(data stored in ACNUC9543 zone)

EMBL: CP000591

ID   CP000591; SV 1; linear; genomic DNA; STD; PLN; 593542 BP.
XX
AC   CP000591;
XX
PR   Project:PRJNA13044;
XX
DT   20-APR-2007 (Rel. 91, Created)
DT   02-OCT-2014 (Rel. 122, Last updated, Version 4)
XX
DE   Ostreococcus lucimarinus CCE9901 chromosome 11, complete sequence.
XX
KW   .
XX
OS   Ostreococcus lucimarinus CCE9901
OC   Eukaryota; Viridiplantae; Chlorophyta; Mamiellophyceae; Mamiellales;
OC   Bathycoccaceae; Ostreococcus; unclassified Ostreococcus.
XX
RN   [1]
RP   1-593542
RX   DOI; 10.1073/pnas.0611046104.
RX   PUBMED; 17460045.
RA   Palenik B., Grimwood J., Aerts A., Rouze P., Salamov A., Putnam N.,
RA   Dupont C., Jorgensen R., Derelle E., Rombauts S., Zhou K., Otillar R.,
RA   Merchant S.S., Podell S., Gaasterland T., Napoli C., Gendler K.,
RA   Manuell A., Tai V., Vallon O., Piganeau G., Jancek S., Heijde M.,
RA   Jabbari K., Bowler C., Lohr M., Robbens S., Werner G., Dubchak I.,
RA   Pazour G.J., Ren Q., Paulsen I., Delwiche C., Schmutz J., Rokhsar D.,
RA   Van de Peer Y., Moreau H., Grigoriev I.V.;
RT   "The tiny eukaryote Ostreococcus provides genomic insights into the paradox
RT   of plankton speciation";
RL   Proc. Natl. Acad. Sci. U.S.A. 104(18):7705-7710(2007).
XX
RN   [2]
RP   1-593542
RG   US DOE Joint Genome Institute
RA   Grigoriev I., Grimwood J., Aerts A., Salamov A., Zhou K., Lou Y.,
RA   Pitluck S., Schmutz J., Myers R.M., Lucas S., Detter J.C.,
RA   Glavina del Rio T., Putnam N., Rokhsar D., Palenik B.;
RT   ;
RL   Submitted (21-FEB-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 92f1bc5ef9c57079272dbe1358910a45.
DR   BioSample; SAMN03081420.
DR   EnsemblGenomes-Gn; ENSRNA049434237.
DR   EnsemblGenomes-Gn; OSTLU_2073.
DR   EnsemblGenomes-Tr; OSTLU_2073.
DR   RFAM; RF00005; tRNA.
XX
CC   URL -- http://www.jgi.doe.gov/ostreococcus
CC   JGI Project ID: 3436080
CC   Source DNA was provided by Brian Palenik (bpalenik@ucsd.edu))
CC   Stock culture is available from CCMP (http://ccmp.bigelow.org/) as
CC   strain number CCMP2514
CC   Contacts: Brian Palenik (bpalenik@ucsd.edu))
CC             Igor Grigoriev (ivgrigoriev@lbl.gov)
CC   Annotation done by JGI-PGF
CC   Manual curation done by the Ostreococcus User Community
CC   Finishing done at Stanford/JGI, Stanford Human Genome Center
CC   (www-shgc.stanford.edu)
CC   The finished chromosome has no gaps. The sequence has less than one
CC   error in 100,000 bp.A
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Additional Note: Transposon sequencing failed to verify the number
CC   of repeat copies 42140-47990.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..593542
FT                   /organism="Ostreococcus lucimarinus CCE9901"
FT                   /chromosome="11"
FT                   /strain="CCE9901"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:436017"
FT   gene            complement(<853..>2406)
FT                   /locus_tag="OSTLU_26328"
FT   mRNA            complement(<853..>2406)
FT                   /locus_tag="OSTLU_26328"
FT                   /product="predicted protein"
FT   CDS_pept        complement(853..2406)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26328"
FT                   /product="predicted protein"
FT                   /note="GO_component: - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26328"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98683"
FT                   /db_xref="GOA:A4S491"
FT                   /db_xref="InterPro:IPR004263"
FT                   /db_xref="InterPro:IPR040911"
FT                   /db_xref="UniProtKB/TrEMBL:A4S491"
FT                   /protein_id="ABO98683.1"
FT                   /translation="MNRRRRAEDGDDIEAVVERRVSSKKARPPARTTFLRRITFALTTA
FT                   LVTFACVKNDLYANMRKPEVYKVVDAGRGTVRWAIEERVSAWNGVGAHAAKFPDEFGLR
FT                   RVQSMCDEIAVGSLSATYWPLNVNSSGFSDSRALCEALNDLPGTLRLYTLKTPRVTRLK
FT                   YAFAEKIPTFNRGYGVETYLAREIERGPFATRSFKDATAIFIPVRPYLQRLLTAEAYVM
FT                   AGPAKGSNNNGAIRQAIRDRLSRDIERVKAINAEAWTSKQKCARVVMTNIDIGLSAFDS
FT                   SDDEVRHGAVVITGNSELPIQNSEDAKDDEARARRANAVQAGFDPARHVAIWFGISSHL
FT                   PREVVRMGALKSTNVRTIEVSFRGSMHRGGVRRVVFPTLKQAEAGRGWDLSTSGQDKPR
FT                   DYMTMLSKSKYCLYVYGDRAHTARLYDIITFGCVPVIVADGYDLPFSWLFDWSKFSVRV
FT                   LEDDVATLPSILDRADYDSLRRELVKVHSFFQYHNRGSIFGDAFWITMLGVRRQLAKCT
FT                   "
FT   gene            <3013..>3960
FT                   /locus_tag="OSTLU_5433"
FT   mRNA            <3013..>3960
FT                   /locus_tag="OSTLU_5433"
FT                   /product="predicted protein"
FT   CDS_pept        <3013..>3960
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_5433"
FT                   /product="predicted protein"
FT                   /note="GO_function: - cysteine-type endopeptidase activity;
FT                   ubiquitin thiolesterase activity; GO_process: -
FT                   ubiquitin-dependent protein catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_5433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98524"
FT                   /db_xref="GOA:A4S492"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4S492"
FT                   /protein_id="ABO98524.1"
FT                   /translation="GAGLANLGNTCFLNSVLQCLTHTPALANFALRGEHKKYKTGGSFN
FT                   ALYEIGEHVARALNSSGRTIAPTALVKNLRALSKTFRKGRQEDAHELARCLLDAMHKKC
FT                   VEVVKPKISPNSARAETSFVWKVFGGRLRSQVNCKTCGRNSETFDPFLDLSLEVGRAKS
FT                   VLGAFKMFTHTEVLDGDNKYRCEGKSANSKSHLTKASKQFTVNQAPNVLALQLKRFAYV
FT                   PFGRGKLNHFVEYPLELDITPYTSDEGLTSRGKAVYDLYGVLVHAGNSSNSGHYYCFVK
FT                   VATGTWCLMDDDEITSVSEKVVLKQQAYLLFYARR"
FT   gene            complement(<5346..>6492)
FT                   /locus_tag="OSTLU_17201"
FT   mRNA            complement(join(<5346..5389,5505..>6492))
FT                   /locus_tag="OSTLU_17201"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(5346..5389,5505..6492))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17201"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17201"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98684"
FT                   /db_xref="GOA:A4S493"
FT                   /db_xref="InterPro:IPR010635"
FT                   /db_xref="UniProtKB/TrEMBL:A4S493"
FT                   /protein_id="ABO98684.1"
FT                   /translation="MRGRKMHECDKLATSWIDEQRGAHERRVRARDDDAQRRFLYFLHI
FT                   PRTAGRSFHWCFLKPSFKDHELCGNQYTGLRIDPREPTCEFLATHDDYSLIERFTEQPR
FT                   VVTMLRKPSARALSSYEFSIEVAARSFGKEPVNTTRVQTRDVWPWSVLTRFMDDELRSY
FT                   DDAVNADGRNELSISNVYDNALYTPFEDWAEMKMVHDDIHNGQFFQLLGLTNNTDDAVE
FT                   PRAAELRECALWRGTKASKMMMDYAKERLEHEVDVLALHERLDESIELAARQLDLPLSA
FT                   NANFADPTQIDAQNVKSRISKVGTSFKSDDASDCVDVVGFSFRFSKLKTMTTGQRILKG
FT                   FTS"
FT   gene            <7068..>7274
FT                   /locus_tag="OSTLU_26331"
FT   mRNA            <7068..>7274
FT                   /locus_tag="OSTLU_26331"
FT                   /product="predicted protein"
FT   CDS_pept        7068..7274
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26331"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26331"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98525"
FT                   /db_xref="UniProtKB/TrEMBL:A4S494"
FT                   /protein_id="ABO98525.1"
FT                   /translation="MAGAHSADVVARALALAAEARGDGERKRTNALLEGALKQYVSELD
FT                   EFRAVCERLKERETAGGGAATTN"
FT   gene            complement(<8231..>10126)
FT                   /locus_tag="OSTLU_44250"
FT   mRNA            complement(<8231..>10126)
FT                   /locus_tag="OSTLU_44250"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<8231..10126)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44250"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44250"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98685"
FT                   /db_xref="GOA:A4S495"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A4S495"
FT                   /protein_id="ABO98685.1"
FT                   /translation="MTRAVPSIDARARAHATQTRRRPRRAHLYHPSTRARSSTAPRAFL
FT                   DRLSGNATATGDKQQRDLFAQTKRAEVRIPGFLAYVDVDEATSTRGAEVVDAVLHAGAT
FT                   CVALREYGVDGTGGGNSGKKLYEAATTLKTLVRGRACVLIVDRTDIAASAELDGVVLTD
FT                   DGVPTVVARKALPETAVVAHESESAEEAEKASKEGADLLLVRDVAMLEAIRQSVSVPIF
FT                   VDAADGLGALASENSSTLQDLAAKGANGVTIRNLTKDPASGDEALLQSAVRAVANALEQ
FT                   SYEALGDSKGANGSAPQVTPKKFSLVSADGEEMIERERQLVEEILKFLRENCTDLDEIK
FT                   LLAEARKGLEDLFLVVICGEFNAGKSSVINAMLGDKFVAEGILPTTNEIAVLRYSSKKS
FT                   REQTEDGFFNVGIPAELLQQMRIVDTPGTNVILQRQQRLTEEFVPRADLVLFVLSADRP
FT                   MTESEVKFLTYIRKWGKKVVFVVNKTDLLSDLGDVDEVVAFVKENATRLLSVSDPAVLP
FT                   VSSRNALKAKKADSSNYANSRAFVESGFGKFEDYVMSFLGGSGERAGEALRLKLSTPLN
FT                   VSELLLNAAEQILEGEDEEAKSEVAMATGVTSQMESYRQEMITDAAAQRAAAREVV"
FT   gene            <11078..>11407
FT                   /locus_tag="OSTLU_9648"
FT   mRNA            <11078..>11407
FT                   /locus_tag="OSTLU_9648"
FT                   /product="predicted protein"
FT   CDS_pept        <11078..>11407
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_9648"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_9648"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98526"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A4S496"
FT                   /protein_id="ABO98526.1"
FT                   /translation="GILTERDYLNAVARGFISASTKVSEVMTSFRDASKKIAKLVSVSP
FT                   EDSVLAAMESMTNNRLRHIPVIASKGVNPKDQSPIEPRVLGVVSIGEVLKALLAESRSE
FT                   ISHLES"
FT   gene            complement(<11576..>12115)
FT                   /gene="MCS"
FT                   /locus_tag="OSTLU_44114"
FT   mRNA            complement(<11576..>12115)
FT                   /gene="MCS"
FT                   /locus_tag="OSTLU_44114"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase, putative chloroplast precursor (MECPS)
FT                   (MECDP-synthase) (ISPF)"
FT   CDS_pept        complement(11576..12115)
FT                   /codon_start=1
FT                   /gene="MCS"
FT                   /locus_tag="OSTLU_44114"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase, putative chloroplast precursor (MECPS)
FT                   (MECDP-synthase) (ISPF)"
FT                   /note="GO_component: - chloroplast; GO_function: - lyase
FT                   activity; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase activity; GO_process: - terpenoid biosynthesis;
FT                   isoprenoid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44114"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98686"
FT                   /db_xref="GOA:A4S497"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:A4S497"
FT                   /protein_id="ABO98686.1"
FT                   /translation="MRARAEATVDGAAPVLPFRVGHGFDLHRLESTAEFPELKLIIGGI
FT                   EIPHDRGCVAHSDGDVLMHCVVDAITGALGLPDIGQLFPDTDPKWKGQTSDVFVKEAVR
FT                   LMKLEGYSIGNLDCTLIAQRPKISPHKDNIRANVAKVLGVHEAVVNVKAKTHEKVDSLG
FT                   ENRSIACHTVIMLIKD"
FT   gene            <12515..>13195
FT                   /locus_tag="OSTLU_26335"
FT   mRNA            join(<12515..12534,12751..>13195)
FT                   /locus_tag="OSTLU_26335"
FT                   /product="predicted protein"
FT   CDS_pept        join(12515..12534,12751..13195)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26335"
FT                   /product="predicted protein"
FT                   /note="GO_function: - electron transporter activity;
FT                   GO_process: - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26335"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98527"
FT                   /db_xref="GOA:A4S498"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4S498"
FT                   /protein_id="ABO98527.1"
FT                   /translation="MAMRCLSSKTTTPTTAFAARRRQTTAKRQLRVRAGEGETDGNVKF
FT                   ANNKPEFEAVSAAAGSGLVAVQISTKTCGPCKMIYPTFVGLSQELPKVTFVKIMGDTDL
FT                   ESRALMKEWGVRVVPLFLLFRNGERVGEWSGAKADILKENVRAACNADEK"
FT   gene            complement(<13291..>15063)
FT                   /locus_tag="OSTLU_26336"
FT   mRNA            complement(<13291..>15063)
FT                   /locus_tag="OSTLU_26336"
FT                   /product="predicted protein"
FT   CDS_pept        complement(13291..15063)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26336"
FT                   /product="predicted protein"
FT                   /note="GO_function: - catalytic activity; GO_process: -
FT                   histidine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26336"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98687"
FT                   /db_xref="GOA:A4S499"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014640"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4S499"
FT                   /protein_id="ABO98687.1"
FT                   /translation="MRAAPVASPARTARARGLRLAARARGDGCAVTRRAVTRSPVRRGR
FT                   GRANATHATNAAKEPVYLLDYGAGNVRSVRNAVTALGFEVRDVKTPKDLSEAKKLIFPG
FT                   VGAYGSAMDILRERGLIEPLREYVRADKPFLGVCLGLQLLFDGSEESGGVEGLGLIPGS
FT                   VDKFRGEGLIVPHIGWNLTNTKKSSGLMDGMESERVYFVHSYRATPTEANKDWVLATCD
FT                   YGGEFIASVQKGNVMACQFHPEKSGATGLGVFQRFLEDAKPTGQFGTAPSVTNGLARRV
FT                   IACLDVRSNDSGDLVVTKGDSYDVREKDEGGDVRNLGKPVELAGKYFKQGADEVAFLNI
FT                   TGYRDLPLTDAPMLEVLRRSSETVFVPLTVGGGIRDFTDSNGKSYTALEVASAYFASGA
FT                   DKVSIGSDAVYVAEDWYASGKVNTGKTSVEQISERYGVQAVVISIDPRRQYVADPSMTK
FT                   NKCVETSRPGPNGEKYVWFQCTVKGGREGRDIGAYELAIAMEALGAGEILLNCIDEDGQ
FT                   GNGFDHELVNLVSDAVGIPVIASSGAGCPEHFTNVFNVTKCSAALAAGIFHREEVLVSE
FT                   VKAHMTSNGLPTRA"
FT   gene            complement(<15257..>15619)
FT                   /locus_tag="OSTLU_9112"
FT   mRNA            complement(<15257..>15619)
FT                   /locus_tag="OSTLU_9112"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<15257..>15619)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_9112"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_9112"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98688"
FT                   /db_xref="InterPro:IPR011421"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4A0"
FT                   /protein_id="ABO98688.1"
FT                   /translation="EQNARFTETRNFAGKMVEVETEIVEGSKEAKARSKRVEMLAKGGL
FT                   DAVLAELMEPKKLNVLDKTKADWRGVKDVDVELQEDLQHHQRGGRTYREHQDFLQQADY
FT                   REYELERDARLAAQSKR"
FT   gene            <16477..>17610
FT                   /locus_tag="OSTLU_4215"
FT   mRNA            join(<16477..16623,16687..>17610)
FT                   /locus_tag="OSTLU_4215"
FT                   /product="predicted protein"
FT   CDS_pept        join(<16477..16623,16687..>17610)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_4215"
FT                   /product="predicted protein"
FT                   /note="GO_function: - RNA binding; pseudouridine synthase
FT                   activity; GO_process: - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_4215"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98528"
FT                   /db_xref="GOA:A4S4A1"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4A1"
FT                   /protein_id="ABO98528.1"
FT                   /translation="RYCAPYDFDFVCGVKARWAGRRLCDLFASEFPMRPKEYYVKAHAM
FT                   GRLCAREHEDGPMLAGGNRVRHFIHRHEPPVMADEVRVLTVNDDVVSVWKPATVPVHPT
FT                   GQYRRNTVLALLAASRRDLGRLFPIHRLDKNVSGLLLLARSSEAANEMRVKMEAREMRK
FT                   EYVARVRGAFNDGDATPVSNVESLGFDSKGRVAIWRGKKGVTDLDERTLKSFKDASTKF
FT                   TCIKTLVDGTSLVRCEPFTGRSHQIRAHLAMLGYPIANDVAYGGALVEVERARAIQHAC
FT                   DVTVLNEAGELVKDESLAIDYSAPRKSREQSSDLCPHCPRIVHAGDQAIDLEAIWLHCV
FT                   RYSGEGWEFECPMPDWA"
FT   gene            complement(<17634..>18644)
FT                   /locus_tag="OSTLU_17209"
FT   mRNA            complement(<17634..>18644)
FT                   /locus_tag="OSTLU_17209"
FT                   /product="predicted protein"
FT   CDS_pept        complement(17634..18644)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17209"
FT                   /product="predicted protein"
FT                   /note="GO_function: - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17209"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98689"
FT                   /db_xref="GOA:A4S4A2"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR026873"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4A2"
FT                   /protein_id="ABO98689.1"
FT                   /translation="MSSLADEVTTIAFESLAVDAHASFIVNASASEDTLEHAFTEHLRL
FT                   SGIYWGVCALATMGNLRKTMDADKREEILSYVASCRCESGAYSGGAGHDGHVLYTLSAV
FT                   QIYALFDAMDRIDRDSVVNYVKGLQLADGSFQGDEWGEVDTRFTYCALSTLRLLDRLHE
FT                   VDVEAACAYINKCKNFDGGFGATPGGESHAGQVFTCVGALAIGNRLDYVDGDLLGWWLA
FT                   ERQVKVGGLNGRPEKLPDVCYSWWVLSALSILGKTHWIDRGALARFILRCQDETSGGIS
FT                   DRPDDEPDVYHTFFGIAGLSLMGHPAVVEPIDPVFALPNSVLKQLGIEPWSARKC"
FT   gene            complement(<18756..>21620)
FT                   /locus_tag="OSTLU_26340"
FT   mRNA            complement(<18756..>21620)
FT                   /locus_tag="OSTLU_26340"
FT                   /product="predicted protein"
FT   CDS_pept        complement(18756..21620)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26340"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26340"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98690"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4A3"
FT                   /protein_id="ABO98690.1"
FT                   /translation="MTLARDARTRGAEREGDDAETQSRGKKRARRKRDDAGRRDARTTF
FT                   GGFATLPTELVVKIMKELDGYSLAMATCACKDFEATGRENDELWLELLIKLEPRALMRE
FT                   DLMQNGSGKFRAFSYKELFMWRLHTLKGCAMMNTKAYAEMAARGDATRALSADASGPSS
FT                   SELRSKIGHLGRLAVINQEQLFTCDPRPKGGLIYNVYDSGMNSFVPHTLLWSPRSELLA
FT                   CAFLVNGAESKTCHSKIILSAPKAVLTGQLKFARGDALTNTNAEVSTPRHGRHPYEAPP
FT                   MNNIIALPHGLQCAHMAFAPCGTMLNILHKDRMESSLYTLDCAISITSLYGPSNGKSGT
FT                   SPVPPPSEHVTRVASGTDSIRFAISPIDNNSLLMFGDQREIMLLRKQGIRGGAIPLSDR
FT                   WPGTRAFDEVSSDDDSLYASDGFEREYEMPPDAVDVPRSLNHSLTSANSNAAHPACDTA
FT                   SEPLESAFQDDIHERATRDCQEVVSTPKMTWWQQLSRNILAGVKSATLGARGNEKPSTS
FT                   AKRDEDSEHGALKRIKDSANSIDRSDWSCLKAGTWWSNIPNFRKLTDILVKEHAKQPLA
FT                   RLYTDETAKRIEWVPSKRGDVNGRGFWLLPSSIPERYDDDHDTAYYAFLVMVPVPSEKA
FT                   IKERKIKPFISGDDDELFQNISECVITEISPAPAYAEPNIVARFLYAGRAGGRQVVWST
FT                   VDGLFVRCVDFNLDAEGDWMGPPTLGPMMQVIDFTSILNGANRWNKSYDEVSVRNYASW
FT                   NGSRQVPVLSVVNEVLRYTIEVIQWSPSGERLLILMAVHLAYEEPVQAGEYYTVHQWIC
FT                   WDPPPVMSDDSEKALHRVPAGECHGVLSFGSRFIPSQTFRSECSEKMDNLSGGINLWSP
FT                   EETAIAFGIQVPRVVPTHESSDYIVIQNFPRVNFDEIERRSLTGEAPPLQQDGSVASLP
FT                   YHLNYVDSALEYVCEGTYCSWSPT"
FT   gene            complement(<21962..>25360)
FT                   /locus_tag="OSTLU_25190"
FT   mRNA            complement(<21962..>25360)
FT                   /locus_tag="OSTLU_25190"
FT                   /product="predicted protein"
FT   CDS_pept        complement(21962..25360)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25190"
FT                   /product="predicted protein"
FT                   /note="GO_component: - nucleus; cytoplasm; GO_function: -
FT                   tRNA binding; GO_process: - tRNA-nucleus export"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25190"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98691"
FT                   /db_xref="GOA:A4S4A4"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040017"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4A4"
FT                   /protein_id="ABO98691.1"
FT                   /translation="MTTLDDVDALDAVVRDAFARTNDARATAKAADASRALDALKRDAR
FT                   AWAVCLRAYSRTTSSETKFWCLQTLTEALAKEARGGGTTMSDEDAETLRRALGACVSEA
FT                   TGESATGGDGGDDRRSSAATAASSTSTPAFVKNKLAQACAYAVALEYPERWPSFFADLA
FT                   NLLSRGTQGVDMFTRVLEAIDEELIATVDAGRAGKEDFARSMRIKEAMRADGSLRLVFD
FT                   AWRQCLEHYARVDPRVATRVWSVARRYVEWVDVGLVASEEYVKGAKECLMLDDLSGAAD
FT                   ESLRAAAVGYLHAVITKGMETSAKVRLIISTKIVEVCARLQVICAATQDDFDEEFVTQV
FT                   TNLAAAVAAELLNANKVENITALGVELSAEVSSSLHQVTPLVLSSISFKHERAVLVALP
FT                   FLTAYIGYMKSQPALLNAAQPALTSACQALIARGAFPTEHIDGLDWNDGSNALTQEFEA
FT                   DVFSLRAELNVQLKNIARLAPHLAREVVRQVLMSAVVGSGEGNQLCWQNVEVAISALFT
FT                   LGEGADDAAVKPMSIADRAKATNGTGEVTDTPLGALVVSLIREWGTSVGRAAYHRLVAP
FT                   TFLEICVRYHAVLERDDAALVAALTAFLDERGIGHVDLAVRSRACYLISRLSRPLRCKL
FT                   SDKVENIMCVLPAYLTEFARSLPEPATQNAAFVSVSAAGIQSRAMAESGNDDRLYLFEA
FT                   FGTMLGADEVKEEEQYRYLSQIAAGLCRQIEEVAAGGQSGEDAPIRIALATRAIVAFGN
FT                   ISKGFSQRTCLTSRPRTGEVFRSCLEMSLRCLDVWPRDASVRNRATGFLHRMIDLLGPT
FT                   VTPYLAPTVHKLRRDADAVELRETLVLFNQLASTYAAELAPFVVEVLPGLAAQIFNTIS
FT                   SAYAQASVESVGGSIATNTEVVREADELERMWLTTTAALGANALIAPTFTGYPNTKRTA
FT                   PLREQLLSHLVQAAQSHGMVSARKVALTALKSFVEEWTLDTSPDEPPSLEGAPTSSAPA
FT                   KGPRDERVPGFTRFVVERVCVECCILPPIRGDLDLSDAVSVGALNESFAILAVVHARQS
FT                   DALTTALTHIFRHSILPSHSPDRIDAIVNEYIRVLAAAAAAGKPHLRSTKPARALVDAV
FT                   RREIGAAPDRGRTLDLTPRLAKRGV"
FT   gene            <25942..>26526
FT                   /locus_tag="OSTLU_44260"
FT   mRNA            <25942..>26526
FT                   /locus_tag="OSTLU_44260"
FT                   /product="predicted protein"
FT   CDS_pept        25942..26526
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44260"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44260"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98529"
FT                   /db_xref="GOA:A4S4A5"
FT                   /db_xref="InterPro:IPR004895"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4A5"
FT                   /protein_id="ABO98529.1"
FT                   /translation="MSVDAASASAGAGVFGAVGRVKESAQHVWAQQKPMSEILDASAYA
FT                   RPVSFGDATSRMQKNLNYFRINYLVFASAVLSLFVLFHPSSLAIFGSVAAAWVYVFSVR
FT                   SEPLKIGDRELSHRETLMGMSALSAFVIFMLTSAGTVLFSGLGVALLGVGAHAAARVPD
FT                   DLFVEDANDNKGFFSFLEPPSRNGQVSSGTV"
FT   gene            <26961..>27428
FT                   /locus_tag="OSTLU_8994"
FT   mRNA            join(<26961..27176,27246..>27428)
FT                   /locus_tag="OSTLU_8994"
FT                   /product="predicted protein"
FT   CDS_pept        join(<26961..27176,27246..>27428)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_8994"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_8994"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98530"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4A6"
FT                   /protein_id="ABO98530.1"
FT                   /translation="VRSVMTSRVLTVRPDESVFEAMKLLVDNRISAVPVVNASGEVLGV
FT                   VSEYDLMARVGKKETTKSVADDGMFPRRMYKASGSKVSTAMHEATTCTPDMPLVEATEL
FT                   MLNGNLARMPVVDDRGALVGILSRGDIMR"
FT   gene            <27781..>30039
FT                   /locus_tag="OSTLU_44147"
FT   mRNA            join(<27781..29193,29308..>30039)
FT                   /locus_tag="OSTLU_44147"
FT                   /product="predicted protein"
FT   CDS_pept        join(27781..29193,29308..30039)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44147"
FT                   /product="predicted protein"
FT                   /note="GO_function: - RNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44147"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98531"
FT                   /db_xref="GOA:A4S4A7"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR040059"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4A7"
FT                   /protein_id="ABO98531.1"
FT                   /translation="MPRAESKAGGGAKARRAAKRTNKFNPSAAAAAPALVNVGDASQYD
FT                   DERAIELERRKKSNVKQGKKLGKRKKGATSDKETGSSEDAAPKKKRSDAAANAEKVDFS
FT                   KLSRKEAKAKSDEMKALRKPNFALVQELAQIWERMRGKKVSKTDRSAMCDEIYKKCVGK
FT                   VPELANNHKGSRVVQAVLKYGTTEQCAKIMSEVTPQMALLSKSLYGNFLVRKLIDAADK
FT                   KEIPALVGNLRGQIARLARHPVGSQIVEALFHAASAKEKKAMTFEFYGPEFVHFGAADD
FT                   VKSLREALLLKPVAQRQGMLRHINVTMIPVLEKGLVSSSVIHRVLAEYLSVGGPSTKAE
FT                   AAGSIAAAGLLRMMHTKDGAHAVNMILAHSGAKQRKGVIKALKGQVSRVSQDDYAHVVI
FT                   ASLFDCVDDTQLLGKGVVSELKAESLAEVASHKNARRVLLHILNPRSTRYFPSHLLECM
FT                   PDPQKVREDAEETFGGEDEEEAPEGDDDDDDDDGLEEAPADGPDFGIAKKPASTRRAEL
FT                   FHQGLGDSLVAACSVNAASMLRSNLASDVLFEVAAGGCDDIFYKTVGDKKMTDLFEAIS
FT                   EAVATSMTSEQIDAELGEKLEPLHANFFSTRTLRRMALEVKHAQFVPIFWKSALKANLK
FT                   TWIDGHGAKVVAAVVRTKTDAKTRKEIHAAVGKLVDSGDAAAWSEGFFRVKDGDKPRNS
FT                   AGKDEQPTSKKAKKAKKASK"
FT   gene            complement(30074..>31096)
FT                   /locus_tag="OSTLU_26345"
FT   mRNA            complement(30074..>31096)
FT                   /locus_tag="OSTLU_26345"
FT                   /product="predicted protein"
FT   CDS_pept        complement(30155..31096)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26345"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26345"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98692"
FT                   /db_xref="GOA:A4S4A8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4A8"
FT                   /protein_id="ABO98692.1"
FT                   /translation="MATARDRPAGREGDGEGDGDGDDAAQKRTKNRDRHAVHELAGYKI
FT                   EGVSVGGRETSVVLPALGVAFDSGRCPQRCVYADVMCLSHTHMDHVGGCGMYIATRGLL
FT                   SLTPPTVLLPSARREAFGTFIESLRALDDSELNHRAIGIDPGERYAMNKLFEIAAFRTR
FT                   HPVPSQGYVVYGTKQKLKPAYAGLSGPEIKRLRDDGEQVTDKVEVPEVAFTGDTTGDWI
FT                   DDPANADALRAKLLIMECTFIDDAVSKHDAERFGHTHIDDIVARADKFQNEAILLIHFS
FT                   ARYKAEEVRAALKAKLPRALYEKCTPMLVGFD"
FT   gene            <31806..>42632
FT                   /locus_tag="OSTLU_88532"
FT   mRNA            <31806..>42632
FT                   /locus_tag="OSTLU_88532"
FT                   /product="predicted protein"
FT   CDS_pept        <31806..42632
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88532"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88532"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98532"
FT                   /db_xref="GOA:A4S4A9"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4A9"
FT                   /protein_id="ABO98532.1"
FT                   /translation="VYVARAVALVVVSDIAAWTVTLYGGGIPAAMRSLVIFGGMSVVYY
FT                   GAYVARWNRSMFDLATRLVAAAAIGSSSVIFGTALALKVIPRPMMQVLAILLASTVAPL
FT                   LGVYVEELRLHRTSTRRTRLMILSDCSLYGSWDAVAGTVAWACAFNQSADAFGPALAQS
FT                   SFVAFIVAAACRWMRAMYVLYVIDHWIIQTVAAMSQEFTETVSRATVVVMEEVSRAPIV
FT                   VKETVSRVSVAIAETVTQTPDVVSHNDESPQPVAEPKMHERSDNNEAAVASVKMRVARE
FT                   PQPVVMESAPSSDAAPVAGESVSVTQQPDERRIEYAPPYTAVIREQDPRPEPPRVVYAP
FT                   AFVVVEEASTSSSTESDVTQPLESKRRRRQRKRQYRRRESLAKNTIDMSEIVSKEVNIA
FT                   LNMGVSIEAELQRMLDRRQSTLNDMKNQQANPISIAQVEADIAALRAELRRATTSREQF
FT                   QRAQTSYESDLEMWMESIRAAAAVSRLDYAIDSLKNASVADDPQVKELIDQRAVWGLRL
FT                   VSSQIFTIVELQDSLDSGEARSSARIAELRGAIESLELKLTRLQEEKTQSVDNRILLED
FT                   RLQKLNLEIDSVRERERVAQEDWQRERLRLEVELEASVKELQTATRTVDDALKAKLELL
FT                   AKLQTAQDQSDTDAEAIRRLEHETETLQTKLKSLTEQLSVANASVEQINSRRFDLESQL
FT                   RAKATELDLANANRADTSLVEELRRQVKNLSTEICWLRDQKSREGSEAEAVLQKQLAEA
FT                   RTQLEIQRNELEIEAKAEISELKRSMDVIREEMERLTSEMSEKTEKSLEYQRIVQERQK
FT                   EIESLTKNKELAARAIDESKKNLAQAQEALETKQKALDDRVSQVASLSLDLAASEEKTL
FT                   TLERELSASCQRSQELEELISSLRSYSESRDALLADIDLLLGNENDEREAMLRGSKNAS
FT                   DLVERIQKRLRREVVLEKKLDQAQLLEQVGLTVEELKTREAASLWWKDLVQIGSKALET
FT                   IQSTAVDLSKGTVTASLLERSISLRAKELQNITSEPQYQRLQKSFNDLKRLSEAAERKL
FT                   QEKERKIKSLKADSKESAAELKALTSELASVKEDLKYIRDIAKEERDEQIQRIESLMLE
FT                   VDSFENAKFDGEEAVRFRNEAAKLRGMKIRLEAELKLSQDLAETASSELARAREEHDVV
FT                   ITQLSEEIAALELDITVKSEAIEKLESKTNNIEVKLGSDLESALAKLNTTLEELDKKST
FT                   DFASLESASVEQKRNFEKHVDELEKRLGASEAEVQRLIQDRDLAIEAKDNEMVSKILSQ
FT                   SAIVSDLESERDALRSQLADLSSARDSELASVRADLESQLREREEDIERVRSELDESKA
FT                   ALESERDALQSELERVLSQVPEVDASQSAIVSDLESERDALRSQLADLSSARDSELASV
FT                   RADLESQLREREEDIERVRSELDESKAALESERDALQSELERVLSQVPEVDASQSAAVS
FT                   DLESERDALRSQLADLSSARDSELASVRADLESQLREREEDIERVRSELDESKAALESE
FT                   RDALQSELERVLSQVPEVDASQSAIVSDLESERDALRSQLADLSSARDSELASVRADLE
FT                   SQLREREEDIERVRSELDESKAALESERDALQSELERVLSQVPEVDASQSAAVSDLESE
FT                   RDALRSQLADLSSARDSELASVRADLESQLREREEDIERVRSELDESKAALESERDALQ
FT                   SELERVLSQVPEVDASQSAIVSDLESERDALRSQLADLSSARDSELASVRADLESQLRE
FT                   REEDIERVRSELDESKAALESERDALQSELERVLSQVPEVDASQSAAVSDLESERDALR
FT                   SQLADLSSARDSELASVRADLESQLREREEDIERVRSELDESKAALESERDALQSELER
FT                   VLSQVPEVDASQSAAVSDLESERDALRSQLADLSSARDSELASVRADLESQLREREEDI
FT                   ERVRSELDESKAALESERDALQSELERVLSQVPEVDASQSAAVSDLESERDALRSQLAD
FT                   LSSARDSELASVRADLESQLREREEDIERVRSELDESKAALESERDALQSELERVLSQV
FT                   PEVDASQSAAMSDLESERDALRSQLSELRQMSSESIAGLQQQLVAFSAEADSAASLRKT
FT                   VKELKATIRQRENLLSETVFDPMLNDDLDRMNDELASKSAELDSARTKLQSTLNKLKER
FT                   EEQAESSQAVASAVIDEIRAELLNANEKLAARESYANAVELALRSELTEREKEIALLRV
FT                   KVAKILDDSTNKQTSLTTALDSAQSEIERLTRELEDVEQSKQVAMKESFERNESQIASL
FT                   NAAHRELDQRLRDELDAALKAKASLEKELSDRAESTAATETAKRNAEALSESLQSQLDA
FT                   LSTQRAELEQRLVKREEELVAELDAAKHEATAQAARFAQLGEAASDHAHDEVDKLKSEV
FT                   ERLEFELGAVKNELTSATSTAKADIARLTDELASASAARDAVAETAHPEEDGSSESASA
FT                   FEAMRRDMTRLESELAAALAELAELESPRESESSDTEAIREFTTALDSAQSEIERLTRE
FT                   LEDVEQSKQVAMKESFERNESQIASLNAAHRELDQRLRDELDAALKAKASLEERSDRAE
FT                   STAATETAKRNAEALSESLQSQLDALSTQRAELEQRLVKREEELVAELDAAKHEATAQA
FT                   ARFAQLGEAASDHAHDEVDKLKSEVERLEFELGAVKNELTSATSTAKADIARLTDELAS
FT                   ASAARDAVAETAHPEEDGSSESASAFEAMRRDMTRLESELAAALAELAELESPRESESS
FT                   DTEAIREFTTALDSAQSEIERLTRELEDVEQSKQVAMKESFERNESQIASLNAAHRELD
FT                   QRLRDELDAALKAKASLEKERSDRAESTAATETAKRNAEALSESLQSQLDALSTQRAEL
FT                   EQRLVKREEELVAELDAAKHEATAQAARFAQLGEAASDHAHDEVDKLKSEVERLEFELG
FT                   AVKNELTSATSTAKADIARLTDELASASAARDAVAETAHPEEDGSSESASAFEAMRRDM
FT                   TRLESELAAALAELAELESPRESESSDTEAIREFTTALDSAQSEIERLTRELEDVEQSK
FT                   QVAMKESFERNESQIASLNAAHRELDQRLRDELDAALKAKASLEKELSDRAESTAATEI
FT                   AKRNAEALSESLQSQLDASRAEEAKLRDELNHFQELAREEISALHNEITEIKFTSQESQ
FT                   ASLGESPWPSITISTLAGLNEMMSRGSEFGSEGLDWLEHAAHEVQALEKSVLDATAELE
FT                   LRENEYEQTIAQLQDSVRDAETDLNSQKSLASAALSDVEHLNDKLAERDEELASLRLEL
FT                   ANLVSDDVTRELELTISNLRIQLTAKDNELNGAVASLNDLENDKRAIEEAMSELQAAAD
FT                   MQAARVQTSIEQISSLNVELAKRSAALDASWDNLSHAESRARFAEQERDDVRRLFEERL
FT                   AVKERALRETQGDVEHLRQTVRNLQDKLKAHRYARSETEAGHPEEDGSSESASAFEAMR
FT                   RDMTRLESELAAALAELAELESPRESESSDTEAIREFTTALDSAQSEIERLTRELEDVE
FT                   QSKQVAMKESFERNESQIASLNAAHRELDQRLRDELDAALKAKASLEKELSDRAESTAA
FT                   TETAKRNAEALSESLQSQLDGKT"
FT   gene            complement(<49821..>50552)
FT                   /locus_tag="OSTLU_93405"
FT   mRNA            complement(<49821..>50552)
FT                   /locus_tag="OSTLU_93405"
FT                   /product="predicted protein"
FT   CDS_pept        complement(49821..50552)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93405"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93405"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98693"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4B0"
FT                   /protein_id="ABO98693.1"
FT                   /translation="MRANFTRAPSRGPSTSTSGAASRAARARSAGDGECAFTDANDRAV
FT                   EKFWRNWTGAAHCRQIVTKSSRESLYRDPARLESKVRALLRVFPVDGDGNCGSHGLDVP
FT                   ASAAREPRLLALREDEFVKRVLMVKRCVAGISGRQITLAPGLLLCDGRALEEAMRGLEE
FT                   TLGAAEARDAVAKQPDRLLELVGFYGVGDDAEEEERDIGRAMRHYARAVPPVSDARAVE
FT                   QRVAARELGAKKFHVGESGAI"
FT   gene            <50579..>51766
FT                   /locus_tag="OSTLU_26347"
FT   mRNA            <50579..>51766
FT                   /locus_tag="OSTLU_26347"
FT                   /product="predicted protein"
FT   CDS_pept        50579..51766
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26347"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26347"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98533"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4B1"
FT                   /protein_id="ABO98533.1"
FT                   /translation="MAPVAVAANVEIAAPLAVEDTATLCDLVRGALCFWRCERDYFFAE
FT                   GSKCARARDACAAACRLPPEWVTRALGTTREREIAKHTDPLERKEYLGTLTEEEARTLR
FT                   RRRAEAARFVRRRAMAAAPERQSMTKRAGERRRRERAWTSSKLRKDGDDASVSASDEFG
FT                   KAEALEAELAEANARRYRRAYDGADESGYSSRSSSYYSDESSYSSYTGSSYSSYTGSSY
FT                   SSYASDADAERERRRALALDAMKPPNDATAMTVSRKDALGKPLIVGKHLAFATEGLLPE
FT                   GLTRWEAYIAEAERAGELRDAKMRRRAERRDRSLHRELDALKLYADRVKLSEQDVQIRR
FT                   QALIDAHDARVRESVEREVKIAARARRKRNVLLNLDHDARSRLLKRWALRPSAQK"
FT   gene            <52249..>52656
FT                   /locus_tag="OSTLU_44311"
FT   mRNA            <52249..>52656
FT                   /locus_tag="OSTLU_44311"
FT                   /product="predicted protein"
FT   CDS_pept        52249..52656
