIYRGDTGLDSGRPQNIFSL
FT                   DERLVGQGRLTREARVNLDLGAETRLDDGTVVRFDGAVPFVNVQVSHDPAQIWVLVFAM
FT                   TMMAGLVVSLIIRRRRVWVRITPAGPGTVGVEFGGLARTDNSGWGEEFERLTVRLLAGH
FT                   PDAGHAGTQADAVSGERVT"
FT   sig_peptide     733891..733998
FT                   /locus_tag="Mjls_0687"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.759 at
FT                   residue 36"
FT   gene            735568..736572
FT                   /locus_tag="Mjls_0688"
FT   CDS_pept        735568..736572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0688"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   mmc:Mmcs_0695 cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96499"
FT                   /protein_id="ABN96499.1"
FT                   /translation="MNTVEIDLGLARYSDWAFTSSVVVLVVALLLLAVELAYSRGRTVE
FT                   RRELVSAGAAPAATSGRGVGADSAGPGIVADTPRRPLGERIGSSGVALVYVGTALLLAC
FT                   IVLRGLSTSRVPWGNMYEFINLTSFCGLVAAAVVLRRPQYRALWVFVLVPVLILLTVSG
FT                   RWLYSHAAPVMPALQSYWLPIHVSVVSLGSGVFLVGGVASILFLLKMSRFGQPGHDGPV
FT                   ARIVQRLPDAQTLDRIAYRTTIFAFPVFGFGVIFGAIWAEEAWGRYWGWDPKETVSFIA
FT                   WVVYAAYLHARSTAGWRDRKAAWINVAGFIAMVFNLFFINLVTVGLHSYAGVG"
FT   gene            736572..737738
FT                   /locus_tag="Mjls_0689"
FT   CDS_pept        736572..737738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0689"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96500"
FT                   /protein_id="ABN96500.1"
FT                   /translation="MGDHSAGGFRAQQRFRDPAADEPQAPPEWSAPTPPTGIPVVDPAA
FT                   VAPAPSVAEPQLDAQPVSHPVSQPLPVPPTPYLDLSTVALLGRPKEAPSHGWRKWLYLA
FT                   TFKLVNIGESPKAAQQDSLVTRVKQPLGGCYRIAVLSLKGGVGKTTITATLGATFASIR
FT                   GDRVVAVDANPDRGTLSQKVPLETTATVRHLLRDAEGIERYSDVRAYTSQGPSRLEVLA
FT                   SETDPAVSEAFSSDDYTRTLEVLERFYSLVLTDCGTGLMHSAMTSVLAHADVLVVISSG
FT                   SVDGARSASATLDWLDAHGHQAMVANAIAVINAVRPRSGKVDLQKVSDHFSRRCRAVQV
FT                   VPFDPHLEEGAEISLDRLKPATRQALLELAGVVADGFAGAARRDGDRG"
FT   gene            complement(737755..737919)
FT                   /locus_tag="Mjls_0690"
FT   CDS_pept        complement(737755..737919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0690"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mtc:MT0553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96501"
FT                   /protein_id="ABN96501.1"
FT                   /translation="MAYLLLILVLAGLVYIGWRLMRVSATRPQRRVIGPDDDPDFLRRL
FT                   GQDDNNPRQ"
FT   gene            737968..738285
FT                   /locus_tag="Mjls_0691"
FT   CDS_pept        737968..738285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0691"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96502"
FT                   /protein_id="ABN96502.1"
FT                   /translation="MSEGRQGARLVADVLIYVGARLLLVAVLAAAILGVGHLLGLREFP
FT                   LVIAILFALVIALPLGIWMFAPLRQRATASIAAFDEQRRKDREQLQARLRGEESPGDPQ
FT                   A"
FT   gene            738282..739325
FT                   /locus_tag="Mjls_0692"
FT   CDS_pept        738282..739325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0692"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; KEGG: mmc:Mmcs_0698
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96503"
FT                   /protein_id="ABN96503.1"
FT                   /translation="MTPRQVYGAEFAGAAGFLNSPTYGLPPDFLMRALHDCLAAWQAGT
FT                   LDAKSFDQPVRDARAAYAALVGVPYATVAMAGSTSAALGLVAAALPDGSRGATLAGEFT