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44311"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44311"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98534"
FT                   /db_xref="GOA:A4S4B2"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4B2"
FT                   /protein_id="ABO98534.1"
FT                   /translation="MSDEEAGDGIGGDVGTRDEEHKMALLVREDVAMGAGKLAAQAGHA
FT                   AVGAAMATRDRSPMLMGRWECDGQKKVTLGVKNLRVMNELLGEAKTARLTTFVVEDAGR
FT                   TEVEPGTVTVAAIGPAAASDIDKITGHLRLY"
FT   gene            complement(52705..>59716)
FT                   /locus_tag="OSTLU_50795"
FT   mRNA            complement(52705..>59716)
FT                   /locus_tag="OSTLU_50795"
FT                   /product="predicted protein"
FT   CDS_pept        complement(52754..59716)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_50795"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_50795"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98694"
FT                   /db_xref="GOA:A4S4B3"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012591"
FT                   /db_xref="InterPro:IPR012592"
FT                   /db_xref="InterPro:IPR012984"
FT                   /db_xref="InterPro:IPR019580"
FT                   /db_xref="InterPro:IPR019581"
FT                   /db_xref="InterPro:IPR019582"
FT                   /db_xref="InterPro:IPR021983"
FT                   /db_xref="InterPro:IPR027652"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR042516"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4B3"
FT                   /protein_id="ABO98694.1"
FT                   /translation="MDVGVSEEVMEKARKWRALNAKRYGARRKFGYQEPPKEEMPPEHV
FT                   RKIIKDHGDMSSRKFRHDKRVYLGALKFVPHAVYKLLENMPMPWEQVRHCEVIYHITGA
FT                   ITFVNETPRVIEPVFIAQWGTMWIMMRREKRDRKHFKRMRFPPFDDEEPPLDYADNLLD
FT                   VDPLEAIALELDEEEDGAVAEWFYDHNPLKWTKFVNGPSYRKWQLPLPVMANLHRLSSQ
FT                   LLSDLTDKNYFYLFDHKSFFTAKALGMCIPGGPKFEPLFRDMDRADEDWNEFNDINKLI
FT                   IRSALRTEYKVAFPYLYNNRPRKVSLAVYHTPMVMFIKTEDPDLPAYYYDPLIHPIAFY
FT                   RSNKQKTTPREEDDGEDDFQLPDGIEPFLEDTPLYTDNTAGGIALLYAPRPFNLRSGKT
FT                   RRAMDVPLVNNWFHEHCPSGYPVKVRVSYQKLLKGFVLNQLHKRPPKPMKRRNLFVALK
FT                   KTKFFQCTELDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERK
FT                   KSRFGNAFHLCREVLRLTKLVVDSNVQFRLGNIDAYQLADGLQYVFSHVGQLTGMYRYK
FT                   YKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGVGFWAPMWRVWLFFLRGIVPLLERWLGN
FT                   LLARQFEGRNNKGIAKTVTKQRIESHFDLELRAAVMHDILDSMPEGVKQNKARTILAHL
FT                   SEAWRCFKANIPWKVPGMPTPIENMILRYVKSKADWWTNVAHYNRERIRRGATVDKTVC
FT                   RKNLGRLTRLYLKAEQERQHNYLKDGPYVTPEEAVAIYTTTVHWLESRRFSPIPFPPLS
FT                   YKHDRKLLILALERLKENYSVNARLNQNQREELGLIEQAFDNPHEALSRIKRHLLTQRA
FT                   FKEVNIEFMDLYSHLIPVYEIEPLEKISDAYLDQYIWYEADKRQLFPNWIKPSDTEPAP
FT                   LLVYKWCQGINNLTDVWDTNEGECVVMLQTRFEKMFEKVDLTLLNRLMRLIVDHNIADY
FT                   CTAKNNVVISYKDMSHTNSYGMIRGLQFASFMTQYYGLVLDLLLLGLTRASEIAGPANM
FT                   PNEFISYRDVETETRHPIRLYSRYIDRVHVLFRFTADESKDLIQRYLTEHPDPNNENMV
FT                   GYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSLTTLEWDNGFVSVYSRDNPNL
FT                   LFAMSGFEVRILPKIRMATEYFANKDGVWNLHNEQTKERTAQAFLRVDDEALKSFENRI
FT                   RQVLMSSGATTFSKIVNKWNTALIGLMTYYREATIHTSELLDLLVKCENKIQTRVKIGL
FT                   NSKMPSRFPPCVFAAPKEIGGLGMLSMGHILIPQSDLRYSVQTDSGITHFRSGMTHEED
FT                   QLIPNLFRYIQPWEAEFNDSQRVWAEYALKRQEAQAQNRRLTLEDLEDSWDRGIPRINT
FT                   LFQKDRHTLAYDKGWRVRLTFKEYNLTRQNPFWWTHQRHDGKLWNLNNYRTDVIQALGG
FT                   VEGILEHTLFKGTYFPTWEGLFWEKASGFEQSMQYKKLTNAQRSGLNQIPNRRFTLWWS
FT                   PTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESVVMDMCNVFD
FT                   QELDALEIETVQKETIHPRKSYKMNSSCADILLFAAYKWSICKPSLMGETNDSFDQKSS
FT                   NKFWVDVQLRWGDFDSHDIERYTRAKFLDYTTDNMSIYPSPTGVMIGIDLAYNLHSAYG
FT                   NWFPGCKPLVQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLNSQNYGELFSNQ
FT                   TIWFVDDTNVYRVTIHKTFEGNLVTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLA
FT                   QLAKWKTAEEVAALIRSLPIEEQPKQIIVTRKGMLDPLETHMLDYPNIVIKGSELQLPF
FT                   QACMKIEKFGDLILKATEPQMVLFNIYDDWLKTISSYTAFSRLILILRALHVNNEKAKM
FT                   MLRPDKSVVTLPHHVWPDLTDEQWIKVEIALKDLILADYSAKNNVNVSALTQSEVRDII
FT                   LGAEITPPSVQRQEIAEIEKRGQDANQQIAVTTKTTNVHGDELIVTTTSPYEQSTFGSK
FT                   TDWRIRAISATNLHLRVNHIYVNSDDLKETGYTYIMPKNVLKKFITIADLRTQIAGYMY
FT                   GVSPPDNPQVKEIRCVVMPPQWGNHSSVNLPSTLPEHDYLSDLEPLGWIHTQPNESSQL
FT                   QPQDCTQHAKILEQNSSWDGEKSIILTCSFTPGSCSLTAYKITPAGYEWGRANKDMTST
FT                   NPQGYGPGHFEKVQMLLSDRFLGYYMVPDGGSWNYSFQGVKHSAGMKYALKLGNPLEFY
FT                   HERHRPTHFLEFAALEAEKPEETAPMDREDVFS"
FT   gene            complement(60659..>63236)
FT                   /locus_tag="OSTLU_25192"
FT   mRNA            complement(join(60659..62075,62172..>63236))
FT                   /locus_tag="OSTLU_25192"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(60771..62075,62172..63236))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25192"
FT                   /product="predicted protein"
FT                   /note="GO_function: - phosphorylase activity; GO_process: -
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25192"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98695"
FT                   /db_xref="GOA:A4S4B4"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4B4"
FT                   /protein_id="ABO98695.1"
FT                   /translation="MYQATAQSVREGLVERWNDTYAHFHKENPKQAYYLSMEYLQGRAL
FT                   TNAIGNMGLTGEYSEALRSLGYTLEDVMSVERNAGLGNGGLGRLASCFLDSIATLDLPA
FT                   WGYGLRYKYGLFKQGVDKATGEQLEYADDWLEVGNPWEVARPQVSYPISFYGKVVNGKW
FT                   APGKQVRAVAYDSPIPGYKTRNCISLRMWDAQPSAVEFDLAAFNASDYETSMGPTNLAS
FT                   MLCAVLYPGDGTREGKALRLSQQYMLCSASVQDILARWKERGNSDWSKLHEKVAIQMND
FT                   THPTLAAPELMRILMDDEGLSWDDAWAVTKKTVAYTNHTVMPEALEKWPLDLVEELLPR
FT                   HMEIIKRIDEEFIASAAKAKAAKAAKKDDKKKDDKKKKESEEEKPAMVRMANLCCISGM
FT                   AINGVAAIHSEIVKDFTFNDFYKLFPEKFQNKTNGVTPRRWLAFCNPQLSAVITKWVGN
FT                   DKWVTDTDELRKLAEHATNPELQAEWKAAKLARKKICKDYIKKVTDIDVPIDSMFDIQV
FT                   KRIHEYKRQFLNILGIIYRYKQMKAMTPEERAKCVPRVCIFGGKAYATYTQAKRIVRLI
FT                   NNVGSVVNNDPEIGDLLKVVFVPDYNVSLAETLIPASELSQHISTAGTEASGTSNMKFQ
FT                   MNGCLIIGTLDGANVEIRECVGDDNFFLFGITDPEVEPARAERAAGKFVPDARFTETLE
FT                   YVRSGVFGDKFEELLGSLEGNEGFGRGDYFLVGKDFASYLEAQERVDVAYADSMGWTES
FT                   SIISTAFSGKFNSDRTIDQYAKEIWGIKPCTVPERK"
FT   gene            complement(<63974..>65179)
FT                   /locus_tag="OSTLU_26351"
FT   mRNA            complement(<63974..>65179)
FT                   /locus_tag="OSTLU_26351"
FT                   /product="predicted protein"
FT   CDS_pept        complement(63974..65179)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26351"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26351"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98696"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4B5"
FT                   /protein_id="ABO98696.1"
FT                   /translation="MHSLKKRRAALEGDDLTEAARDAAKRDALRALRLKTVIRENHGAA
FT                   RTTRVEFARGSARTSNLYATCGGSAVTVYDDAHFGDHTAIVAQYAHETTAHQTGGEITC
FT                   VCFARGEDDEKENETATTRGGGHEFGDAIVTAGDEHGWISVISVAENRVVGRLNAHPGS
FT                   RVVDADGACARDGFVVSVGEDGFLKAWDVFGGPDGEGECVGTFDVGTNARSVACDANGA
FT                   FAVTGHADGVARRWNLSGAVSQKSKALPLATFKPRFAVECVRIVDDVLFAKTRDGRIET
FT                   CDLKRNESIASWTLPNEKYRDHKYTGPACRFGVSSDGKFLACGDGTDSGVVYVYDARTG
FT                   ENIVELQPLRVVGVVHAAAVVDHCRHVFAAYGPAVVWRYEVINVSSDDDAIAGDAFEAV
FT                   VK"
FT   gene            <66002..>66340
FT                   /locus_tag="OSTLU_9177"
FT   mRNA            <66002..>66340
FT                   /locus_tag="OSTLU_9177"
FT                   /product="predicted protein"
FT   CDS_pept        <66002..>66340
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_9177"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nucleic acid binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_9177"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98535"
FT                   /db_xref="GOA:A4S4B6"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR031150"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4B6"
FT                   /protein_id="ABO98535.1"
FT                   /translation="KLYVPEDEYPGYNFIGLILGPRGNTQKRMERETNTRIMLRGKGSV
FT                   KPGAHRDHKTDYKEDEPLHVVILGETWEGVDAAAEMVGHILRPIDEEANVHKRMQLREL
FT                   ASINGTFVE"
FT   gene            complement(<67353..>68390)
FT                   /locus_tag="OSTLU_3060"
FT   mRNA            complement(<67353..>68390)
FT                   /locus_tag="OSTLU_3060"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<67353..>68390)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_3060"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_3060"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98697"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011084"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4B7"
FT                   /protein_id="ABO98697.1"
FT                   /translation="PAWIRPPGTMFIVDGFEYAASSEARCEHWFLTHFHADHHRGLTRT
FT                   FDRGVVYGTRTTTELVRTKIGVPRERLRVVEFGVVVRVDGVDVTFLRANHCPGAAMICF
FT                   EFPHRRDASPVLHTGDFRFHDGMRNDPTLLRITSDPSAPRPILILDTTYCSLEHDDFPT
FT                   QERVLKAVRDAVVHEDLLSTRKLFLFGTYTIGKEKVFLEAAKVLNRKVYIGKAKRSVMD
FT                   AIALDPEERSAMTHDDSKTNLHVVPMGSTSFMKMASILKYYKSRFDTVIAFRPTGWTFS
FT                   AQKKTARATSRRQRGRLIQYGLPYSEHSSLNELREFVRFMNPKFIFPHVNNDGGENAKR
FT                   MLTLLR"
FT   gene            <68905..>69399
FT                   /locus_tag="OSTLU_26354"
FT   mRNA            <68905..>69399
FT                   /locus_tag="OSTLU_26354"
FT                   /product="predicted protein"
FT   CDS_pept        68905..69399
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26354"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26354"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98536"
FT                   /db_xref="GOA:A4S4B8"
FT                   /db_xref="InterPro:IPR007062"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4B8"
FT                   /protein_id="ABO98536.1"
FT                   /translation="MTPRRDDAASPKRAKRAVEWDEANLAKNFAERSATMKIEEIETPW
FT                   HSPPRELFHDLRAEDEGEVARRERAHEEVMRRLEALIRADARGETSTPPTTKDADATMG
FT                   DEGSEDGTSRVAFHDPDARDEDFEDDAEEVVKKRLFDAKRKAFQCKGRATARFLADEAG
FT                   D"
FT   gene            complement(69442..>73251)
FT                   /locus_tag="OSTLU_25194"
FT   mRNA            complement(69442..>73251)
FT                   /locus_tag="OSTLU_25194"
FT                   /product="predicted protein"
FT   CDS_pept        complement(69451..73251)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25194"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25194"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98698"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4B9"
FT                   /protein_id="ABO98698.1"
FT                   /translation="MTTTQGARKLSSSIANNHSGGKTAIARAARARALTTPARGGRGRV
FT                   IDPRVVRAAPARAVADVGGEGGGATIRASELSPAHSSVERWIVFSDLHVSKRTMETCRR
FT                   VLERVHAEALKREAGVVFLGDFWHARGAIPVEPLNEALALMSSAKWTAPTIMIPGNHDQ
FT                   VTAGGLSHALTPLAKANPNIVVFDGPTLYGGALWLPYRRNSDELKRAIEDTRGEFNAIF
FT                   CHADVVGASMNETFQARDGLDPALFGGANTYTGHYHKPHVVPNTNITYVGSPYEVSRSE
FT                   AGQKKEFIVLDSQTWVEGANARVSLDIGPKHFAVEGVDASAPPTARPGDIIRWTLPIEA
FT                   MDAVSDAVPSVVQKARDQGFIVEVCYVTKDLTARIPKAEELGPAGLFDAYAVASEMAPS
FT                   VSAFGRKVLQEVAASDDAPETRRQSKGVSVSFETVEVEGFGTFQSATRYPLGARGVCVV
FT                   VGENKSDTCSDSNGAGKTTLVMSPMWALTGQSDLRIDGAGSGKSLTKSDVVNDSSKFGR
FT                   VRLEGFLNGGTPFWVERKVNRTKLVSLKYAIDGEEKTMAESKLTQQGLNDDLGADVIAN
FT                   TTFHGQHTVGALLDANDASLKAALGKLVEADTWTKAKDISRKRVTEARGNVNAIAAEVK
FT                   AREEYIARTRLRRDQAHVESEKWEFEYRRRVSELETSSSAVSTTFTKYLARTNHFLQRL
FT                   SRASEALEVTSSHAERVLDSSRNDSDDAARRFEVKESEFEHKTSVIEGEIERLNGVVRE
FT                   WQSKEASAGAIGRQSHAAVGMFAGAGGTHSHPDGVGTCDRCLQAIDPTHHKETLIKLKD
FT                   EARKTAIEHGNAIEQLKRATAALNKAMDDRRNLTEAAALARKAERMRAETTATASANAT
FT                   DQLRHSQRSLSLIGNAVARAEMLLNSAPEDVVHEALTMSIDDAFAMSESTISISGASSN
FT                   VLAGLDPDLTRGSMSSASLSNASPQIQLLRDEQMNVADADFVRQLVKGAEDAIMDGERA
FT                   GRDAARRLQELNEFSRSARSNPHTSALEELDAQLAGESESLGARIESLNGAKELLGVAQ
FT                   AADTAFSTKGIQSYLFEGALGDLSARVGQYMDALTGGALTLELRPAGAAFTGDDNDVVQ
FT                   SDVDADETATRKTKSKSAKAPASASAAERIERVIHARRPDGSLIARSLRQLSGGERRRA
FT                   ALALALAYADLASERCGVACDALVLDEVLQHLDAEGIARVTSLLRALPKRTVLLTSQAD
FT                   SATAHLFDVVDKVVKSDFGSGVVVSAGDDADLVDLAARASA"
FT   gene            complement(74488..75663)
FT                   /locus_tag="OSTLU_26356"
FT   mRNA            complement(74488..75663)
FT                   /locus_tag="OSTLU_26356"
FT                   /product="predicted protein"
FT   CDS_pept        complement(74523..75368)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26356"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26356"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98699"
FT                   /db_xref="GOA:A4S4C0"
FT                   /db_xref="InterPro:IPR039987"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4C0"
FT                   /protein_id="ABO98699.1"
FT                   /translation="MKSEGSNVNPDIGVSCSIDDPSSCSLADLELMYVDALWNYYNGGK
FT                   FTLSDEDYDRLREELNWQGSGFPTLRRYEIEFVQAAISYSRGESVVDDDKYEELKRRVK
FT                   AEGKRTDVTALLLYTKGKELLDEAEFELLGAEMKKLGIEVGMKGATCTLSQTSTELISD
FT                   TSGVFTMYAALATVPLLLGLSPSILLGFFGVHVPSGLSLGFAATLCAGLTYKLVNYTNL
FT                   QNAEILIGACPCCEMPIKQFFGGESPAETFEHKCSACGTKCTLNRPKRLIETAGGFSRA
FT                   "
FT   gene            complement(<76060..>76374)
FT                   /locus_tag="OSTLU_7962"
FT   mRNA            complement(<76060..>76374)
FT                   /locus_tag="OSTLU_7962"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<76060..>76374)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_7962"
FT                   /product="predicted protein"
FT                   /note="GO_function: - DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_7962"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98700"
FT                   /db_xref="GOA:A4S4C1"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4C1"
FT                   /protein_id="ABO98700.1"
FT                   /translation="QQVALRQFWREMMIEIQQTNDFKNHLLPLARIKKIMKSDEDVRMI
FT                   SSEAPVLFAKACEMFVLELTTRAWAHAQENKRRTLQRSDVAAAITKTDIFDFLVDIVPR
FT                   E"
FT   gene            complement(76912..>78491)
FT                   /locus_tag="OSTLU_26359"
FT   mRNA            complement(76912..>78491)
FT                   /locus_tag="OSTLU_26359"
FT                   /product="predicted protein"
FT   CDS_pept        complement(77499..78491)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26359"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26359"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98701"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4C2"
FT                   /protein_id="ABO98701.1"
FT                   /translation="MAERARSRGETVRETRGGAKAAPPTASARREKFDPRAPPKILPSS
FT                   ALLAARNAPDESVSEKDARVVDTPGSDWLQSRGATAPMVLRRKPPPPVEDAESDERMDE
FT                   TESEDKARKKRGGRRVREREERRVLRSSKNDSDKTAASRMKNAPPPAANYNDWVGSQYG
FT                   GGYGASVEGAVPAYGMAFADGSGLFPTFAAGYPAGYSGYYGYASAPPSATWTQEAASAA
FT                   SDASASAAASYPYQAPVTVPANAPFDINATGTYGAAADVSHLAERLGDLPSSLGAEFGS
FT                   TEDLSSVANAPVAGGGHPRVQRHASRASGSGGRKNRSRRAPKDARNGEI"
FT   gene            <79500..>80138
FT                   /locus_tag="OSTLU_26360"
FT   mRNA            <79500..>80138
FT                   /locus_tag="OSTLU_26360"
FT                   /product="predicted protein"
FT   CDS_pept        79500..80138
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26360"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26360"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98537"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4C3"
FT                   /protein_id="ABO98537.1"
FT                   /translation="MDDDALARPAVFVEAERRASAEAERRAREARARREEAEAEEEAEA
FT                   EDDDEIDSDATDDEEAFDWRAVRANGDGNDGTTAREVEADAEASARRSATLPTRNLAKT
FT                   QPWRARLPNFTPVRELPPQSFHDGELVFVDYEAQFGGPRSAASKAFARREARAFGGVGA
FT                   RDRAAASTAPTAAVPRWFTDERGRKTFVDARGKSLVGKAAYAASQRLRA"
FT   gene            complement(<80367..>80582)
FT                   /locus_tag="OSTLU_88539"
FT   mRNA            complement(<80367..>80582)
FT                   /locus_tag="OSTLU_88539"
FT                   /product="predicted protein"
FT   CDS_pept        complement(80367..80582)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88539"
FT                   /product="predicted protein"
FT                   /note="GO_function: - DNA-directed RNA polymerase activity;
FT                   GO_process: - transcription"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88539"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98702"
FT                   /db_xref="GOA:A4S4C4"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4C4"
FT                   /protein_id="ABO98702.1"
FT                   /translation="MIIPVRCFTCGKVIGNKWDTYLDLLQADYSERDALDALGLNRYCC
FT                   RRMVMCHVDLIEKLLRYNTLERVDDA"
FT   gene            <80945..>84215
FT                   /locus_tag="OSTLU_17228"
FT   mRNA            join(<80945..82075,82362..>84215)
FT                   /locus_tag="OSTLU_17228"
FT                   /product="predicted protein"
FT   CDS_pept        join(80945..82075,82362..84215)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17228"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17228"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98538"
FT                   /db_xref="GOA:A4S4C5"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4C5"
FT                   /protein_id="ABO98538.1"
FT                   /translation="MEADDAAAARRRGDDDEAARLYAARLGDARASSTTHVRYALAAKA
FT                   CGRAASDAAAFEATLRQGLERAMREAAEDGVEDVGRDARARAIGGQLALSLCQRGANED
FT                   ASDLLEFLGYSRRLSEEVLRYAEEGARERAPEDVARVYDDALDARALRFLGDAFARRGA
FT                   STFWIEHDYYAPETGFFSYVHDVPSRRENKMDAVVDMVKDVASRAFPGVKRARYAEWWA
FT                   HSRPHTDGHQLHFDSHDEGLGEVRHPICSAVVFVDGCCGGPTLVTNQKDTSAELASRAW
FT                   LVYPKTGRVAVFNGDYLHGVVPGRVADDGFDPEFASRRRITLMISFWEDTDVHHSWTPA
FT                   GSARPFPPRDAPGVSWRSRFDFAADDDFAAEAAVGVERTDAKTVAITGTDDDYKLSTRH
FT                   ATLLDAVDAASVALESFFATAKVKNAHEAHERAAHEVLRHFRGTLGTLGTPREETTDAF
FT                   DDPPEKRTKTEDGEAGKKKKDEEMDAEAREDAIGRAGDVLQNMLRETHRLHVNASCRVN
FT                   TRAPEVKRARDNLTRIRREARELYKKIDPRGYERDRERVRMMAEETQAALDFKITRFET
FT                   PPKDLAELRAKCPVMSSTGSPHHLCAHLCYYREYEPARQMYVLRCRAAEANGNAAALDG
FT                   WRAELAVRPAEDIPAFNRSRADTRGTASGACSLKHLPWMVEFIGPGGERFKDGMDVLNF
FT                   VAVECDKLSWPRASHGGNGVREARVSEDGLNDQTELLRAALWDEDTDGTAGTTPVRRSF
FT                   TRIARCVDETRTPLRLAPDPLANENDENDDGEKINESVVLAAANAFDDETPGQTPTKTP
FT                   LKDQQGGDAAASPPGSGPEPVRHWWAPPLSPFGLLEEILWQDEWKLLVSCMMLNCTTRL
FT                   QVDRVLWRLFLLAPTAAAAVELGDTHEGLEALERIIAPLGLHRKRTNAFVKLSRDVEAQ
FT                   RAKYGGRIKNVSACHGVGVYAADAHALFVDGVLAGPPRDHALRWYHAWAHERRENAAKS
FT                   APKRT"
FT   gene            <84761..88242
FT                   /locus_tag="OSTLU_25198"
FT   mRNA            join(<84761..86263,86324..86635,86690..88242)
FT                   /locus_tag="OSTLU_25198"
FT                   /product="predicted protein"
FT   CDS_pept        join(84761..86263,86324..86635,86690..88204)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25198"
FT                   /product="predicted protein"
FT                   /note="GO_component: - microtubule associated complex;
FT                   cytoskeleton; GO_function: - motor activity; ATP binding;
FT                   actin binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25198"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98539"
FT                   /db_xref="GOA:A4S4C6"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000857"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="InterPro:IPR038185"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4C6"
FT                   /protein_id="ABO98539.1"
FT                   /translation="MADALSVDGALTTSLLRLTSDQTNKSVKLHALLVVLVSDTDDVTG
FT                   ETFAAGVQKIAKEVIKREELADEMYLQIIRATRSAASDRGRRKAWELVRVIAALFAPSR
FT                   DFIGFVSEYINEVAARGSSDIQPLARSALQTMKRTSKSAMRRHEPTAEEIIAFARGEKL
FT                   RVVITFLDGTFEDLPYDMSTTAKEAVVALATSINLQNYSTFSLFTVRKFFGKVAPLIKE
FT                   GLLSEEHHELGDVSFLSDALGDIRAMKTESTPSKATSMQTGLLFKKRMFRDADETIDET
FT                   TFVLLSYVQAKHDFMMGNYPISRDDAALLAALQVQAEEGPRLGEDQAALGLVLAKYLPR
FT                   TMCNTRPTKEWTEHIAGQHASIRGLSGDEARQALLRMIRSLPYGNSAFFRAKRVDDPIG
FT                   LLPGKLMIGVNKRGVHFFRETPMEYLYTADLRDIMQFGSAPHAIFFKMRVSGALHVFQF
FT                   ETSDGENICMALQTHINDVMMKKMADKKAAMMAVEAVTPSKKPTKRGDIDASDAQKEIK
FT                   TLNEKLANMRNERAELRAQLDQANEAFHEANDRLESERASKADIVDTIQMLERQLKESK
FT                   EAAIASDNATTDKLDDLTAIQLQELRDELQQVVVLEQKLKRAEAAHAEELKETAEQNGA
FT                   DISEWQNKLHEADSRAGELEAEIRALRLEYEEQKAMVTKEMLDELEQLREMKNTFEGQQ
FT                   ATARELMAGQTQKIKELEEKYTSEVTLRRRYFNMLEDLKGKIRVYARTRPLTEIETSQN
FT                   QQAILATPDEFTCSHPWRGEKKDRSYEFDEVFPANSTQEQVFEDTKYLVQSAMDGYNVC
FT                   IFAYGQTGSGKTFTIYGDDANPGLTPRAIAEVMRCVHRDSNKSSVKMECYMLELYRDDL
FT                   IDLLLPVGTSDAPRLDIKKDKKGWVTVPNATIVPVTSEDEIIEVIHTGLKVRKTAGTKM
FT                   NVESSRSHLIFSLVMETTDLQTGALTKGKLSFVDLAGSERVKKSGAEGDTLKEAQAINK
FT                   SLSALGDVISALASEQQHIPYRNHKLTMLMSDSLGGNAKTLMFVNVSPTDGNVEETQNS
FT                   LTYATRVRTIKNDNGKSVESKEVQHLKQQVAHWRQKAGEVEESHVDIEDERVGLDQLSL
FT                   NQ"
FT   gene            complement(<88249..>89550)
FT                   /locus_tag="OSTLU_44133"
FT   mRNA            complement(join(<88249..89343,89428..>89550))
FT                   /locus_tag="OSTLU_44133"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(88249..89343,89428..89550))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44133"
FT                   /product="predicted protein"
FT                   /note="GO_function: - zinc ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44133"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98703"
FT                   /db_xref="GOA:A4S4C7"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="InterPro:IPR037275"
FT                   /db_xref="InterPro:IPR039512"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4C7"
FT                   /protein_id="ABO98703.1"
FT                   /translation="MLIWVRNALNEDEREGMISSMRHATQNTRFAQWMNTWYSGKTNAA
FT                   DTAAVSSQDGMRQVHAYLSRRSGDVDKETFKPGWEDIFRMNQIQLEDAVRTVNRDDTLA
FT                   PTKKAYLIQNLLASRWIVGNQLQAQKDKTTELSSVGSAQKSGAPAILCQPVDEDEENGK
FT                   DGCKHYKRRCKIVAPCCDQAFTCRFCHDDASDHTVNRYAVKEMVCNECKKRQPVNEVCV
FT                   GCSTSMAKYHCNVCNLFDDSSEAIYHCPFCNVCRRGKGLGVDFFHCMKCNACVSLQHGK
FT                   HECSERGMDSECPVCKEFLAESETPVKELPCGHIMHATCFTTYTRHYYTCPLCRKSLGD
FT                   FSMYFRMLDAILADESDDSVPEALRGKTQKVSCNDCAKDSDAKFHFVYHACAHCRSYNT
FT                   RVLTFD"
FT   gene            <92847..>94238
FT                   /locus_tag="OSTLU_2292"
FT   mRNA            <92847..>94238
FT                   /locus_tag="OSTLU_2292"
FT                   /product="predicted protein"
FT   CDS_pept        <92847..>94238
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_2292"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_2292"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98540"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4C8"
FT                   /protein_id="ABO98540.1"
FT                   /translation="VVCIQGPPGTGKTSVVVEIIAQAAARGERVLACAPSNLAVDNLVE
FT                   RLDGVTDVRAVRFGAPERISAAALSCSLDAKVSEATELFFQTQRVESSETSTKLRALMD
FT                   RYQKATNVPKKQREKLQSEIEALKKKLKTTVSAGTKHRKASQAKILREANVVLATNAGA
FT                   GMDTVQQLPPFDLVVVDEAAQASEPLSWIPLVRGRRAVLIGDPCQLAPVVRSLEAVEAG
FT                   LARSLMSRLMPAPENLDDEDDGWNARAYASSGVLTLTLSTQYRSHETISSWSSREAYGG
FT                   RLRAAESVRGALLRDLPGVQDTQITRIPMLMITARSPYGRIPAECNERRVGGSYINEGE
FT                   ATTAAAHVLMMLKAGVRASDIAVISPYAAQVRLLRSVLAVALEDVEGADAVEISSIDSF
FT                   QGREAECVIISTVRSNARRGVGFLSDNRRMNVAVTRGKRHVTIIGDDKTIMGDAFLRRL
FT                   VEHIEA"
FT   gene            complement(<94399..>95805)
FT                   /locus_tag="OSTLU_93408"
FT   mRNA            complement(<94399..>95805)
FT                   /locus_tag="OSTLU_93408"
FT                   /product="predicted protein"
FT   CDS_pept        complement(94399..>95805)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93408"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93408"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98704"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4C9"
FT                   /protein_id="ABO98704.1"
FT                   /translation="VTQKGDDAPRRRSSGRASGDAADLSFSSIPDVSKNASFSGASNSP
FT                   PGLEPTPASMVGRKLSAGSSSSGRTPPGNRADASFNDSTSSHMTNSSEEGVDGGNNNKR
FT                   RSSRRTHKGVTRFGEFQSWESVAADEVPPSPAFVGNPRQRQAYLEAYAKARYEEELAER
FT                   KANGHAVEDTVSDVHSRVAELMKAADEMLPDYAPSPAKSLHAKSLREQLQESWQGKGYY
FT                   ARLMAQMASPSPARPNQRPPHMQRLHQGANDAAAAANKAKLDEAAKQQASLATMSGAAL
FT                   NGFGGGGGGYLFANLPGMAAAAPAPAPPAVVAAKSKAKRKSGDVMPPPGTKRAPEKSPE
FT                   PTKSEDTAESVTNSILKVQQAIRRLSMSPAPSKMANLAAIDSNSPRMGGTQLKFDSPLS
FT                   ASSVDVDAAIHGSDMEAMRKALRELRRENEDLREKLVTTQREARVAISRVTGDVIARAK
FT                   IAEQEFSRKF"
FT   gene            complement(<96304..>97185)
FT                   /locus_tag="OSTLU_26368"
FT   mRNA            complement(<96304..>97185)
FT                   /locus_tag="OSTLU_26368"
FT                   /product="predicted protein"
FT   CDS_pept        complement(96304..97185)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26368"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26368"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98705"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4D0"
FT                   /protein_id="ABO98705.1"
FT                   /translation="MPRVIAAGVRARVRTPAPASIHSARRARASSGALLNAQPRHSARS
FT                   VRRPSACRASARRRDEAKAQNALDAAVDVDNLGYTEPWAVELVTFWREYAGARDRVVRA
FT                   LVDVGETHREMRDPAQIAIAGDRLRRLLPDIDVCAVFERDPGVLKIEFVAASKRVLELQ
FT                   DVLCSSDMCRDVTGLIERHPQLLLVDDIHAHIERAVAKLASLEPNCDARAVVDEFPELI
FT                   YRIHSYDYVESLPISIQNMLLDSASEDDTRLEDYERMWDEREAADRERDDFFADDASEW
FT                   MVDGFWEGPTAD"
FT   gene            complement(<97367..>102983)
FT                   /gene="CHR3510"
FT                   /locus_tag="OSTLU_17234"
FT   mRNA            complement(join(<97367..100243,100551..>102983))
FT                   /gene="CHR3510"
FT                   /locus_tag="OSTLU_17234"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(97367..100243,100551..102983))
FT                   /codon_start=1
FT                   /gene="CHR3510"
FT                   /locus_tag="OSTLU_17234"
FT                   /product="predicted protein"
FT                   /note="GO_function: - DNA binding; ATP binding; nucleic
FT                   acid binding; helicase activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17234"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98706"
FT                   /db_xref="GOA:A4S4D1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022707"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4D1"
FT                   /protein_id="ABO98706.1"
FT                   /translation="MAESGGSRLDRLIKLLDTGSTAAARREAARQIGELAASHSTQLPN
FT                   LLRRVRAHLRSKKWETRVAASATMSEIASRLRHPSVDALIAMESDGAERDAGRDASEAK
FT                   TGRDANAGSDALDLTFAKFDVERVLEKAGILLSSSGIGWRLENGPGTKAERLAQAKASL
FT                   KRRLGMELGPEAGAMMDENMKMSDLVKDEDLLDDGKVTVQEKVAVGDSAAEAVDGLTGD
FT                   VDYSHLSARELNKLKRKAKRMLREGANPLDAKRSKQDEEAARLEQEKAEAEEDDEEQAE
FT                   VAAGGWPLARTCETLAYMMFSEGWEERHGAAAALREVLRHQAASAAIWAPPPGVKPEPG
FT                   TVEIARESNAAWLEDMCVRLLCILALDRFGDFAGDGAVAPVRETSAQALGAALLPLSPQ
FT                   AVDAVVSCTLTLLSRPEWEVRHSALLGLKYILAAKSELAVELLPAALPAATKALVDADD
FT                   DVRGAAAESLLPAVEHLPSHPQFNELLSSLWGLLNELDDLSPSAVPVMKLIAELYALES
FT                   TRAKSTAALAEVVPRLWPFAAHPIPAVRLAVWQTLARLLAVEPNASTQLWVQEACAPAM
FT                   RHAFQGALLDVDAASADAASEAWVALLRTVPIAIIEATFTVHGAKWCELATTVANARGE
FT                   GKLIFVSTPPSVKGEIRAVAKDWPATTAGRMRGLECLARLAAAFGAHERSSSVARMEQH
FT                   IVGMLTGELATARLAGAHLLTSWLRVVPPGPQRPTLQAPGAQLGAILANTNPAYPSAPS
FT                   PTPYGEVAQMVKYVKSESMAFLRVAATNGVVVTGEVPSPEADGFGADSAATLSAAVPQS
FT                   EIAAVETARGSLHASAQRLRDTEAKLHGAVLAAAAGAAVGFGALPPKLNPFIQPLMSSV
FT                   RRERDADLQAHAAASVAAMMKLCTSRSPSPNDKLLKNITSMICGDEAETPKAGLTEEVE
FT                   EEEDDGKKKKSVAGIVDEEVISDATIARRGGEAVIRSAASLFGADVFNQLGALDALMMK
FT                   PITQAPPENAPTATLQSLVDALQLFKILGPVVHEALEEKVIETTKTAFAAALYTDVAVR
FT                   KTAAKTIASIASKHPERIISSLLDFIVPKLEEGEAASQTAKRAGAVGLASELVDTLGAV
FT                   LAPYCVLLLVPLMGRMSDPDLKIRGNATRAFAKLVPLLPLAVGKEPPNDLTTKQKERSK
FT                   KDGEFLEALLDNSKIEDFKLPFKCARTLRPYQQDGVNWLAFLRRFKLHGALADDMGLGK
FT                   TLQSTCILAATTVERKEAGLKTLPHLVICPSTLVSHWAYEIGLYVEPDVLRPLEYHGSP
FT                   PDRRALQKDFGKYDVVIMSYESVRADFDSLDKFDWCYCVLDEGHAIRNPKSRVTQAVKS
FT                   VRAEHRLLLSGTPIQNDVVELWSLFDFLMPGFLGTEREFKKTYGIAAARSAAAKKGGGL
FT                   SEQGALATGALHKQVMPFVMRRTKDEVLKDLPPKIIQDVYVELTDAQRKMYDAFESSEA
FT                   KDQAVSAIEGGGGAEGAAQHVFTTLQYLRKLCSHPKLVVSDGASKKFNPEMRSPKFDAL
FT                   KQILIDCGIGVDLEEEKSNGDEGKPNPASGAGHRVLVFSQLKSLLDLVENELFTTQMRD
FT                   VSWLRLDGSIPPSQRFDVVRKFNADPSIDVLLLTTHVGGLGLNLTSADTVVFLEHDWNP
FT                   QKDLQAMDRAHRLGQRKTVNVYRILTRGTLEEKIMSLQRFKLDVANAVVNADNASMSAM
FT                   DTGQMLELFTAEKGVKLGKDGAPVAKGAAAAAAGAASGGLSNIVNGLEEMWDEAQYAEE
FT                   FSVDDFVSKLKHK"
FT   gene            complement(<103122..104238)
FT                   /locus_tag="OSTLU_19724"
FT   mRNA            complement(<103122..104238)
FT                   /locus_tag="OSTLU_19724"
FT                   /product="predicted protein"
FT   CDS_pept        complement(103122..104237)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_19724"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_19724"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98707"
FT                   /db_xref="GOA:A4S4D2"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR034649"
FT                   /db_xref="InterPro:IPR041243"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4D2"
FT                   /protein_id="ABO98707.1"
FT                   /translation="MTRERAPTTATLEALRHLVRAAKEDSAILDAPALEFFRRWLEEDL
FT                   GATIPAPRTTTTTGTGTDAIEIEDDEAMAAESDDLSAIAMGAETAPETLGEAEEAKASE
FT                   AKRLASEAFAREAWEEAIERYTEALMIAPSALTYAKRAECFIKLRKPLSAIRDGTAALK
FT                   LNPDSAKALKVRGAAHRYLGHWNEANADLSAGLSQDFDETYGEMHKKVLSVVHELHVRE
FT                   GKARAAKEAKEREELEKRRAAAEAARKEAAAKDAGGPGFGQPGAGFPGGAGDLPPGVSP
FT                   EMAQKLMSDPDLIAAMQNPKVMQALQTMMKNPMAAMQYMSDPEVGPVLQKLMASMGGAM
FT                   PGGAPGGFPGGFPGGFPGAGAAPGGAANDVD"
FT   gene            <104616..>105890
FT                   /locus_tag="OSTLU_17236"
FT   mRNA            <104616..>105890
FT                   /locus_tag="OSTLU_17236"
FT                   /product="predicted protein"
FT   CDS_pept        104616..105890
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17236"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17236"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98541"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4D3"
FT                   /protein_id="ABO98541.1"
FT                   /translation="METALEDAKSMIEYARARWRVGARGDARGVLEHASVALRRRGEEP
FT                   ATSSAIARARTAWAHLARERGERGTARDAARDARDAARESGAPEDGASADAMWTLLEAR
FT                   EEAKEATWADVVEGARRGAGGGAGGRCAAAGAETLAALTRRRARDALEAAETCEIALRG
FT                   MSSEELREAKDAPHGWAIASAMKALGHVERLTPSGSSERALELYERAAEYAKDVALSEH
FT                   PGAMASRMIAEDLQADCALARAQAYAALGDVENAETFAARAVSAAEALGDEKHPRVGAA
FT                   IAVSGDVYVAKALRSMSNDEKTSLGDGAGVMFAEGLYKSAIKLMHYPHVVEDGKIVLDY
FT                   EARHLCALLHARYSSILRASGGQREREANAWLESAKILWPDERGDDEGVDGVDIVTKAA
FT                   TKLGVKHGPSVLIDLQQMAPLTMGA"
FT   gene            complement(105875..107107)
FT                   /locus_tag="OSTLU_26372"
FT   mRNA            complement(105875..107107)
FT                   /locus_tag="OSTLU_26372"
FT                   /product="predicted protein"
FT   CDS_pept        complement(105983..107092)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26372"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26372"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98708"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4D4"
FT                   /protein_id="ABO98708.1"
FT                   /translation="MARERTTDASTPARAADASRLLALFDLSNVSPICVSRASWLRAAS
FT                   SATGKVVPPVEDETFPFDASPTAAVFAPTRGRRAKDDDARVARAPVKAAAVVKSQDAGR
FT                   ARTTVPTVTATRANDDDDDDGGAIDGVIYEEDRNALFEAQLRRAMAAEAAGVDVGRMLA
FT                   AKGGLANSPPKASGGDDDAEANSEGDGEAKVEDDLSARDDVAMDVDAPVEFVNSPVNSP