FT                   STTFPFAAQARRGVSLTELSADELVARAGDYDFVTVSLVQSATGAVLDAEALRTNVAGT
FT                   GTLTIVDVTQAAGWKLLNLDWADVTVASVYKWLLAPRGTAFLSVSERTADLMTPHAANW
FT                   YAGDQPWESIYGLPLRLASDARRFDVSPAWFSALGAGLTLPWLAGLDRAAVEAHTVGLA
FT                   DTLRAELDLPPHPSAIVTLPSDRHDDAAERLQRAGIHASVRAGAVRVGFHLYNTADDLN
FT                   GLLDALA"
FT   gene            739356..739700
FT                   /locus_tag="Mjls_0693"
FT   CDS_pept        739356..739700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0693"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   mmc:Mmcs_0699 protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96504"
FT                   /protein_id="ABN96504.1"
FT                   /translation="MTTHKNLYEQWITRLWAGEPVAAELVTDDFVGHWPDREVHGPAEL
FT                   QAIIEQTHKMLSDLTFEIELGPFVDGDMVAGRWVGSGTGEQGPMRFTGNDILRVAEGKF
FT                   AEYWTGTSAS"
FT   gene            739784..740041
FT                   /locus_tag="Mjls_0694"
FT   CDS_pept        739784..740041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0694"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96505"
FT                   /protein_id="ABN96505.1"
FT                   /translation="MTPPELSSYLDTVTDIDELNAATKAVASADPAVGLRAVKALRRTV
FT                   EKLEAMHVADARRKGWSWQAIADALGVSRQAVHQKHNGRS"
FT   gene            740043..740594
FT                   /locus_tag="Mjls_0695"
FT   CDS_pept        740043..740594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0695"
FT                   /product="Clp N terminal domain protein"
FT                   /note="PFAM: Clp N terminal domain protein; KEGG:
FT                   mmc:Mmcs_0701 Clp, N terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96506"
FT                   /protein_id="ABN96506.1"
FT                   /translation="MFERFSGPARTAVTLAHEEARAMRADDIRPEHLLVGVLRSAGPSL
FT                   SRMLNGHALTAEDVRERLAAASTGEFDDDASALREIGIDLYAVRDIADRRFGAGAFDSA
FT                   GRAPRRRRRLGTPLVKPAKKALELALREALAHRDSVIGCEHLLLGILRGGDEVAVGLIT
FT                   ERVDAARLRADIVALLDRAA"
FT   gene            complement(740607..741476)
FT                   /locus_tag="Mjls_0696"
FT   CDS_pept        complement(740607..741476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0696"
FT                   /product="1,4-dihydroxy-2-naphtoate prenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   mmc:Mmcs_0702 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96507"
FT                   /protein_id="ABN96507.1"
FT                   /translation="MATFAEWVEGARPRTLPNAVAPVIAGTGAAAWLDGAVWWKALLAF
FT                   VVAVALIIGVNYANDYSDGIRGTDDVRSGPLRLVGSRLASPRAVLTAAIASLAVGAVAG
FT                   LALAVASAPWLIAVGAVCIAGAWLYTGGSKPYGYLGLGEVAVFVFFGLVAVLGTQYTQA
FT                   LRVDWVGLALAVAMGALSSAVLVANNLRDIPTDRESGKITLAVRLGDARTRLLYQALLA
FT                   TAFALTLVLMLATPWCAVGLVALPLAVRAARPVRGGLGGKDLIPVLRDTGLTMLVWAVA
FT                   VALALALG"
FT   gene            741569..742345
FT                   /locus_tag="Mjls_0697"
FT   CDS_pept        741569..742345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0697"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="KEGG: mmc:Mmcs_0703 methylthioadenosine
FT                   phosphorylase; TIGRFAM: methylthioadenosine phosphorylase;
FT                   PFAM: purine phosphorylase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96508"
FT                   /protein_id="ABN96508.1"
FT                   /translation="MLGVIGGSGFYSFFGPDARSVRLDTPFGAPSAAITVGTVGDHEVA
FT                   FLPRHGVDHEFSPHTVPYRANMWALRALGVRRIFGPCAVGSLTPDLGPGSMVVPDQLVD