FT                   AVEASPPASAAEDDAFERMLSAALKETRGASTPIEKQPLDRAVPKREFKPKLEVKSPEK
FT                   YEPAAKPTPSTSALDFEAKLEAAMRAAEAGGDLTAILSGPSSKTANSPVGTTSAEARVN
FT                   YRELGFTKAERRHHSLHVETEEAASERKT"
FT   gene            complement(<107273..>107599)
FT                   /locus_tag="OSTLU_9345"
FT   mRNA            complement(<107273..>107599)
FT                   /locus_tag="OSTLU_9345"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<107273..>107599)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_9345"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_9345"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98709"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4D5"
FT                   /protein_id="ABO98709.1"
FT                   /translation="ERDANDDVKSQGARESSPKLVPYNVRVATPPPVDLGLHKLPKNIA
FT                   CGETIEVPTNADGDESANGWFIVNRVTTMYNLVRGRYRKDGSRLDVQKAERYFINASLE
FT                   RLYSK"
FT   gene            complement(107892..>109954)
FT                   /locus_tag="OSTLU_25201"
FT   mRNA            complement(107892..>109954)
FT                   /locus_tag="OSTLU_25201"
FT                   /product="predicted protein"
FT   CDS_pept        complement(107906..109954)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25201"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25201"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98710"
FT                   /db_xref="GOA:A4S4D6"
FT                   /db_xref="InterPro:IPR018731"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="InterPro:IPR040182"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4D6"
FT                   /protein_id="ABO98710.1"
FT                   /translation="MGDRTRQIAREWVMKCADVVLDARARAATPRDARDGGMKANRWFN
FT                   CACARRRETTRAMERDEAARDGGTRAVKELEGDSVDAFVEGAVTVDVYFERGGDASTSG
FT                   ERALVERWAFHAGADGERVGGNNHFNKDLDTAVVYKRAVIMVRTVVAMLRTLPAHGARL
FT                   RAMRRRGARDGGGGGGFSFEIKNVDRGGTIASAHPGKAEGYRTYAFTDVPTSIGKLSAC
FT                   VYFLDQVAMSALEDECVAVVETAPTPCERLDASVGPDVVALAGGEMSLSPSPTGKSDAP
FT                   ESLQRARREEDSSPMSRGILFDEASPSPSPNARPPIRGGMTASLSSGSLQQQAKPPVSP
FT                   SVVPLADYTSPNYQRFDNAPSSAPNNGPAPIYGFNAAPVGAKHALQSAIESPLVEPPRP
FT                   PPRRSTMASCLKIDVGTSIDKDDFVAKPPGANDIGAPSPSIAVAQPPPPPAPASPMTTI
FT                   GFSPTTAAPIACSPRVRAPKDGRSGPAPHGSPSPWGGFVCPESPIPSPGGAAFAHPRSV
FT                   PRSSWSPSSSLGTSIRDVIGVYPHSPGGVSNFARRMSGASDDAAPGSPLTPHAADESID
FT                   NQDEFPFAIDDADATATATYVEHTPADLLSLLENPCTLRRRSLDGPLPLDAALEDSTDS
FT                   IVNQSAELDKSVGGDDKSRAASNGMTLGSALRALAELDVAAKTQFTD"
FT   gene            <110690..>111544
FT                   /locus_tag="OSTLU_43950"
FT   mRNA            <110690..>111544
FT                   /locus_tag="OSTLU_43950"
FT                   /product="Tat family transporter: protein export TatC"
FT   CDS_pept        110690..111544
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_43950"
FT                   /product="Tat family transporter: protein export TatC"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_43950"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98542"
FT                   /db_xref="GOA:A4S4D7"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4D7"
FT                   /protein_id="ABO98542.1"
FT                   /translation="MVPLASAAVTTVKEKRTFVEAPPEDVQREQVRSFLYPGEDELPDD
FT                   VSMTIWEHLEELRERALISAAAVGALILVCFCFAKDLTIFLEEPVKSQGVRFLQLGPGE
FT                   YFFTTVKVAGYTGLLAGAPVVLYEAIAYVLPGLTLNERKTLGPIVIGSSVLFYGGIAFA
FT                   YYVLVPAALKFFVGYADGAVESLWSIDQYFEFVLVLLFSTGLSFQVPVIQLLLGQSGIV
FT                   SSKQMLSVWKYVVVGSVVAAAVLTPSTDPFTQMLLAVPLMSLYLGGAALVGVFEKDREG
FT                   ETA"
FT   gene            complement(111600..>112178)
FT                   /locus_tag="OSTLU_26376"
FT   mRNA            complement(111600..>112178)
FT                   /locus_tag="OSTLU_26376"
FT                   /product="predicted protein"
FT   CDS_pept        complement(111681..112178)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26376"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26376"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98711"
FT                   /db_xref="GOA:A4S4D8"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4D8"
FT                   /protein_id="ABO98711.1"
FT                   /translation="MLALGEDLEKFDVLALEPTSERAFASACANKHADVVSVGAGRRLR
FT                   YKFTASAVRAATGNRISFELCYGEALRDSNSRMWFFANASALARATRGGRELFILSSGA
FT                   ERAIELRSMYDVVNLATFFGMTEKAARAAMTTNVHAMLAMCKRRRDAAATDSVVERMDA
FT                   SA"
FT   gene            <112783..>114261
FT                   /locus_tag="OSTLU_44053"
FT   mRNA            join(<112783..113478,113506..113646,113707..>114261)
FT                   /locus_tag="OSTLU_44053"
FT                   /product="predicted protein"
FT   CDS_pept        join(112783..113478,113506..113646,113707..114261)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44053"
FT                   /product="predicted protein"
FT                   /note="GO_function: - amino acid binding; GO_process: -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44053"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98543"
FT                   /db_xref="GOA:A4S4D9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4D9"
FT                   /protein_id="ABO98543.1"
FT                   /translation="MTRSSATRGSGDDYDLDAGIAGATPGDGWTPTSYDGRGSTGDVYQ
FT                   GPARLAEGLRRHTVLVYVADETGMINRVAGVFARRGYNIESLAVGLNIDKAIFTISVIC
FT                   SDGDVGKLIKQVNKLAKVRKVENVTDKECVERGLMLLKVKCEPEQRSQVLEINRIFRAS
FT                   VVDVAERSLTMSVVGDPGKNRAFQSALMKFGVIQVARTGKLALKREPVYSEARSRRVKL
FT                   MEAMRKAKDASAKYESILASRIVRAVAGMEHDDDGDLHVGDVYTSLENDEIGVWDVPMD
FT                   ENAKYTPHTISILVDNRPGVLDSITGVFARRGYNIQSLGVGPERTFDISRISTVVPGST
FT                   EDIAMLLKQILKVPYVISAEDITMTPFTERELMLIKVVSSRAQRAEIIDLCGMFRAKVC
FT                   DISEDTVTIEVSGRQRKINAIQALLEPYGILEVARSGRVALPRDSGVDSKLMMAIESES
FT                   DLDKW"
FT   gene            complement(<114298..>115152)
FT                   /locus_tag="OSTLU_43937"
FT   mRNA            complement(<114298..>115152)
FT                   /locus_tag="OSTLU_43937"
FT                   /product="predicted protein"
FT   CDS_pept        complement(114298..115152)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_43937"
FT                   /product="predicted protein"
FT                   /note="GO_function: - aminocarboxymuconate-semialdehyde
FT                   decarboxylase activity; GO_process: - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_43937"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98712"
FT                   /db_xref="GOA:A4S4E0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4E0"
FT                   /protein_id="ABO98712.1"
FT                   /translation="MRASIIDAHVHVWPSAEDFAYEDGKAPPVPGAANELIAAMDANGV
FT                   RAAMIVQPINLGFDHTYVERALETHANRFVGMCLANPSAGDAGVEALEKLLAGRFRGVR
FT                   FNPGLWPNGKGMDGEIGRKMMRACAARTPPAVVGFMCFNGLDLHVDEIRALLKAEPTVP
FT                   VLIDHFGFTKGVDDPNFELLQALGRDFPQVSVKVSAHFRVRIETSDGGDSTATQLRELV
FT                   KVFGPHRLIWGSDYPFVTAEEGGYADAVRVLERQIGDDDPALLANIRGDNFLRLFPGAL
FT                   GEA"
FT   gene            complement(<115309..>116238)
FT                   /locus_tag="OSTLU_5336"
FT   mRNA            complement(<115309..>116238)
FT                   /locus_tag="OSTLU_5336"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<115309..>116238)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_5336"
FT                   /product="predicted protein"
FT                   /note="GO_function: - oxidoreductase activity; GO_process:
FT                   - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_5336"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98713"
FT                   /db_xref="GOA:A4S4E1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006181"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4E1"
FT                   /protein_id="ABO98713.1"
FT                   /translation="VVVGGGVIGLTVALTLAERGMDVRVVAASFERTTSSVAAAFWFPF
FT                   IVRTEPAALSDAWAIKSYEWYRELAREDGACGVEMRRCREFLKAPAPAAGWANAVEHYR
FT                   ALERGEHDEKYAGGYEFDVPVIAMPKFLPWLRTRCEALGVKFETRTLADVREARAFASN
FT                   SERAFVVNCTGLGARRLVNDDLVKPVRGQVVYLKQDCGYGLFDDDPNALAYLIPRADCT
FT                   VLGGTAQVDNDSLEPDDADERDIIAKCKRLWPELDETKVIGTNVGLRPSRTVVRCERDP
FT                   ADATLIHAYGHGGAGVTLCRGTALEVLAL"
FT   gene            <116921..>118330
FT                   /locus_tag="OSTLU_17244"
FT   mRNA            <116921..>118330
FT                   /locus_tag="OSTLU_17244"
FT                   /product="predicted protein"
FT   CDS_pept        116921..118330
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17244"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17244"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98544"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4E2"
FT                   /protein_id="ABO98544.1"
FT                   /translation="MCEPKRGRELTKLLQMLVEYLLHVQEALSEGKAKAERDAEGWKDR
FT                   ARTERDEARKSARELRLAMEAHEAELIAVAAEYAKKRNNPDNAELEDARRRGESMAAER
FT                   AAKDLEKRLREQRELFDSAVDRMRAAHAEAQAEAARELSARKAELASARAQYVASSTES
FT                   TKEANRMVADAQALIREAREKAELEKSNVARVRSELNAAVEATQRHKRSLVDVKSELTR
FT                   LKEDFKFEHESNAELRKALERRDEERKLMREQIERLHGKQKSSMTEEMAELTNMRELAK
FT                   NNYAEIERLKRENEVLREDKNAQSTWVAEEKKRWVSANEQILQAELTEKDNAIAQLREE
FT                   ISQLRNDIATERSRKMITIKPIIAEYEARAQAAPPVAPKPAVKAAKARKTLEPPPSDVQ
FT                   DMDGALHAAMLDLDVDLDAVAEAGLDDATFQEAMAKFEAVQMQDVPKELRAKYALSRAK
FT                   IQKELDGVAVR"
FT   gene            complement(118375..>120080)
FT                   /gene="SDG3510"
FT                   /locus_tag="OSTLU_25206"
FT   mRNA            complement(join(118375..118642,118678..>120080))
FT                   /gene="SDG3510"
FT                   /locus_tag="OSTLU_25206"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(118612..118642,118678..120080))
FT                   /codon_start=1
FT                   /gene="SDG3510"
FT                   /locus_tag="OSTLU_25206"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25206"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98714"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4E3"
FT                   /protein_id="ABO98714.1"
FT                   /translation="MPFGLGGMGAALPKSKKAQKVDEADAIRVEGNEKFAKGDYLGAIA
FT                   AYDAALKLNGSDASAYANKAECYLRARVFEKALECATKALECSKGDKAMELKAIYKKSM
FT                   ALNGMARYVDAAKTADEGSRLADAPEDAAVRATLEKVKLECDMLTAQAFTGAYDLGALY
FT                   LNRMGASFRRCADYIGVVRVSKLSDGRRGLVTTSAVAAGDLLMVQSPLSSASFGKTVEQ
FT                   NLVRGLYEAARAHPADWAILKALPASSEDEQKDAPEMSVFRKHISAANKENAPAPESPE
FT                   ELAFIPKVVANCAISGRRLCGVWPLPSFINHSCAPNCHRINVGQIMLVFASQNLPAGAE
FT                   ITMKYYDTLMPKKDRDAFASRRGYMCNCARCAFESTGDVSEEKKADEAEENDEGAGPIT
FT                   CAVNELKRKLKPVLKDFKEELAEMKKTKGKTVPNVNPLIELRGWYESRLAALNLSRAQL
FT                   AMARMSCYSMSGRDEARAR"
FT   gene            <120487..>121224
FT                   /locus_tag="OSTLU_93415"
FT   mRNA            <120487..>121224
FT                   /locus_tag="OSTLU_93415"
FT                   /product="predicted protein"
FT   CDS_pept        120487..121224
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93415"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93415"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98545"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4E4"
FT                   /protein_id="ABO98545.1"
FT                   /translation="MSAPVDVARAAAARVRADASSTSRAGSGVVVRHRGVACVLTAAHV
FT                   ASFAGAKNALRVELASGAARRGRVVGVHDALDLAVVYLDGDLDGAATMEPGEARVGDEA
FT                   RALGTAQRYAAATAACADAIRGRRETGRVLKIHRDDRGDDTHAMHDARVLAGQSGGALV
FT                   RETDGKLLGVHSFGDAFWGGSRDVCVLVNAATLDAIEIARDGVDPEVYATARVNAMIFR
FT                   SSDEALKRMAPELSAKQRASWIF"
FT   gene            complement(<121311..>122288)
FT                   /locus_tag="OSTLU_44228"
FT   mRNA            complement(join(<121311..121745,121797..>122288))
FT                   /locus_tag="OSTLU_44228"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(121311..121745,121797..122288))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44228"
FT                   /product="predicted protein"
FT                   /note="GO_function: - pseudouridylate synthase activity;
FT                   GO_process: - tRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44228"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98715"
FT                   /db_xref="GOA:A4S4E5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4E5"
FT                   /protein_id="ABO98715.1"
FT                   /translation="MVASKRIAAAVPRYLAFLEYDGARFRGFQRQCGVAATVQGALDEA
FT                   LTAFTGARGAIECVGSSRTDVGVHALRNSAHFDFARTTKDGTTVEPHDGASVRRGVNYH
FT                   LRKLGAAVRVTECVRVDEMNPKFHARHDAVARRYRYDILVGERDDGGSLFDAERAWYVR
FT                   ATCDGRLNVDAMRDAAAALTGTHDFSSFRANGCQASSPVRTLTSIDVKEELTEWPAAEA
FT                   RGTKQKISIAVAAPSFLYHQVRLLAGALKAVGANDLTVKDVQELLEAKDVARAPQMAPA
FT                   HGLYLADVAYLENYAVRPAYGARDEDA"
FT   gene            complement(<122500..>123963)
FT                   /locus_tag="OSTLU_93416"
FT   mRNA            complement(<122500..>123963)
FT                   /locus_tag="OSTLU_93416"
FT                   /product="predicted protein"
FT   CDS_pept        complement(122500..123963)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93416"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93416"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98716"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4E6"
FT                   /protein_id="ABO98716.1"
FT                   /translation="MSLRATNPRFGARVASARATLARRRARPGRVDVVPRAGPKNRLRE
FT                   KEAKKRSSSARDYEREMDDYVEKHVAPATRALDAARARPERRSDAQRFIRKVQRKVKKA
FT                   SQKAVDALLPRDAGAFRPRADVPARVGAPGTYATVYRPQRPNPASAYGRAAAAWGTLFA
FT                   CAWIALKVINRENPLRAIGSAFKGVGRRAPPPGATGPGRWVGDRSLGGRQVWVPATADR
FT                   FRDERKRLEGALDDVPEDANVKPGSATKARGNEKKTSGAAKALPAWWTPPSPQYVPPGR
FT                   KEALIQVAKAQGATLAAKRVSGAGFSADDIADFRAACAAAGERGCAVKSVGPESARVAI
FT                   FRAAADFAVTDAMRGQAGATSAFNTPVGPFLVGLSDDLSLDAHKCVSIVMADVAVRVRG
FT                   AVVQAGAGLRSNDSVATMLELNKLVDLFNTFPFTPDAPELDMLSVGLRSRLSEDERRRI
FT                   CDEFDAISNGEHSAVVRVAVCGASDSAYE"
FT   gene            complement(124055..>126241)
FT                   /locus_tag="OSTLU_25207"
FT   mRNA            complement(124055..>126241)
FT                   /locus_tag="OSTLU_25207"
FT                   /product="predicted protein"
FT   CDS_pept        complement(124793..126241)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25207"
FT                   /product="predicted protein"
FT                   /note="GO_function: - RNA binding; adenosine deaminase
FT                   activity; GO_process: - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25207"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98717"
FT                   /db_xref="GOA:A4S4E7"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4E7"
FT                   /protein_id="ABO98717.1"
FT                   /translation="MRAHAVDDVDDVERVAAVVRACALATYDARGREKTSKDAYTTLCA
FT                   FCIVERNDAASARGTCYVAAFATGTKCVPMANRARDGGAIGDCHAEVLARRALTRWLQR
FT                   EYAEARDGRASVFEVTRERGAGCDEETAWDEILGAGNRVRMRAGVEVHAYCSQSPCGDA
FT                   SVFELPSEARRSDGGAEASTATVKRAKTTGGAGGGAGVTGAKILTDMNGGGGGGGGADP
FT                   ERDRPTQEVGAVRWKPGRGAPSFCLSCSDKMCRWQMHGLQGTLMRLVAREAIKPRSICV
FT                   SIPNVREERAEETKRVVALALKRAIVKRARLDDSQSDDRVEPRCVAVDAPSDDLSSYRA
FT                   VVDGDRVASPTCVTYVAPSRSTFEFNDAVGAVDIASGRVERLLGAIGFLHGYGKKCRAS
FT                   GAASSALCARELCASFDADVLSRLPPRARRAMENKPYAAIKREFRAFRSRDFGIPSSPP
FT                   LPGKDKSDHESFVPFPRRVRSAAS"
FT   gene            <127000..136289
FT                   /locus_tag="OSTLU_26387"
FT   mRNA            <127000..136289
FT                   /locus_tag="OSTLU_26387"
FT                   /product="predicted protein"
FT   CDS_pept        127000..136278
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26387"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26387"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98546"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR011641"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4E8"
FT                   /protein_id="ABO98546.1"
FT                   /translation="MSFSTGKVRKRKYPDSFYYVVAPEADEEVGYLGAPSDWPTGDRVT
FT                   VDLHTGCSPIDALPFQRPGFDFDTVQARFVSKKLSMEFMFEDSQPMTKVGCGHFRATVE
FT                   LSKGWEFGFYLHANGDDSDENTMLDIGCETAVPGANNTKCPDFASPAMLATSECTDKFV
FT                   CNHGLYTFWNRRYDGEQTSFLWGACGSECPHQDCGHMYCAANERVQNQACASCPPGTTN
FT                   DAGDKNVGADTQCDPVICGAHMRVQDHNCVQCVAGKENEAGDDASQSNTECDAVICEPN
FT                   HHVAGNVCTACPAGHAHAGGDVQHGPDTSCDEVLCHTNERVLGHQCVACPPGSTNAAGD
FT                   GAASGDTQCDHTICPANMHVVGHVCTPCPPGMNHPGGDDAFFGDTSCSAILCQSNQRVL
FT                   GHACVSCPPGTTNDADDDASGGDTQCDPVICGAHMRVQDHNCVQCVAGKENEAGDDASQ
FT                   SNTECDAVICEPNHHVAGNVCTACPAGHAHAGGDVQHGPDTSCDEVLCHTNERVLGHQC
FT                   VACPPGSTNAAGDGAASGDTQCDHTICPANTHVVGHVCTPCPPGMNHPGGDDAFFGDTS
FT                   CSAILCQSNQRVLGHACVSCPPGTTNDADDDASGGDTQCDPVICGAHMRVQDHNCVQCV
FT                   AGKENEAGDDASQSNTECDAVICEPNHHVAGNVCTACPAGHAHAGGDVQHGPDTSCDEV
FT                   LCHTNERVLGHQCVACPPGSTNAAGDGAASGDTQCDHTICPANTHVVGHVCTPCAPGRD
FT                   HPGGDDATLGDTSCSAIMCGPNQHVVSHACTVCPAGMVNDANDDASGGDTHCDPILCPS
FT                   NQRVQGHTCVQCAPGKTNAPNDDASRGDTECDITYCAANQRVQGHQCVACAPGTTNDAG
FT                   DDASQVDTQCAPIICGAHMRVQSHACVQCVPGRENLAGDDASGQDTPCDEIVCEENHKV
FT                   VSHQCVACPAGKIHTAGDVASGPDTSCDAVTCSTNERVQGHQCVACPAGTTNDGGDDAS
FT                   GGDTQCDPVICPAQTHVQNHVCEVCPPGHAHPGGDDASQGDTQCDAVMCGANYHVQDHH
FT                   CVPCPTGKDNQANDNAAGADTECDIIYCAANQRVQNNVCTACPPGTINAGGDNAFDHDT
FT                   TCDTVYCGVNQHVFENECVPCPAGMVNPSGDDATGPRTFCEPIICGAHMHVQNHQCVQC
FT                   APGDENLAGDSAAQHDTTCDEVTCSANEHVVSHQCTACPAGHAHAGGDVQHGPDTSCDE
FT                   VLCHTNERVQGHQCVACPPGSTNAAGDGAASGDTQCDHTICPANTHVVGHVCTPCAPGY
FT                   ERLAGDDATGGDTQCSAVLCGANMHVQNNLCAACPAGTTNAAGDDASRGNSECDHTICE
FT                   AHMRVQSHQCVACMDGKENLAGDDAAGGDTQCDEVICAADHHVLNHQCVSCPYGHAHAG
FT                   GDVQHGPDTSCDEVLCHTNERVLGHQCVACPPGSTNAAGDGAASGDTQCDHTICPANTH
FT                   VVGHVCTPCAPGREHPAGDDATGGDTQCSAVMCGSNMHVQNHVCTACPAGTTNAAGDDA
FT                   SGANTQCDPILCGANQHVLNHQCMQCPPGTLNDASDSAAGGNTQCDAVQCGCNQRVQGH
FT                   QCVTCAPGTTNDAGDDASQGDTQCDPTICGAHMRVQDHACVACVDGRENLAGDDASQGN
FT                   TQCDEIVCEENHKVVSHQCVACPAGKIHTAGDIASGPDTSCDAVTCSTNERVQGHQCVA
FT                   CPAGTTNDGGDDASGGDTQCDITRCTAHMHVQNHVCVQCPAGKENVAGDDASGGNTECD
FT                   VVRCGANQHVVDHVCTACPAGTTNDEGDDASGANTQCDPVICELHMRVQNHQCVACAPG
FT                   KENLAGDDASQGNTECDAVICSANEHVVSHQCTACPAGHAHAGGDVQHGPDTSCDEVLC
FT                   HTNERVLGHQCVACPPGSTNAAGDGAASGDTQCDHTICPANTHVVGHACTPCPPGHEHP
FT                   AGDDATGGDTQCSAVSCGPNMHVQNHACTACPAGTTNAAGDDASGANTQCDATICAHNK
FT                   HVVNHECVPCPDGHEHPGVADASGSDTSCDVTLCGANQHVVNHQCMQCPPGTLNDASDS
FT                   AAGGNTQCDTVQCGVNQRVQGHQCVTCAPGTTNDAGDDASQGDTQCDPTICGAHMRVQD
FT                   HACVACVDGRENLAGDDASQGNTQCDEIVCEENHKVVSHQCVACPAGKIHTAGDIASGP
FT                   DTSCDAVTCSTNERVQGHQCVACPAGTTNDGGDDASGGDTQCDITRCTAHMHVQNHVCV
FT                   QCPAGKENVAGDDASGGNTECDVVRCGANQHVVDHVCTACPAGTTNDEGDDASGANTQC
FT                   DPVICELHMRVQNHQCVACAPGKENEAGDDASQGNTECDAVICSANEHVVSHQCTACPA
FT                   GHAHAGGDVQHGPDTSCDEVLCHTNERVLGHQCVACPPGSTNAAGDGAASGDTQCDHTI
FT                   CPANTHVVGHACTPCPPGHEHPAGDDATGGDTQCSAVMCGSNMHVQNHVCTACPAGTTN
FT                   AAGDDASGANTQCDVTLCGANQHVVNHQCMQCPPGTLNDASDSAAGGNTQCDAVQCGCN
FT                   QRVQGHQCVTCAPGTTNDAGDDASQGDTQCDPTICGAHMRVQDHACVACVDGRENLAGD
FT                   DASQGNTQCDEIVCEENHKVVSHQCVACPAGKIHTAGDIASGPDTSCDAVTCSTNERVQ
FT                   GHQCVACPAGTTNDGGDDASGGDTQCDITRCTAHMHVQNHVCVQCPAGKENVAGDDASG
FT                   GNTECDVVRCGANQHVVDHVCTACPAGTTNDEGDDASGANTQCDPVICELHMRVQNHQC
FT                   VACAPGKENEAGDDASQGNTECDAVICSANEHVVSHQCTACPAGHAHAGGDVQHGPDTS
FT                   CDEVLCHTNERVLGHQCVACPPGSTNAAGDGAASGDTQCDHTICPANTHVVGHACTPCP
FT                   PGHEHPAGDDATGGDTQCSAVSCGPNMHVQNHVCTACPAGTWNDEGDDASGANTQCDPV
FT                   ICEVHMRVHDHACVACAPGKENEAGDDASQGNTECDAVICEPNHHVAGNVCTACPAGHA
FT                   HAGGDVQHGPDTSCDEVLCHTNERVQDHQCVACPPGSTNAAGDGVASGNTQCDSTICGA
FT                   NRYVSNHVCVLCPYQHYRAAGDDATGPDTACIRYYGLG"
FT   gene            <136408..>136911
FT                   /locus_tag="OSTLU_17249"
FT   mRNA            <136408..>136911
FT                   /locus_tag="OSTLU_17249"
FT                   /product="predicted protein"
FT   CDS_pept        136408..136911
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17249"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17249"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98547"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4E9"
FT                   /protein_id="ABO98547.1"
FT                   /translation="MRASARVASARAVVKRERDARSTRARAFVPPIVPNPRQGDDDANA
FT                   DAAPTLPNIERALAPHGWAIGAERGYDDTPHAFKIFKVRDGHHTLEQLQEALYVSDERG
FT                   CRIRRETQSLFYMCCDGVRCRLNEGKKEIVVEMPCDLDSVGAYVAKAKVIEDIIKSSQK
FT                   KRAS"
FT   gene            complement(<137037..>140204)
FT                   /locus_tag="OSTLU_26389"
FT   mRNA            complement(<137037..>140204)
FT                   /locus_tag="OSTLU_26389"
FT                   /product="predicted protein"
FT   CDS_pept        complement(137037..140204)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26389"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26389"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98718"
FT                   /db_xref="GOA:A4S4F0"
FT                   /db_xref="InterPro:IPR002093"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015187"
FT                   /db_xref="InterPro:IPR015252"
FT                   /db_xref="InterPro:IPR015525"
FT                   /db_xref="InterPro:IPR036315"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4F0"
FT                   /protein_id="ABO98718.1"
FT                   /translation="MPAPSPGVSVGALARCGNPFAHTPAWPKTQRTTPETAAAARRARG
FT                   KGFMYLRDEDDDADAVTPVSRRRAPASAPGPSARATAMAQSPFVIMQRHMAGSATPYAN
FT                   LDAPAPDSVTLTTASGKSVIARANGAIRTDEQPRFDDDDEAYEDAFTFRAAIETPATTR
FT                   AESGGVFTSAAPKGLVFQTGGGASIAVSEDVKRRARAMFADVDENDPSSSGRERPSAAA
FT                   ATPPAASGGGGLVFQTAAGATLELSEAALKKSRAFLAEVGNENTPVRAAFPQPSFKTPK
FT                   SLPAVRKAPSKAPGFTPPMKSTTAFTPPMSILGARTAASAPRQAKRSRHDGTGASVGVA
FT                   VHDLFAARVRMGMRAPLCTFFNNLLPFQVRPAFVDTCVATLNADTAKSLRLPSVERGLV
FT                   GWREMRELMIKAGASDASLTNEWVANAYKWIVWTQACMARAFPEKYAFGVLSESAVLQR
FT                   MLYKYEREINRAERPHVRRILEKDENPGAPAVYVVSAIRSMTTASGIGNVPTMSEIEIS
FT                   DGWYSVRARLDAKLTRAVREGRLRVGYKIFVVGAELRGVTDAVSPLSDDAEMAYVCLHV
FT                   NGARLAPWDAALGRVTYNLTIPLRSVVPDGGVVPRMLIHVRHAYPMMHQERRDADKNVL
FT                   RCEIAERRAHAEWQRARDSVLHELQDAMHNRIGGWGSEVDQERAIREALQEKNLYDRRT
FT                   SAVLRLNVVGFMPSSKHESYRGPITRGSTSAILTIWDADEALVDAAQPGQSFAVTAIKP
FT                   RANAFIEGELSLSTTRYTRWTPIPQEDIAAQKLEHSEHEWRCLSVRAAVDLADLSRSGL
FT                   VRKEFDAVACTLHCGPPRSTQRGRLSQWIFCFDSSVLDSTTPNAARPHLLAVEITGYDD
FT                   DSFVKADDWMPSTKLFTEARHECGPPLVLRNLEFQHYDADNGVYVARVPIENVSVTLAA
FT                   QTPGIHRISVASRDLERFCGSRDDRSRSIIASLKSRARALTGVPENAESLVDEMPWDEV
FT                   HASQEPASQYDPPRLSMDDDWNDENAQSLADEAVRLTRSASKAPVVVPTPTPRRTPRRS
FT                   SRGSASR"
FT   gene            <140854..>141684
FT                   /locus_tag="OSTLU_13022"
FT   mRNA            <140854..>141684
FT                   /locus_tag="OSTLU_13022"
FT                   /product="predicted protein"
FT   CDS_pept        140854..141684
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_13022"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_13022"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98548"
FT                   /db_xref="GOA:A4S4F1"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4F1"
FT                   /protein_id="ABO98548.1"
FT                   /translation="MSRARSASDAGAEALAEALARHESRAARLSFAEEARVILDTNGCG
FT                   ALSTLGNQRAGVLAGFPCGSVAAYASDEDGLPIFALSALSQHARDARENGKATLTVTRA
FT                   EFEDVSDGRVSMSGILTEVDAGEATARARARYLARHPGAFWVDFGDFAWYKMTEVVAIR
FT                   IVGGFARAGSVTVEEYANARPDPVAAFSAPVCGHMNADHGDSLRDVVKHYVGVDVDSVE
FT                   MRSIDALGMNCRVVKDGEKYACRLPFESAATGRKEVKDQIVLMTRNAAAAANAQ"
FT   gene            <142606..>142887
FT                   /locus_tag="OSTLU_43989"
FT   mRNA            <142606..>142887
FT                   /locus_tag="OSTLU_43989"
FT                   /product="predicted protein"
FT   CDS_pept        142606..142887
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_43989"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_43989"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98549"
FT                   /db_xref="InterPro:IPR014953"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4F2"
FT                   /protein_id="ABO98549.1"
FT                   /translation="MLGICAASAEEGLAALKTWTAELGLPKGKLHGMDKDGIPVDPPKG
FT                   AVFIKYNSLSGDAYISGYGGTFRGVLFTPELDDGAFRQYGYLPLDVLL"
FT   gene            complement(<142951..>144252)
FT                   /locus_tag="OSTLU_44390"
FT   mRNA            complement(<142951..>144252)
FT                   /locus_tag="OSTLU_44390"
FT                   /product="predicted protein"
FT   CDS_pept        complement(142951..144252)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44390"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44390"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98719"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4F3"
FT                   /protein_id="ABO98719.1"
FT                   /translation="MIPDGVASASATSIAASENGEAEEFNLLRSCYVCKSRFRKMHHFY
FT                   AALCPECAELNWEKRSQTADMRGKFCVVTGARVKIGYRIALKLLRAGANVIATTRFPVD
FT                   ALKRFEGEDDAGQWIGRLQILAMDLRDLPALEKLCAHLLATLPRLDVLVNNACQTVRRP
FT                   PAYYKHLLQAEARSGFTRSLAGANARCDFLPSADAEAPSPTALSDWRQGDKFKEAGWMA
FT                   PSAAMSQLQLIASDADESNEHFPEGALDVNGQQVDLRTKNSWTMKLGEIETPELLEVLA
FT                   VNAAAPFVLNGKLRPLMAKTVAVDKEAGVEYAAAFIINVSAMEGQFARAKLSTHSHTNM
FT                   AKAALNMMSATSGKDFAEDGIYMNSIDTGWINDENPLEKAARLAKEKGFQTPIDEEDAA
FT                   ARVLAPVFEGFSEPPQAWPPVFGKFLKDYRETFW"
FT   gene            <144787..>145818
FT                   /locus_tag="OSTLU_88555"
FT   mRNA            <144787..>145818
FT                   /locus_tag="OSTLU_88555"
FT                   /product="predicted protein"
FT   CDS_pept        144787..145818
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88555"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88555"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98550"
FT                   /db_xref="GOA:A4S4F4"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4F4"
FT                   /protein_id="ABO98550.1"
FT                   /translation="MSYAKSTRPTRFLRVCPLRARDEARALAEGAAREAVEVDARDIDA
FT                   KRAVTFEFARVEDATAALERLRGGRTRASVFGAGVADGETALACGYSARASDSRAPERE
FT                   RTKASRRSSVEGLTLIENFVTVDEERALATLAATSGDETRLARRRVKHFGYAFDYGTRD
FT                   ANLKVVDEIPELAMEVLRRLPRETPGYEGAMRCDQVTVNEYPRGVGLAPHVDTHSAFGD
FT                   TILSLSLLGGTVMEFRTSGEAHRAIYLPPRSLLVMHGESRYRWQHYIPHRKFDTLEGEA
FT                   APTPRDDVRLSYTFRERRSGPCECAFPLQCDSRDGAQSKCSKRKTGKTQAFAELVGESG
FT                   DSF"
FT   gene            complement(145809..>147583)
FT                   /locus_tag="OSTLU_50834"
FT   mRNA            complement(145809..>147583)
FT                   /locus_tag="OSTLU_50834"
FT                   /product="predicted protein"
FT   CDS_pept        complement(145841..147583)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_50834"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_50834"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98720"
FT                   /db_xref="GOA:A4S4F5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4F5"
FT                   /protein_id="ABO98720.1"
FT                   /translation="MTLKPNYSYRAREVAGESHVIKSELGIFKSVRALAKDTRDGMRVT
FT                   FEVVPFEILRGVELQGLEAVPAKVVEETFRPMMGKPINSNHVSGAVEYFKAYAESKRGI
FT                   DSIEGISLLEEPSDGVLRLGFVDVDINDVKVEIDPSIDAKTGKENKVLSKVDSVMPYFE
FT                   NIKTTKVLNGMRVRETIDRFRAQNPRFGEPQINMLPKPGPLGKRTLLVSLKEKSMKGVT
FT                   CGGGMSARGLSEGIFSGIAGHFSAFHTNLFGQGKMLNLGVEATPRKGGRGLTVVRPQVN
FT                   LQYQDPWVGFGPTRTSRAMSVRSESSSMRSTHGVNSTNVDGDQPDITSPGLSEMSLQRL
FT                   QTSVEHSRPLLNGWNGMFSVDFKRTGVLDNDGNHSLFDAYGAPVTFSGTKCDTALAAQM
FT                   RFTYGGPNAAQLMLSAEQALPVQPQWLNYTRMVAKAKRSFNLLSVGSLPGPVQLVLSSK
FT                   GGSVVGDLPPYEAFAIGGTSSVRGYNDGAIGTGRKYVVGSAEMRVPVTPTITGAAFFDY
FT                   GSDLHSGGSVLGDPAGTRGKPGSGYSYGVAGMFETGGLPIRFDYAKNDQGNARFHFSLA
FT                   RDFN"
FT   gene            complement(148080..150353)
FT                   /locus_tag="OSTLU_26395"
FT   mRNA            complement(join(148080..149680,149936..150353))
FT                   /locus_tag="OSTLU_26395"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(148347..149680,149936..150185))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26395"
FT                   /product="predicted protein"
FT                   /note="GO_function: - glutamyl-tRNA reductase activity;
FT                   GO_process: - porphyrin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26395"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98721"
FT                   /db_xref="GOA:A4S4F6"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4F6"
FT                   /protein_id="ABO98721.1"
FT                   /translation="MSAALAPRAIAVGARATRKPTKKNFRHALRAVVDSETPQGDQTKP
FT                   MQVQRPTRDAVTLRPAGVSDAVVDSSKALEALAALGGNPYESERKSSIVTVGLSIHNCP
FT                   VEIREKMAVPPEAWNDAVAELCAYPHIEEAGILSTCNRMEIYVVALSYERGLKEVEEWM
FT                   VKHSGVDVESLREHLFVLKDRESTGHLLKVSGGLDSVVMGEGQILAQVKSVFAMGESEK
FT                   AFGRHLTGLFKAAITAGKRVRSETSIASGAVSVSSAAAELVQMKLPSQSFEGVRVLIVG
FT                   AGTMSKLLVKHLASKRCTEMTIVNRTKPRAEALAEEFPEVNMRIELMDQFLTLAGEHDV
FT                   IFTASSAVDPIICKDDLAKMSVCGDAVGGKRRLVDIAVPRNVDANCCEDPNTLVYNVDD
FT                   LKELAEINKAKREAAGLEAEALLLEEQRNFEAWRDSLETVPTIKRLRQKAENIRSAELD
FT                   KAMTKLGDGLTNKQKKAVEELSRGIINKILHGPMAALRSDGSDPTAVALTLVNMHALER
FT                   MFDLRNVDED"
FT   gene            complement(<150716..>151975)
FT                   /locus_tag="OSTLU_2307"
FT   mRNA            complement(<150716..>151975)
FT                   /locus_tag="OSTLU_2307"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<150716..>151975)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_2307"
FT                   /product="predicted protein"
FT                   /note="GO_function: - metalloendopeptidase activity;
FT                   GO_process: - proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_2307"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98722"
FT                   /db_xref="GOA:A4S4F7"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4F7"
FT                   /protein_id="ABO98722.1"
FT                   /translation="KLVNILESPEEAAIAPKDVERIKKEIFGMQTFYVTAVENLGAEMN
FT                   GAGVLFKGNLRTERAKVWETVQADLERMFNGEYTAFMLEEPPGEDGPSGDVAIDSKYGP
FT                   RVSFLIVPSDRAGPSPGTAGWQYLLALALMGLTVGSAVQLGLVAEVSKLPPETMSWLQQ
FT                   AGDVELPEGALPPGLENFDSVAYVESALPVTIGVMAASVGHEVGHQIAAFMRKIKIGIP
FT                   FLIPNSQLGTFGTLTQIKSTPETRADLFDVAAAGPVAGGMVALNLFVYGLTLSMGGDSP
FT                   DLIPIPNALFNSSLLLGGISQLFLHAGAKGVMVHPYFIAGWCALTTQALNLLPVGSIDG
FT                   GRMTQTAFGRRVLGATSLGTYIGLSFGIIASSLALPWAIYIVLTQRTPEFAPKDDVTEV
FT                   DDGRATLAFALIAVAFLVLLP"
FT   gene            <152763..>153614
FT                   /locus_tag="OSTLU_93419"
FT   mRNA            <152763..>153614
FT                   /locus_tag="OSTLU_93419"
FT                   /product="predicted protein"
FT   CDS_pept        152763..153614
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93419"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93419"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98551"
FT                   /db_xref="GOA:A4S4F8"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4F8"
FT                   /protein_id="ABO98551.1"
FT                   /translation="MLRCARAPTPPTPTPTPTPTRGARARVRRASTRARALDDDDARRD
FT                   SRFASEDERRRAVERLAPPKRDGDRAKPRLRELGKKRAMGFTSGAASSGEAREAARRAR
FT                   LERRDARATRESREIMSAMRDALDAWESEIDGMTDFARASVLEQASTATEMFERLRDEG
FT                   FGAVESAFAVMSWMDDAIEDAAARADEDAATSTSTSKERVEDASKASKSKTAPDGVVGA
FT                   LSDALRQWFAIDITELEDGRKSIVVNASAEFLAVFILLLVASAHFGGELVSDFLAPDPL
FT                   LR"
FT   gene            <153796..>155079
FT                   /locus_tag="OSTLU_43912"
FT   mRNA            join(<153796..154053,154165..>155079)
FT                   /locus_tag="OSTLU_43912"
FT                   /product="DMT family transporter:
FT                   UDP-galactose/UDP-glucose"
FT   CDS_pept        join(153796..154053,154165..155079)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_43912"
FT                   /product="DMT family transporter:
FT                   UDP-galactose/UDP-glucose"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_43912"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98552"
FT                   /db_xref="GOA:A4S4F9"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4F9"
FT                   /protein_id="ABO98552.1"
FT                   /translation="MSRRAVDAARDDRVVSCDDDVDSRSLASDPSRASTSHAATTDFAV
FT                   LLHPTAHFILVAAATIGSLALYGVLQERVMTIPYARERGESEDVFTCSMFLVFMNRWVA
FT                   LASSGALAMVTGWGGGATRGGAKDYAAVSFSNLVATVCQYEVLKYLTYSVSTLAKTMKV
FT                   VPVMIWGQFLGEKKFTSREYFDAAVMTFGCFVFVANRGWRSAVQKRYEGEYDESSLEWA
FT                   ANAGFLILAVYFVFDGFTSTFQQKMYRRDGVTVTAQVFFTSFFTTVFGFAWLVITDQLS
FT                   PSIRFVHDHPAIVGDILLLSCASTVAQFSIAYTIKSYSAVILASIMTFRQFLSVLISCY
FT                   VFSSPLNVVQWLGILLILAPLTFKHVAFANWAESAHPSSSKSDDDRLNAL"
FT   gene            <155281..>157881
FT                   /locus_tag="OSTLU_44236"
FT   mRNA            <155281..>157881
FT                   /locus_tag="OSTLU_44236"
FT                   /product="predicted protein"
FT   CDS_pept        155281..157881
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44236"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44236"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98553"
FT                   /db_xref="GOA:A4S4G0"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR014786"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4G0"
FT                   /protein_id="ABO98553.1"
FT                   /translation="MSIAAWSTARDAATAFAARDALVPIDDAARAAFAELRSQRCEDLL
FT                   ERAFLRAFERALRDDALPRWREACAMPSSIDAGALERTNAEERDEEEEETRARAEGWTR
FT                   AEAAPATTAFAEWIERGRERARAFSAGVRGVSEDDDAVRTFERAFDAMVGGTCAARGPP
FT                   RLSAILSAWYRARAREFDHAVRKRWGETSDDDENDRMETSVLERQSSIGADIASCGEVM
FT                   GRAWAAETSAMGETLARCHASLGRVAENAAARALGECVKRHVIRRCRGAFDAPKLWPTL
FT                   RWVRAVPLEFFKTALRLKRVDGAAIESWRGRLEYTVHEHLGALRIHELFDIIVDYPDSL
FT                   PAITDLRTCLQNTTLHAALVDSFVDAMRSRLLHAGASTVDIVQQYIGTIKTLLELDPSG
FT                   VVLELVSGPVKEYLRERKDTIRCVVTMLTDDGGEDGGEGGEGALYVELGRLARGESIEI
FT                   AESSVPAPNPNATVSGTDNLDRMDSITAEMVAIAAGANDDDLADGVQSTQQVLSGWDAW
FT                   EPEPVETEAAASRGRRRKAGDIIGLLVGIYGSKELFINEYRTMLAEKLLSKSNYDTERE
FT                   MHALELLKLRFGETSLHNCEVMLKDFADSKRANANIKTRPTTGTPSAKDRRTSDILIQT
FT                   PVEATIVSSLFWPAFSTDLTDFKLPTEIQEHMDAYARRYHQIKAPRKMEWKASLGTVVM
FT                   DVTHNDRTFEASVNPLQAAILHYFQREKVWRANDLANALGVSVDALRKRIVIWMNNGVL
FT                   VERKEGHVISYALAEPSDEVDAMDGVHDDDEHVSGVATAEETAAAGMMVYEQYIMGMLT
FT                   NFPSLPLDRIHNMLKMFVVEPVYDKTVAELEGFLLELVAQDKLAMDGSAFAKKK"
FT   gene            complement(<158028..>158831)
FT                   /locus_tag="OSTLU_26400"
FT   mRNA            complement(<158028..>158831)
FT                   /locus_tag="OSTLU_26400"
FT                   /product="predicted protein"
FT   CDS_pept        complement(158028..158831)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26400"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26400"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98723"
FT                   /db_xref="InterPro:IPR021467"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4G1"
FT                   /protein_id="ABO98723.1"
FT                   /translation="MRCASALARASAPLNACARRTGRGARARDALALKRATVGVRRTIE
FT                   IESIRPRTAARARASVATRASSLDDDVVVVPGDYRVGGVLLGVALLTGPALHLWTQFLV
FT                   HGVLGGFLAFQASRVRFRFTRTDLEVVFIEPGADDSAALATDVASSGDNKLQGGGENRW
FT                   AYDTITNWEFWWPGFPCLVYFKETQTKSDGQPHFFPIIMDGKMLYEVMLSRLPPSQNEK
FT                   PSPSEWSLDLALEQTQIGRQIKENLNEDQLRQIKEMKGFPVLDDK"
FT   gene            <159327..>160241
FT                   /locus_tag="OSTLU_17260"
FT   mRNA            <159327..>160241
FT                   /locus_tag="OSTLU_17260"
FT                   /product="predicted protein"
FT   CDS_pept        159327..160241
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17260"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17260"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98554"
FT                   /db_xref="InterPro:IPR032054"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4G2"
FT                   /protein_id="ABO98554.1"
FT                   /translation="MCANIERSTGRRCSLETLRMVAACAPAGTITFRAKTSRADDLKNI
FT                   HVDVDLGIEEGSSGNDKAGMVAMRAKMAAIRAKMVMIVANTHEGDAYDASAAPPESWRE
FT                   DFDLESVPLPEPVKIAFMEDSSRDGPRLLSSTSAPLLGEASTSALGRGGVSEGELTRAM
FT                   SDLGPDGKGISARAVQAVLERQAIVEAFNDPSAVADRERRRLHGRLPHVFDAVRTAFAA
FT                   RKRSVMELDPLLDELMHTNARAEISAHELADGVRILARMCPEWCTIVHARHGDEELFRI
FT                   VSRDPATARVARAKLAKLCRDAA"
FT   gene            <160506..>161953
FT                   /gene="PAFE3501"
FT                   /locus_tag="OSTLU_17261"
FT   mRNA            join(<160506..160558,160663..>161953)
FT                   /gene="PAFE3501"
FT                   /locus_tag="OSTLU_17261"
FT                   /product="predicted protein"
FT   CDS_pept        join(160506..160558,160663..161953)
FT                   /codon_start=1
FT                   /gene="PAFE3501"
FT                   /locus_tag="OSTLU_17261"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17261"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98555"
FT                   /db_xref="GOA:A4S4G3"
FT                   /db_xref="InterPro:IPR007852"
FT                   /db_xref="InterPro:IPR031336"
FT                   /db_xref="InterPro:IPR032041"
FT                   /db_xref="InterPro:IPR038103"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4G3"
FT                   /protein_id="ABO98555.1"
FT                   /translation="MDPLRLIRDHTIAGIIAESTHDDERIHLKDVDVELRRTTETNYRS
FT                   KAGNKLLKVEAIWYFIKYHVANPDAAHTAYMKAAIAAGFSTLSMLDRKDLIAYLTGERA
FT                   TSDRIDITVPVIVDEEGVSTVDAKRAREEDEAEGVPRERVLRDRNSVLRAPKDMTSVLD
FT                   FFAAPEEEKERLEEEKQQAADLAKGIKNQRYRDVKEQVFWREHVGSDFDMMNLDTNASF
FT                   LSGPKPPVDDGTDMLMTDARAMEKQPTAPSGPSTASRGGPAAAAKAPRKTSGKPGGVPI
FT                   IIVPAGFNQKVVLNMFNAKEFLQDGKFTQWDVVQKGGAKKSSSVYISRTYKRDGAKVKY
FT                   EVTEKAPHKRSEDWARVAAVFVLGAKWQFKDWPFRGVEDGDLVETFTKIRGFHARFDGD
FT                   PEVDVVKTWNVKPITISRTKRHGDRAAFEFFWDELDRHLALRSSALKY"
FT   gene            <162436..164391
FT                   /locus_tag="OSTLU_26403"
FT   mRNA            <162436..164391
FT                   /locus_tag="OSTLU_26403"
FT                   /product="predicted protein"
FT   CDS_pept        162436..164301
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26403"
FT                   /product="predicted protein"
FT                   /note="GO_function: - catalytic activity; GO_process: -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26403"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98556"
FT                   /db_xref="GOA:A4S4G4"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="InterPro:IPR021940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4G4"
FT                   /protein_id="ABO98556.1"
FT                   /translation="MATKPGALYDFPWAEWGSMKYAVFLPFVATVALGKDDGDSFCWHL
FT                   LAIAALRYASAQLWISLSRVHAWTRKTRIQARGIDFKQVDREDNWDDYILLQTLVIALV
FT                   HWMPGLGFNNFPATNEKTAVQLLLLHAGPTEFIYYWLHRALHHHKLYSAYHSHHHASFV
FT                   TEPITGSVHPFMEHLMYTANFAIPLIGTWALGGGSIAMFYMYLLGFDMLNAIGHCNFEF
FT                   IPRWFMRLPLMKYLIYTPSYHSLHHSRVHTNFCLFMPLYDHVYGTADVTSDELYEKAIN
FT                   GRAVPVTAPDVVFMAHGTELLSVFHLPFMLRSFSSRPFVSQWWLKPFWPLCVPFVLVLR
FT                   MFGKSFVADRHRLKTLNCETWVTPAWGFQFFIKSEFNHINRKIEEAILDADRAGVKVVG
FT                   LGALNKNEALNGGGALFVNKHGKSLKTRVVHGNTLTAAAILQKIPSECKEIFLTGATSK
FT                   LGRAIALYCVERGMRVVMYTTSEERFEKIRNEAAKKDQHLLVQSTSLSDGAKIKDWVIG
FT                   KHCPEKDQNMAPRGAIFHQFVVPPIPETRKDCVYTDLPAFKLPKEAKDFRSCEMTMKRG
FT                   HIHACHAGALVHSLEGWDHHEVGAIDHTRIDTTWEAALKHGFALA"
FT   gene            complement(<164644..>165027)
FT                   /gene="PRPL24"
FT                   /locus_tag="OSTLU_17263"
FT   mRNA            complement(<164644..>165027)
FT                   /gene="PRPL24"
FT                   /locus_tag="OSTLU_17263"
FT                   /product="Plastid ribosomal protein L24 large ribosomal
FT                   subunit"
FT                   /note="imported to chloroplast"
FT   CDS_pept        complement(164644..165027)
FT                   /codon_start=1
FT                   /gene="PRPL24"
FT                   /locus_tag="OSTLU_17263"
FT                   /product="Plastid ribosomal protein L24 large ribosomal
FT                   subunit"
FT                   /note="Chloroplast ribosomal protein L24; Chloroplast large
FT                   ribosomal subunit protein L24; imported to chloroplast;
FT                   GO_component: - plastid large ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17263"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98724"
FT                   /db_xref="GOA:A4S4G5"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4G5"
FT                   /protein_id="ABO98724.1"
FT                   /translation="MEIVAKKKWEKQALTPRGLPVRIPMHVKTNDKVVVIAGADKGKVT
FT                   NVVEVFTKTGEVLCKDVNVKTKHVKPRGEGETGQIIQREFPIHHSNVMHYSEAKSVRSR
FT                   IGTKEEGGKKVRVLKKTGEVLAN"
FT   gene            complement(<165613..>166530)
FT                   /locus_tag="OSTLU_26405"
FT   mRNA            complement(<165613..>166530)
FT                   /locus_tag="OSTLU_26405"
FT                   /product="predicted protein"
FT   CDS_pept        complement(165613..166530)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26405"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26405"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98725"
FT                   /db_xref="GOA:A4S4G6"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4G6"
FT                   /protein_id="ABO98725.1"
FT                   /translation="MDVAALTARAVDAYNTSHTFARDVLSHRLAVDDANAAHALVAIVT
FT                   LLAIVVAFRVVFGVGGAFAALASGPGSRSKTYKPAVLLLGGKGCGKTALWQGLKYGEQR
FT                   FRTTTSVEANECGDAVVVGKNSRGREVTKSHVRVVDVPGHAKLRKEALRELARARAVVF
FT                   VVDSVSFASERKEVAKFLFDILSDESFQTRKIPLMIACNKCEKLTAHPPDFIRKRLERE
FT                   IDAARAADAGSLPEMAITAAQRRANAVAKKKRDKYRTLCQRPGETFTFDAFTKASRRPG
FT                   VVCDRVSAMKNQLAPLCDFIVRVT"
FT   gene            complement(<166618..>167232)
FT                   /locus_tag="OSTLU_17265"
FT   mRNA            complement(<166618..>167232)
FT                   /locus_tag="OSTLU_17265"
FT                   /product="predicted protein"
FT   CDS_pept        complement(166618..167232)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17265"
FT                   /product="predicted protein"
FT                   /note="GO_function: - ribulose-phosphate 3-epimerase
FT                   activity; GO_process: - carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17265"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98726"
FT                   /db_xref="GOA:A4S4G7"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4G7"
FT                   /protein_id="ABO98726.1"
FT                   /translation="MLDEGADWLHVDIMDGHFVPNLTIGPPVVADLAKRVGPRDAFFDC
FT                   HLSVSNPATLVPALAAAGASSVTFHIEVVSGTAAEELCKTIRSLGMRAAVACKPSTPCD
FT                   EDGGVYELVDAGLVDMVLCLSVEPGFGGQKFNPAVCDKVSALRARYPDLDIQMDGGVNP
FT                   STAELCARAGANVLVAGSAVFGAANPAQVISQLRQSILNAS"
FT   gene            complement(<167368..>168813)
FT                   /locus_tag="OSTLU_2596"
FT   mRNA            complement(<167368..>168813)
FT                   /locus_tag="OSTLU_2596"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<167368..>168813)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_2596"
FT                   /product="predicted protein"
FT                   /note="GO_process: - carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_2596"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98727"
FT                   /db_xref="GOA:A4S4G8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4G8"
FT                   /protein_id="ABO98727.1"
FT                   /translation="VVGVDGGTTGIRAGVFTLTGVPLAFADVPYATSHPAPGRAEQVPA
FT                   SWLDGLATAIAEARRLCGVDARDVAAVCVDTTCCSVVALDARGDAIGNSVLWMDVRASD
FT                   EATACVETEDDALRVNCAGAGPVSAEWMVPKALWLKRNDRERYDRATMICEYQDYVNLW
FT                   LTGRYCGSMNNVGVRWHFDGDGRPPMTMLEKLGCAELVEKWPKEILPMGAAVGGMTARA
FT                   AAACGLLEGTKVIQGGADAFVGMVGLGVIEPGQLALITGSSHLHLGVAEEEFHAKGIFG
FT                   TYRNALVESAPFVVEGGQTSTGSVVNWFKNLCGGGDSFYDDMNREASAIPPGCEGVVAL
FT                   DHFQGNRTPHVDALSRGVISGLTLKHSKAHVFRAILEGVCCGTRLIFETMTRGGYEPKE
FT                   VVIAGGATRSELWLQIHADVTGVPHVVTECSDAPALGCAILAAFGAGLFGSVREAVAAM
FT                   VRKSRVISPNPEAHAAYADVYAAY"
FT   gene            complement(<168890..>171292)
FT                   /locus_tag="OSTLU_93421"
FT   mRNA            complement(<168890..>171292)
FT                   /locus_tag="OSTLU_93421"
FT                   /product="predicted protein"
FT   CDS_pept        complement(168890..171292)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93421"
FT                   /product="predicted protein"
FT                   /note="GO_function: - zinc ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93421"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98728"
FT                   /db_xref="GOA:A4S4G9"
FT                   /db_xref="InterPro:IPR001293"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4G9"
FT                   /protein_id="ABO98728.1"
FT                   /translation="MGGLVRLRDARGNGTDFWMSTNRATPWTARGALGRARRDAGATLD
FT                   GVDARGGAAMTSGRMETAGEDSTAATRGDDAEEAAEDDALEHAPTVFVGFPHASLVCPQ
FT                   CRDVMLSPVVAENGTTYCAKCAPREDAEDALAEDAEVEDAIQSLPVLCRRAMVLKRNAQ
FT                   GASEWCWKADGCGESGIRLRLRDVHDRECAFVPRRCWYPYDSRVECEANEARKGRDYCG
FT                   AIVTKIAYVSHVSECAWRSVKCDVKGCEDVVPFCKMTQHALTCPSALVKCPNECEWDGK
FT                   RRELAEHREICPREYIKCGFINLQHEDGNGCLYGCERDAIDSHRTDCDFRPWHCPSCDA
FT                   VVNAMHASIHAVKCEESRRPCPRCRAMVRTRAFDAHQEFFCVGASKPCAFAAFGCLEVG
FT                   AETELRAHERDAAPRHLRLVVKALEAERSSGRKKSKVIERMEQALNKFGEEYASLATKA
FT                   SERVRFVESKAIEEMDRLNEHMESSKRAYDAHVVALEKEIEQLKADRAAAVDADAHLAK
FT                   LDTAITCEEAQQLLDAAKGEMASVNAQFAKLQFAIDVREQKWEEDIEHAATKEAATREA
FT                   VRREIASIIATTSGADDDLLKRMDTLSTEIREISRTLNLDLMDLADKQKELEDAWRRAN
FT                   ENPRLRASAPRAKNPPSPTRGDSDSEASEAVSVKPRRKFKTTSDTTSETASERSHRRLG
FT                   SATLRARRLAAAAAASSEDLTNAPIPPSIIAMTDSERSFDPTSRADLADAPEPPSAAAA
FT                   AAVADDDILRGALLSRYVHVTAKPNAAPEPNPLVVPRPPWIDSDDDL"
FT   gene            171605..173511
FT                   /locus_tag="OSTLU_26408"
FT   mRNA            join(171605..171963,172152..173511)
FT                   /locus_tag="OSTLU_26408"
FT                   /product="predicted protein"
FT   CDS_pept        join(171754..171963,172152..173492)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26408"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26408"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98557"
FT                   /db_xref="GOA:A4S4H0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4H0"
FT                   /protein_id="ABO98557.1"
FT                   /translation="MSLTSDEMNYLVYRYLLESGFTHAAFALGNESYVDGRKLTDGQRE
FT                   VPPGALISFVQKGLQYCELEANLNEDGTDVDADFSVLSAKDLLSLSVDELKELVSARRN
FT                   MTEEERKALREEEEKEARAKAEANGIKIESDIEREIKSEEVTVLDGHTSEVFICAWNPT
FT                   KQMLASGSGDSTARVWTVPAGPSGREAQTKLAKPKVLDHKASGDGVEAMDTDEKSAAPD
FT                   GKSMQGDVTTLDWNADGTLLATGSYDGQARIWDTNGKLKMSLKHHKGPIFSLKWNKTGD
FT                   CLLSGSVDKTAIVWDAKTGDMKQQFAFHSAPTLDVDWRSPTEFATSSMDHSIYVCKLGD
FT                   DKPIKAFNGHTDEVNAIKWDPSGTLLASCSDDFTAKVWSLKKDTCVHDFNEHEKEIYTI
FT                   KWSPTGPGTENPDLPLLLATASYDATIKLWDVESGKCLHTLEGHTDPVYSVAFSPDGKY
FT                   LASGSFDKHLHIWNVKDGSLMRTYQGEGGIFEVCWNKEGTKVAACFSNNRVSVLDFEN"
FT   gene            complement(<173569..>174831)
FT                   /locus_tag="OSTLU_26409"
FT   mRNA            complement(<173569..>174831)
FT                   /locus_tag="OSTLU_26409"
FT                   /product="predicted protein"
FT   CDS_pept        complement(173569..174831)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26409"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26409"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98729"
FT                   /db_xref="GOA:A4S4H1"
FT                   /db_xref="InterPro:IPR021967"
FT                   /db_xref="InterPro:IPR037665"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4H1"
FT                   /protein_id="ABO98729.1"
FT                   /translation="MTFAGVVGALEVALDQSVRRASGGLRQACSRESTESKPYGIAATC
FT                   LRQLEAVVEALANSNGDDVVARDRAAAEVSAWALVSELFAEDKLGASRGTAAEVHRRRA
FT                   GVSAWLREQVARAAPCEEELFGRRAALTHVAGGRTVSAARAAAAHGDPRLATCLAQIGA
FT                   GKNVAFYAKQQLTRWRAGSVGKYIDEFSEQAFKLLAGEVERDDDGMGWYQNLGLHMWLA
FT                   AGPTSPLRDVVKNYLDAVAQQRAANPLPPVATYEALDANQATHLRDVAFNILALAASTE
FT                   DEGGSPSTAEVRVAFHPLTYSDDVLNASLAWHLFGVLNAIGVLEGEGMDALADEITVAF
FT                   ATQLLGMPERGRCEWAVFVSQHLRDDTRRTKMTGHILRERFEEWKCDDGKIAFIKDVCA
FT                   VPQESLDDAHALWDVYSTPRP"
FT   gene            complement(<175889..>176176)
FT                   /locus_tag="OSTLU_7301"
FT   mRNA            complement(<175889..>176176)
FT                   /locus_tag="OSTLU_7301"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<175889..>176176)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_7301"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_7301"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98730"
FT                   /db_xref="GOA:A4S4H2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4H2"
FT                   /protein_id="ABO98730.1"
FT                   /translation="YYVAAFTLVFEYVHAMDIVFRGMDPETMTIDQHGALRLTDFRFAK
FT                   HLAVTDDTPGKTFTACGAAAYMAPEVVRGVGHDERADWFSLGTFIVHLLNG"
FT   gene            complement(<177689..>178597)
FT                   /locus_tag="OSTLU_4795"
FT   mRNA            complement(<177689..>178597)
FT                   /locus_tag="OSTLU_4795"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<177689..>178597)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_4795"
FT                   /product="predicted protein"
FT                   /note="GO_function: - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_4795"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98731"
FT                   /db_xref="GOA:A4S4H3"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4H3"
FT                   /protein_id="ABO98731.1"
FT                   /translation="SYAMRYAACSQRGYYPEALSKANQDAHVSEARFGDRDDECVFGVF
FT                   DGHGEFGTECARFAAMRVPMEMAKREFGDAKGYEEAFRTTNEALRRSEVDDSLSGTTGI
FT                   IAHVKGRDLYVINVGDSRATMGIEKADDKGEVVVETVDLSSDQTPFRADECERVKKAGA
FT                   RVMTLDQLEGFKDPTVQCWGTEQDDDGDPPRLWAKNGMYPGTAFTRSIGDAVAERIGVV
FT                   ATPEIERVRLNKDTKAIVIASDGVFEFIPSTSVIKAAMATSDPQQSAIALVVESYKLWL
FT                   QYETRTDDITVIVILIEDFPDE"
FT   gene            complement(<179087..>181975)
FT                   /locus_tag="OSTLU_88568"
FT   mRNA            complement(<179087..>181975)
FT                   /locus_tag="OSTLU_88568"
FT                   /product="VIC family transporter: potassium ion channel
FT                   subfamily H"
FT   CDS_pept        complement(179087..181975)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88568"
FT                   /product="VIC family transporter: potassium ion channel
FT                   subfamily H"
FT                   /note="GO_component: - membrane; GO_function: - ion channel
FT                   activity; GO_process: - ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88568"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98732"
FT                   /db_xref="GOA:A4S4H4"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4H4"
FT                   /protein_id="ABO98732.1"
FT                   /translation="MAAAERARAKTRDRATRATRDGDSDDEFFGAGATPNASDARDATT
FT                   ASAHDSAGSDEGARGDGDGKLDAANGTRAMTRAEKVKDAIRRAKEAAKAGIVNVPRGSA
FT                   ARAKHGLATSAKALREKEEGDTRRRLDENKMARAAMTAAASEKHKQKMFDTTRLENFLD
FT                   HGDESEADWNAADSDEDEDEASAIAKYGDDDEARSLFVMHPTTKLRQYWDFLQIFLLLY
FT                   IAISVPYRIGFSEPSYGLWYVADFLVDIYFYIDMFFNFFTAYWETSADDDDFHYVTNLW
FT                   KIQKHYLKGWFIPDAISLIPVDYVSRSIDGTLTCSWESEAACGAAAENSQVPEVLRLFK
FT                   MLRLLRVMRTGRILERYQENLMRVYKMVTLGRLLALLVLLSHWMACAYAYVYDFQREDA
FT                   SGVESHKSEMYVAALFWSVQTLTTVGYGNVVPTTVDERVIAILVMITGGFVFSAIISGV
FT                   NMSMDEDSPGNRFAVLMNHVRELLSEHKMPNGLKSRVRSHYKASAKPQKLVNRDIIQPL
FT                   PEAIRADVNFYIYGKALSIGLKANGTVQPDGIVIEILCRTMDTHMYARGARICYPYELA
FT                   DKFIITLNGRVSYSPDEASGFHHSHVQKIKRKRLREQQIELAEEKGLLRGPGTVLNPGL
FT                   LSGFYKGMLCAMPFDKHVEALVMDHAVFYDICAQHQPTLLRNFEDEFLHALQALNKPKM
FT                   ARIALSECDMRRFLEETTRNVCSNWRELLQQERAQEDTKRRAREQAGAIGTVTAGGFKD
FT                   TNVPVSGAAPGATMGAIKLAMQQMHADIVNISEQIAQVMIAVKEVQVVGQDTASNVSHI
FT                   IISNDTIEEKQLNMELNVEAVYQSLQQIASNGLSMEAGGWHGGGGGGGKQVFDFRKSGS
FT                   QSGGAGGGKDAAPFSALQSDAIREKIEQAAKRGTKLSVTTHIDNEEEVWERERRPPTVG
FT                   IQGIRRVDPDRARARQAEKDKYRADGVLRDAL"
FT   gene            <182211..>182594
FT                   /locus_tag="OSTLU_26412"
FT   mRNA            <182211..>182594
FT                   /locus_tag="OSTLU_26412"
FT                   /product="predicted protein"
FT   CDS_pept        182211..182594
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26412"
FT                   /product="predicted protein"
FT                   /note="GO_function: - molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26412"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98558"
FT                   /db_xref="GOA:A4S4H5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4H5"
FT                   /protein_id="ABO98558.1"
FT                   /translation="MCGARASVDDGLTLTDACATRLRAIADEDGSAPARLRLAVEGGGC
FT                   SGFKYEFTLERDAATARDKTFRAANGAEVVVDAISYEFVKGATIDYAEEMIKSSFEVVK
FT                   NPQAETSCGCGASFGAKDGAFGG"
FT   gene            complement(<182779..>183498)
FT                   /locus_tag="OSTLU_26413"
FT   mRNA            complement(<182779..>183498)
FT                   /locus_tag="OSTLU_26413"
FT                   /product="predicted protein"
FT   CDS_pept        complement(182779..183498)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26413"
FT                   /product="predicted protein"
FT                   /note="GO_process: - nucleoside metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26413"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98733"
FT                   /db_xref="GOA:A4S4H6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4H6"
FT                   /protein_id="ABO98733.1"
FT                   /translation="MRARDRENHFCLDQNDAAVRAIAAALPWYGPEYSPHDVPSFYDVS
FT                   GITENPEVFRAVTELFVARYRAQGEAGPTHIAGFDARGFLFGPPIAMALNVPFVMIRKA
FT                   GKLPGVLVSSGTYVTEYSTDETVMRLGSVKAGDRVVLIDDLIATGGTALAGFNLVDQLG
FT                   ARVHEFAAMVSLPFLDGVKKIHEYADGKFKDVPCFTMVDDSTIGPEMCRDPPAGTPRVV
FT                   AAGDAARVSAEIDAATA"
FT   gene            <184094..>184882
FT                   /locus_tag="OSTLU_26414"
FT   mRNA            <184094..>184882
FT                   /locus_tag="OSTLU_26414"
FT                   /product="predicted protein"
FT   CDS_pept        184094..184882
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26414"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26414"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98559"
FT                   /db_xref="GOA:A4S4H7"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4H7"
FT                   /protein_id="ABO98559.1"
FT                   /translation="MKAMLEGLEYAPEDNAAATTAATAETVGYAFSSDHLRALERDGYV
FT                   VVDDLISQDVARAAAASARAMYDRGVMQNLRQEGRDDDVAVLATSSLPAGDEFAGLRPC
FT                   VEALLRVPDDLRRVVARVDDDALGADVVSKVRACRAPDRLMLARYGSESCRYVPHLDND
FT                   PSDDANDAGSPGLRPSDRVFTLIAYLNPDWDATRGGRFRAYRPGVAADAASPSDFVDID
FT                   PILGRVVVFDAAKLLHEVRPSFHDRYAVTVWTRGAELLPA"
FT   gene            <186274..>187074
FT                   /locus_tag="OSTLU_3085"
FT   mRNA            <186274..>187074
FT                   /locus_tag="OSTLU_3085"
FT                   /product="predicted protein"
FT   CDS_pept        <186274..>187074
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_3085"
FT                   /product="predicted protein"
FT                   /note="GO_function: - protein kinase activity; ATP binding;
FT                   GO_process: - protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_3085"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98560"
FT                   /db_xref="GOA:A4S4H8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4H8"
FT                   /protein_id="ABO98560.1"
FT                   /translation="FKIAEEELSIGAKLGVGSFGVVHRAKWNDTDVAYKTMIADKMNDD
FT                   TINAFAEEIRMMRALRHPNIVLFLGAVIQRGRMGIVSELMKRGNLEQLLHGNGKWSESL
FT                   RSNGMLRRQMAADCARGMLYLHSLAHPVVHHDLKPANLLVDANWTLKVSDFGMSELKSY
FT                   TYGSNCKAPGGTPEWMAPEALRGDDVNELSDVFSFGVILWELITLNFPWADLSSPVQIV
FT                   AQVAFLHRRLKIPSWVEDPMEQLLHDCWTRETEARPTFASIVERL"
FT   gene            <187844..>189241
FT                   /gene="TPR5a"
FT                   /locus_tag="OSTLU_43955"
FT   mRNA            join(<187844..188599,188636..>189241)
FT                   /gene="TPR5a"
FT                   /locus_tag="OSTLU_43955"
FT                   /product="TRP-containing protein"
FT   CDS_pept        join(<187844..188599,188636..189241)
FT                   /codon_start=1
FT                   /gene="TPR5a"
FT                   /locus_tag="OSTLU_43955"
FT                   /product="TRP-containing protein"
FT                   /note="contains a tetratrichopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_43955"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98561"
FT                   /db_xref="GOA:A4S4H9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4H9"
FT                   /protein_id="ABO98561.1"
FT                   /translation="AQQMMSNMTPEQMAQMQRMAGSMGLGAPPGAAEAMKNMTAEDMRR
FT                   AAQEMGNMTPEQLKTQYEQAQGHAKASADYRYAGSETLKKEGNKLVGEGKHADAVEKYA
FT                   RVKENLKDDVNAAAKTLRLSCMLNMALCFNKIGKHDGAISECTEALELEPRSLKAYYRR
FT                   GQAYVAKGELEQGVNDLMRANKLSPGDETVAGELEAAVKRMESQGLAVPAAAPEFDHPE
FT                   AAPTTSAGSSGSAMPGMPGMPTLTPDVQAQQMSSMMGNLSDDQIEQMAATNPMMAGMDP
FT                   DHVKKAAGMMKNMKPETMQSMMKMAQSMGTEGGKGFDPNDPEMMSKMQKELNNPEMREA
FT                   MVEMIQGMDSESLKEMSKSMGMTMDDAQAEQAVNALKNISPKTMERMLSMASVAGGIYS
FT                   RFKRPIDWAMRNKRTALSIFVVFTAMGTTYVLRWWRRRGGAVEAADNQTSTSTF"
FT   gene            complement(<189271..>191661)
FT                   /locus_tag="OSTLU_44312"
FT   mRNA            complement(<189271..>191661)
FT                   /locus_tag="OSTLU_44312"
FT                   /product="predicted protein"
FT   CDS_pept        complement(189271..191661)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44312"
FT                   /product="predicted protein"
FT                   /note="GO_function: - DNA binding; ATP binding;
FT                   DNA-dependent ATPase activity; GO_process: - DNA
FT                   replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44312"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98734"
FT                   /db_xref="GOA:A4S4I0"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008045"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4I0"
FT                   /protein_id="ABO98734.1"
FT                   /translation="MEQRDIYEDRGGRRAGRVRPRALEEGEDEWLRQARRRRAADRAAD
FT                   GDMEDDDEEFDVNIDVYDCPLREWITKDRTKVEIRKRLSRFLRKGQVDEAGRSLYHKKI
FT                   REMCNNNLQSLEISYMHLAKSESLIAVWVADAPKDMLDLFDEVALTEVLKLYPSYGDIH
FT                   PDVFVRIVDLPVEDAIRDIRQSHLNSLIRVSGVVTRRTGVFPQLKNVTYTCMVCSYNVG
FT                   PIFQNSSREEERPNACPECHQKGRWQINSAKTVYRNYQKLTLQESPGSVPAGRIPRSKE
FT                   VIVLNDLIDMAKPGDEIEVTGVYTNNFEASLNTRQQGFPVFTTYIEANYVKRKGDLYSS
FT                   GNLTDEDREDIRKLSRDPKIVRRIMKSIAPSIHGHEDIKMGIAFALFGGQEKFVKGKTR
FT                   LRGDINMLLLGDPGVAKSQFLKYTQATAGRAVYTTGKGASAVGLTAAVHKDPVTREFVL
FT                   EGGALVLADRGVCLIDEFDKMNEQDRVSIHEAMEQQSISISKAGIVTSLQARCSVIAAA
FT                   NPIGGRYDSSKTFSDNVELTDPILSRFDILCVVRDVIDPVLDERLAKFVVHSHVKCHPR
FT                   FEDDPEAPLQNPFGENDDDDIEPIDQKLLRKYISYAKKECRPKLNQQDLPKIQRVYAEL
FT                   RKESVTREGMPVAVRHIESIIRMSEARAAMRLSQQVSADDIDAAIGCMLQSFIGTQKQS
FT                   VQKTLQKKFARYTHFHRDYDALLLEILRGLLRETMRWENVGAKPNSQADTAGQTTTVRC
FT                   RDLESKARAYGIEDLAPFYGSSAFRNSHFSYDAARQCIVHTSD"
FT   gene            <192455..>193147
FT                   /locus_tag="OSTLU_93424"
FT   mRNA            <192455..>193147
FT                   /locus_tag="OSTLU_93424"
FT                   /product="predicted protein"
FT   CDS_pept        192455..193147
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93424"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93424"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98562"
FT                   /db_xref="GOA:A4S4I1"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4I1"
FT                   /protein_id="ABO98562.1"
FT                   /translation="METKRVVFVSLKPSSTASDDQHASRNARRKRALGIEERATWEEFV
FT                   SAACARLQIAGARAVYHASTGERVHGIEDVQDIEDLIVEEDESARMMTSGATPGVSPLR
FT                   TPNGRANGATARGTPGRDYDGDYDDDDGKSKPRRMSVLLSSLVPGLGSAVGDGALRKLD
FT                   SALDAAERGDDDGRSKNHRVPTRKPVGARKTLKRKKRLNRRAAALLLIVFVGTLVYVFG
FT                   RRFEDAPF"
FT   gene            <193558..>194166
FT                   /locus_tag="OSTLU_7292"
FT   mRNA            <193558..>194166
FT                   /locus_tag="OSTLU_7292"
FT                   /product="predicted protein"
FT   CDS_pept        <193558..>194166
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_7292"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_7292"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98563"
FT                   /db_xref="InterPro:IPR026113"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4I2"
FT                   /protein_id="ABO98563.1"
FT                   /translation="IDVLELGCGVGNSVFPLLRANLNMRVVAVDCSPTAIAAVRANPEF
FT                   DARRLRTHVVDASARRSMESCVDDASVDAVTAVFFLSALTANGLRNAAEEIRRVLRPNG
FT                   VLLFRDYARGDVKNADASSQFVPGERIDENASLSSTSNEQTYRRSDGTLAVFFDEDELN
FT                   DVFASVGLVGECEIVTHSITNRKLGVTMDRKFVQGRFVRL"
FT   gene            complement(<194223..>195764)
FT                   /locus_tag="OSTLU_43992"
FT   mRNA            complement(join(<194223..195167,195243..>195764))
FT                   /locus_tag="OSTLU_43992"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(194223..195167,195243..195764))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_43992"
FT                   /product="predicted protein"
FT                   /note="GO_component: - alpha DNA polymerase:primase
FT                   complex; GO_function: - DNA primase activity; GO_process: -
FT                   DNA replication, synthesis of RNA primer"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_43992"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98735"
FT                   /db_xref="GOA:A4S4I3"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR016558"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4I3"
FT                   /protein_id="ABO98735.1"
FT                   /translation="MVFGALRTNREKAEARAKTALERKYGGNAARLDAYNTAPDDERSI
FT                   EYLERAAMDRYGVLRAIDDARSGGKKDEELKRAIASAEEEYNMRRTTGGTFDAEGAARD
FT                   ATSHFLLRLASCRSEEHRRWFRENELELFKYRYGELSLDAKMEFMRTNGFNDYARASEK
FT                   EVRERRDDLRDYQRMCEEAASEASRWFVVGFEEVCPLVKSRRAYLIGGNAWIRKETLDQ
FT                   LVFGRFKTMLNKMVAEAITLFNKFEKKEAHRLTPLLKSVHNRRSGSGYDFQGEDGTMSI
FT                   AGIEATQESFPLCMRQLYKALKKDHHLTHGGRRQLQLYLKGIGLPLDQALVFWKTEFTK
FT                   HPKCSAEKFEKDYAYGIRHAYGKEGKRVNYTPHACGQCIAADPGVKDAHGCPFKTLTSG
FT                   VKDNGARLHELLGTLKISGAKSHAIVEKATNMHYQIACGMTFAAIHDGVEIEAGVHTPH
FT                   QYFHESRKILAPPTASEAVLGDANAQSVAA"
FT   gene            <196129..>197364
FT                   /locus_tag="OSTLU_93426"
FT   mRNA            <196129..>197364
FT                   /locus_tag="OSTLU_93426"
FT                   /product="predicted protein"
FT   CDS_pept        196129..197364
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93426"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93426"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98564"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4I4"
FT                   /protein_id="ABO98564.1"
FT                   /translation="MSAALAETIARDAADGRAGEYDLAGFGEAWVDALVEAAFATPTRA
FT                   KGGFYASCKFIVGGGKKTRAKYDDEVVKHLTAALRARGFEDDRGASACEACQGTYKYQH
FT                   DTDKDLKYLHVFPRVTHEAEGGEAAAAAGGTQSPEYRACACDLEEFERLVEMYCPSFSQ
FT                   KRALLRRMKVMEHALGALEQKVIAMESLNDREQTMYDSMVEVAAKIEFLQQALDDMIKK
FT                   GRLTKGEQGEIVEDLELKLEDLNLMVNEANEEGKPKRAEMLESKKEIVVKKIDSVRAKP
FT                   PIVYTVPHERELLDLKKELNSLKKIAAQSKGKLMSGADAAKCANIPKLEERIANLENSE
FT                   EKGWYEDECRALLFPPVAEKKAPAKAKASGAKTNSGWLTKAAKGGSRGGGGSAKASSTR
FT                   GPSNPFAMLGDD"
FT   gene            complement(<197412..>200042)
FT                   /locus_tag="OSTLU_44172"
FT   mRNA            complement(<197412..>200042)
FT                   /locus_tag="OSTLU_44172"
FT                   /product="predicted protein"
FT   CDS_pept        complement(197412..200042)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44172"
FT                   /product="predicted protein"
FT                   /note="GO_function: - phosphorylase activity; GO_process: -
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44172"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98736"
FT                   /db_xref="GOA:A4S4I5"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4I5"
FT                   /protein_id="ABO98736.1"
FT                   /translation="MESDRADVTESSFLESATTILDRPRQYVDDAEMGVDHLAHKELLW
FT                   KLSSTYLPNDVASLQRSLVRHVEYTLARRRYKLDTSSFYQATAHSVRDRLIERWTDTQQ
FT                   YSAKKGAKKVYYLSLEFLIGRSLGNAVSNLGLRGAYAEALRQIGYDLEDIMSEEKEPAL
FT                   GNGGLGRLASCFLDTLATQNYPAWGYGIRYKYGMFEQRIVNGKQVEFPDYWLTDGNPWE
FT                   VERLDVQYPVRLFGHVREFQDPDGNTLYAWEGGEVVMAQAYDTPIPGYGTYNTNNMRLW
FT                   SSKPSHEFNLASFNAGNYYGAVEAKERCESITSVLYPNDATEEGKRLRLKQQYFFVSAT
FT                   LQDIYRRFKKNVGRGSTTMKNMPDKVAIQLNDTHPAIAIPELMRLLLDIERLPWDEAWE
FT                   ITRKVFAYTNHTILPEALEKWPVPMITELLPRHMQIIYEINHRFLLEVQKMWPNDTARM
FT                   SSMSIIEESSPKMVRMSNLAVIGSHTVNGVAMIHTKLLKSLLFPDFLLMWPEKFINVTN
FT                   GVTPRRWLLQANPALASIYTGMVGPGWVNDLKRLEPIKTMAQDPQFRQRWRAAKQTNKQ
FT                   ALAEWLYRSMNIRVDPNALFDMQIKRIHEYKRQLLNVLGIVHRYAEITQATPEQRKTMV
FT                   PRVHIIAGKAAPGYVMAKNLVMLVCAVSEVVNSDAACRDLLKVVFVPNFNVSLAEILIP
FT                   ASDISQHISTAGMEASGTGNMKFVMNGGLIVGTMDGANIEIEQAIGEHNMFTFGAKADQ
FT                   VAAIRRKMAHDPPKIDPRLHRAMGMIRAGIFGKPDDGAYNQLLDAIDPRKDVYLTAHDF
FT                   PSYLGAIAEADAAYQYEEKWTAKCIEAACSMWMFSSDRTIREYAAKIWNVEPLPFRPPR
FT                   HHSER"
FT   gene            complement(201526..>203421)
FT                   /locus_tag="OSTLU_50879"
FT   mRNA            complement(join(201526..201740,201771..>203421))
FT                   /locus_tag="OSTLU_50879"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(201568..201740,201771..203421))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_50879"
FT                   /product="predicted protein"
FT                   /note="GO_component: - cytoplasm; GO_function: - tRNA
FT                   ligase activity; ATP binding; nucleic acid binding;
FT                   GO_process: - tRNA aminoacylation for protein translation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_50879"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98737"
FT                   /db_xref="GOA:A4S4I6"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4I6"
FT                   /protein_id="ABO98737.1"
FT                   /translation="MLLARAFARRTVSTPRASLAARPRASTRASERESARATATAATTR
FT                   RRGATTRTRARASDAGTNKKRDGGAGNRKRGEGGGRDASGVTSSPEEVKALRAQKLDAL
FT                   GALGQRGFDYRFDRTKYCDALQREHEGLENGVEIEGSSEAVCGRVMAKRSFGKLAFLSL
FT                   VDERGSVQLFCDKKRLDETSPGAFEMITELVDVGDIIGVHGSVKRSDKGELSIVPAKVQ
FT                   MLTKALLPLPDKWHGLQDVEKRYRQRYVDLIVSPEVRNTFKARSNIISTIRRMLDDDGF
FT                   LEMETPVLHTQAGGADAKPFNTFHNALGMQLTLRIATELHLKRLVVGGFERVYELGRVF
FT                   RNEGLSTRHNPEFTSIEVYQAYADVTDMLELTEEMICRCAMKACGTLTIPYGDVTIDLS
FT                   QRPWRRAPMNDLVKEATGVDVMAFGDDLEGAKAAAIPALKAHSKKAGEGIKGVKLAASV
FT                   GHVLNEMFEAACESDLIQPTFVLDHPLEISPLAKPHRSKPGVTERFELFVVGRELANSF
FT                   SELTDPIDQRKRLEAQMVTHAKTSAAQREAAAANEAYDVEMDEDFVAALEYGMPPTAGM
FT                   GLGVDRLVMLLTNSPSIRDVIAFPLLKKQDS"
FT   gene            <203552..>204076
FT                   /locus_tag="OSTLU_6946"
FT   mRNA            <203552..>204076
FT                   /locus_tag="OSTLU_6946"
FT                   /product="predicted protein"
FT   CDS_pept        203552..>204076
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_6946"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_6946"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98565"
FT                   /db_xref="InterPro:IPR008580"
FT                   /db_xref="InterPro:IPR042266"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4I7"
FT                   /protein_id="ABO98565.1"
FT                   /translation="MALVTLSVYDIKHAENARISSAVTSLNTLTRNALNVGGIFHGGVE
FT                   VFGDEWSFGYCPEGSGVYRCNPRMNPMYEYRESVPLGVTSLSPARASAAVAALRAQWRG
FT                   SDYEVLERNCNHFCEALCEALGCEGPPEWLNAFANNANKARGAYQSAVSGVESAYESAV
FT                   SGVAGAWAWLAS"
FT   gene            <204379..>205476
FT                   /gene="lhcq-like"
FT                   /locus_tag="OSTLU_88576"
FT   mRNA            <204379..>205476
FT                   /gene="lhcq-like"
FT                   /locus_tag="OSTLU_88576"
FT                   /product="chlorophyll a/b binding, possibly photosystem II
FT                   light harvesting complex"
FT   CDS_pept        204379..205476
FT                   /codon_start=1
FT                   /gene="lhcq-like"
FT                   /locus_tag="OSTLU_88576"
FT                   /product="chlorophyll a/b binding, possibly photosystem II
FT                   light harvesting complex"
FT                   /note="GO_process: - photosynthesis light harvesting"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88576"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98566"
FT                   /db_xref="GOA:A4S4I8"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4I8"
FT                   /protein_id="ABO98566.1"
FT                   /translation="MLSRGLVSTSRASVARARAPARQQRATTSRRASIVRRTAARATND
FT                   DDKASSSQDVPDDEPTPAVGDTDVNSALGDVISSPLFYVTFGVAGGVGLVRALGENASF
FT                   LLSAAPVVLLTVISKTSFGESLMKNIDDQRPALVAEKARRENERARARERSSLYGARRV
FT                   KFLGDAEYEYPAHLDGSLCGDAGFDPLGLGKDDLPRMRELELLHARWAMLGIVGVAVPE
FT                   LLERYGVADLGEPVWWKVGAAKMNSDVSLDYFGLQGFHIAGGSGIAIIAACQVVLMGGP
FT                   EYARYVGIDSLEPVGVYLPGDKDYPGGAPFDPFKISDDADEFEKQKVMEIKHGRLAMIA
FT                   MLGVAAQAFVTRAGPIENLASVFSG"
FT   gene            complement(205468..207209)
FT                   /gene="FBP65"
FT                   /locus_tag="OSTLU_26425"
FT   mRNA            complement(205468..207209)
FT                   /gene="FBP65"
FT                   /locus_tag="OSTLU_26425"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /note="Has EST support"
FT   CDS_pept        complement(205518..207146)
FT                   /codon_start=1
FT                   /gene="FBP65"
FT                   /locus_tag="OSTLU_26425"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /note="FKBP-type peptidyl-prolyl isomerase; contains 3 FKBP
FT                   domains in tandem, followed by 3 TPR repeats; GO_process: -
FT                   protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26425"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98738"
FT                   /db_xref="GOA:A4S4I9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="InterPro:IPR040478"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4I9"
FT                   /protein_id="ABO98738.1"
FT                   /translation="MTTADDAVDAVDVSPVGDGGVTKRIATPAPPDARAPEKGDAVTVH
FT                   YVGSLATGETFDSSRERDEAFTFTLGKHEVIDAWDVGVATMRVGERATLTCAPEYAYGD
FT                   RGAPPKIPGGATLIFDVELLSFKSHRDLCGDGGVMKETVREGEGYASPSAEDEATATME
FT                   AKTRTGDETLVAKTTRTFSLAANGDAPCEGVRAALLKMKRGETARVTLSEAYAEGLTTA
FT                   KDGAVVELMLDAIHAVVAVNGVEGATKKILEEGEGYETPNDGAKCEIEYEKRVGGATTE
FT                   TKPAHEIVVGDEHVPDELESAIAMMKLNEKALVKLADGTEYTVKMTKLERAKEQWSMNN
FT                   AEKIEAAEKYKTSGNDAYKGGKFARATKKYDAALKFVEMDESFSDEEKQASKKLKLSLN
FT                   LNSAAVAIKTKSWMSARKSSEKALAIEGSNEKALYRFAQAAMELQEYDESRRSLKKILE
FT                   ADESHAEATRMLTRLKALEAHQAKKDAKIFGGMFSKIDLGYEDVKVKADEPDEEIPAPE
FT                   AMPEVPAFDEPPAPDANEPFGVESV"
FT   gene            complement(<207278..>208687)
FT                   /locus_tag="OSTLU_17282"
FT   mRNA            complement(<207278..>208687)
FT                   /locus_tag="OSTLU_17282"
FT                   /product="predicted protein"
FT   CDS_pept        complement(207278..208687)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17282"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17282"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98739"
FT                   /db_xref="GOA:A4S4J0"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4J0"
FT                   /protein_id="ABO98739.1"
FT                   /translation="MMREYLSLLVAVGGVKGTLAVCLAYAAGASAFGDFGAGTGGEAMD
FT                   FARAASIGLAFAAPTAIYDALVMGVDWTARAEATNEAREEASGEVREASALERYFEPLS
FT                   RYQEEETLNNPCRSMPFWMDASVALTARVADEMLERGVVLGLLAKWLADRAVEAGFEPY
FT                   EVDAPAKAAAAFGVYLVLEARLRRVQRQTRVQAFRVERNKVTGKQKLVPVSEDDIKASA
FT                   EKTKKPSLKFWEKKPDAAADDESSSPLSANEAPNVAETRAFENILRGKSVKDFLDGSRS
FT                   RLLFVSQSLAFVVTGGVFAPIVGGYVADAMYIIHQRNTMTRFIERALGDAAPARGAGPP
FT                   DPDTVRRAQAAAFKNMLARKKRRMGRDVVDAMRRDPSISRDVNVLFQDVVRKVKRVKDI
FT                   DESTAVDEVLLAVNDFAADDAADDDAADDDSGVSYAERMRAALRRVSEDMDAIELARAE
FT                   SPPSADDDDPN"
FT   gene            <209576..>210247
FT                   /locus_tag="OSTLU_4040"
FT   mRNA            <209576..>210247
FT                   /locus_tag="OSTLU_4040"
FT                   /product="predicted protein"
FT   CDS_pept        <209576..>210247
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_4040"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_4040"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98567"
FT                   /db_xref="GOA:A4S4J1"
FT                   /db_xref="InterPro:IPR007940"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4J1"
FT                   /protein_id="ABO98567.1"
FT                   /translation="EAEEVDPRVGDALDELNDSMTECNGLENALQEARKARSRTQTVAR
FT                   KRLDSVAARLSSSVMTAVPVFHKRALAQLYQVRSIEALRAYESAHDAHERAKKRNDELE
FT                   RELVASSGKVDIELMEVCAEAMREVSETTAVKLRATEVHERNTRRAVEATAEAAGLERE
FT                   RTSAVKKALPWFNAKALGEAECAQADERVSELKLAVRQAKARYEAALRALNEISEEVHA
FT                   RR"
FT   gene            <210974..>212233
FT                   /locus_tag="OSTLU_1568"
FT   mRNA            <210974..>212233
FT                   /locus_tag="OSTLU_1568"
FT                   /product="predicted protein"
FT   CDS_pept        <210974..>212233
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_1568"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_1568"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98568"
FT                   /db_xref="GOA:A4S4J2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4J2"
FT                   /protein_id="ABO98568.1"
FT                   /translation="LTAGVLLVMSAFFSLAETSITTLYPWKVRELADQEGSTGGVFQIM
FT                   RKDVTRFLTTILIGTTFSGIMATALITEAALILYGDGATTAVTVALTIVMLVFTEIAPK
FT                   SVAVQHATVIARVIAKPIYLLSFVVYPLGRTCQIVVNAMFALFGLKTSAEPFVSEEELK
FT                   LVLAGATKSGEVESAEKDMIQNVLDLEETVVRDVMTPLVQVHGVRSDATLAEFRTEWIE
FT                   HKYSRVPAWEDRVDNIVGIVRANQIMQLGIERDLRPEQSKELEDVLVQDVMLRDTYFVP
FT                   ESMSVSKLLRELMQRKSHMCVVVNEFGGTVGIATLEDCVEEIVGEIYDEEDSQKANADE
FT                   DEQDATPFIREVGQGAYLVDTRAALWKLADELSLDIPESPLYETVGGFVCDLFGSIPDV
FT                   GASITTTFEHVEDEDASSDDE"
FT   gene            complement(<212506..>213597)
FT                   /locus_tag="OSTLU_26429"
FT   mRNA            complement(<212506..>213597)
FT                   /locus_tag="OSTLU_26429"
FT                   /product="predicted protein"
FT   CDS_pept        complement(212506..213597)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26429"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26429"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98740"
FT                   /db_xref="GOA:A4S4J3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4J3"
FT                   /protein_id="ABO98740.1"
FT                   /translation="MDFILRRSLLQMFLILTLLLTLCASCRAGDADFKAQLSTTVDVRA
FT                   LTSSRYDGSEARPLLVFLHGYCLSDDAQQTLKLESMRNVPAVRNRLGIARRRQQTLVQS
FT                   GLREAALDRNWIYLAPRAPRTTRECVLCNLQESSPNSQDRLFGSWITGILARDSPEFEC
FT                   RAWDGSDAVALPEISATDDLDVKYILEVVAAAKKEFNVDEKRIYVVGIATGGFMASRLA
FT                   CEKPELFRGVVSLAGGTFSDASRCRPKSGETNVLLVHGTDDHTVPIDGGVNARGIPFPS
FT                   ADDSFSTLGKAMDCSNVVAKSMDTLPADGNSVEVRVAKAKYDRCENNVDVEQWKLNGVD
FT                   HFIERETSEALFYDVVTWLNDLD"
FT   gene            complement(<213727..>214413)
FT                   /locus_tag="OSTLU_26430"
FT   mRNA            complement(<213727..>214413)
FT                   /locus_tag="OSTLU_26430"
FT                   /product="predicted protein"
FT   CDS_pept        complement(213727..214413)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26430"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26430"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98741"
FT                   /db_xref="InterPro:IPR025114"
FT                   /db_xref="InterPro:IPR038938"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4J4"
FT                   /protein_id="ABO98741.1"
FT                   /translation="MERELTPGRKARGDDGDDFADVRDACLRLVRESSGARETRAKGLM
FT                   IIRNCAPPGFAGAFGGFLRLFPKWFAARHAAAVTPMLLPWLVGEAEVNDAPEDVALDVS
FT                   DDVSTSVFAAMIGAPKVRAGYKQGVLLKRCRVLEETGCAAVCANVCKHPTQKFFTEEIG
FT                   LPVTLTPNYETFECQFTYGATPPSVEADPAFASPCFRQCGVSETLRDAECGNALESDES
FT                   PCASSN"
FT   gene            complement(214712..>215898)
FT                   /locus_tag="OSTLU_26431"
FT   mRNA            complement(214712..>215898)
FT                   /locus_tag="OSTLU_26431"
FT                   /product="predicted protein"
FT   CDS_pept        complement(214762..215898)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26431"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26431"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98742"
FT                   /db_xref="GOA:A4S4J5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4J5"
FT                   /protein_id="ABO98742.1"
FT                   /translation="MDWARARAKAPEGTVVEPFEMRRSMALSLAAARMRDVARAEASEE
FT                   LMKKHKGATSTRDICVEFTTLSRDVYAVYHPVWYVSFEHGYVVDENANKIIQQPREAVV
FT                   CGVTGLVVSDDLICDHKARALAFSAVAIPASIAAYVWPESAYFFLGQGALASAVAAAGA
FT                   AVLARQVPKMRQDKIDAVRVHDEERAFARAMRSVGNSEWMDESVQRRRDDAEWRRWRET
FT                   DKMRWDPDKRRAWAYSILETQIFRFRERQEMRHEMEERAHLADEAARREAEMERKYGAN
FT                   WKRSRGDDAHGAPSGRHPGFSRDIHGFYKTLRLDAKLGHATEEEIKAAFRLVALETHPD
FT                   KVAGDASAKKRAAERFQLAQKAYAVLGNKFERTAYDRK"
FT   gene            216644..218368
FT                   /locus_tag="OSTLU_25220"
FT   mRNA            216644..218368
FT                   /locus_tag="OSTLU_25220"
FT                   /product="predicted protein"
FT   CDS_pept        216672..218312
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25220"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25220"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98569"
FT                   /db_xref="GOA:A4S4J6"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4J6"
FT                   /protein_id="ABO98569.1"
FT                   /translation="MARRRGPRRRGDGDDDESTPLVARGRGSTTPATVTRVTLLVLVAM
FT                   GVVGASTAPRRRFSARVGVFKKGLKTVTSAASGVASAWSKTGDAAWTRAENLSKNARKK
FT                   VGAELTAAMQSGHQEIFKQYDEASGWSQQAANQVAGEATELGDDVEKTAKMIAEFLDGY
FT                   KCDIGVKDLKKTVDDIKNAVGSNSLKSMYDKVTGSPNRYFKNMDDLACQMMWDTSGFAQ
FT                   AASVMEAFIELAKDKCPLVVKGSSKPAFTYGFSVSGDIVGVVLSAGRSGEVGLGIDLSG
FT                   QKFCYAGHCVYSGFTLDVPQVGVDFNVVVSGWKSMSDVSGRSNMMAFGLSGELPDSAIP
FT                   DFDVDLTLVTGGAKMSNILGVSKALGVGQDASELPVTGSFAKGTCITPWCVTYEGGSCA
FT                   GDPGEGRDFKCYISRHSSFRLPAPFAGQTVQDRWDYYNRKSESGKKMRKEIESNNDKYP
FT                   IYEGCEFGDAEMECYYDKFYAKAHPKDYDDIEKKVNKESCNGFSSDSECSKNRRERIIE
FT                   KKVSRAKADFFKDKGGWKNEPTSYAKCGI"
FT   gene            218608..220113
FT                   /locus_tag="OSTLU_26433"
FT   mRNA            join(218608..218864,219062..220113)
FT                   /locus_tag="OSTLU_26433"
FT                   /product="predicted protein"
FT   CDS_pept        join(218855..218864,219062..220023)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26433"
FT                   /product="predicted protein"
FT                   /note="GO_component: - nucleus; GO_function: - DNA binding;
FT                   GO_process: - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98570"
FT                   /db_xref="GOA:A4S4J7"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4J7"
FT                   /protein_id="ABO98570.1"
FT                   /translation="MARSVGSGAMPASAEDSIGWYLSLYWPAMNKEFKGVVQKYDHDSK
FT                   HHTVKWDNAPKGSDGVTEVDLTEGELTWLKAPEKPVKKAAKGKPAAAKAKPKAYKEYDA
FT                   LETMDDLEARFTGKTTKAVAFQVLKNSGVNGMTLQEIVDESQKLGLRDWTQCKQPKTTI
FT                   NVCVSQDSAFVKISPGRVGLRINGAQTRDASQEPKHVKASGASKKRGRPPKTGEAKPKK
FT                   VQRQEPQHWERKPPIDLSIEVYTSNNTHVTNAPISVAYNVTIKALKKAISNNTKGMLKP
FT                   HYQQLYHDNRNIGMDEDAFLVHAVRPHKFERTLDLKLVISDQ"
FT   gene            complement(<220167..>221027)
FT                   /locus_tag="OSTLU_94921"
FT   mRNA            complement(<220167..>221027)
FT                   /locus_tag="OSTLU_94921"
FT                   /product="MPT family transporter: inner membrane
FT                   translocase (import) Tim44"
FT   CDS_pept        complement(220167..221027)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_94921"
FT                   /product="MPT family transporter: inner membrane
FT                   translocase (import) Tim44"
FT                   /note="GO_component: - mitochondrial inner membrane
FT                   presequence translocase complex; GO_function: - protein
FT                   translocase activity; GO_process: - intracellular protein
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_94921"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98743"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4J8"
FT                   /protein_id="ABO98743.1"
FT                   /translation="MAIDAVKEEYRLAMMDPGDAAAERRKAAGYDEAMFEPYDGTTAVA
FT                   TTAAPKPSAFGKLWGGVKSKLGIASAFDKLEGLKKTAPYAKGAELAEDMRERWETSDSP
FT                   VVHRIQDFQDNLFSETEQGEAYRMIRQRDPMFNINDFIAEVRRDIPKVLGAYLKGDVEA
FT                   LKQTNISSEMLERLSGQMNLWKHEGQHVDPRILDLSEVELMEVRLMENEPLVVLTFSCQ
FT                   QINCVRDKSGAVVEGAEDDIQSVHYLWAMQLVDKEYTTKDGRKYTKPTWALRELVLRGM
FT                   MAVAA"
FT   gene            <221853..>223157
FT                   /locus_tag="OSTLU_26435"
FT   mRNA            <221853..>223157
FT                   /locus_tag="OSTLU_26435"
FT                   /product="predicted protein"
FT   CDS_pept        221853..223157
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26435"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26435"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98571"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="InterPro:IPR036464"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4J9"
FT                   /protein_id="ABO98571.1"
FT                   /translation="MGVGGVAIEDMAQGEVIFSLRMRDDDDAPIALTTTEVENERGPLR
FT                   TLAKMVNATRLTSRYAGVIEDEWGFPLDSTRAATLALALAREVELGDDAYWRAYVDLLP
FT                   REVDSLQMWDDDELEALQGSRLIERARRRRALVRREYEATREALGATAPSYESFRWAYA
FT                   TVLARAFVLPDLNCMALLPGLDLYNSARDAEKCTVERLGHVEDDDDEDDDEDVAFANEG
FT                   EAQVTLRVGIGGAAAGTQLFHDYADHTSGGALLEFGFVYHGERERGSGVDAVETSLVRA
FT                   YDALDARSRAFLAERVFGAFNVRTSLTFELSNVGGVYKPALRGAACVPLEMWRAARALA
FT                   LSPERALPASLDDVLDEDTEIRARRIILDALKAERARYAATSIEEDVRALRLALDAGAA
FT                   ARRTAAALDVRVGEKSLLDDVITDLETNARRARRG"
FT   gene            complement(<223214..>223549)
FT                   /locus_tag="OSTLU_93433"
FT   mRNA            complement(<223214..>223549)
FT                   /locus_tag="OSTLU_93433"
FT                   /product="predicted protein"
FT   CDS_pept        complement(223214..223549)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93433"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98744"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4K0"
FT                   /protein_id="ABO98744.1"
FT                   /translation="MPPTTTKPRCRVVARAPRWIARARGTGTSTIARAWSKKDDDEIWD
FT                   EDERRRVEENKRWRRTDDPSEAWDIDKERDALMYKRESLEALLRVEYEPEEGRGEAKDD
FT                   DDDDARA"
FT   gene            <223823..>224461
FT                   /locus_tag="OSTLU_93434"
FT   mRNA            <223823..>224461
FT                   /locus_tag="OSTLU_93434"
FT                   /product="predicted protein"
FT   CDS_pept        223823..224461
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93434"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93434"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98572"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4K1"
FT                   /protein_id="ABO98572.1"
FT                   /translation="MTARATRERDDGARATTDEGGARATTDEDRARLTKYWLRRRCSTG
FT                   SHASEATEVGMLTGGESSNESHQATGRRARRGGSASASTPPGAGRRAERGGIDTPGHFA
FT                   FATPMSARVREEGMTTPRTPTLANDSPDRARLDELLAAPVKPNFGTRAAIECTPRHTPL
FT                   KLRFDDNVDVVVSGTHATSKKRARGKLSDVFKATKSTTPRLTRARKAML"
FT   gene            complement(<224625..>225584)
FT                   /gene="SPD1"
FT                   /locus_tag="OSTLU_26437"
FT   mRNA            complement(<224625..>225584)
FT                   /gene="SPD1"
FT                   /locus_tag="OSTLU_26437"
FT                   /product="Spermidine synthase"
FT   CDS_pept        complement(224625..225584)
FT                   /codon_start=1
FT                   /gene="SPD1"
FT                   /locus_tag="OSTLU_26437"
FT                   /product="Spermidine synthase"
FT                   /note="putrescine aminopropyltransferase;
FT                   S-adenosylmethionine-dependent methyltransferase; uses
FT                   decarboxylated AdoMet to synthesize spermidine from
FT                   putrescine, and spermine from spermidine; GO_function: -
FT                   catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26437"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98745"
FT                   /db_xref="GOA:A4S4K2"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR030668"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4K2"
FT                   /protein_id="ABO98745.1"
FT                   /translation="MNKYADDAPQSADKCIGACGEGWLCEVSEMWKGQAMSLKIDEELF
FT                   RGRSEFQDVYVFKNSAYGNVLVLDGVIQATERDEFAYQEMITHLPLCALNEEPKRVLVV
FT                   GGGDGGVLREVTRHGSIERIEIAEIDGMVVEMSKKFLPSMAVGFDDARVEVNICDGIKY
FT                   VGDAEEGTYDAIIVDSSDPIGPASVLFEEAFFKKMHRALKPGGVVCTQAECVWLHIDLI
FT                   EDLAKMCKGIFVGGSMAYGYTTIPTYPSGQIGFMMCSKPAADGSTVDFTKAKRFPRPAD
FT                   ESALKPMRYYNPQVHAAAFVLPEFARAALEPHLVPGSE"
FT   gene            <226036..>227883
FT                   /locus_tag="OSTLU_43996"
FT   mRNA            <226036..>227883
FT                   /locus_tag="OSTLU_43996"
FT                   /product="ABC(ABCD) family transporter: long-chain fatty
FT                   acid (ALDP-like protein)"
FT   CDS_pept        226036..227883
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_43996"
FT                   /product="ABC(ABCD) family transporter: long-chain fatty
FT                   acid (ALDP-like protein)"
FT                   /note="GO_component: - membrane; GO_function: - ATP
FT                   binding; GO_process: - transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_43996"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98573"
FT                   /db_xref="GOA:A4S4K3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4K3"
FT                   /protein_id="ABO98573.1"
FT                   /translation="MLDLKSKETSGAAATAAVGRKTRDAGRGKRTREIGVGKDFWNELG
FT                   YLLKVAFPTAGSRGGQLLGAQFTLLVMRTLLTVRANKVNTFYLTKAISSASWKFWVRWF
FT                   FNFGGWMASGVVVNSGLRYTESLITIELRAALTKKAHKMYMENNNFYKTAVLRQGGLDN
FT                   VDQRIVADIDAFAKETAFLYGHSFKPILEFTLSLTEAAKELGYSRPLALFASQIIITGV
FT                   LRSIAPRLGPMVAREAALEGGFRHTHARLIAHAEEIALLDGGKREIEILDEGLDNLVVT
FT                   QRWHALQRIRKSVADNVSKFQGLLVGSIFVHVPFMMKASVSEGERISSFRATEELMLRC
FT                   GGAFTEVLLLGKNLDELAGYTHRLSQLFKTLDLASKEAREDKAKLASAGADHAEGSPIV
FT                   FDKVTVGAPEPDGSQRVLVKDLTLAVASGQHLLITGPNGCGKTSLLRVLAGLWAPVSGT
FT                   VTRPSGVSSIMWLPQRPYLLQGSLRDQVVYPRDARTEKIVDARVKECLMMAGLAKFVDG
FT                   SMNVGLNTRHLEWNDVLSGGERQRIGFARLYYHAPKFAILDEATSAINPDEESKLYERL
FT                   IETDTTVVSIAHRLELRKFHKLELKIAGDGEGGFRILKL"
FT   gene            complement(<227911..>228762)
FT                   /locus_tag="OSTLU_26439"
FT   mRNA            complement(<227911..>228762)
FT                   /locus_tag="OSTLU_26439"
FT                   /product="predicted protein"
FT   CDS_pept        complement(227911..228762)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26439"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26439"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98746"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4K4"
FT                   /protein_id="ABO98746.1"
FT                   /translation="MEASTTDGTFASETASDGATGATRKREVTVRILTRDRDYDPFDAD
FT                   EKAVGYDVEDAVYKPSVSTWGVFERPPDISKTYGGGRTVKREELEDEEAIAARRARVAK
FT                   KLAKYREDQGMTLTNAEYAEVREVLERSGEAMKRGYMQDALDLLEPWALDRIGQKTEMG
FT                   GRIIFNYAICLDNLQRRDEALKQYRRCIGNQYGNVSKQADRMIWGMTTASKKMKSDLFD
FT                   YMDAAKLDAYDEYLIKMANEKFAGEIDEEEVKALNTQAMLTMVGLFGAPMLLFAYLTTS
FT                   TH"
FT   gene            229142..>230424
FT                   /locus_tag="OSTLU_26441"
FT   mRNA            229142..>230424
FT                   /locus_tag="OSTLU_26441"
FT                   /product="predicted protein"
FT   CDS_pept        229708..230424
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26441"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26441"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98574"
FT                   /db_xref="GOA:A4S4K5"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4K5"
FT                   /protein_id="ABO98574.1"
FT                   /translation="MRAIVRGDAGAGARDSGPGDGLAGELAGYFEECADAAFHAKVVAE
FT                   GETLRAMKSRERVKWLMRARLEMIESKLDSWPRALAAMATPRYAMTTLRRRAALADFIA
FT                   DAADVDALDVLPDSLDTFRWHAERAAMLALYAATELRLLTDSSKDRRKTWAFLDARVDD
FT                   IARSRVDVLELKSYIDVFARDADLTTLGASFASKDALAAAFAPVADVFARASRAVFSTP
FT                   SRDASERDPPRDSPDR"
FT   gene            <234130..>234354
FT                   /locus_tag="OSTLU_9233"
FT   mRNA            <234130..>234354
FT                   /locus_tag="OSTLU_9233"
FT                   /product="predicted protein"
FT   CDS_pept        <234130..>234354
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_9233"
FT                   /product="predicted protein"
FT                   /note="GO_function: - calcium ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_9233"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98575"
FT                   /db_xref="GOA:A4S4K6"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR039647"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4K6"
FT                   /protein_id="ABO98575.1"
FT                   /translation="LTASRIKADRQKGNLRSVFDEIDVNRDGKLCLAEFTQAYKKVDES
FT                   LTDAQIAKLFRDADVDNSGTLDYDEFCEVM"
FT   gene            <235291..>236370
FT                   /locus_tag="OSTLU_13035"
FT   mRNA            join(<235291..235502,235665..>236370)
FT                   /locus_tag="OSTLU_13035"
FT                   /product="predicted protein"
FT   CDS_pept        join(235291..235502,235665..236370)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_13035"
FT                   /product="predicted protein"
FT                   /note="GO_function: - GTP binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_13035"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98576"
FT                   /db_xref="GOA:A4S4K7"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4K7"
FT                   /protein_id="ABO98576.1"
FT                   /translation="MDGGSRRRRGADGGDGGKGGDVVLVACARTKGLGDVKNLLRGATG
FT                   GAGGAQGRIGSRGADARARVPLGTIVRGEWLVVADLTRDGQTCVLARGGKGGKGNKRMP
FT                   VGREAGTREPGAPGEEGKFVLELKTVADVGLVGLPNAGKSTLLRALSNATPRVGSYAFT
FT                   TMQPQLGAVSATDGETITLADIPGLIKGAHENKGLGHNFLRHVERCEALAYVVDLSSGD
FT                   GVKPWDALDILKRELEEYLPGLSKRPGFIVATKTDLPHTARTLKALRARTAPTPVFAVS
FT                   AANREGTDEVLRVFENEIIGNRRV"
FT   gene            complement(<236659..>237756)
FT                   /locus_tag="OSTLU_3295"
FT   mRNA            complement(<236659..>237756)
FT                   /locus_tag="OSTLU_3295"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<236659..>237756)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_3295"
FT                   /product="predicted protein"
FT                   /note="GO_process: - phosphatidylserine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_3295"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98747"
FT                   /db_xref="GOA:A4S4K8"
FT                   /db_xref="InterPro:IPR004277"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4K8"
FT                   /protein_id="ABO98747.1"
FT                   /translation="ARSPHTLTMLACGAVALAVATHAFANDANDARWTTEDGIRRGATG
FT                   ALGAYLAYGALQGPATHMTRPHAAVWKVVHAAFTMYLLALIVLLFQTPADAQKMLKFFW
FT                   DDLGTPLPTRSYGGDCRVYTPGHRSGSFGIVYETLFDEFTVAHVLGWFGKAVAIRDWGL
FT                   LWAYSIAFELCELTFEHWQPNFNECWWDMWVWDVMICNLLGICAGMWLVKFMRGKFHDW
FT                   SGKKASSRSAAAKEPPRSPVRGALKTVLTSLTPASVDHYTWRPTGSPSRFLKCAFLVFC
FT                   GLVFDLNLFFMKFVLHVPPSHNFCLYRLGLWFAMSNIAIREYYVFIETPDVGEAKLGPN
FT                   AWLALAVLIVEFLVVVKNGRGKFTAP"
FT   gene            <238016..>240295
FT                   /locus_tag="OSTLU_93436"
FT   mRNA            <238016..>240295
FT                   /locus_tag="OSTLU_93436"
FT                   /product="predicted protein"
FT   CDS_pept        238016..240295
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93436"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93436"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98577"
FT                   /db_xref="GOA:A4S4K9"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4K9"
FT                   /protein_id="ABO98577.1"
FT                   /translation="MHRARDDARDDARDDGDDARDDARDGANDWMRAIENLQPTTPRGC
FT                   AACAVLVAIALKATTANESSFALGALVGCAGTLAAQVAAVTRAVRANAAATAAREVADA
FT                   AAREEFDRGRDDDARNGDEGRNAGVGATTSVGEAPHSGWIVVARANAKSAKGAAASGEK
FT                   KFARLTRDGRLQLANERGGEVVDVIDLCGCDVALTKFPGLEKPTELRWHKSTPMVVRHG
FT                   DRAVYRSMKTVWLFALSSPAKEAWFVALMTCVERLRAESGGAEADARALDRMRVEADDF
FT                   AKFTQETKKYKEESARRDAHAQGTHSAGAGTAGATINALGSRLLFDMFRDERWQLEQKE
FT                   KLVNKMNNAPGTPKFVGTFEITHIDFGSTVPHIISARVPSFSSSSAPWDGASMPGRGFS
FT                   HALELDVEYVGRATMTVQTRVDLSKYAQDMESEANNVSNAESVDEIARSFSSIKKAAAR
FT                   EAARVVTSLSDTLSATPLRFTLTLKKCQGVMRLWIPPPPGDRLWWGLIKEPDIDLEIIP
FT                   ELGAAAISHEGIASRVSQFLRNLFVADMHSQLLLPNCVAEPWKELRPFVSAMELSLAEA
FT                   ATEEFSALQPPSPSPSPINTERERPAERDRPAVSNVTTPASTPRPSFDTPTSPPPEQVM
FT                   ESPPVSPKASVAPIAAVSASLPSSPTATITGLATTTSTEPPPKRPASEDIQAKPTSSFF
FT                   AQAKSFTQKLERSFGDDFKDFTAAVKDAGVAGGLKHVSKNIEKVIAPTSSKDPAQPSSS
FT                   NVLKND"
FT   gene            <240877..>241494
FT                   /locus_tag="OSTLU_43977"
FT   mRNA            <240877..>241494
FT                   /locus_tag="OSTLU_43977"
FT                   /product="predicted protein"
FT   CDS_pept        240877..241494
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_43977"
FT                   /product="predicted protein"
FT                   /note="GO_component: - nucleus; GO_function: -
FT                   methyltransferase activity; GO_process: - nucleobase,
FT                   nucleoside, nucleotide and nucleic acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_43977"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98578"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4L0"
FT                   /protein_id="ABO98578.1"
FT                   /translation="MYEHEQFDVIMMDPPWQLATANPTRGVSLGYSQLTDQHIADLPLP
FT                   QLQKNGLLFVWVINAKYQWCLNQFKKWGYEFVDEIVWVKVTKTRRLAKSHGFYLQHAKE
FT                   VCLVARRGDAPPGLKNRAIGSDIIFAPRRGQSQKPTEIYELIEELVPNGRYLEIFARKN
FT                   NLRDYWVSVGNEVTGTGLPPDDVKAFEERGHIPSAKYGASNR"
FT   gene            complement(241565..243799)
FT                   /locus_tag="OSTLU_26449"
FT   mRNA            complement(241565..243799)
FT                   /locus_tag="OSTLU_26449"
FT                   /product="predicted protein"
FT   CDS_pept        complement(242397..243761)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26449"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26449"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98748"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4L1"
FT                   /protein_id="ABO98748.1"
FT                   /translation="MTLNERERLISAFSPPRALADDAIVVDVDAIGVNTRRDDDVRSRF
FT                   APSPSPSRSRVAAGAAAIALLGAASVAIAIAGRSGDASDAAATRARLGYTDAEKARALD
FT                   VRRSIGDKRSGHGFPIFLHIPKTGGTTIETSLGVSGIAEGYCIKREDRAYELHPRYRGW
FT                   ENWHSIPKDYVRKSWAIVRNPYERAESEFLYWTGTYDRKLFDSLKVGYDEGNCEKFAAH
FT                   LTLNVHDSKIRACYEAGGWELRAQKKCEDEINGGVASLSHWAPQMLMASRAENLFRIEE
FT                   CFGAEEGECPLTPWSKRHGGASVKEENIISFIHHRYHKKIEMVVTNAWHKDVPKPDLHS
FT                   CWSRFDPELLNLFNTFYGGDFEHLGYDIMRSAANLGAPSQTVPKELIGLTLGQLAERLP
FT                   KGERVAVNNAPTCPPKESVLEEFLHGGDKSHAQVGEATTQTTTRRASRRNTKPKH"
FT   gene            complement(<243871..>245535)