FT                   RTSGRDDTYFDSGGIHVDFADPYCPTLRAAAAGLPGVVDGGTMVVIQGPRFSTRAESKW
FT                   FASQGFSLVNMTGYPEAVLARELEMCYAAIALVTDLDAGIDSETAVRAVDVFAEFQRNL
FT                   VPFKKVVHEAIDQVAVERTCDHCLPHDGVTLPIELP"
FT   gene            742342..743373
FT                   /locus_tag="Mjls_0698"
FT   CDS_pept        742342..743373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0698"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: mmc:Mmcs_0704
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96509"
FT                   /protein_id="ABN96509.1"
FT                   /translation="MRVLLTGAAGFIGSRVRAALESAGHEVVAVDVMLPAAHGGAAPLP
FT                   EDTHRVDVRDADALAPLLEGVDAVCHQAAVVGAGVNAADAPSYGSHNDYGTTVLLAEMF
FT                   AAGVRKLVLASSMVVYGQGRFDCPAHGPVDPLPRTRADLDAGVFEHRCPVGGEELQWRL
FT                   VGEDEPVRPRSLYAASKAAQEHYALAWAEATGGSVVALRYHNVYGPHMPRDTPYSGVAA
FT                   IFRSELENGDVPRVFEDGGQMRDFVHVDDVAAANLAAIEAGLPGFEAFNVCSGRPISII
FT                   EVASELCEIRGAAPPLVTGQYRSGDVRHIVASPRRAAEQLGFRAVVDPRDGLREFAFAP
FT                   LRA"
FT   gene            743375..744202
FT                   /locus_tag="Mjls_0699"
FT   CDS_pept        743375..744202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0699"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96510"
FT                   /protein_id="ABN96510.1"
FT                   /translation="MRRWARLVVIVVLVANGALALLWNQQRRLIYFPAPGPVPSATAVW
FT                   SGARDVVVRTADGVDLGAWFFAAADRGPAVLVCNGNGGDRSMRAALALALRRMGLSVLL
FT                   FDYRGYGGNPGRPTEDGLAADARAARDWLAAQPEVDPDRLAYFGESLGGAVAVGLAAAR
FT                   PPAALVLRSPFTSLADVGAVHYPWLPVRRLLLDRYPSIERIAGIHAPLLVIAGDRDDIV
FT                   PAGLSRRLYDAAAEPKEFVLVPGAGHNDPELLDGPQMLEAIERFLRHTAVLGP"
FT   sig_peptide     743375..743497
FT                   /locus_tag="Mjls_0699"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.819) with cleavage site probability 0.428 at
FT                   residue 41"
FT   gene            744223..745347
FT                   /locus_tag="Mjls_0700"
FT   CDS_pept        744223..745347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0700"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   mmc:Mmcs_0706 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96511"
FT                   /protein_id="ABN96511.1"
FT                   /translation="MKTAICEQFGIDFPLFAFSHCRDVVAAVTNAGGFGVLGATAYTPE
FT                   QLDRELSWIDEQVGGKPYGADIIVPAKFEGKGENLTRTDLVDRIPAEYREFVTQLLADH
FT                   DIELDSAPKLGGSSLSGDTGRELLDVAMSHPITLIANALGVPPDYMIEAGRERGVPVAA
FT                   LVGAREHAVKQVAAGVDLIVAQGTEAGGHCGEVTTLVLIPEVIAAVEETGTKVPVLAAG
FT                   GIVTGRQMAAAVAMGADGAWTGSVWLTTEEAETAPHTVQKMLAATSRDTVRSAGRTGKP
FT                   ARQLVSDWTQAWAPRGDRRPLPLPLQNMLAEPLLRRIDILAAQGHPGAQQLATYFVGQG
FT                   VGLMNKVKPAREVVREFIEDYLSAAERLNNSLPD"
FT   gene            745389..746735
FT                   /locus_tag="Mjls_0701"
FT   CDS_pept        745389..746735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0701"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; KEGG:
FT                   mmc:Mmcs_0707 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96512"
FT                   /protein_id="ABN96512.1"
FT                   /translation="MSHSRPRVLIIGGGFGGLFCARRLSRADVDVTVLDRAAGHLFQPL
FT                   LYQCATGKLSIGQISRPLREEFARHRNIRTLLGEAIELDPVARSVTALRPDETTFTVDY
FT                   DVLVVAAGMRQSYLGNEQFAEWAPGMKTLDDALDIRQRLFTAFEIAETLPPGPERTSWL
FT                   TFAVAGGGPTGVELAGQIREVATKTLAKEFHSIDPEEARVLLFDGGDRVLKTFAPALSL