FT                   /locus_tag="OSTLU_26450"
FT   mRNA            complement(<243871..>245535)
FT                   /locus_tag="OSTLU_26450"
FT                   /product="predicted protein"
FT   CDS_pept        complement(243871..245535)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26450"
FT                   /product="predicted protein"
FT                   /note="GO_function: - RNA binding; GO_process: - RNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26450"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98749"
FT                   /db_xref="GOA:A4S4L2"
FT                   /db_xref="InterPro:IPR000061"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035967"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4L2"
FT                   /protein_id="ABO98749.1"
FT                   /translation="MHFSLNNPRKGNRLALQRARDARKAARDAAEVEAVLETFQNEFGD
FT                   GDDDDEDGRANAVTFVRGGLQRPDARDGVDDEGVGEVYALGARDGPAPAAKRKGADAEN
FT                   DVEAGPSAPRGKKKLKAIDAMLEEFAAKAPVVPEASARSEPASTSERVEPATATDASRS
FT                   SNVRITNLPVDVAAVDLARAFERYGPIASVKIWRPSKESRETSNSGYVCFMSRTSAERA
FT                   VDEMHDALLFGNTVNVVISMAMRIPQHAMWPTTLHANEAAELLARAPAEVLGDIPWSVA
FT                   PTATSDTSDEADVVVQIPDDEDLKRRIDITAAYVAEDGEVFERALKAREATNEEYRFLF
FT                   DECSQAHAYYAWRVFAFAQSDALETWRTEPFVMIRDGARWIPPPLDETQASRLENRVGR
FT                   SSKRAAMKLSTADRKSLVEILQHITVARDDIRDAMEFAVERAECAADVVDVIATSLCNL
FT                   ETPRQTMTARLYVVSDLLHNCAAPVKGVQAYRALFISALPSVFERLELYLEAASSSASR
FT                   RAFKRDVLATLRAWSDWCAFTDDFIIRLRGSAFAVDD"
FT   gene            complement(<245634..>247597)
FT                   /locus_tag="OSTLU_17301"
FT   mRNA            complement(join(<245634..246478,246542..247007,
FT                   247220..>247597))
FT                   /locus_tag="OSTLU_17301"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(245634..246478,246542..247007,
FT                   247220..247597))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17301"
FT                   /product="predicted protein"
FT                   /note="GO_function: - RNA binding; GO_process: - protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17301"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98750"
FT                   /db_xref="GOA:A4S4L3"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4L3"
FT                   /protein_id="ABO98750.1"
FT                   /translation="MMRETNDKTSVEYQRMSWDALKKSINGLVNKVNASNVQHVVPELF
FT                   QENLIRGRGLFARSVMKSQMASPQFSGVFAALVAVVNTKFPEIGELIAKRCVLQFRRAY
FT                   KRNDKPVCVAATRFLAALINQQIIHELIALELLTVLLGTPTDDSVEVAIDFVKECGFTL
FT                   QELTPQGLHGIFERFRGILHEGEIDKRVQFMIEGLFAFRKGGFEGKKGVSPELDLVDED
FT                   DQIVHEIGLDDEMQAQPGLDVFKEDPEFEENERRYADIRKEILGESSSSSSDSDSDSDS
FT                   GDGKVEIADLTETNLVNLRRTIYLTIMSSLDFEEAGHKLMKLNIPPGAEVELCTMLVEC
FT                   ASQERTYLRYYGLLAQRFCFIHKIYPQLFDEVFMKQYSTIHRLETNKLRNVAKFFAHLL
FT                   ATDAMSWTCLAYIQLTEEATTSSSRIFIKILFQELAEALGLKQLNEKMQNPEMREYFQG
FT                   IMPKDEPRNTRFSINFFTSISLGALTEDMREWLKTAPKTVPKRSRSSSSSSSSSSSSSS
FT                   SSSSSSSSTSGSRSSSSSSSGSSSHSSSSSRSRSRDRRRKRSRRR"
FT   gene            <247984..>248811
FT                   /locus_tag="OSTLU_17302"
FT   mRNA            <247984..>248811
FT                   /locus_tag="OSTLU_17302"
FT                   /product="predicted protein"
FT   CDS_pept        247984..248811
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17302"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17302"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98579"
FT                   /db_xref="GOA:A4S4L4"
FT                   /db_xref="InterPro:IPR025789"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030445"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4L4"
FT                   /protein_id="ABO98579.1"
FT                   /translation="MRRVAVARAAFSGAARGRGRPSARARADARRDGRGRARGRDVARA
FT                   STTGTTREDDARDDARDDARAAYDATYEGLDRDAGLAIAERADRGKTREDEWFYGELEF
FT                   AAARDALRRVCPNAGEGREFVDLGSGLGKMVIVAALSGLFERARGVELLTELHEAATSA
FT                   RAAFDDALARGDGEVIEGARACEVTLDEGDLLNYDVSSADVVYIHATCFTPQLLSALAL
FT                   KLASELKTGARVMIMSKQFPEGWVFKPFDGGYAALAQPQSKWKLDCFLYEISR"
FT   gene            complement(248826..249829)
FT                   /locus_tag="OSTLU_26453"
FT   mRNA            complement(248826..249829)
FT                   /locus_tag="OSTLU_26453"
FT                   /product="predicted protein"
FT   CDS_pept        complement(248870..249472)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26453"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26453"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98751"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039190"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4L5"
FT                   /protein_id="ABO98751.1"
FT                   /translation="MARAKIMERARARVRWGWAKESALRGALATKAERWEEAERCFAQA
FT                   LELDPEHVRAYAARGACYANRRMYAEAIRDFDRALKIDPNDGAAKAYKAAVEEKARRLE
FT                   RARSGANVGARATTEDLDSLRARVLNPARGLDALSRSHGATKTYEMELGDDDDGVDARS
FT                   RRERKRKKERKKERKKRKKREKKRSRRDDSSSSSSSS"
FT   gene            <249908..>256625
FT                   /locus_tag="OSTLU_44002"
FT   mRNA            join(<249908..249973,250218..>256625)
FT                   /locus_tag="OSTLU_44002"
FT                   /product="predicted protein"
FT   CDS_pept        join(249908..249973,250218..256625)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44002"
FT                   /product="predicted protein"
FT                   /note="GO_component: - nucleus; GO_function: - nucleic acid
FT                   binding; helicase activity; ATP binding; type III
FT                   site-specific deoxyribonuclease activity; GO_process: - DNA
FT                   restriction-modification system"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44002"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98580"
FT                   /db_xref="GOA:A4S4L6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041094"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4L6"
FT                   /protein_id="ABO98580.1"
FT                   /translation="MPGARDGGAEAAARYRQYEYKANASLVLESDRRGRPRGEPTGAPE
FT                   SLEGKIDASRFGDRARGGTDGDFAEKRERAARRRAEKRARGDAGEAEAFGKRGRATKGA
FT                   SVLGGSEYGLYKPKTRETRAAYEGLLSVLQGVFGDQPQDVMRGAADEVLAALKEEGKTE
FT                   RAKQKDVEALMGTLTSERFAQITAIGKLITDFSIPGEGGEGAGEELDDDIGVAVEFEEE
FT                   EEEDSDVDEVLEASDVDDDDEGDEGAYDGAVGARAVEDEYTPNADHGLNPADIDAHWLQ
FT                   RAISKAFGFTDSDAAESLKLSEDVYQVLSTEDDRECENALVSMLDYDKFDLIKVLLKNR
FT                   LKVFWCTRLARSASEEETANIEAQMKADPAAAGILASMRATRASARDRQTATEQKIREE
FT                   ARKLRGEVAEMRTQGGAAAAGRQLLELDALAFVQGSHFMSNKRCELPPGSFRSAKKGYE
FT                   EVHIPALKQPPFNDDEALRAIEEMPEWAQPAFEGMKTLNRIQSRVYECALLSPENMLLC
FT                   APTGAGKTNCAMLTILHEVGLHRRRDGSVDTSAFKIVYVAPMKALVAEIVGNLSNRLKT
FT                   FGIQVRELTGDVSLSKAEIEATQIIVTTPEKWDIITRKSGDRVYTQLVKLIIIDEVHLL
FT                   HDDRGPVLESIIARTVRQVETTQEMVRLVGLSATLPNFEDVATFMRVNPEKGLHVFDNS
FT                   YRPCPLQQQYIGVTVKKPLQRMQLMNEICYEKVMESAGKSQVLVFVHSRKDTAKTAKAL
FT                   RDLAMENETLGKLMRDDSASREILLTEAETVKSSELRDLLPYGFAIHHAGMSRADRTLV
FT                   EELFGDGHVQVLVSTATLAWGVNLPAHTVIIKGTQVYNPEKGGWDELSFQDVMQMMGRA
FT                   GRPQFDTFGEGIIITQHSELQYYLSLFNQQLPIESQFVKQLADALNAEIILGTIQNVRD
FT                   AVIWLGYTYLFVRMLRNPTLYGVSVDAVEDDPVLEQRRSDLIHTAAAQLDKSGLIRYDR
FT                   RSGALQGTDLGRIASTYYVSHGTLMAFNQHLKPTMGDIELCRLFSLAEEFKYISVREEE
FT                   KMELSKLAERVPIPVKESIEEPTAKINILLQAYISNMRLDGFALMSDMVYVTQSAGRIL
FT                   RCIFEIVLKKGWSQLAEKSLALCKMCARRTWASQTPLRQFSAIPVDVLQKIERKDLAWD
FT                   RYYDLSSQEIGELMRAPKLSKALHRFIHQVPRLELSAHVQPITRSVLKVDLNIQPDFIW
FT                   DESVHGYVQGFWIIVEDNDGENILHHEYFLLKGHNAEEEHGVSFTVPLSDPLPPQYFIR
FT                   VVSDNWLGSDTVIPVSFKHLMLPEKNPPPTELLDLQPLLVSTLKADGYDELYAGRFTHF
FT                   NPIQTQVFQCLYNTDENALVGAPTGSGKTVCAEFAIMRSLMTNQDGRSVYMAPTATLAD
FT                   ERYDDWSSRFGALGVSVTKLTGDTTADLKLLEKGQIVITTPQQWDVISRRWKQRKNVQT
FT                   VSLFIADELQLIGGSNGPTIEVVVSRMRYMSSQLAKPVRVLGLCTSLANARDLGEWIGA
FT                   SSHGTFNFSPGVRPVPLEIHFQGVDIINFEARMQAMARPVYGAIANHCRRSEPSIVFVP
FT                   TRKHAKLASLDLLAFAAAEGEPGRFLQVEEGDLEPYLAQISDESVRHALTFGVALIHEA
FT                   MSEKERKVVERVFAVGAASVLVATAPLAWGLTTPCKLVVIMGTQYYDAGGAGAADYPVT
FT                   DLLQMMGRASRPGIDDAGVCLLLCHAPRKEYYKKFLFEPFPVESHLDHFLHDPMVAEIV
FT                   TRTIETKQDAVDYITWSFYYRRLTQNPNYYNLTGVSHRHLSDALSELVETTLGDLEASK
FT                   CISIEDDMDCAPLNLGMISAYYYITYTTIELFAASLTAKTKLKGLLEIVAGATEFESFA
FT                   VRPGEADMLRRILNHAPITLSSNKTTDPHVKVAALLQAYFGRTSIHGDFTQDLQKILPD
FT                   ATRLLQAMVDVISSNGWLGPALAAMELSQMMVQGMWDKDPAVMQLPHIDQETGERCVTA
FT                   GIEGVYDLIDMEDDARRDILQLSDEQLEDVAEAANRYPSIEVAFDVTDPDDVTAGDAVE
FT                   IVVNLEREIEGEIGPVFAPRYPGRKEEAWWLVVGDVRKGTLHAIKRITLGKRQKVKLEF
FT                   AAPEQVGKADLTLYFMCDSYLGCDQEYEFTLDVKEGEDESDDDAMKP"
FT   gene            complement(256703..258134)
FT                   /locus_tag="OSTLU_26455"
FT   mRNA            complement(256703..258134)
FT                   /locus_tag="OSTLU_26455"
FT                   /product="predicted protein"
FT   CDS_pept        complement(256765..258111)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26455"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26455"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98752"
FT                   /db_xref="GOA:A4S4L7"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4L7"
FT                   /protein_id="ABO98752.1"
FT                   /translation="MSLAVAASAVAFGAALRHLGYVTERDGRSLCVIIFSSTLPAVMAR
FT                   TFATARMDASARCVALAGCAFGCACVLVSLTTTRAMRGANARSSGDALIEMSRRSREAL
FT                   VSGAAVGLNLGNFAYPLAEILYGAKALELIVVFDATNQVFLLIVAHAIYTWRCSKIDVD
FT                   GAGEAAKDGSTTKILESMRRSMVKQARNPCLLACFVTLCYRAVWGDGGFPPAIDGFLAF
FT                   LAGANKPAALLALGILFQPNMARDEARDMVCALARRYGASMLCASAVLYTMGGTLGSIG
FT                   SAVALMAMLSPLPLLTVTYAMEFALNVPFAATLVNYANLVSGAMIAVLAHVSFANPVAL
FT                   APNLAAFGAATLGFGALVRRADRSAGGATKRASGVIASCFDPRRSMRVGIDARRPAMRA
FT                   RGDRARTCGVSVVARAQSPSNRAARSRGVASATHIASVRLGALLRPVLV"
FT   gene            <258317..>260134
FT                   /locus_tag="OSTLU_93439"
FT   mRNA            <258317..>260134
FT                   /locus_tag="OSTLU_93439"
FT                   /product="predicted protein"
FT   CDS_pept        258317..260134
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93439"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93439"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98581"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4L8"
FT                   /protein_id="ABO98581.1"
FT                   /translation="MENAALRDARAVTHGAASASADVEIGDDGCAIAGGRARETRAGGR
FT                   GGWLTAGACAAACGLGVALAMAGSRNGDETGGRGVIAREDIDVRRFVAVPMLGSKRGRR
FT                   GTSSKRGDDDDDAPGLGIDGDDDVPPFAANTGYFAYEEWFKKFTHGKSPGESKRELAGA
FT                   AAATPIQESAHRGVVDSDGWKTIRDDLRHAGGKRKLLLLLRHGQATHNAWGDTVDEELE
FT                   TLPCTWRDHGDLLDPSLTDRGVEQALTTRASLTTRDGFFKAIRGGSDKKDRIRVASSPL
FT                   SRAMETAIIVTSGVDHISRPIAVTDYLRERIELNAPFEVRRPISIDEGEDSDASKLIKN
FT                   SHAHGCKFHKGLRELYGDDAFMLNVETHHKHHSDCRVDKTTPLSYTHCGGLTLTHEADL
FT                   ELGDEREENIIAMMNRVKVVLANVFDRYDEEVVMLVTHSDFIISALMELYPDTLGFVPQ
FT                   NGEVVPIVVEDRRTNHLPEAHATDDDASETASKAKTKSKAAVGEADHNRKHAKSEDEET
FT                   EDRTARGKKSMRAKASTGDEIVVDSDSSGPAATIKYFDDDDQTAKESATRHKSRKREAS
FT                   LGNDLSRRVEESLKNFHKQFERSADLGSE"
FT   gene            complement(<260179..>260793)
FT                   /locus_tag="OSTLU_88591"
FT   mRNA            complement(<260179..>260793)
FT                   /locus_tag="OSTLU_88591"
FT                   /product="predicted protein"
FT   CDS_pept        complement(260179..260793)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88591"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88591"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98753"
FT                   /db_xref="GOA:A4S4L9"
FT                   /db_xref="InterPro:IPR009269"
FT                   /db_xref="InterPro:IPR040466"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4L9"
FT                   /protein_id="ABO98753.1"
FT                   /translation="MPSPDPRGRADERSKRSKRDASTSSSSSRSRSRSRDAADGDQTHR
FT                   FKQFLKKRHERLESVRRAAERAEREALDAGEALIGPPPPPESFEVDRDAINHGKHLLAG
FT                   EGEAMGRFAAAGERIPRRGEIGLKTDQIERFENLGYVMSGSRHSRMNAVRMRKEAQVYS
FT                   AEEKAALAALSKEERAAKERRVLDDMRALVQAQLESRERHD"
FT   gene            complement(260881..263905)
FT                   /locus_tag="OSTLU_50798"
FT   mRNA            complement(join(260881..261853,263875..263905))
FT                   /locus_tag="OSTLU_50798"
FT                   /product="predicted protein"
FT   CDS_pept        complement(260901..261851)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_50798"
FT                   /product="predicted protein"
FT                   /note="GO_function: - protein kinase activity; ATP binding;
FT                   GO_process: - protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_50798"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98754"
FT                   /db_xref="GOA:A4S4M0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4M0"
FT                   /protein_id="ABO98754.1"
FT                   /translation="MELNTEWEIDYKDIEFEGGVPSSQNRIGHGGFGEVFLGRYHGSLV
FT                   AVKKLFNQDMMGKGLSDFRREVQILSRLRHPSIVLWLGACTQAPNLTIVLEYMDKGSLH
FT                   QFLHRTTTPYTTLTLTRWAMTIAQGMVYLHSAKPFPIVHCDLNTNNVLVNRDGMVKITD
FT                   FGLSKVKHSSRLSRQTGMTGTVNYASPEVIRGGKFSEASDVFAYGVILWELLTRRIPWE
FT                   DLNEYQIVFQMTSDLDASLAATAKNLELPASAPEGYRKIIHGAWATQPERRSAFKDVLG
FT                   DLREVYREQVDIEKALRAARKGSTSSLSATSAPDK"
FT   gene            <264298..>264941
FT                   /locus_tag="OSTLU_17308"
FT   mRNA            <264298..>264941
FT                   /locus_tag="OSTLU_17308"
FT                   /product="predicted protein"
FT   CDS_pept        264298..>264941
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17308"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17308"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98582"
FT                   /db_xref="GOA:A4S4M1"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4M1"
FT                   /protein_id="ABO98582.1"
FT                   /translation="MFLADAVEAKDLPGLAERMRERLRTMKENYHDITSYEGLRQRKKG
FT                   ALKAAKKMDLLRAAFNVDEAPKDACPMPTHKSDKPLKRKREYRILGTKMLCAGVCFLVL
FT                   LMIPFLVTQYEEHEHHTGCDSISQGMIKLDHASSGQLEVNLLVGPCTYNASDFHMSYNI
FT                   YQSYNHHTYQLGALGKPLTTPHWSAASSGHRRKLLGGGGAGVSKHVKASFET"
FT   gene            <265066..>266409
FT                   /locus_tag="OSTLU_13038"
FT   mRNA            <265066..>266409
FT                   /locus_tag="OSTLU_13038"
FT                   /product="ArsB family transporter: P-protein-like protein
FT                   (tyrosine transporter)"
FT   CDS_pept        265066..266409
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_13038"
FT                   /product="ArsB family transporter: P-protein-like protein
FT                   (tyrosine transporter)"
FT                   /note="GO_component: - integral to membrane; GO_function: -
FT                   arsenite transporter activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_13038"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98583"
FT                   /db_xref="GOA:A4S4M2"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4M2"
FT                   /protein_id="ABO98583.1"
FT                   /translation="MWLGLVLLISIFGLIITEIIHRTLVAFIGAAAVLFILSLQHRLPS
FT                   IATILTWMDHGTLALLFGMMIIVALLSRTGVFEYISVHIVEYSKGSMWRLFFMLMIFDA
FT                   VLSAFLDNVTTMLLLAPVALSLCKALNIDPRPLLIPLSIFGNIGGCSTLIGDPPNIIIG
FT                   NALKEHIGFVDFLRVLGPGVLLTMPFIFAFVKWYYGDALFGQKINVDIDELRAKYPIRD
FT                   MNLLIRSGTILIFVILLFFLHPVMHMEPAYVAVFGAIAILLTGSHDEFEYALEKVEWDS
FT                   LLFFAGLFVFTEGIAKLGLLRAIADELSTLIASFPIGQRQIGAMLLVELVAGIASAFVD
FT                   NIPFTTTMLPVIIQMSENVQGISIEALAWALCFGADFGGIGTLIGSSANIVMAGIAAEA
FT                   GFPITFKSFFRIGWPVMCISLCIAGAYLAALEGAGTFKVKDDDSASYS"
FT   gene            <266624..>267850
FT                   /locus_tag="OSTLU_93440"
FT   mRNA            <266624..>267850
FT                   /locus_tag="OSTLU_93440"
FT                   /product="predicted protein"
FT   CDS_pept        266624..267850
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93440"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93440"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98584"
FT                   /db_xref="GOA:A4S4M3"
FT                   /db_xref="InterPro:IPR019007"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4M3"
FT                   /protein_id="ABO98584.1"
FT                   /translation="MDKYRKQQRKREIEKNKERRKEARAVAAQTKDLSELQAERERLEK
FT                   AKNAPQIPGQRLRVDKIDEKLTWLSKQIDAKRASDARDREAGLTPRSAKPRGPTSTAYA
FT                   VGAEQYYKPEDSVYWHPKLNPTGRPPAGKPQKWKAGIVVDECASASRQALPAATAASDS
FT                   DSDSDSDSDAMPPPPGPPPGFELVIPALPVKDDAIAAAKTDTNDEDEPLLPPSAPPDHE
FT                   DEPLPPPPVPAGDEDGSDSEALPPPPMPPTGTSGGNEVEVAPPRVTETTTVVRRAPVGS
FT                   MPRVVPVQRRPPPPPKHGVGGFFAAAPRAVRKPPSDPATFTKSAAPTATPIVRAEHNVK
FT                   LKALVPASVRVNRQEAPNAKRQRVVTGRAINAAPKVAASSSAGGSGKAADETYLSFLDE
FT                   MSELGAFAE"
FT   gene            complement(268493..>269634)
FT                   /locus_tag="OSTLU_50937"
FT   mRNA            complement(268493..>269634)
FT                   /locus_tag="OSTLU_50937"
FT                   /product="predicted protein"
FT   CDS_pept        complement(268867..269634)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_50937"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_50937"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98755"
FT                   /db_xref="GOA:A4S4M4"
FT                   /db_xref="InterPro:IPR007051"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4M4"
FT                   /protein_id="ABO98755.1"
FT                   /translation="MSTPTPRSFEDDLTALPPCTRADGTYACQRLGCDAYYAPGPGNVP
FT                   GSCVHHTKRPCFRDGVKSWPCCGKSSHDFGEFMSIKGCASGTHTCAKITYEDDEAAAVV
FT                   ERLPAAPAMPLSMEARARGEGDASACVRCKSGFYCAEHANSASPATTSTTEARETTPDV
FT                   AQKVKPEVDLDTEQTCKNPGCGRKFRERDNADDACEHHSGAPIFHETKKGWSCCGKLVY
FT                   DFDDFLKLAPCARGRHDADAKPIQFQSSSAKKT"
FT   gene            complement(<269829..>270482)
FT                   /locus_tag="OSTLU_17312"
FT   mRNA            complement(<269829..>270482)
FT                   /locus_tag="OSTLU_17312"
FT                   /product="predicted protein"
FT   CDS_pept        complement(269829..270482)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17312"
FT                   /product="predicted protein"
FT                   /note="GO_function: - magnesium ion binding;
FT                   phosphopantetheinyltransferase activity; GO_process: -
FT                   fatty acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17312"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98756"
FT                   /db_xref="GOA:A4S4M5"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4M5"
FT                   /protein_id="ABO98756.1"
FT                   /translation="MRYDEDARDARDVTFAYGARGKPSVRGPATLAARCGFSVSHCDGL
FT                   TAVAVTTNGDACGIDVEDENRRIGTDVGKFARRWLSDDETRRLSDIVADDERARAFMRL
FT                   WTAKESYVKALGLGIAGRPFREFDIAWDVAEDAAKTWSMDLRDVTDDGTVPWRFALLKP
FT                   RASQSHVMSLCAPAGADGRMPRVRVRWASPFEPLVDVDAADADVLALGGSRATI"
FT   gene            <270999..>275084
FT                   /gene="SDG3527"
FT                   /locus_tag="OSTLU_88595"
FT   mRNA            <270999..>275084
FT                   /gene="SDG3527"
FT                   /locus_tag="OSTLU_88595"
FT                   /product="predicted protein"
FT   CDS_pept        270999..275084
FT                   /codon_start=1
FT                   /gene="SDG3527"
FT                   /locus_tag="OSTLU_88595"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88595"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98585"
FT                   /db_xref="GOA:A4S4M6"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011124"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4M6"
FT                   /protein_id="ABO98585.1"
FT                   /translation="MPAPGAEGTERACGASGRALRDRATLKHTSRQQEIILQSIRATEQ
FT                   TIGAIKRASLSEEIERRRETALGIVRDIDAAWKAMPAVPERGAGAARECFLQCDAAGCG
FT                   KWRRAPRAMGDALAGDAKFYCKDGRDGRFNRCEMAQEVGDDEVDSILDESVAADAEARE
FT                   RCKRDISNERGRMYQKRKRLLELERRHDIGEIELQEDGTYVTLAKRGKNGKNGKRHGNN
FT                   GVGGLGSKAPPHPGPFDEFAWVQCEAEGCGKWRKVKHAAVEGMSVRDRWVCCMNEDKEH
FT                   STCKTPQEMSDEDVDKFKVDQERRMILHQKQLQEHYAHFAPRGAKLPEGLIRVTVPVQD
FT                   TTPPEAEPPAAVPVAAPAPGTAETTRISIDDGPEDSPMWVPGIPRPMAPLVTPNTIPVQ
FT                   VAVSCNGHAGVYLPRRNLFRCHCEQPEHMCASVSGDGDGRLFGGSVWEAHCGKASTRKY
FT                   KASVKVHMNGPNPQMFIGRWFDRVGLKVADAKGGGGGGKPKKPKVKSFIMELEEAILPG
FT                   PINQLSLRNLMTIFGFILDGSAVGEVKVKTEGEEKEKPKALTANERREEGAKELGRFAS
FT                   VCKAWKQASLTVLKTAGVAKAEKKNFDGTALRTQFTVITEYVDRKDEKECQIERSVTLA
FT                   ANHPFDKKSKMKTAHVDDGTPPGWWPSLGVKAERKKLVTEVIEQETYGVDFVTGRDATE
FT                   TLKRVLPDYSEDDVWGLYKQLLAQVNESYGAMTPDTLATQNLAVAAEDLAVKLERKADA
FT                   KSLAFSKALWKLAAAAIETPEYYYVHRKGFGVVCNQPIKKGEFLIDFLGEIYPPWAWAE
FT                   KQDAIRQVQKARGLRDRGPPEFYNMQIERPGGDAEGYSVLFCDAMHENNYAGRLSHTCD
FT                   PNVEVNLKAINGKYEIHFITTRDIAPGEELAYNYHSCTDNMKEVEMAFCLCGARMCRGS
FT                   YLNFVGEDHHSQVLESKHKLIDRQVMSFKAIDKAADPLTSKQERSLAAVGFYPGKGLLR
FT                   NCPGWLLQFVGDVAVYMDTELNELPKHILAAAKKEHAKLLEKNPQAEFSYTEKFAKIDA
FT                   LAMRENRTQCVAIMLSKLRRLLTRARDDGPQKSVYECMDVFEKSAPPYVTLTEAEIAAH
FT                   FWGSGPENFEKSIVCGLIRAMGPHERKNDADKFIKWTSMVESVAVEVRKGKMTRKESLL
FT                   WLRDELKKLKQTDGARHDLAAGLIHLYAETNRFWQPSSAPEHQVYKSDKVAVREDEVNA
FT                   WGVGAGGGGDKIVARVEKTYRPGFSAATMLQWHKQEMADPTQYITANRRGNLSMPDIAC
FT                   CYSSRPGQPLARSSDREHETWLAHLQSWPEEPWPQSSGPWGVANSQKLIGSPVLDAWMK
FT                   GQRSIPAKCLAWLKTNTG"
FT   gene            complement(<275169..>276338)
FT                   /locus_tag="OSTLU_93442"
FT   mRNA            complement(<275169..>276338)
FT                   /locus_tag="OSTLU_93442"
FT                   /product="predicted protein"
FT   CDS_pept        complement(275169..276338)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93442"
FT                   /product="predicted protein"
FT                   /note="GO_component: - intracellular; GO_function: -
FT                   nucleic acid binding; 3'-5' exonuclease activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93442"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98757"
FT                   /db_xref="GOA:A4S4M7"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4M7"
FT                   /protein_id="ABO98757.1"
FT                   /translation="MDDLTYDGEIVVASTARELEEAMARIEAFDARAGTTATTKHCGFD
FT                   MEWKVSFKRGAGESKTSLVQIAVANEDLSEKLVVLARIHTAGLTRRFKRWTRDGARGKT
FT                   GFNVRGDARKLVRDYGLEPSRVIELSVLAKERFEGGCPSAPSWSLARLCEHVLGKTLPK
FT                   DKTRMSNWEREELNESQIKYAAMDAWASLLVYRALMKRDVVESFGGEPYECDPLPEPVE
FT                   SSDEEVEDEDEDEDEDEDEANAFVDDEEDDEEPTDVVFDDAVDKGELSAQSARAGEIEL
FT                   TDTEREVYAKHIAGASLDDIATTTDTDRIVVFSTLLSAMRKGCAFYFKLLCIPEHLTLF
FT                   FDDHVMLNGALPKANDFVEYAKIDDERSCKLMLIALTVKLAREREQQQC"
FT   gene            <276942..>278549
FT                   /locus_tag="OSTLU_26466"
FT   mRNA            <276942..>278549
FT                   /locus_tag="OSTLU_26466"
FT                   /product="predicted protein"
FT   CDS_pept        276942..278549
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26466"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26466"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98586"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4M8"
FT                   /protein_id="ABO98586.1"
FT                   /translation="MRDVDADVLPLLLRLRSAGASAEGLRRGAAGVRAWRDALARGLLP
FT                   DASLEWPEDETFRTALIEALGDLDMARFTRRFPPVLDTLMKNVLDILYVYERDREDEDA
FT                   TPELPPTEPRDSETANDGEGEGDARGSGAGESDEEEGEGEARSQAGGRGGAGEETDGSD
FT                   NVDEFDVGMDGDDGANEAMERAKEKNKEIVSRLMEEFKEQWEPAMDKLDKAAKAFEGLD
FT                   LDDLADGPEGFDLTRGLWQQTGWKELDSLRKKLQDLKELRDMVRSLGRGSGRGPLRRAP
FT                   RQRERQGFPIGLVRSPMEPEQTSGLCRSDDLSRMMPSEMVLLASSLPQARLLHFARRAE
FT                   RTLLSYERVGWSEEPAVTVEGFETRPAAECGPIIVCLDTSGSMMGARETVAKAMVLECM
FT                   RQSRSQQRACYLYSFSGPGDCQELELKLNAAGLYGLLEFLSGSFHGGTDVDEPFNRALA
FT                   RLNEAEWSNADILLVTDGEIKPPDETLIANLNEAKEEMGLKVHGLLVGDAGNAEVVESI
FT                   CTHVHAFKSWTAVGGKPS"
FT   gene            <278786..>280147
FT                   /locus_tag="OSTLU_3307"
FT   mRNA            join(<278786..278866,278963..279547,279695..>280147)
FT                   /locus_tag="OSTLU_3307"
FT                   /product="predicted protein"
FT   CDS_pept        join(<278786..278866,278963..279547,279695..>280147)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_3307"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_3307"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98587"
FT                   /db_xref="GOA:A4S4M9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR042238"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4M9"
FT                   /protein_id="ABO98587.1"
FT                   /translation="VDLDACERRYLLVGGIDGSVRAYDTEAANRAGASGTASGTASGAA
FT                   ATSEEIGHTYATSCVRWLPSDTGMFFSGSYDKTVKCWDANSLRSACDVELPTKCRTLAL
FT                   SDAATTHSLVAIGSDDNVVRLWDPASNAIAHTLSGHRGSVHAIEWLRSNEHALATGGAE
FT                   GDVRLWDIRSAGAYMILDRHNTQPSARVDAIKDAMYAGASTSGTIEAGPKPASRKMADS
FT                   SARGRDERDDASRSRLFPAGDGYSSIPAPAHDGQVSGLRTTPCGMFIVSTGADGRIRRW
FT                   DLSNGLNTYTPYDSAGAAPTASACQIAITADGERLYVPCTDTRVRVYRTHTGTLDAELK
FT                   GHLDDVVACAYKDGGDAKLFTCGKDANVLVWAP"
FT   gene            <280505..>281098
FT                   /locus_tag="OSTLU_26468"
FT   mRNA            <280505..>281098
FT                   /locus_tag="OSTLU_26468"
FT                   /product="predicted protein"
FT   CDS_pept        280505..281098
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26468"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26468"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98588"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4N0"
FT                   /protein_id="ABO98588.1"
FT                   /translation="MPSKRASANGRVDRAATDRSRASTPRGVKTLKVRLARATKFRDEN
FT                   RIPVRDRLGDGAKTTKSAAKDLRRTIERATTTGDARTRAKGDVGPGDLRRRLPRRDDGA
FT                   AANAKAKATRTSGDLRNALSGKSGRKGVANAKGRGDARVNALLRRLNLSSYEAAFAREE
FT                   IDLIALRAMRDGDFDKLGLPYGVKVKLALALGRR"
FT   gene            <281261..>282031
FT                   /locus_tag="OSTLU_26469"
FT   mRNA            <281261..>282031
FT                   /locus_tag="OSTLU_26469"
FT                   /product="predicted protein"
FT   CDS_pept        281261..282031
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26469"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26469"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98589"
FT                   /db_xref="GOA:A4S4N1"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR040183"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4N1"
FT                   /protein_id="ABO98589.1"
FT                   /translation="MSVEHSRTVRLSEDLSYVQPTAPLPSWLKGFFVTAVSKGQDSVVQ
FT                   AAIEASNILNDYWFKVAYDAHRIDGEKPYERAEAMWIPGCDACAFVALRPDDNDANVYM
FT                   CAKAIVEECRKGADWKQPTHVARIVAVEKSSSELELDALARDVLSKHFPERGGDSEPVT
FT                   FGIHYEEHSPMRHFSSTDVNRFVGSHVPDEGYKVDLKNPRFTICVVNAGGSMMMSVVEA
FT                   YDALGHFNVHRAAFEDKLSDTVPARGDDSAQPAA"
FT   gene            <282429..>283844
FT                   /locus_tag="OSTLU_43938"
FT   mRNA            <282429..>283844
FT                   /locus_tag="OSTLU_43938"
FT                   /product="predicted protein"
FT   CDS_pept        282429..283844
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_43938"
FT                   /product="predicted protein"
FT                   /note="GO_process: - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_43938"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98590"
FT                   /db_xref="GOA:A4S4N2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4N2"
FT                   /protein_id="ABO98590.1"
FT                   /translation="MTVVIFIFLLDQLSHGPLKGRKSPPVIDVAPVWGGMLAFLAGPMK
FT                   LMREATPKYGEVFTVPVFHKRITFLIGPKVSEFFFKAKDTEMSQKEVYEFNVPTFGKGV
FT                   VFDVDHTTRAEQFRFFADSLKSNRLRMYVGMMVKEAEDFFSKWGDAGEVDLLEQLSELI
FT                   VLTASRCLLGREIRETLYSEVTDLVHDLDKGMVPLSVFFPYAPIEAHRKRDAARKNLAK
FT                   IFDKVIQARRESGASEPDVLQTFIDARYKDGSRLTNDQVLGMLIAVLFAGQHTSSITST
FT                   WTGLLAIANKERVMPALEKEQKDIMKKHGKDLDFDILAKMDELHFAVKEALRMHPPLIM
FT                   LLRMAQVPFEVETSTGKKYTVPKGHIVATSPAFSHRLDNVYSDPNEYKPERFREPNPED
FT                   KAQFASFIGFGGGRHGCMGETFAYMQIKTIWSILLRNFEFEMVGKVPEPDYTGMVVGPT
FT                   AGQCKIRYKRRVL"
FT   gene            <284584..>284997
FT                   /gene="MRPS9"
FT                   /locus_tag="OSTLU_44376"
FT   mRNA            <284584..>284997
FT                   /gene="MRPS9"
FT                   /locus_tag="OSTLU_44376"
FT                   /product="Putative mitochondrial ribosomal protein S9"
FT   CDS_pept        284584..284997
FT                   /codon_start=1
FT                   /gene="MRPS9"
FT                   /locus_tag="OSTLU_44376"
FT                   /product="Putative mitochondrial ribosomal protein S9"
FT                   /note="Putative mitochondrial ribosomal protein S9,
FT                   imported to mitochondria; GO_component: - mitochondrial
FT                   ribosome"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44376"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98591"
FT                   /db_xref="GOA:A4S4N3"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4N3"
FT                   /protein_id="ABO98591.1"
FT                   /translation="MVRVPIRDVAGRSYGTGKRKTAVARVWLAPGSGEHKVNGKPYDEY
FT                   FSSPAARADMIAPFFVSDTLGLFTAVVDVRGGGISGQAQAVRHGVSVALQNYDPAFRPA
FT                   LKAAGYLKRDPRIVERKKPGKAKARKSFAWVKR"
FT   gene            <285380..>285562
FT                   /locus_tag="OSTLU_26472"
FT   mRNA            <285380..>285562
FT                   /locus_tag="OSTLU_26472"
FT                   /product="predicted protein"
FT   CDS_pept        285380..285562
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26472"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26472"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98592"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4N4"
FT                   /protein_id="ABO98592.1"
FT                   /translation="MKQREAFRRSNAKTHKENERRNAIERQEKRLARWRAGVAMKREYE
FT                   MKYGGGLGETTARGE"
FT   gene            complement(<285706..>287118)
FT                   /locus_tag="OSTLU_17319"
FT   mRNA            complement(join(<285706..286440,286486..>287118))
FT                   /locus_tag="OSTLU_17319"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(285706..286440,286486..287118))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17319"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17319"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98758"
FT                   /db_xref="GOA:A4S4N5"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4N5"
FT                   /protein_id="ABO98758.1"
FT                   /translation="MTGTAVNPLLRAAYLARRGIHDVTLVIPFLAPNEQKLVHPGMIFN
FT                   TPEEQGEYVNKWVEERCGFKPQMKLSFYPGRYATDKYSIIPVGDLTSYIPGDRESDIAV
FT                   LEEPEHLNWYHSGERWTDKFKHVVGIVHTNYLDYVRLEENGEIKEKALKFVNNVVSSVH
FT                   CHKVIKLSDAVQEFPKSTTMNVHGVSPIFLDVGAKKAIEATKEKDVEMKRSKKPVFTKG
FT                   AYFLGKVVWGKGYKELLDRVSEHNVSEDGRECPLELDVFGNGDDFAEVKSNAEKMKLPL
FT                   HFHGRKDHAASDIHDYKVFVNPSLSDVVATTTAEALAMGKFVVCAKHPSNEFFSTFPNC
FT                   LVYNTPQEFTKCVKQALTSEPAPLSAQDSYRLSWEAATDRFLDAAELSPRDVNPSLGDK
FT                   AKETFAHAMHTTMNKIEPIRRATGAGNNTLKAPEKLDASWVPEPWDSSARDSNRKS"
FT   gene            complement(287210..288655)
FT                   /locus_tag="OSTLU_25231"
FT   mRNA            complement(287210..288655)
FT                   /locus_tag="OSTLU_25231"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<287212..288411)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25231"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25231"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98759"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4N6"
FT                   /protein_id="ABO98759.1"
FT                   /translation="MRDAGRGRDGDDASRRDKARAAATTTTTTTRETDVERRSGAVKGE
FT                   RTDAGLGRERARATSQGAAGQDGVFNVDALRAAVDRHHRHFSSEVERAWRESNFSFGFG
FT                   RGSAGGEFARESGDEGDDARAHRAGRKKTLSISAFREMARRASQDSLAKLDDAKFMERF
FT                   EKLRRPRRSAGGDGRRTSESKRDERKSRPTSTQDLQALIAKNIPKAPAIPKWGEEWDVF
FT                   KAIGTNFNQDDGALAKTPQRPNRTLNRRRAQSETVVDRSPGTSPRKSPKEAPETARSPR
FT                   EMSRSSSTDALTAMGDGDADHGARALSETSSPREGGANVLESLKKEITKKKDELASRLP
FT                   RPPSLPKLTTDLQNAVRRFAGQPEEIVVKSPYDASLSSPGVVLKRAESKELAAELEASE
FT                   A"
FT   gene            <288850..>291702
FT                   /locus_tag="OSTLU_26474"
FT   mRNA            <288850..>291702
FT                   /locus_tag="OSTLU_26474"
FT                   /product="predicted protein"
FT   CDS_pept        288850..291702
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26474"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26474"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR039874"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4N7"
FT                   /protein_id="ABO98593.1"
FT                   /translation="MRGNRCAATARATDDLGARTAAAVCDDDPFAFGARARALFEDIDG
FT                   ETLAEDDDDDDDDARRGDARRIGRGVSVFEKVRREKAGTTMTATTATTATATATAEEEE
FT                   EDAFDEPRAKAKANAKKPAKAKAGRERAREKTARDGGDDDVMVVDDDVGECARPAEDLF
FT                   DEVAATGDKRAKREVKTLARPKKRVVEAPAAVVETHAVMPAPSARAKASTTGRIRASTS
FT                   AAASAPPPAKKKKVSLKEFAGEEDGDEGGFDDGEGDDDHGLVPQSGAQLADIDEANYAV
FT                   SGLSTVRDVKEKMRCVGVLANLMGNQRTRRLLASYGIPMKIIKAAQDAAMAPHAPNALK
FT                   FGAAALLYLAASDLRAPATDAMRSVKSANAIRALLRPASSSDDALYLKTANTVRSALKA
FT                   LKFLPNEAKDAPTLALLVAHQTLKGEQDAVLASGSGPGAGDVENSFRTILANQGAVLAT
FT                   CELVAQATTTLSKFGGACFVASASASTNDSVDDESTIEEYEQSAARVIARLFRASRVLE
FT                   CVSFESPAACAVISTSALGGSKRDDTNADVRPLDLLAVSTTRLAPEDGLNSSRGDGRGV
FT                   ESATTTAAIDIPSPSPVKSRIPGGITMTPPSTPGAVRVAGTSYDDNDGLTPLSSPVPIG
FT                   LMQTAATRDNAAAIQWLADNVRTPVKGGSHNARTACRALVEALPTLAAATTASVVGAKK
FT                   GDVVQGIEIRYNAAIAVDHRVAVGALKSALCTLTNVTNENKEGCDAVVGEDSRGLLVIA
FT                   SLIPWLALSIEGFTLRDAKERKRTRTPTDDSGSSLLNAALVLLVNIVEADATTADVLRN
FT                   AMVRLPGDSSRGASFVEALTMLYLQSGGADEDEDEGEKETAEEAQHLTADMIKSYSSKT
FT                   NGDDLILQAYCGLLLAFLIEDDAALRAEVTSTFPEKPQGTSRLKPLADTLERFHAFHES
FT                   LNSISAASSERLVKVVTWLR"
FT   gene            complement(<292222..>292722)
FT                   /locus_tag="OSTLU_93445"
FT   mRNA            complement(<292222..>292722)
FT                   /locus_tag="OSTLU_93445"
FT                   /product="predicted protein"
FT   CDS_pept        complement(292222..292722)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93445"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93445"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98760"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4N8"
FT                   /protein_id="ABO98760.1"
FT                   /translation="MAMDIMDTPEPMATPVPTSPVRARMDSETYTDCVPGILLLCVRSL
FT                   HQARRSIASVVRSLAPAFAPAFAPIFISPSNPRRVRSTRARLVDRFARVLARAFDVDEN
FT                   VSPNPRARDRDEDSRRVAPRRVAHPPRDATDPSRESRGVARCRPSRARARIPHLNCDET
FT                   MKR"
FT   gene            complement(<293084..>293827)
FT                   /locus_tag="OSTLU_5039"
FT   mRNA            complement(<293084..>293827)
FT                   /locus_tag="OSTLU_5039"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<293084..>293827)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_5039"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_5039"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98761"
FT                   /db_xref="GOA:A4S4N9"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR016722"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4N9"
FT                   /protein_id="ABO98761.1"
FT                   /translation="VIVASGPFSCSSDLKYEPLNDMLDYVREENPDALVLCGPLVDAEN
FT                   AFVKRAECGGLTYDEVAKVVVDKIEDKLFKDETIRTKVIFVPSIRDVTLDPVFPQPAAS
FT                   LDAYVSADAARAKRAFSASNPGTFTINGIVFSACSHDVLKHLSAQEISKGFVPKDRLAR
FT                   LAKHVLTQGCAYPLYPPDASACLDARYGEDLTFKQTPDVLIMPSDLKTFAEDIDGVVCV
FT                   NPGRLARGAVGGGLAKIVVHPTTDGQ"
FT   gene            complement(<295150..>296322)
FT                   /locus_tag="OSTLU_4114"
FT   mRNA            complement(<295150..>296322)
FT                   /locus_tag="OSTLU_4114"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<295150..>296322)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_4114"
FT                   /product="predicted protein"
FT                   /note="GO_function: - UDP-galactopyranose mutase activity;
FT                   GO_process: - lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_4114"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98762"
FT                   /db_xref="GOA:A4S4P0"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4P0"
FT                   /protein_id="ABO98762.1"
FT                   /translation="RDREFDLVVVGAGISGCVFASRASRELGMKTLLVDKRDHVGGNCY
FT                   DFVNAKGFRVSQYGVHLFHTKHARVWEYVNRFSEWTPYEHRVKAAIEREDGEYEHGGRR
FT                   YRIVGVPPNRDTINALFPEADLKTDEDARRWLDARRSVNENPKNGEESALTRAGAELYE
FT                   AIFKHYTKKQWDKYPEELDASVLARIPVREDVDDRYFSDPHQALPKHGYTRIFENMIMG
FT                   DPNITVRLNTDFFEHKDMLRSKARKFVVFTGPIDAWYASQGLPKLEYRSLRFFEEYHEG
FT                   EDKTKPFFYQPCLQLNYPGPEVEHTRVVEYKHKPNQPREAREHAGTVVFKEYSCDHGEP
FT                   YYPVPNPANRELYEKYRDMAAKEPGVVFVGRLASYKYFNMDQAFLNALETF"
FT   gene            298352..300117
FT                   /locus_tag="OSTLU_26478"
FT   mRNA            298352..300117
FT                   /locus_tag="OSTLU_26478"
FT                   /product="predicted protein"
FT   CDS_pept        298360..299376
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26478"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26478"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98594"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4P1"
FT                   /protein_id="ABO98594.1"
FT                   /translation="MTDSVAHASPTWRTYSLDPSLQPDWMNGTAEVEAVKTAEDELERS
FT                   YKNKPFFKNTSYEAFARKRGEYDKPTPDGLEEFKRLLRASYLRTVERIDEDTQVLEAQL
FT                   QDENISETRRSVIPQHIEDTRAKLKEQDNSLNALCADVDAVIADLKGLPDKIADIKEHA
FT                   SEQLQQHKRKRTSISLERNLEELSDALRSYEAKKEQERLTITDYRGKYGSCPSQYVRQT
FT                   AWARRPSGREEISFIVHPVGVIGCDGSNLSVDGRVSIDGYGEFNVPKWQPEWGPEKQMC
FT                   ACECFQEWYKVDAQDLLYSALRGVEGALKALSGSGDDTSSLRRRLGDANLDEASTGS"
FT   gene            <300818..>302086
FT                   /locus_tag="OSTLU_2491"
FT   mRNA            <300818..>302086
FT                   /locus_tag="OSTLU_2491"
FT                   /product="predicted protein"
FT   CDS_pept        <300818..>302086
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_2491"
FT                   /product="predicted protein"
FT                   /note="GO_function: - cysteine-type endopeptidase activity;
FT                   ubiquitin thiolesterase activity; GO_process: -
FT                   ubiquitin-dependent protein catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_2491"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98595"
FT                   /db_xref="GOA:A4S4P2"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR033809"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4P2"
FT                   /protein_id="ABO98595.1"
FT                   /translation="CPYLDTVNLANLDFDFEKRCAVSLSPVHVYACLVCGKYFAGRGKK
FT                   THAYAHALECGHHVFMRLADGAAWCLPDGYEVVDEGTTLSRIRDVLAPTYAKKYVEEEI
FT                   EGARPMWRRALDGTEFLVGVVGLNAIWSKRDDGVSAVLQSLNRVAPLRRALLLDDARER
FT                   EDVYRALADITKKIWNARNFKGHSSPHEFMQAVRNRSKDAFGAETGNHDAAQFLRWLLN
FT                   ELIRDEKKRGEKRSVIQSCFQGEVEIIDDSSASRASPFLMLSMDLPNAPLFQDVMEKNI
FT                   IPQVSLERALLKKFDGVTADPKTRRRFKITKLPNYLIVNYSRFTKNNFFVEKNPTIVTF
FT                   PTRGLNLADHIPVPRGDENSATYDLIANIVHDGAPDDGSYRAMVYHAPDKNWYETQDLR
FT                   VAEVLPQQVNLTETYVQIYERRDK"
FT   gene            complement(<302203..>302733)
FT                   /locus_tag="OSTLU_26480"
FT   mRNA            complement(<302203..>302733)
FT                   /locus_tag="OSTLU_26480"
FT                   /product="predicted protein"
FT   CDS_pept        complement(302203..302733)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26480"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26480"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98763"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4P3"
FT                   /protein_id="ABO98763.1"
FT                   /translation="MTPTLRGGARDAPGPSSARGGSGTEYVLARRLAHPFRSAAIGDVV
FT                   AFAHPSDATRTLIRRVSATEGDELVDAANASVYVVPKDHAWVTADADAETDSAKSAGRH
FT                   EDSRSFGPVDAWALEWRVMYSMRSAVDHATVENSAAARAADAPVLEAELANAMEALGWD
FT                   GEGEGEGEGGEGD"
FT   gene            complement(<303116..>304390)
FT                   /locus_tag="OSTLU_93448"
FT   mRNA            complement(<303116..>304390)
FT                   /locus_tag="OSTLU_93448"
FT                   /product="predicted protein"
FT   CDS_pept        complement(303116..304390)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93448"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93448"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98764"
FT                   /db_xref="GOA:A4S4P4"
FT                   /db_xref="InterPro:IPR001503"
FT                   /db_xref="InterPro:IPR038577"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4P4"
FT                   /protein_id="ABO98764.1"
FT                   /translation="MPADAWDSTYVKGFGRLFTPGACVEKVVIGCDGDKRADVRVFSQS
FT                   GYLWRGKNKGKDGSYAKPAKIDPGQVDVYMAHEAVATFGKDLQNPKVVREFDYVGYFDQ
FT                   KRSAIWWPFGPSLDSMAEDFPAYTIPHSERIPAVAWIAIDCLPPRPGIVVGLAEHFPTF
FT                   SMGNCFNNYHLPRNLPGRGVENLEYQSKMARYMFYFAVENAPMCQGYMTEKVWMALARG
FT                   SIPIYTGHDSFTELMPTKKSYIDLRDYDSFEALAAELEAIASDESRYNEYTSWRYDHPS
FT                   TWSPGFRKLLRVQSTDIKVGLCAVLAKGPTVFPKADKMGGCSSDADLLGVKHGDFGAYI
FT                   EAARFRSKHHETGVPRSPLDFLQRVSCKDEQEKEFMGDCFVRRDAPVPPEIPLLLAARD
FT                   RAQWNRREKRIEDRAIDATADETAN"
FT   gene            <305050..306451
FT                   /locus_tag="OSTLU_26482"
FT   mRNA            <305050..306451
FT                   /locus_tag="OSTLU_26482"
FT                   /product="predicted protein"
FT   CDS_pept        305050..306441
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26482"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26482"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98596"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4P5"
FT                   /protein_id="ABO98596.1"
FT                   /translation="MRARARGALERAEPSARVSRAARRRFPRPRAPSRATSRANDRFRD
FT                   ARDDDDDDDARARQFLRLARDARDGSWALQSATVTLRPRDASARATRALRVCALVHYGE
FT                   ARYYRGVAKDFETRENDATLVELITSRKHLEASDERGLKLWRLSEALAPTAEARALANA
FT                   HGLRAQLDALDARARGWYVADVTREELIALRREAGEMTAKTAEETTRNAKRSAVSMGGN
FT                   LPPALEALAVTAFGRASEGDPARLFARLSCWFVPCPEAHLLLLDWVWAGGRPSEVLGAM
FT                   VDCCASGDLESARRLAFAQMIVSAQAEGPAGGGSTEPVLVARRNDVAMDGVNKAFKAPE
FT                   IDTVNLLYGGLHVPGLVRCARERLDMEVVDVAWRDAWRVQPPENASPLRYAIVPLILGI
FT                   DGTDWAQTLHDAVALGASAGILSTFLYIVRHGALYYALGKWLLEWNRQLFDADVGPSPE
FT                   NVKYR"
FT   gene            complement(<307167..>308390)
FT                   /locus_tag="OSTLU_3043"
FT   mRNA            complement(<307167..>308390)
FT                   /locus_tag="OSTLU_3043"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<307167..>308390)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_3043"
FT                   /product="predicted protein"
FT                   /note="GO_function: - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_3043"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98765"
FT                   /db_xref="GOA:A4S4P6"
FT                   /db_xref="InterPro:IPR000407"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4P6"
FT                   /protein_id="ABO98765.1"
FT                   /translation="TRYAVVIDAGSTGTRVHVFTFSRSAFASGGEALRDETFRSIEPGL
FT                   KSYGGDAEAAATSIEALIDVAKGVVPESARRETPFSVRATAGLRLMPEGREAADAIVEA
FT                   VRRKIANAGFHPSSASFVSIMDGEDEGAHAWVSVNYLLGNLGGAPEKTVTVVDLGGGST
FT                   QIAYAVGGGAAKDAPKGYVRDIEAASTTYRTYVHSFKGYGIVAVRPKIFSVGKNKDGSH
FT                   PCLPNAFADSCEKDCYGLEPGETYAAIGSSDGSDFTRCLLATTQALEGNCAKAPCSFAG
FT                   AWTTPRKTPLFVMSFIVERAIQGGAVPPPRRPTDIATMTPRDVKRAALRACSTPAAELE
FT                   ARFPVAARDAVDVNYLCLDLVYVYALLTVGHGAADDETIRALDKIRYRRRDVEASWALG
FT                   DGIAAAAAA"
FT   gene            complement(308683..>310166)
FT                   /locus_tag="OSTLU_50811"
FT   mRNA            complement(join(308683..309354,309442..309957,
FT                   309997..>310166))
FT                   /locus_tag="OSTLU_50811"
FT                   /product="POT family transporter:
FT                   dipeptide/tripeptide:proton"
FT   CDS_pept        complement(join(308691..309354,309442..309957,
FT                   309997..310166))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_50811"
FT                   /product="POT family transporter:
FT                   dipeptide/tripeptide:proton"
FT                   /note="GO_component: - membrane; GO_function: - transporter
FT                   activity; GO_process: - oligopeptide transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_50811"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98766"
FT                   /db_xref="GOA:A4S4P7"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4P7"
FT                   /protein_id="ABO98766.1"
FT                   /translation="MRGAHPLGLVVLGATEMWERFGYYAARALLALYVTKVLRDPTFDV
FT                   ERVLGLRTVGKTDAVGMMERTRAAEATSAKTYGAFACLAYLTPVFGGIVADAVLGAHRS
FT                   AVVGAVVMALGYGAMASEWAFLIGLALVCVGNGAFKPSISTQLSALYAKDDPKRDAGFS
FT                   IFYCCINVGAFFSPLIAGTVRVYFGYGAAFASAAVGMWCALAIYALNRRHVVDAMIPAS
FT                   ANDNDEDLNDMARLIRENSNAMFAVAIVCVAGIGFSMVYEQSGSTLMLFSDEHVDLHGM
FT                   PTEFVAALNPLLVLSLTPAVTALWDWQARRGAEPHQMSKIAIGCALLSSSFAVLMFGAL
FT                   PIDSHASPTRVSVFWIVLNQIFLTAGELFTFPVALSYISKIAPDGLLSAIIGLWFGSYF
FT                   FGNYFSGVLGSTYPSFDSPSGFFAALALIAGAVALVLGLARAPLAARCPT"
FT   gene            <310735..>311469
FT                   /locus_tag="OSTLU_5300"
FT   mRNA            <310735..>311469
FT                   /locus_tag="OSTLU_5300"
FT                   /product="predicted protein"
FT   CDS_pept        <310735..>311469
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_5300"
FT                   /product="predicted protein"
FT                   /note="GO_component: - mitochondrial membrane; GO_process:
FT                   - respiratory gaseous exchange"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_5300"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98597"
FT                   /db_xref="GOA:A4S4P8"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="InterPro:IPR038659"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4P8"
FT                   /protein_id="ABO98597.1"
FT                   /translation="VERRVNEALIGVAVTVIDNLYGGRSYARFHALETVARVPYFSFMS
FT                   VLHLYETFGWWRKADYLKVHFAETMNEYHHLLIMESLGGAELWKDRFVAQHIAVAYYWI
FT                   CVAQYLVSPRWAYNLLEQVESHAYATYDGFLNANEEVLKATPPPSVAVQYYTKGDLYLF
FT                   DEFQTVDRGERRPKIDNLYDVFVNVRNDEAEHMKTMEFCQRPGNGLRSPSSKEAMVLLS
FT                   KDACEVDEDFQVDEDCEKASIAA"
FT   gene            complement(<312423..>313184)
FT                   /locus_tag="OSTLU_44270"
FT   mRNA            complement(<312423..>313184)
FT                   /locus_tag="OSTLU_44270"
FT                   /product="predicted protein"
FT   CDS_pept        complement(312423..313184)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44270"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44270"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98767"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4P9"
FT                   /protein_id="ABO98767.1"
FT                   /translation="MRARTRTRTQSRTQSRTQSQSNARQRATAPTVLVPIARGSEEMET
FT                   VIIVDVLRRAGADVTVASIEPGDDDETRRDDDDDAARRDDAVECSRGVRIVPDARLRDL
FT                   ARVETRAWDLIALPGGMPGAANLAKSERLTRALTRQMETPGALVAAMCASPGVVLAPRG
FT                   MLDGLACTAHPAFVKDLPSDASANGRVVVDGDVVTSRGPGTALEFALALAEKLFGADKA
FT                   REVAAPMVLPPIDHSSPRVANEWRLLDAEVV"
FT   gene            313762..315339
FT                   /locus_tag="OSTLU_26487"
FT   mRNA            join(313762..313835,313990..314054,314282..314944,
FT                   315212..315339)
FT                   /locus_tag="OSTLU_26487"
FT                   /product="predicted protein"
FT   CDS_pept        join(313796..313835,313990..314054,314282..314944,
FT                   315212..315253)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26487"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26487"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98598"
FT                   /db_xref="GOA:A4S4Q0"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR027246"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Q0"
FT                   /protein_id="ABO98598.1"
FT                   /translation="MAKYYGDIAKSAKDLLTGGFNYDTKVSVDTKSAGTGVSASVVQKG
FT                   EAVSGDLKVNANVVDQVIDIELNQDAKAKVTASFPSLIPNGKLSVGGTVQDLETVKVSA
FT                   SVLAGPLGVKADVANYAAPKADASLCYAIGGGFAVGAMATIKSSSALAYTVAAQSKQGD
FT                   VTYALTAADQFKTFKASVVTALDSKQTLGAEVVYKKAATATIGYSKKMDGHSFKAVVAN
FT                   PVSAEFNPTLSVHASLGSLIPKTTATISCQVDKTMKYKYGFQFATKL"
FT   gene            <315914..>318169
FT                   /locus_tag="OSTLU_44118"
FT   mRNA            join(<315914..316543,316769..>318169)
FT                   /locus_tag="OSTLU_44118"
FT                   /product="predicted protein"
FT   CDS_pept        join(<315914..316543,316769..318169)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44118"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44118"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98599"
FT                   /db_xref="GOA:A4S4Q1"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="InterPro:IPR026740"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Q1"
FT                   /protein_id="ABO98599.1"
FT                   /translation="KLDALKRLIALMATGRDVSVFFPSVVVNIVSESFEVKVLVYMFLV
FT                   RTADQKPEEALLSINSFQKDLAHPNPRVRALALRVMSSIRIQVIVPVVILAARKCAVDP
FT                   SPYVRKSAAHAIPKIYRMDNTRKEELIEIIETMLRDSTPFVLSSAVAAFTEVCPDRIDL
FT                   LHRHYRKICRMLVDMDEWGQILLSELLLRYARSQFLAPDAHTRELGGSRGPGWMDEDHR
FT                   LLLRCTRPLLQSQNAGVVMAVAALHFYLSPAADLPKVVRALVFTAHGRPEVRHVVIKNI
FT                   CTMVTTQPILFQSHFNAFFVTPRDPLQVRALKLEILTHIVTSENAPTLLRELQAYLRSS
FT                   NHDFVALTIRAIGRCAAIMPQIASVCIRSLLELSLHPSPKVASEAVVVIRALVQQNPKE
FT                   HIVVVMRLMRRLDSLIAPEARSAVIWLAGGEIFDGDAENIKASDKELREKFFELAVQMM
FT                   RRVVKSFPDEHEMTKQQIVNTSCKMYIQDPIRIAPMLKVVFALAAADPSVDMRDRIRVF
FT                   RALFPVDGKPSAVKHFGDAVVLCAKPEPKLPSPAMQTCEHALGSLSHFMDHMAPGYTPL
FT                   AKHPTVQPPTNVREQYFAGGSGREGSSAIAVHNGKSNGLGASGFYSSSDDSDDSDSDSS
FT                   SYTGSDDSDDSSDDSGDSSDDDEDEDEDDESDDSSSSNDSD"
FT   gene            complement(<318264..>319094)
FT                   /locus_tag="OSTLU_44356"
FT   mRNA            complement(<318264..>319094)
FT                   /locus_tag="OSTLU_44356"
FT                   /product="predicted protein"
FT   CDS_pept        complement(318264..319094)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44356"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44356"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98768"
FT                   /db_xref="GOA:A4S4Q2"
FT                   /db_xref="InterPro:IPR019275"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Q2"
FT                   /protein_id="ABO98768.1"
FT                   /translation="MVGARGIEDVIATRSAPTTGRRGRARARATVRTRARFDILKPLRA
FT                   GPRFAAEQSVDPRVYRGAYADWTVDAADRAEVFAYRGSLSAMSLGAALTAGLCHAGDYV
FT                   DAEKAYFLGGLGLGGALLMVHMYVGEIRAAMRALWSVGFLGSAAIAMSAQEPLPVYVWE
FT                   HPMSVLLVGPMFAALTGLAFKEGMCYGKPEAALLFFAVPAMCLSHLFGASADVCGVEAN
FT                   VVLALLVVLALRKYSQPIKDDIGDKSIFMFQALEEGSDEQLEFLKRARENGFDV"
FT   gene            <319343..>320146
FT                   /locus_tag="OSTLU_44192"
FT   mRNA            <319343..>320146
FT                   /locus_tag="OSTLU_44192"
FT                   /product="predicted protein"
FT   CDS_pept        319343..320146
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44192"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nucleic acid binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44192"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98600"
FT                   /db_xref="GOA:A4S4Q3"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Q3"
FT                   /protein_id="ABO98600.1"
FT                   /translation="MDDDAPGGPQGARSYAPYAGAQANDACRNCGQLGHYARNCAQNAG
FT                   LNGGRGADRCNRCGQIGHWASECSLPYSGGAGAGGFRGAVGGGGARPGDRCSRCGGLGH
FT                   YARACPSPAMAAFAGGAGGAPKTCHNCGRVGHIARDCRQGGGARGYDNARAPKQRKGAG
FT                   PDDVCNRCGEKGHWASSCSQPDTRTEAERTRQAKPDDKCHRCGELGHFAKDCSLPPDNT
FT                   CRICKQEGHFARECPNKDTAAAANMDADLDNYMKEGAEKKESGEA"
FT   gene            <320396..>322138
FT                   /locus_tag="OSTLU_44124"
FT   mRNA            <320396..>322138
FT                   /locus_tag="OSTLU_44124"
FT                   /product="predicted protein"
FT   CDS_pept        320396..322138
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44124"
FT                   /product="predicted protein"
FT                   /note="GO_function: - glycerone kinase activity;
FT                   GO_process: - glycerol metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44124"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98601"
FT                   /db_xref="GOA:A4S4Q4"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Q4"
FT                   /protein_id="ABO98601.1"
FT                   /translation="MSKKFLNAPDDVVSEMLDGVCLATPSIARIADQNVLVHVREGEDK
FT                   VVVISGGGSGHEPAMAGYLGRGMLDAAVCGNVYASPSVEAVLSAIRATTTDAGAALVVM
FT                   NYTGDRLNFGLAAERAKLEGFDVEMVIVNDDCALASDRVGIAGRRGLAGTLFAHKVAGA
FT                   AADAGKSLKEVCAEARACVEATGTMGVALQACTLPGSSGVAREIAEGTMELGLGIHGEP
FT                   GAHTAKTTSADEVVETLMTSIFAQNEKIGKLSEGSNVALMVNSLGATPLMELYVAARAA
FT                   FSWLAGVKKINVTHAYVGTFMSAIDMNGFSVTVCALDDDTRVQRLEAPCSCSAWPKTAK
FT                   LTPAKLLSVSAPASDRNETIASGPPTTPEGVMALKAIKRVAKDLIAVEDTLTKYDTAVG
FT                   DGDCGTTIRKGAEALMKAADTYPIDDVSALMRAIGDTIRQNMGGTSGVLYDIFFTAAAD
FT                   KLAKVAKGKAPSVDIVLLAFSTGVQAMCQYGGARAGDRTMLDALVPALTMATTTYMSKK
FT                   SVIEVASEAAKAAANGAEDTKSMKANAGRSSYVNQDVLKETPDPGAVAAATWINAIFAA
FT                   VSES"
FT   gene            complement(<322168..>326691)
FT                   /locus_tag="OSTLU_26492"
FT   mRNA            complement(<322168..>326691)
FT                   /locus_tag="OSTLU_26492"
FT                   /product="predicted protein"
FT   CDS_pept        complement(322168..326691)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26492"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26492"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98769"
FT                   /db_xref="GOA:A4S4Q5"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Q5"
FT                   /protein_id="ABO98769.1"
FT                   /translation="MSWPATSALTNATSFANATFDVDGSARATLRPDVEGKYSAALVDT
FT                   NGCYASQTLEVEVSWTCETSTNTAVAAAFIAFAAFCAYSFGRNLESSDFEDKRNVILDV
FT                   GASYKMIGSGEADAELDDEYKRELDELTQEIKSEHITYVTKIDLDRDLKNILVDKKKSA
FT                   RERAAKEAGLWNEAEEQFQKNLYATERAERRRSMVGEQLVATASKLMAWVKYTVRLRSA
FT                   TFALMFRYKLAKVLDKEYWSHNLLRFQLYIEFFAFTAFAWRRSSHSNEMYRDAIADVFF
FT                   YPGLFGPDMTERGAKTELTNWFVVLLFGVVICPVVVKFCGRVRDHFDQCMWAFAEYVEL
FT                   GGDKTLTQYSDDPDAESGGGAQVDEETVQVNKLAKVHAMMSKTMRRVLLQPVAMRDDFT
FT                   PVRDREKQRFKVVPDVAWENGSDEAILRTVRLETTSPLNLRLIPREAAERMELMAEYAL
FT                   RRRTYSKRVGDFRDRVKAVGFVLRVLILRVALVPMVFASLGFLMVTTSFTPTPWIHVSK
FT                   DPSASFGDNLMISLFVGLGAIAVSMKMAVVSETLEPNLRPVPIFEMLSIFLKVSLATIA
FT                   AYMEGELPGHGVPALDSVARLESLNSLRNIMPVVVCLVLLVAHMNIQSLRGFGQKRNES
FT                   RAGAFGGAFMFAVVTYFSRIFNNPPWMSHGLVPHTGGSNWTRPGVVIGIIMTLIAMVMV
FT                   RVFNHSLGDHKCIRSELEKLSDPEQVEKVEKIMTPEFIKEQVEAENRRDRVVALVAFYN
FT                   LLSTEQRTQLLSPLVKKTNMPRASQTKDGENEDVGDAWDTASDAFEELGIIMHCIIDDP
FT                   DQEFLQVAGEGFIRSVIHAYVQGTVEIALWCDDDSPASTWEAVKSIVSTVKDCIKGGES
FT                   KTFQATVATVSMECIQSFDFANLMSTLLFKAHDIDLDMYGEDYVVSARMFRQIIDDAFE
FT                   IPPRPIAKKLTQAITHVRDPDTDEVRRLDKAERVTYVARSWLRQEVKAKNRPELNWFSS
FT                   LGYYAAVGRLQNEADEERLELAHDFMKTLLDASLSTDKQISFYSIRTLATLVRVGDAGP
FT                   SVFAVDGLKVLFECMEAHAGSSKETFVSEILYALTNADACRSEFLSALSHLIVSMEPGK
FT                   EREKIHAIELLHQSIKLEMSAVYRVMNTKSDEGEVSKKSYKAFISMSAAQFVHDALYGM
FT                   LIDDEAETRELSIHALVDLITLFVWGTEGNFYDFEVPVTGSYTDAAFERFVDAAKRKMP
FT                   GGALMSKTMYRRLYGDIKVQGLQKDTDKLIAVLLKIVNTDDNAGVRAAAERGISDMRAL
FT                   LSDDSALTAITLYDESSDVRDVRGAAPSRETLHNVSAIIHSSVERQRQKDETISKLRLN
FT                   EFWRKMKEREHSGNSHRQAKSTRGGRVEIERDSDPSKGPAPPIGGRMTMVKGTTGFKRV
FT                   PDQATPKIVRHPPPPPPTERLERQRRARSALHADRLAKREAASDRWYGGENFRRQRSIE
FT                   SANNEASEVVVSSNIAALNERPTFTAPRYGTTKVPREFRRAPRPPE"
FT   gene            <327320..>330304
FT                   /locus_tag="OSTLU_26493"
FT   mRNA            <327320..>330304
FT                   /locus_tag="OSTLU_26493"
FT                   /product="predicted protein"
FT   CDS_pept        327320..330304
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26493"
FT                   /product="predicted protein"
FT                   /note="GO_function: - DNA ligase (ATP) activity; ATP
FT                   binding; GO_process: - DNA replication; DNA repair; DNA
FT                   recombination"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26493"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98602"
FT                   /db_xref="GOA:A4S4Q6"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR029710"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Q6"
FT                   /protein_id="ABO98602.1"
FT                   /translation="MDDVANDSGHRLGTRDGGDDDDDDAEEDGARLTSEPSTSGASLRY
FT                   ATARDVPFRKLCGAFEALQNERGRSKATSARRYRVLDTLHDRCLVSARDGTRVDAFDAY
FT                   RLILPALDKERGAYFLKHDALAKVVVSAFDMSRASEDAKKLEDWKRKGGGNFPQVVRDV
FT                   LAGGHLADREKDEDARTLTIGDVNEALDALAACDNKDQRASTLRALFSKMDATQVKWTC
FT                   AIILKETKISMGEKAILRHYHSEANDLWDWTSDLRRVCEDLPRRDFRMKREDIDVGVGL
FT                   INPQMARRQNSIDAVYRALKGTQFVIETKFDGERIQIHKDGDIINYWTRNMNDFGPRGY
FT                   DVMNALFRHLPKRCILDGELMVWNKLRDQSYPFGALKNLIKAANMRKAKDELFPLKAHL
FT                   ENRDGGDSDGEEDLMSSKYAWYAENVKKLTYGDLELVYVPFDILYAVDRSVKTHKLRER
FT                   HELLKEHVREVSVMCGNIRARILLATPDCAFSRVGSTKEDIERALLEAMDNGEEGLVIK
FT                   DLDGPWIPGDRSNNWMKIKPDYLSSEDLDVVLIGGYYGAGELRGGKISQFLCGIVEATN
FT                   DPISTASDGVKIMSFCKVGTGISAMQLDDLRSRLGDFMHREKPQDMNYNVTDAYNEKPD
FT                   VWIWPPQRSLVVTVKGDIRAIRTTTFATGYSLRFPRVTGIRYDKKWSDILTLCDLLKTI
FT                   EEEVPTLKVNIDDTRGGTNARKRSRTTGPATLLPAHLMPVDVSGVVQESEIFKNMQVHI
FT                   ANCESREQKQELFKAVIARSGTTSELWHKHVTHSVALNRDGSKFRTASREGDVYTIAWL
FT                   QECIHEGRVVPPKPRHRLHLSATTWYGTDAMDRYGDDHFSDCNLADVHALVHQVGDQTK
FT                   RWKTAEVPALVELDREYPSVCADVKLLTFRGCVFEIDDSLGKDARVDEQSSMFPSVLAG
FT                   ERRNVEQILRIYGGKLAPEGRMGTHIVRMYDDSVVFEDMDDGRKQVSLSWVKRCIDRST
FT                   TADVV"
FT   gene            <330759..>331688
FT                   /locus_tag="OSTLU_93452"
FT   mRNA            <330759..>331688
FT                   /locus_tag="OSTLU_93452"
FT                   /product="predicted protein"
FT   CDS_pept        330759..331688
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93452"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93452"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98603"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Q7"
FT                   /protein_id="ABO98603.1"
FT                   /translation="MRCATKRARLCAQGILTNVHGRALKEIVTITLKAMISAGPVVAIP
FT                   TKFPNHARGVVVIGDAFDDLRAMKGLMQSGKVVFNALSCALLASGGNRDTASATTSIFT
FT                   TLPRARVKEFIPSHVFNAFADGLIGFDDKTPSLSEVCTVAFVRFNPKGDDCVVECIGVV
FT                   HRVVSQYQGVVLQSIVDDNGPSCLCAFGVPGTPKRGATTRGLRFARDLLKTLDGALTHA
FT                   RCGLSTGVVNIGAACEVNSKSHSEFSLVGVPVILAARLADAVKPGVAAMDEETRVWAAS
FT                   ALNNNARTSRIELCLKGFPRAMTTFIIE"
FT   gene            complement(<331709..>333613)
FT                   /locus_tag="OSTLU_88612"
FT   mRNA            complement(<331709..>333613)
FT                   /locus_tag="OSTLU_88612"
FT                   /product="predicted protein"
FT   CDS_pept        complement(331709..333613)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88612"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88612"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98770"
FT                   /db_xref="GOA:A4S4Q8"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Q8"
FT                   /protein_id="ABO98770.1"
FT                   /translation="MRQAWKDVSADALDDAAKMELGKKMEHVPEELRRVGAKAGGEMFV
FT                   TFGTASVQDFVFNWAAAAKKLSLEPIFVGALDEEMHTLCVKAGIPSMLLTGRSVLDNRD
FT                   QEFITQKSKTFKKMGTVKTKFIQDLLELGIAPILSDADVVWMRDPRELFNNGTYAYADV
FT                   LISSDCIDTVNDRADNANCRNVNFNTGIVHIRPTEPAKAFVEKWKQKVATSEIAWMRDQ
FT                   PALNLLVREGSPALAPAVAVPDDKRGLPGYRSIVFAANSTIRMGVLPIAQFSNGHTFFV
FT                   QEHHLYHPEDGEPYAVHTTYQYGDSARYAYGKRQRLRQHGLWYADDDTDYWKPKKYLTI
FT                   STKGSQMKFNGSRAIGMENDAYLTAITRHFEEDRLRRTTIRNGFALAKALGRIFVLPPA
FT                   RCYCDKIWNTLAGCRALGAETAHLPYACPMDHIYNLEGLHDLGVDFREAGFLEDMRLKG
FT                   NVREDVIHVKIGAKDDKNMADVVIERGFSASDAVEALESYNDHGVIMIDQLDEGSFCGF
FT                   DDKQKDEAFDTAINNALNHDQYFCFNEAYDKQGRPRSGGGKDGKEYEPRVVERHCGIAE
FT                   GEQSRLATRGVVTEVLKDPITCSCEWAYKLPKALADTRCAAQSRDEDDRTRTGLGDIE"
FT   gene            <334604..>335338
FT                   /locus_tag="OSTLU_26496"
FT   mRNA            <334604..>335338
FT                   /locus_tag="OSTLU_26496"
FT                   /product="predicted protein"
FT   CDS_pept        334604..335338
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26496"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26496"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98604"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Q9"
FT                   /protein_id="ABO98604.1"
FT                   /translation="MGTTPEKVVTMYLDEKFKSATVEGELLAKCENLKTLSCASCGLTT
FT                   LAGFPALANLKDLSLNDNRIADGLEALVGCKALSSLSLANNKLANVDDLKAVAEELTLS
FT                   VLELEANPLTENEDYHEKVMTMMPTLNVLDGRDEFGNEIEDDDEDDDEDEDDEDDEDED
FT                   EDDDEDDEDADEDEDEDESEEEEEEEEEEMGLADLYGDKPLEDDDDDDDAFVEDEDPES
FT                   EDIDEEESDDDEDEAAAKKPKI"
FT   gene            complement(<335562..>335900)
FT                   /locus_tag="OSTLU_17339"
FT   mRNA            complement(<335562..>335900)
FT                   /locus_tag="OSTLU_17339"
FT                   /product="predicted protein"
FT   CDS_pept        complement(335562..335900)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17339"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17339"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98771"
FT                   /db_xref="GOA:A4S4R0"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4R0"
FT                   /protein_id="ABO98771.1"
FT                   /translation="MGGLLTTAAVAETMTLTGGAAGASASAGATASLGAAGTAIGETLG
FT                   SLGSYTIAVGTYTITAPVALIAGIGVAIAAMASYAVTRRLRASGASETQSLLRGTSYGT
FT                   TRDGDNMV"
FT   gene            <336638..>337396
FT                   /gene="MRPL4"
FT                   /locus_tag="OSTLU_17340"
FT   mRNA            join(<336638..337152,337237..>337396)
FT                   /gene="MRPL4"
FT                   /locus_tag="OSTLU_17340"
FT                   /product="Putative mitochondrial ribosomal protein L4"
FT   CDS_pept        join(336638..337152,337237..337396)
FT                   /codon_start=1
FT                   /gene="MRPL4"
FT                   /locus_tag="OSTLU_17340"
FT                   /product="Putative mitochondrial ribosomal protein L4"
FT                   /note="Putative mitochondrial ribosomal protein L4,
FT                   imported to mitochondria; GO_component: - mitochondrial
FT                   ribosome"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17340"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98605"
FT                   /db_xref="GOA:A4S4R1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4R1"
FT                   /protein_id="ABO98605.1"
FT                   /translation="MRVRWTIAEGQGRGEDAVVPVYSFDGEARGSVELPGRIFDQPLRV
FT                   DVAHRVVRWQRAKARKGLHKTKSRGEVAGSTRKVRPQKGSGRARVGNLKAPQMRGGGTA
FT                   HGPVVRSHAHALPKKVRRMGLKVALSAKAAEGKLIVVDSFAGMEPKTRAMKATLERLTG
FT                   DLGLAAGGDELVRMSARNLPHVEVLPQIGANVYSILRRRTLIVTKSGLEQLIARLDAPI
FT                   KR"
FT   gene            complement(<337487..>338251)
FT                   /locus_tag="OSTLU_6009"
FT   mRNA            complement(<337487..>338251)
FT                   /locus_tag="OSTLU_6009"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<337487..>338251)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_6009"
FT                   /product="predicted protein"
FT                   /note="GO_function: - oxidoreductase activity; GO_process:
FT                   - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_6009"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98772"
FT                   /db_xref="GOA:A4S4R2"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4R2"
FT                   /protein_id="ABO98772.1"