FT                   KANDTLRELGVELHFGVHVTDVRRDGITVTPKQGVPDQQFGTRTVLWTAGVEAVRFARH
FT                   VAEVLGADTDRAGRITVGPDLTVAGHPEIFVIGDLAGREGLPGVAENAMQGGLHAASCI
FT                   RRDLAGRPRRPYRYRDLGSAAYISHGHALLQVGPLRVSGYAGWVAWGLLHIAFLTGVSN
FT                   RISTVATWLASIARTGRYHRAFMLGAGDRHDQRYTYSSWDLAEPAPEGN"
FT   gene            complement(746756..747790)
FT                   /locus_tag="Mjls_0702"
FT   CDS_pept        complement(746756..747790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0702"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: mmc:Mmcs_0708 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96513"
FT                   /protein_id="ABN96513.1"
FT                   /translation="MPSTDLWEIGAWALACSIPVVLAGALVIRLARTWSLAVSMVVLVL
FT                   IPVIATFTGVLGASGFMITETFEPIAVVLVVVAVVTIPGAVMLGRYQARRTVWEQEIRD
FT                   SERAAEMSRRQLVAFVSHDLRTPLAGIRAVSEAIADGLVGGDEVRAHAKHIEQESIRLS
FT                   EMVDDLFEMSKINAGAVQPTFDRVALDEVVDDVLAAHRIAAERAGVQLRAELPDEPVRV
FT                   LGSDRALVRVLSNLVANAIAHTPEGGRVQLALGSDENVAWARVDDTGVGIDEADLPRVF
FT                   DVAYRGSNDRVPREDSSLPSGSGLGLAIAAGLVQAHRGTLSAHNLDTGARFEVRLPLAS
FT                   DVSD"
FT   gene            complement(747777..748490)
FT                   /locus_tag="Mjls_0703"
FT   CDS_pept        complement(747777..748490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0703"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mmc:Mmcs_0709 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96514"
FT                   /protein_id="ABN96514.1"
FT                   /translation="MTRVLIADDDSVVRDVVRRYLERDGLEVAIARDGTEALRLLGTER
FT                   IDVAVLDVMMPGPDGMTLCRTLRQRGEHTVPVILLTALGEEDDRIAGLEAGADDYLTKP
FT                   FSPRELALRVRSVLRRSPTPVGVTPVDLTVGALTISAAARSVTVDGRPVSLTNREFDLL
FT                   LFFITHADTVFTREELLKQVWRWDFGDLSTVTVHVKRLRSKLGDQHRVQTVWGRGYMWS
FT                   DTAGAREGLASGAVN"
FT   gene            748592..749248
FT                   /locus_tag="Mjls_0704"
FT   CDS_pept        748592..749248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0704"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   mmc:Mmcs_0710 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96515"
FT                   /protein_id="ABN96515.1"
FT                   /translation="MPECPVTVVLPCLDEAESLPAVLAALPDGYRALVVDNNSTDGTAE
FT                   VARRHGAEVVHEARPGYGAAVHAGVVAAGTPVVAVLDADGSLDPRELPALVAELDRGAH
FT                   LVVGRRRAVPGLRWPWHARLGTAAVCWRLRRRHGLPVHDIAPMRVARRDDLLALGVRDR
FT                   RSGYPLELLVRAAAADWRVVEFDVTYGPRTGGRSKVSGSLRGSVVAALDFWRVIE"
FT   gene            749245..749916
FT                   /locus_tag="Mjls_0705"
FT   CDS_pept        749245..749916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0705"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96516"
FT                   /protein_id="ABN96516.1"
FT                   /translation="MTQLPVTVLVVAKAPVPGLAKTRLAVTVGFEMAAVIASAALLDTL
FT                   DAVLATPVQARVVALTGDLDDVHNGAVLRAKLAGFTVVDQHGDSFAERLAYAHADAAAA
FT                   VGDRPILQIGMDTPQVTADLLARCAQTLLGADAVLGPAVDGGWWLLGVRTAAMADCLRE
FT                   VPMSRDDTGELTRKALQDRGFDVVIVDELADVDTAADVEPVRWACPPGGRFPFATAAAG
FT                   L"
FT   gene            749921..750550
FT                   /locus_tag="Mjls_0706"
FT   CDS_pept        749921..750550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0706"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mmc:Mmcs_0712 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96517"
FT                   /protein_id="ABN96517.1"
FT                   /translation="MLGNLYDRALDGERCWIRSGDGEVKTLPVRSWLGGRHADRLFDRA
FT                   VVRLCEGPTIDLGCGPGRLVADLVRRGVPALGVDQSATAVELARRNGAPALRRDVFGAL
FT                   PGLGRWQTALLADGNIGLGGDPRRVLRRAAELLRPGGRCVVEFDSETQGVQKNLVRLES
FT                   SNTVGPWFRWASVGVDCAAALAEEAGLVMTGLHPAGRRILATLATP"
FT   gene            complement(750432..751016)
FT                   /locus_tag="Mjls_0707"
FT   CDS_pept        complement(750432..751016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0707"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbo:Mb0225 probable conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96518"
FT                   /protein_id="ABN96518.1"
FT                   /translation="MAAFRRVYGAHPLHLLTLIAGFALFGYAIVTLGFSALWNPRTWWQ
FT                   SIAVWFAAAVVAHDLVLFPLYALTDRILMLSQRIPTPVPVLNHLRVPLLGAALTFVVFS
FT                   PGILQQGAPAYTAATGLTQEPYLGRWLLLVAAMFTLSAAVYAVRLGRPRQSATVSPASR
FT                   VSDARRDADPSSPTPPPPPARPHNPPPPTPT"
FT   gene            complement(751016..752260)
FT                   /locus_tag="Mjls_0708"
FT   CDS_pept        complement(751016..752260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0708"
FT                   /product="oxidoreductase, molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding; KEGG:
FT                   mmc:Mmcs_0714 oxidoreductase, molybdopterin binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96519"
FT                   /protein_id="ABN96519.1"
FT                   /translation="MGPRKFPWRSPLRGRWLTSVLGAVLLLTLPIVTVTGLLSYIAYGP
FT                   QFGQAIPADVGWLKLPTFDWPTDPAWLYRLTQGLHVGLGLILIPVVLAKLWSVIPRLFV
FT                   WPPARSIAQLLERVSLLMLVGGILFEIVTGVLNIQYDYIFGFSFYTAHYFGAWVFIAGF
FT                   LVHIAIKIPRMRAGLRSMPLRAVLRTDRAGTRPEAFEPDGLAPADPAEPTVSRRGALAL
FT                   VGGGALLMAVLTAGQTLGGVTRQAALLLPRGRSYGDGANDFQVNRTARAAGITPAATGA
FT                   EWALTLRGGPRPVVLDRAALAALPQHTARLPIACVEGWSTTQTWSGVRLRDLAALAGVP
FT                   EPASALVSSVERRGAFNRARLQANQIAHGDALLALRVNGADLSPDHGFPARVIVPALPG
FT                   VHNTKWVSAIDFEAP"
FT   sig_peptide     complement(752150..752260)
FT                   /locus_tag="Mjls_0708"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.523 at
FT                   residue 37"
FT   gene            complement(752322..753677)
FT                   /locus_tag="Mjls_0709"
FT   CDS_pept        complement(752322..753677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0709"
FT                   /product="putative conserved integral membrane protein"
FT                   /note="KEGG: mmc:Mmcs_0715 putative conserved integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96520"
FT                   /protein_id="ABN96520.1"
FT                   /translation="MRAHRRETIAAAVGLLLVVTAFIVPHLDLGVVTPLINATPERFRS
FT                   FAGTAPVFGWWNAHVGWGTVPAVFLGVAAVVWGRTLSERLSWRTLVPATWATSAAWAFS
FT                   LAMVDGWQRGFAGRLTARHEYLRQVPTVTDIPDAVRTFADRILDYQPDSWITHVSGHPP
FT                   GALLTFVWLDRIGLGGGAWAGLLCLLAGSSVAAAILVAVRALADERTARLAAPFLAVAP
FT                   TAIWVAVSADGYFAGVAAWGIALLALAVRRVGRRPELFAVGAGLLLGWAVFLNYGLVLM
FT                   ALPALAVLICSADWRSALRALLPAVGAAVVIVVVFVIAGFWWFDGYQLVQERYWQGIAV
FT                   DRPFQYWGWANLASVVCAIGLGSVAGLGRVFDIAAIRARSGLHLLMLGALAAILCADLS
FT                   MLSKAETERIWLPFTMWLVAAGALLPVRAQRWWLALNVLGALLINHLILTNW"
FT   sig_peptide     complement(753612..753677)
FT                   /locus_tag="Mjls_0709"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.941) with cleavage site probability 0.351 at
FT                   residue 22"
FT   gene            753886..754740
FT                   /locus_tag="Mjls_0710"
FT   CDS_pept        753886..754740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0710"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG:
FT                   mmc:Mmcs_0716 formate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96521"
FT                   /protein_id="ABN96521.1"
FT                   /translation="MSYVNPAQFVTKMIDAGETKAFMSTRDTVIRAYMAGAILALAAAF
FT                   AVTITVQTGNALAGAVLFPVGFCLLYLLGFDLLTGVFTLVPLALLDKRRGVTVRSVMRN
FT                   WGLVFLGNFAGALTVAFMMAIVFTYGFSVDPNEVGQKLGEIGHSRTVGYAEHGAAGMLT
FT                   LFIRGVLCNWMVSTGVVAAMMSTSVSGKVIGMWMPIMLFFYMGFEHSVVNMFLFPSGLM
FT                   LGGDFSIMDYLVWNEIPTVVGNLVGGLAFVGLTLYATHARTGTEWNRPVDPEQFTLPVE
FT                   ARA"
FT   gene            754737..755192
FT                   /locus_tag="Mjls_0711"
FT   CDS_pept        754737..755192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0711"
FT                   /product="cyanate lyase"
FT                   /EC_number="4.2.1.104"
FT                   /note="KEGG: mmc:Mmcs_0717 cyanate lyase; TIGRFAM: cyanate
FT                   lyase; PFAM: Cyanate lyase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96522"
FT                   /protein_id="ABN96522.1"
FT                   /translation="MTREQFTAEIQAARLAKQLTWQQLADAIDRPVMWTIAALLGQHPI
FT                   PVDSGKVLVDMLGLDEAAIPVLAAVPMRGGLPTAVPTDPTIYRFYEVLQVYGGAIKELI
FT                   HEEFGDGIMSAINFSIDVQRKPHPAGDRVVVMLDGKFLPYDWTAAEV"
FT   gene            complement(755206..757530)
FT                   /locus_tag="Mjls_0712"
FT   CDS_pept        complement(755206..757530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0712"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: mmc:Mmcs_0718
FT                   oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96523"
FT                   /protein_id="ABN96523.1"
FT                   /translation="MNSRRRPHHDHDASFDEHAIVTSEPKTEAAGVKAVMVSLKRGVEQ
FT                   MGAVRTATALTRLNQRHGFDCPGCAWPEDAGGRKLAEFCENGAKAVAEEATRRVVTPEF
FT                   FARHSVAELGGRPEYWLSQQGRLTHPVVLRPGATHYEPIAWDDAYRLIADELRALADPD
FT                   EAVFYTSGRTSNEAAFLYQLLVRSFGTNNLPDCSNMCHESSGAALTESIGIGKGSVTVA
FT                   DVEHADLIVIAGQNPGTNHPRMLSVLEKAKANGAIVVAINPLPEAGLMRFKDPQKVHGV
FT                   IGHGVAIADEFVQIRLGGDMALFAGLGRLLLEAEDAAPGTVLDRAFVDGHCAGFADYEA
FT                   QARAVDLDTVTEATGVGREQLQRIARLLIDSERTVLCWAMGLTQHRHAVATIGEATNLL
FT                   LMRGMIGKPGAGLCPVRGHSNVQGDRTMGIWEKMPETFLAALDERFGITSPRKHGMDTV
FT                   DAIRAMRDGRAKVFIGMGGNFSSATPDTGVTEAALRNCTLTVQISTKLNRSHLVHGRTA
FT                   VILPTLGRTDRDVQAGGKQVVSVEDSMSMVHLSRGSLHPPSDQVRSEVAIVCQLARTLF
FT                   GADHPVPWDWFVADYDRIRDAIAAVVPGCADYNARVRRPDGFQLPHPPRDAREFHTHTG
FT                   KANFAVNPLEWVPVPPGRLVLQTLRSHDQYNTTIYGLDDRYRGVKGGRRVVFVNPADIE
FT                   SLGLRDGQRVSLISEFPDADGSIVERRVDDFLVVPYSTPVGNAAAYYPETNPLVPLDHT
FT                   AAKSNTPVSKAVVVRLEAAQP"
FT   gene            757718..758602
FT                   /locus_tag="Mjls_0713"
FT   CDS_pept        757718..758602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0713"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mmc:Mmcs_0719 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96524"
FT                   /protein_id="ABN96524.1"
FT                   /translation="MSSSVTTHGIVVGVDGSAAGKVAADWAARDAARRGVPLTLVHVIA
FT                   PKDLQMWIEVPAPQEYLRWQSERSERVMAEATAIAERAAENRQLTVVRQVVPGEAKATL
FT                   IEMSKDADMVVVGSRGLGAWGRRLLGSVSTAVVHHAQCPVAVIHDEDPLMDHPDQAPVV
FT                   VGVDGSKAAEQAIAIAFEEASLRGVDLVAVHAWNDVDYEFPDIKWVDYTARGERIVAEC
FT                   LAGYCETYPDVTVRKVLVRDRPAHQLLQQSEAAQLLVVGSHGRGGFPGMLLGSVSSEVV
FT                   QSARMPVIVARSN"
FT   gene            complement(758603..758911)
FT                   /locus_tag="Mjls_0714"
FT   CDS_pept        complement(758603..758911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0714"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   mmc:Mmcs_0720 protein of unknown function DUF1330"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96525"
FT                   /protein_id="ABN96525.1"
FT                   /translation="MTVYAVAQLRFTDRTAYDRYQAAFMEVFARYSGTLLAADDAPRVI
FT                   EGEWTGDKVVLMSFPDEAEFRRWADSPEYQQISVDRRAGADTVVLLVHGIAASIRNR"
FT   gene            complement(758935..759639)
FT                   /locus_tag="Mjls_0715"
FT   CDS_pept        complement(758935..759639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0715"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: mmc:Mmcs_0721 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96526"
FT                   /protein_id="ABN96526.1"
FT                   /translation="MEDDRPSTHTGSIRAIAALGDDLRRRLYEYARDERRPVSRDEAAS
FT                   AVGISRKLAAFHLDKLVDVGLLRFRFLQPAEARVGRPPKVYAPADAEFAVSIPARRPDL
FT                   LADILAHAVLDDGDRTSARAAAVRVAHQRGVDATTAVKRPRGGRIGAERALRLAEELLV
FT                   DYGFEPYRARAGCIRLRNCPFHPLARELPELVCRLNHAFLAGALDGLGADTVEAVLSPV
FT                   AGECCVELLPTR"
FT   gene            759731..760288
FT                   /locus_tag="Mjls_0716"
FT   CDS_pept        759731..760288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0716"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96527"
FT                   /protein_id="ABN96527.1"
FT                   /translation="MWEVVVNAPLEQAKRPVSALLAGPYGHPFHPILVTVPIGAWASSL
FT                   VFDVASHLVDGPGFLAQGAEWLIAIGVLGALVAATVGFLDLIAIPSRTRAHRIGLLHMA
FT                   LNLTVTALYIAGFAWRHADYPQQAAVGFGPLALSVVSFAVLAVSGYLGGMLSYRYGVRV
FT                   AEESTQAEGFGRVEQPAQGGKP"
FT   gene            760285..760719
FT                   /locus_tag="Mjls_0717"
FT   CDS_pept        760285..760719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0717"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96528"
FT                   /protein_id="ABN96528.1"
FT                   /translation="MSIASLIAWILTAGGGAFMLAKWVGGGGHRDRTRTHLPPAVVFGH
FT                   FALAALGLVLWIVYVFTDNHPIGWVALALLVPVAALGVVMVLRWLPVHRAQAQSVGGGS
FT                   QAALHDAPERSFPVAVVAAHGVLAVATVVLGLLAILGIGG"
FT   gene            complement(760720..761370)
FT                   /locus_tag="Mjls_0718"
FT   CDS_pept        complement(760720..761370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0718"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mmc:Mmcs_0724 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96529"
FT                   /protein_id="ABN96529.1"
FT                   /translation="MAALRKPGMMGPMRREVTTVEELRAIVGHPNSYVANKVGPRLSSV
FT                   QQEWLRAASLGFVATVDAQGHLDVSPKGDPAGFVHIIDDRTIAIPERPGNKRVDGYLNV
FT                   LQRPRVGTVFVIPGRGDTLRINGSATVLADADYFDGMAVRGKRPVLALEIRVEEVFFHC
FT                   AKAFLRSGAWNPESWTPDAVPSVAQLAKTFKPDLTQAELDEYYSPDNMDKQLY"
FT   gene            761421..761762
FT                   /locus_tag="Mjls_0719"
FT   CDS_pept        761421..761762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0719"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96530"
FT                   /protein_id="ABN96530.1"
FT                   /translation="MSRRVEVDDDLWDEFHRVVNMTSRELLDWLRTRSAGEGSEELPDQ
FT                   AGTQTGRHVLDILGKRRGDLTADDEHVMRRVVERVHAERRDDLEPTAGQENWRHRLMTI
FT                   GHDPLKPPR"
FT   gene            complement(761759..762823)
FT                   /locus_tag="Mjls_0720"
FT   CDS_pept        complement(761759..762823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0720"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0726 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96531"
FT                   /protein_id="ABN96531.1"
FT                   /translation="MAGRGPALLPTPADDADHAARLSGALRAGAAIDEDVAVVVPTSGT
FT                   TGTPKGAMLTAAALTASAHATHARLGGPGRWLLALPAHHIAGLQVLVRSVVAGERPVAI
FT                   PASFEPPDLVSAVAGMGAGRRYVSLVSVQLDKALRDPAATAALATFDAVLIGGGPMPAG
FT                   LAEKASAAAVPVVRTYGMSETAGGCVYDGVPLDGVRVRLEGSRVLLGGPTLAKGYRNTV
FT                   QPDPFAEPGWFRTDDVGALDDGVLRVLGRVDDAVSTGGLTVMPPVVEAVLSRHPAVADC
FT                   AVFGVADERLGQRVVAAIVLAAGAPAPTVADLRAHVARELDATAAPREVHVVDEVPRRG
FT                   IGKVDRPALRAQFS"
FT   gene            complement(762895..763194)
FT                   /locus_tag="Mjls_0721"
FT   CDS_pept        complement(762895..763194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0721"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96532"
FT                   /protein_id="ABN96532.1"
FT                   /translation="MPNFLAKIVGWITAGYPEGVPGPDRVPLLALLRRRLTDEEVTAVA
FT                   QTLAERGQWDHVDIAVMITSITDDMPTPADIERVRTRLAGRSWPIDDREPREDT"
FT   gene            763411..764661
FT                   /locus_tag="Mjls_0722"
FT   CDS_pept        763411..764661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0722"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: mmc:Mmcs_0728
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96533"
FT                   /protein_id="ABN96533.1"
FT                   /translation="MSSEWIILVLLIATALAFDFTNGFHDTGNAMATSIATGALKPKTA
FT                   VTLAGVLNLVGAFLSVEVAVTVTTSVLKIQDSKTGSLLPNIDASTGLTIIFAGLVGGIL
FT                   WNLLTWLFGIPSSSSHALFGGLMGAGLAAIGLAGVNWSGVTQKVLIPAIAAPVIAGLVA
FT                   GCGTWLIYRITRRVGRKQRESGFRWGQIATASLVALSHGTNDAQKTMGVIALALITTGH
FT                   LTGDVAEDGLPFWIIASCALAIGLGTYLGGWRVIRTLGKGLVEIESPQGLAAEASSAAI
FT                   ILSSSAAGMALSTTHVATGSILGSGVGKPGAHVRWAVAGRMAVAWLITLPAAGLVGALA
FT                   FWVSHSVAGMTTQLVGDGLIFLILVGTSFGLWWRAQQQKVDHRNVNADWDASTNSVVPV
FT                   EVREPVPVAKAKDVAAV"
FT   sig_peptide     763411..763503
FT                   /locus_tag="Mjls_0722"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.663) with cleavage site probability 0.322 at
FT                   residue 31"
FT   gene            764691..764969
FT                   /locus_tag="Mjls_0723"
FT   CDS_pept        764691..764969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0723"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96534"
FT                   /protein_id="ABN96534.1"
FT                   /translation="MVNLESILRVLVVGLILGAGLPALFACGLVAYSSGAGTPDADGVT
FT                   RAPNPALKYLGVALFTIVAAVILVGLLWITRSTIEHQFGLDLFPFAK"
FT   sig_peptide     764691..764792
FT                   /locus_tag="Mjls_0723"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.543 at
FT                   residue 34"
FT   gene            764977..765285
FT                   /locus_tag="Mjls_0724"
FT   CDS_pept        764977..765285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M