FT                   /translation="RVALKLARREQISPDAARLTFALPTPSHVLGLPVGQHVGLSYVDA
FT                   KSGERHERPYTPVSTDDQEGSVTFVIKAYKPCEKFPLGGKVSQHLDGLRVGDSCDFDGP
FT                   KGMKTYEGGGVFAIRRLRSQGGGFEKRKCSRVGMIAGGSGITPMLQISRAILDNGDKVK
FT                   MNLLFANQTEADILCREEIESDVAKYGADKFSADYTLDRPPKAGWSHFCGFITKEMIEK
FT                   TMPPPGKRTQILICGPPPMLKFAVLPALEELGY"
FT   gene            <338919..>339695
FT                   /locus_tag="OSTLU_26500"
FT   mRNA            <338919..>339695
FT                   /locus_tag="OSTLU_26500"
FT                   /product="predicted protein"
FT   CDS_pept        338919..339695
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26500"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26500"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98606"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4R3"
FT                   /protein_id="ABO98606.1"
FT                   /translation="MLAGAPRARPRDVGARRRRPASRGSVAARTRAAAASRECRHYVNL
FT                   KNGIEALPTLRDDLGVRSYEFVRIQSSLLENGDCEKMILELDASLLLNLALGRSCFVWD
FT                   FGSRDVVKGRGNPRALWYGAEFIRYALRKEWFPEGVGDAARRENVPVVRGKQVEREWAT
FT                   KLTMFGRSAKRKIRYYRQFIPDDVRDVRLIGVYRPTTHDDDAEYYREVLLRHEFGDGGD
FT                   VPDVVRDERETIEAIKRLSYNIFFAGVEEPAWLNQK"
FT   gene            complement(<339743..>341545)
FT                   /locus_tag="OSTLU_44217"
FT   mRNA            complement(join(<339743..340771,340970..>341545))
FT                   /locus_tag="OSTLU_44217"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(339743..340771,340970..341545))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44217"
FT                   /product="predicted protein"
FT                   /note="GO_process: - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44217"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98773"
FT                   /db_xref="GOA:A4S4R4"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4R4"
FT                   /protein_id="ABO98773.1"
FT                   /translation="MTTRAIATHRVVAHLDLDAFYCQVERRDLRAKTAAGRRDGRASAE
FT                   DVPLVVVQYNPFERGGVRALAPDDDRELRDGFENHSLIAVSYEARARGVKRNMRGREAR
FT                   ALAPACAVVQVPTRRSKADLTLYREAGREVAAVLARGGTIERASIDEAYLDLTESAKKV
FT                   LEETAWATILEKARTSHAAGASAVSGKGYASVAWWNRDESEWREEEKLLAAGAYICFNL
FT                   RKACVDELGYTLSAGIALNKMLAKLTSGMNKPASQTVLCPDHTSTLLDELPIDRIRGLG
FT                   AKFGRELADGLNVKTIGELARTPLRKLEEVCGEEKAQWVRKVSLGLDDDPVKAREMPKS
FT                   IGTGKTFRGALAIRSIASAKHWLAELTAELNDRCEADEEEWNRVPKLLTLGLSSPDERE
FT                   TSSGHCSRRCPLRPGADEMAQDALTLLSKWASGRERWSITGMSVSASNFVSLEKDSGDV
FT                   VEMFKNATKAAKAPASVSATPAASPIKADQIDKNVLAELPEAIQREIRASMGLLDKSTG
FT                   GGVKRKNEITNYFSKKR"
FT   gene            341643..>342904
FT                   /locus_tag="OSTLU_19738"
FT   mRNA            join(341643..341730,341751..>342904)
FT                   /locus_tag="OSTLU_19738"
FT                   /product="predicted protein"
FT   CDS_pept        join(341721..341730,341751..342904)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_19738"
FT                   /product="predicted protein"
FT                   /note="GO_function: - transaminase activity; GO_process: -
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_19738"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98607"
FT                   /db_xref="GOA:A4S4R5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4R5"
FT                   /protein_id="ABO98607.1"
FT                   /translation="MRALAALERRSDAKGAKRVLRLEIGQPGFATPARVCDAAVRAIEG
FT                   GETKYAAPSGAPRLREAVAEYLVRTRGVAYEAENVVVGPGAKPGLFLPTLACCDPGDEV
FT                   VYPDPGFPTYAAMCAAAGATPRPVPLRSDGASFDMAALEASVNEKTKMIVINSPGNPTG
FT                   GVMPREDVAAVARLAKKFNCWVMSDEIYSRLIYDDEEEGGENDEKIFSICALDGMKERT
FT                   ILVDGFSKTYCMTGWRLGWVACPKHLAEKIKLLTVHSVGCVAAFTQIAGVEALTGPQDS
FT                   VKAMRDEYRVRRDFVVDALNDIPGISCPVPKGAFYAFPSFDFPDVTAQELADYLLEDAR
FT                   VALLPGTDFGAAGERHLRLSYVGELSDLREAMARIKTSLAKRFPDFV"
FT   gene            <344900..>345361
FT                   /locus_tag="OSTLU_5713"
FT   mRNA            <344900..>345361
FT                   /locus_tag="OSTLU_5713"
FT                   /product="predicted protein"
FT   CDS_pept        <344900..>345361
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_5713"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_5713"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98608"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4R6"
FT                   /protein_id="ABO98608.1"
FT                   /translation="QGYPANNTGYPSNSTGYPSSSTGYPSDSTGSGYPSNSTGYPASGY
FT                   PANSTGYPAKGYPANSNGYPAKGYPANSTGYPAKGYPANSNGYPAKGYPANSTGYPAKG
FT                   YPANSNGYPAKGYPANSTGYPAKGYPANSNGYPAKGYPANSNGYPANSDG"
FT   gene            complement(<347198..>348442)
FT                   /locus_tag="OSTLU_17346"
FT   mRNA            complement(join(<347198..348215,348384..>348442))
FT                   /locus_tag="OSTLU_17346"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(347198..348215,348384..348442))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17346"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17346"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98774"
FT                   /db_xref="GOA:A4S4R7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4R7"
FT                   /protein_id="ABO98774.1"
FT                   /translation="MSTTAARRKKSAAAAAEETMVDVEEDAGVTFAEEQSNIVSIDALQ
FT                   QSGVSATDIKKLRDAGFVTVRQLLMFPRKAIIAVKGFSDAKADKVLEGAVKLLPESEAG
FT                   GFVTAAEDAERRKDVVHITSGAAAVDAILGGGFESRAITEIYGEWRCGKTQLCHTIAVT
FT                   TQMPVEMGGGCAKVAWIDTENTFRGDRLVQIANRFGLDADAVLSNVMVARVDTVDQMMH
FT                   ALIAIGAKMAEEPFKLLVVDSIMAIFRVDYVARGELSERQQTLNQFLSRLRKIAEEFNV
FT                   AVVLTNQVQSDPGGMAFAGVEPKKAIGGHVLAHASTIRLMVRKGRAEARVLKVLQGPTL
FT                   KEDEAEFQITEGGVTGME"
FT   gene            complement(<349128..>349496)
FT                   /locus_tag="OSTLU_8926"
FT   mRNA            complement(<349128..>349496)
FT                   /locus_tag="OSTLU_8926"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<349128..>349496)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_8926"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_8926"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98775"
FT                   /db_xref="GOA:A4S4R8"
FT                   /db_xref="InterPro:IPR010334"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4R8"
FT                   /protein_id="ABO98775.1"
FT                   /translation="KLDDAPAALARTDATSAMNLRVLRKEDDAIERIVAHSKHAVLYGF
FT                   DADARQWARKNVEGALFVVRRATEPRDAFVVLNRCGTENLRQRVGGAGFELERSPPYLM
FT                   YRVGREVNGIWFHDAEECE"
FT   gene            349602..350745
FT                   /locus_tag="OSTLU_26506"
FT   mRNA            349602..350745
FT                   /locus_tag="OSTLU_26506"
FT                   /product="predicted protein"
FT   CDS_pept        349650..350708
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26506"
FT                   /product="predicted protein"
FT                   /note="GO_function: - oxidoreductase activity, acting on
FT                   the CH-OH group of donors, NAD or NADP as acceptor;
FT                   GO_process: - L-serine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26506"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98609"
FT                   /db_xref="GOA:A4S4R9"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4R9"
FT                   /protein_id="ABO98609.1"
FT                   /translation="MTTQSATTTTARSATTTATTTLCVVTHEKLLNSRPLTERLRAETP
FT                   RAFDVVVVSNEEEIDKMRRERADGDLAMLWWFATKEVTTAFASRRDVAERVKWMHSGSA
FT                   GVDHLMAIPSVREHASTLTNGRGAFSASLGEWGVFACMHFAKRVDAMRAAQRRKEWIRM
FT                   TVGLIEGKKLVIVGYGDIGQHVARRAKAMGMKVCAVRRTPEKTDPNDDYVENVVGFHAL
FT                   KETCAKADYVLVALPSTEETDKMINADVLSAMKDTAVLINVGRGSTVDEDALVDALRNK
FT                   KIAGAALDVFAVEPLPSDHPFYTMENVLMSFHCADLTSDYHDLALDCFIKHAEQYATNA
FT                   PFTNVVDKRLGY"
FT   gene            complement(<350779..>351300)
FT                   /locus_tag="OSTLU_44011"
FT   mRNA            complement(<350779..>351300)
FT                   /locus_tag="OSTLU_44011"
FT                   /product="predicted protein"
FT   CDS_pept        complement(350779..>351300)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44011"
FT                   /product="predicted protein"
FT                   /note="GO_function: - translation initiation factor
FT                   activity; GO_process: - translational initiation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44011"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98776"
FT                   /db_xref="GOA:A4S4S0"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4S0"
FT                   /protein_id="ABO98776.1"
FT                   /translation="PKPRRDAMEVEYCASCACPLEYCDVVGCARVAARALERVALDDDA
FT                   TATTTTTAAAAATRDDDDGENDDDATRKTTSKKKSKSKAREVVVTRLSRNRKKMITNVV
FT                   GLERFDVDLKEASKAFGKKFACGCSVTKGATGRDELDLQGDYSEQLAALICEKYEVGAE
FT                   DVRCVDKSKF"
FT   gene            <351629..>351946
FT                   /locus_tag="OSTLU_26508"
FT   mRNA            <351629..>351946
FT                   /locus_tag="OSTLU_26508"
FT                   /product="predicted protein"
FT   CDS_pept        351629..351946
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26508"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26508"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98610"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4S1"
FT                   /protein_id="ABO98610.1"
FT                   /translation="MGAREGREMGFRKGFELAEEVGYYAGCAAVWRTCATRDGDARGGR
FT                   VERLIESFERELEESAIGNPLDEGILERVERLRGRFKTLAALLGRRGEHARADASLGIS
FT                   F"
FT   gene            complement(<352017..>354701)
FT                   /locus_tag="OSTLU_17350"
FT   mRNA            complement(join(<352017..353198,354699..>354701))
FT                   /locus_tag="OSTLU_17350"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(352017..353198,354699..354701))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17350"
FT                   /product="predicted protein"
FT                   /note="GO_component: - cytoplasm; GO_function: - tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase
FT                   activity; GO_process: - tRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17350"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98777"
FT                   /db_xref="GOA:A4S4S2"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4S2"
FT                   /protein_id="ABO98777.1"
FT                   /translation="MPGAKPLRVAVLLSGGVDSSVALALLRAAGHECVAFYLQIWFQED
FT                   FRNTWDQCPWEEDLRVAESVCERVGVPLETVPLTDEYWNLVVKDSVEEIRKGRTPNPDV
FT                   LCNSRVKFGAFREWLARTHPGEFDRVASGHYAAVERADVGELARLVMSGDTFKDQTYFL
FT                   ADLSQEQLGSVCFPVGGMPKAEIRALAASAELPNAGRKDSQGICFLGKVKFSEFIAEHL
FT                   GEMPGDIIEVESGKVLGKHRAYWFHTIGQRSGLFLHGGPWYVAGKDCVNNIVYVTRDYY
FT                   SLDKARDTFTVAGFNWISGQEPPLESIEGLRVKVRHGENIYACSFQFKDVDGERCGEVN
FT                   IGQDDQGLAPGQYAVFYDGDTCLGCGKILEPNVGAIGLVPASGERLDATTSPSA"
FT   gene            complement(<354872..>355238)
FT                   /locus_tag="OSTLU_17351"
FT   mRNA            complement(<354872..>355238)
FT                   /locus_tag="OSTLU_17351"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<354872..355238)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17351"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17351"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98778"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4S3"
FT                   /protein_id="ABO98778.1"
FT                   /translation="MDRVKRTSPPSTSGRKREFRVTPGKSGGASAAFSPNIGGSMASPT
FT                   IFGRVDDVVAGLGSDCESESEAETEEFDEDDGGTQCYEDDYAGGTQVLDSAALCDAPTG
FT                   LDLVLAARKEEVEPPCER"
FT   gene            complement(<356002..>357114)
FT                   /locus_tag="OSTLU_44261"
FT   mRNA            complement(join(<356002..356624,356700..>357114))
FT                   /locus_tag="OSTLU_44261"
FT                   /product="MC family transporter: folate"
FT   CDS_pept        complement(join(356002..356624,356700..357114))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44261"
FT                   /product="MC family transporter: folate"
FT                   /note="GO_component: - membrane; GO_function: - binding;
FT                   GO_process: - transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44261"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98779"
FT                   /db_xref="GOA:A4S4S4"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4S4"
FT                   /protein_id="ABO98779.1"
FT                   /translation="MTRRDAANARASTSSPDVDAFANPQHATNFYRNLARGAPPSALAL
FT                   LSDKAFANGFSGAIAGTVAATVVCPLDVLKTRLQVSAATTGTTEYLSTYGALRRIVRHE
FT                   GARGLYRGLGPTVAALLPNWGVYFSTYGALKRIFIADANHFAHILAAAGAGAATIFVTN
FT                   PLWVAKTRLQVQHSHALASAMPKRVPYTSTINALTRMMREEGLKGLYSGFGPSLIGIAH
FT                   VIIQFPLYESIKVELAREREVAVNKIEPIDLMVASAIAKMIASTLTYPHEVIRSHMHVH
FT                   GLGPFSGIGALVRRIYLEGGVAAFYRGCATNLIRTTPAAAITFTSFELVSREIEKLVAA
FT                   AREDD"
FT   gene            complement(<357323..>364141)
FT                   /locus_tag="OSTLU_150"
FT   mRNA            complement(join(<357323..358035,358201..358328,
FT                   358389..>364141))
FT                   /locus_tag="OSTLU_150"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<357323..358035,358201..358328,
FT                   358389..>364141))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_150"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nucleotide binding; DNA binding;
FT                   DNA-directed DNA polymerase activity; 3'-5' exonuclease
FT                   activity; GO_process: - DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_150"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98780"
FT                   /db_xref="GOA:A4S4S5"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013697"
FT                   /db_xref="InterPro:IPR029703"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4S5"
FT                   /protein_id="ABO98780.1"
FT                   /translation="GAGADGRTKAQVAAEEDALQKELGFGTHVDGEDRIGWMINASSTQ
FT                   VEDKESGKAYAAVNCYFMAQDGSTFKAQVKYAPYFYLATKTGCEHEVEALLRRKYGEQV
FT                   LDVEMVDKEDLDLKNHLSGLQQTYLKVSFATTQELMDVRREILPIVSKNKKKSSAAAAY
FT                   EALSHQESLDAGIKPKKKALTDYEEAMIDIREYDVPYHMRYMIDTDVRCGKWYSVRAEH
FT                   GAVTLTLQEQMLDRGEVRVCAFDIETTKLPLKFPDAEHDQVFMISYMLDGQGYLIINRE
FT                   IVSEDVEDFEYTPKPEYKGPFIVWNVPNEQALIRTWFDHMRETQPSIYVTYNGDYFDFP
FT                   FIETRATKNGMDMYREIGFKCEQSGECRSNSALHLDCFAWVKRDSYLPAGSHGLKAVTK
FT                   AKLKYDPVEVDPEDMLPYAQSHPQMMASYSVSDAVSTYYLYMKYVHPFIFALSTIIPLS
FT                   PDEVLRKGSGTLCEALLMVEAYHGNIVCPNKQVSAGEKYYEGHLLNSETYIGGHVECLE
FT                   AGVFRSDIPCDFKLNPEGYQRLLDNLDDDLDYALRVEGKGLGKDDCADYDEIRAQIAEK
FT                   LEYLRDNPNLNMEPLIYHLDVAAMYPNIILTNRLQPAAIVNEDVCAACDYNRPGKGCLR
FT                   EMEWVWRGEHFASTSSEYAAIKAQLQVDKFAPSHPGGPQRTWAELPYEEQQEQKKQRLK
FT                   LYTQKVYRKVMEKPVTATKKASICMRENPFYIDTVKAFRDRRYVYKGENKKWKNNLDEA
FT                   KQSGNIIEIQKAANMVVLYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGVVTNTGAK
FT                   IIQMAKQLVDDIGKPLELDTDGIWCCLPRAFPETFTFTLPNKNKGYKISYPCVVLNRMT
FT                   ALQNTNDQYQTLKVVDGKSSYEVSSEMSIEFEVDGPYKAMILPASKEEGVLIKKRYAVF
FT                   NEDGSLEELKGFELKRRGELKLIKVFQAEVFDYFLKGETLEEVYKAVGNIGNRWFDMLK
FT                   TQGRNFDDEELLEFISESSVMSKPAIDYGDRKSTSLTTAHRLSQFLGADLIKDKGLVCK
FT                   YIISKKPLGAPTSARAIPVSIFNAETAVARAYLKEWTKDALPGADDEMPNMREMVDWEY
FT                   YKTRLAGAIQKIISIPAALQGVENPCPDVKHPDWLHKRIREKNDKFSQRNLKTMFQTQF
FT                   ANGAPLAGKDLNILDIEDGGAKSTPTRPRVRTFRRDGDAPQTPDQRATPSGEAPKTPGS
FT                   ASASAAAPDRATDYDGWLKHYKSKWKTLRANIKRERVEDEKERAQIEREGGVMRRKRRS
FT                   GAFGLESFVESREETIAHSTMHIIQVEQTQVPGIFAVWVLVNGTMQVIKVDVPRRLVIA
FT                   TRETDREGDLGLEGKRRITATLPRGFIAPHLYEINVQERNFASGLEIAALLADPSVIGV
FT                   YEKNVPLIDRFIYNIGCVMAVKKSEQKRALDIGDESYGMNMFQMKATAEVSSYLPKLSH
FT                   ITFYFAGVSGDKGRGIYVLHNSRESKGTVIVHQPGKGVREVTPELWSSFMHSMSGDEQT
FT                   DDEARAEAASKWNVLYARNMEQVGKHLNHAIGAYISASSGGTVLLVQAPPGAGVDPAQD
FT                   TSSVREGLAGRLSALMPASGRLPIVFRPPNLSDSDLSTDAARGWQLDAAKIASARVVES
FT                   AEWLKEHVEIASYAHIPVGNLKSDWWVHTADAFFARTLHDAEQVLWTGPGGEPDLGGGA
FT                   SAVSLSGLDDAYGASRMEVTAPGAYRSVCVELQVHHLAVCAISKSSILNDLEQGALLGF
FT                   ETGTKGTTRMGGHEAAGAFKTLNKLVDNWLRDATDHHNTYADQLLSQIHRWLFSPSSAL
FT                   RDPALKNLVELCMKKVFTLLLAELRKLQVEVVYADMRRIIIATGKHDLASASACVEGLK
FT                   TALHQRELFSWLQLDRVKQWHSLLFRGPFDYAGISAVNLPGESHEGALDMHWNIARFLP
FT                   EAIQDHFHAIIGEFLLLPWKHDKEESDDKVIWLEQQLESHFGPKLLRYAQDIQRVLGLA
FT                   GPRSPPEHQFPSPPGANLSKKLRGTPALAFVRTVIAVLSLDARVEGPVSLLRRNALKMI
FT                   QVAEFSPEAEFVEPCVSFTLRDVICSACSDCRDLDLCRDPDLAAGHWACTARDDDHGPP
FT                   CGQPYDMQWIEGALVAEVNERVRKYQLQDLKCARDGRIKVGHLANRCACGGLYACSAKP
FT                   GALGDDLRVFSNIADAHDFKILRDTVDWV"
FT   gene            complement(<365196..>366524)
FT                   /locus_tag="OSTLU_26513"
FT   mRNA            complement(<365196..>366524)
FT                   /locus_tag="OSTLU_26513"
FT                   /product="MFS family transporter: multidrug efflux"
FT   CDS_pept        complement(365196..366524)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26513"
FT                   /product="MFS family transporter: multidrug efflux"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26513"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98781"
FT                   /db_xref="GOA:A4S4S6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4S6"
FT                   /protein_id="ABO98781.1"
FT                   /translation="MSGHACASPVLPMLAREFGANATEIGATMSAFAAGRLLFNLPCGW
FT                   YADAVGRRPLMIAGPAATTAGMAWSYCSTGLGELLCARAVAGIGSSMYMSGATAMLADL
FT                   STRHTRARILGANQAAVLAGAAAGPALGGAIAGADGMSIRSPFLAVGALSSFASVYSFA
FT                   RIEETRPESVKPEREFAASKHWYCDGHPIEDTKMCLELDEFGKPVVHRDGQVYELLETK
FT                   SPDGAATTTAVDPATAQDAAMGRLVKSMDFWAVCGLNAALFFSGAGGRGTLLPILAYQN
FT                   FGFTPESLGALFSAMAVTSLLGLGPASALTDAVGRKAVIAPCVVASAASVALMGTTTDP
FT                   TAFTAASILWAASGSLMGTAPAAYAADISPKNIRGSALAIYRTCGDVGLLLGPLALGAL
FT                   ADEVGIPIALGVNAALLTISGGVFHFTAREIRRKAQTAAAKIS"
FT   gene            <367155..>367943
FT                   /locus_tag="OSTLU_26514"
FT   mRNA            <367155..>367943
FT                   /locus_tag="OSTLU_26514"
FT                   /product="predicted protein"
FT   CDS_pept        367155..367943
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26514"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26514"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98611"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4S7"
FT                   /protein_id="ABO98611.1"
FT                   /translation="MVGTTTRADASGTTARTAKGERRGVAFFDLDHTIIDVNSSWLWVK
FT                   SEINSGRVGMSLIGTALYWFSRYAFGYGDGAETAGRDAASIYRGEDERMFRERITEFFR
FT                   MELAHRTRPGFKAVLEAHKANGERCVMCTSTWQHPAAIGAEIYGLETGEANVVSSIMGV
FT                   DEDGLMDGTIQVVAYGDGKYETTKKWCELNGVDLKECYFYTDSMSDVKLLENVGYPVCV
FT                   NADARLKKHAAERGWPTVDWGMSDSGMKKPRYGACLSCSA"
FT   gene            complement(<368027..>368728)
FT                   /locus_tag="OSTLU_93455"
FT   mRNA            complement(<368027..>368728)
FT                   /locus_tag="OSTLU_93455"
FT                   /product="predicted protein"
FT   CDS_pept        complement(368027..368728)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93455"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93455"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98782"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4S8"
FT                   /protein_id="ABO98782.1"
FT                   /translation="MRNPAPFITASASSARGALARRDRAREDDDAVLEYWARVRAGVEP
FT                   APRPGAEAKRNKRLCAHLESHLDDVLAHAGAGGADEGRSRLANEAATALEVGEHLAHDD
FT                   VMELKRRAREQRGEALSAREVARLKSLAGGRTRREASPEAAYASPEAAYAMPEAPAGEV
FT                   FEEFDDDEDDEGEFFEYGRSELPRHMRDWYEPPASEYGSFVENQPAAGATTSLDEQKYA
FT                   TVRNLRSHALW"
FT   gene            <370557..>371334
FT                   /locus_tag="OSTLU_26516"
FT   mRNA            join(<370557..370772,370882..>371334)
FT                   /locus_tag="OSTLU_26516"
FT                   /product="predicted protein"
FT   CDS_pept        join(370557..370772,370882..371334)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26516"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26516"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98612"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4S9"
FT                   /protein_id="ABO98612.1"
FT                   /translation="MPSARELSQNVRNLSGPMSGAARRAKGAMRPGNGGRGARNRADDV
FT                   IERRRKIEREMKSQMVEKEVESLVKKRARRALDVERIDLRDGSILFKFKVQNEPAVSAE
FT                   EERLLAMEVEKRLWGDTKTNDNVIARWFMTVKYLASTLSFENALVYVATTPFRMVFWSL
FT                   AYVLRAVFWIVTGRSGVSVRASGRAKRQLRQINTVVTTGPERGFNPFGSVKSRPNWRAE
FT                   "
FT   gene            <373504..>376047
FT                   /locus_tag="OSTLU_193"
FT   mRNA            join(<373504..374334,374368..375476,375555..>376047)
FT                   /locus_tag="OSTLU_193"
FT                   /product="predicted protein"
FT   CDS_pept        join(<373504..374334,374368..375476,375555..>376047)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_193"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nucleic acid binding; helicase
FT                   activity; ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_193"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98613"
FT                   /db_xref="GOA:A4S4T0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4T0"
FT                   /protein_id="ABO98613.1"
FT                   /translation="RKLLELELAKESTKEWLGMQEIRRKLPAHNLKSVVLEAIESSNAA
FT                   VVSGATGCGKTTQVPQFIFEEAIRAGKAGDTSIIITQPRRLSAIAVAERVANERCERIG
FT                   DTVGYSIRLESKQSEKTRMLFCTTGILLRRLQTDPNLTGVSHVVVDEVHERDLLSDFLL
FT                   VILRSLAARRSDFHLVAMSATVNADLFKNYFESHLKTTCPVVEIPGRTFPVAEYRLEDA
FT                   IEATGYVCEPDGEFALGVEQSRGGRIFKMAGGGGARGAALREAVEESFERSAMSEYSET
FT                   TWKSLQVIDEEKINYELMELLVALIADEYEEGAILIFLPGMAEIRTLHDRLRANLKDSE
FT                   SRFLLIPLHSTLSSEEQRLTFNKAPPGKRKVVMATNIAETSITIDDVVFVIDSGRVRET
FT                   QYDPVSRMSALVTAWCSKASSRQRRGRAGRVREGYCFHLYSTKTEATVLADFTTPEILR
FT                   TPLDALCLQIKILGLGDIRKFLSMAIEPPPEGAIASALKSLHELDAVDSKDELTALGHH
FT                   LAELPVDARLGKMMLYGAMFSCLDPILTIAAGVGFRSPFLAPMDKRDEADAAKRKIAAQ
FT                   ASDHLTLVRAYAGWIHARAKGRGFERDYLSKLFLSGQTLKQISEMRQQYTDLLDQIGFL
FT                   RSGAGALGAVSAVNAGNESLVRAVICAGLYPNVALASAPAKTDDGRARSRYPTSSVAVR
FT                   TKHDTDVHMHPTSVCYGMSPSVDSRFLLYHEKVRTTKVYIRDATAVGSYPLLLFGGKIK
FT                   INHERSSATCDNWINFRAAPRVAVLFKHLRAELDALLMEKIASPDMDISHRRDVVKSI"
FT   gene            <376248..>377477
FT                   /locus_tag="OSTLU_26518"
FT   mRNA            join(<376248..376538,376830..>377477)
FT                   /locus_tag="OSTLU_26518"
FT                   /product="predicted protein"
FT   CDS_pept        join(376248..376538,376830..377477)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26518"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26518"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98614"
FT                   /db_xref="GOA:A4S4T1"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4T1"
FT                   /protein_id="ABO98614.1"
FT                   /translation="MLRRALLRSRSSIALNASRALAPSFKARALSTDDDAKAKTRAQAE
FT                   AEAAKKINAGASPLFSWTEVDVSNADRTIPRWQNAAFVVVVGAFFAYFGNKLTSRAGRR
FT                   AARGIRAAATDPATKISFPDTNSAGLTVLGAGCRVKRVAIIDVKIYALAMYVDADAARA
FT                   QKGKGLLNGDYDKELAIELARDVDGKTFMEAMDESLGPRIREIATNMATAEDEDGNFMA
FT                   SVAEAAEKAEEAAVDSLDAMRDGFSSLKLKQGTKMTITWTSNGCAIAVAGAAKMEFESA
FT                   EFAKALLDVYVGEGPVAPAAAQTFEKGLAAL"
FT   gene            complement(<377564..>379057)
FT                   /locus_tag="OSTLU_2732"
FT   mRNA            complement(<377564..>379057)
FT                   /locus_tag="OSTLU_2732"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<377564..>379057)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_2732"
FT                   /product="predicted protein"
FT                   /note="GO_function: - carbon-nitrogen ligase activity, with
FT                   glutamine as amido-N-donor; ligase activity; GO_process: -
FT                   protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_2732"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98783"
FT                   /db_xref="GOA:A4S4T2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4T2"
FT                   /protein_id="ABO98783.1"
FT                   /translation="ETVVGVEIHARLATRSKLFSGAASAYGGDANARVAPFDAALPGTL
FT                   PVLNAGAVARAIKLGIALEGTVQLKSSFDRKHYYYADLPHGYQITQQREPIVRGGIVRC
FT                   VGVENAREGDRDGGRTRRGWLTVGIERVQMETDTGKSQTVGAEAEAAQGTLVDLNRAGQ
FT                   ALVEIVSEPDMRSGEDAAACVEALQRMLRYLHVSDANMEEGSLRCDVNVSVRTAEERER
FT                   GVFGERVEIKNLNSLRSIVRAVKYEAKRHVDVLTAGGRIERETRAFDTNTGKTTVLRTK
FT                   ENLLDYRFTPEPDLPPLVLNPADVEAIANRMPELPNAAFERLMESGASESAASTIIAFP
FT                   STLKYYDTAVDSCGAAKASDVANFIANEIIGAARKDAGASHKEPLSSLPRAASARRVGE
FT                   LLGKVANGDLSGRMAKQVLEALMNSDERALAEIVEDVCGGGQMSSDDQLQDICRAVVDE
FT                   MPKEVELFRGGKSKLMGALVGEVMKRTNGRANPKDASKML"
FT   gene            complement(<379348..>379800)
FT                   /locus_tag="OSTLU_26520"
FT   mRNA            complement(<379348..>379800)
FT                   /locus_tag="OSTLU_26520"
FT                   /product="predicted protein"
FT   CDS_pept        complement(379348..379800)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26520"
FT                   /product="predicted protein"
FT                   /note="GO_function: - oxidoreductase activity; GO_process:
FT                   - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26520"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98784"
FT                   /db_xref="GOA:A4S4T3"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4T3"
FT                   /protein_id="ABO98784.1"
FT                   /translation="MSISTRARATPTLGRRARATRTNALRDTGVTRDGLRAAEKQRVVV
FT                   DVDGVGKVLLQEFANDVYAVSNKCPHLGLSLQGKTPLLSATVSDGAIACPAHGSAFDLK
FT                   TGEARGEWCPKLPALPVVGKKYCGEPTAIASYAVSVDESGAIKIDA"
FT   gene            <380186..>381829
FT                   /locus_tag="OSTLU_26521"
FT   mRNA            <380186..>381829
FT                   /locus_tag="OSTLU_26521"
FT                   /product="predicted protein"
FT   CDS_pept        380186..381829
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26521"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26521"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98615"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4T4"
FT                   /protein_id="ABO98615.1"
FT                   /translation="MATARTATARTATVTTRRRARARSGRRAGARARRARARGEDEAAA
FT                   RDAGETATLAALALAPKEVVDAISVPAELVEVRAYVRWEEAGMPSDTTDAWRQREYDEA
FT                   LLDLKIELLRGTTMNEIRARYKMAPVEGGDAKMFNEDADLARRVKAAAVMKVRASVDEV
FT                   QGAHEETETIEFIESVVVEDAVVEDGEPEAAAADDDAEEAETVASEVEDAIAAAMENAV
FT                   AEDTDAIVDVFAALTEEEIADMEASFSAQATWSTREELVAAITATPSAEDDNEVDLLKD
FT                   LEETKLALSASEEALQKTKTELEDIEAEIVVLQATSDKALAEMKEGWAAEVSHLEAQLK
FT                   QAVARVGMDEGEIAAQIAKFERDAEEARRRVEALEAEKAVVAKQLEDTKVAQIKAEAVR
FT                   DANSEVILMLKKELESTKDELREMKSNSVSEKEFTAMQSELDRAWEAAAELQTMWDNDR
FT                   KVIEFLTKSIDDEKVKKEARQGLNIPVAAKGLLSWARTTISKRANDVSVVSQQTLETVS
FT                   QAYQELEASTGEFSDDVISDDSESDFMRDM"
FT   gene            complement(<382016..>382522)
FT                   /locus_tag="OSTLU_26522"
FT   mRNA            complement(<382016..>382522)
FT                   /locus_tag="OSTLU_26522"
FT                   /product="predicted protein"
FT   CDS_pept        complement(382016..382522)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26522"
FT                   /product="predicted protein"
FT                   /note="GO_component: - nucleus; GO_process: - cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26522"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98785"
FT                   /db_xref="GOA:A4S4T5"
FT                   /db_xref="InterPro:IPR004575"
FT                   /db_xref="InterPro:IPR015877"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4T5"
FT                   /protein_id="ABO98785.1"
FT                   /translation="MDLLARATRARQRVLAVFNARQSDFESLRAWNDHLERVEELIFNL
FT                   TEGVDASATESAIAEHKRRNASEIARYAARARDEGRAAMGETAEAMDAGEGYAPETANG
FT                   DVVAQPVPTSAVRRGLEKTSLDYDENTEEGRKARAAAIARACGFDGRAVAKARCLREAF
FT                   ATIWA"
FT   gene            <382792..>383127
FT                   /locus_tag="OSTLU_26523"
FT   mRNA            <382792..>383127
FT                   /locus_tag="OSTLU_26523"
FT                   /product="predicted protein"
FT   CDS_pept        382792..383127
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26523"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26523"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98616"
FT                   /db_xref="GOA:A4S4T6"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4T6"
FT                   /protein_id="ABO98616.1"
FT                   /translation="MTRTCAHGARVDARRAREACEACEACGTRRELWRCLTCGDASCGR
FT                   YANGHSRAHARASEGGCVVMLSWDDLSVWCHECESYVDPESSAALRACVAAAALAKFGD
FT                   RDGGGAV"
FT   gene            complement(<383927..>385510)
FT                   /locus_tag="OSTLU_44098"
FT   mRNA            complement(join(<383927..384070,384173..>385510))
FT                   /locus_tag="OSTLU_44098"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<383927..384070,384173..385510))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44098"
FT                   /product="predicted protein"
FT                   /note="GO_function: - ATP binding; metalloendopeptidase
FT                   activity; GO_process: - proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44098"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98786"
FT                   /db_xref="GOA:A4S4T7"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4T7"
FT                   /protein_id="ABO98786.1"
FT                   /translation="MEFLAYSVGGLAFMIGSIYLGIVRRTSVPQDQFQAMQFAQSRAGA
FT                   RRDGTVDVTLEDVGGLENIIEDLEEVVAFLKEPERFAKVGARPPKGLLMEGGPGVGKTL
FT                   IAKAIAGEAKVPFYSMSGSEFVEIIVGVGAARVRDLFKRARINAPCLIFVDEIDALGTK
FT                   RAAAGTRGTEEHEQTLNQLLTEMDGFTPDTGVVFIGATNRADLLDPALLRPGRFDRKVR
FT                   VGLPNVEARAKILQIHLSKRNCNPEIDTKRLAQNLPGLSGAEIANICNEAAVHCVRRQG
FT                   EQIEEHDVLDAVERVVSGIRLTAHPKESVTTRKLAAHEVGHALVQNLLHKSNGLIEDIE
FT                   MISIIPRGFEPAITLIQRKRDEDYRYPTRARMCERVQVLLAGRSCEKVLFGEASTRGSE
FT                   DVCEANDLLRNMIVNFGLGQPGMMTTYTYDPKHLNKSERRVARLQGAMVQILQEAEANC
FT                   LAIIAAHEDAVNAMVDRLIENETLSLAEFEEILAAH"
FT   gene            <386964..>387899
FT                   /locus_tag="OSTLU_4512"
FT   mRNA            <386964..>387899
FT                   /locus_tag="OSTLU_4512"
FT                   /product="predicted protein"
FT   CDS_pept        <386964..>387899
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_4512"
FT                   /product="predicted protein"
FT                   /note="GO_function: - cysteine-type endopeptidase activity;
FT                   ubiquitin thiolesterase activity; GO_process: -
FT                   ubiquitin-dependent protein catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_4512"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98617"
FT                   /db_xref="GOA:A4S4T8"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4T8"
FT                   /protein_id="ABO98617.1"
FT                   /translation="SGLTNGGNTCFAASALQCLRRATPLTAWFDGVEKFHDVARCAETR
FT                   KFCVVCEYSQHLERAMASRDAHSIGRLTKDISKVARQFRRGRQEDSHEFINALLDAMHV
FT                   IFLKDLGGEKKYDLRTRETTVIYHVFGGYTLGTVKCLECGYVSKNFQSTLDIPLEVTGK
FT                   IGSVEEALRENFCTEEVLSGSNKYKCSKCKALVRAKKGSKIHVSPNILTIPLKRYSTGR
FT                   FSKITKYIKYPSNFSLAEFMSDDAPYEVTAPEYELFGVLVHQDFYASAHSGHYVAYVKL
FT                   RDDSWVLCNDSRVSPSSEKDAMKQKAYILFY"
FT   gene            complement(<388507..>389273)
FT                   /locus_tag="OSTLU_17365"
FT   mRNA            complement(join(<388507..389144,389207..>389273))
FT                   /locus_tag="OSTLU_17365"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(388507..389144,389207..389273))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17365"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17365"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98787"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4T9"
FT                   /protein_id="ABO98787.1"
FT                   /translation="MGGKQSKRRERTIAIVCTSADSMDGHATGAWLEEIATPYYALLDA
FT                   GFAVDVVSVKGGKVPIDSASESGDFFTADCQKFYDDEDAKKALANAKALKGVKSGHYAG
FT                   IYLAGGHGTCVDFLNNATLTRVIEETLAADKPVAADCHGPVALLACKKPNGDSILKGTN
FT                   ATCFTDAEETAVGLAEKVPVLLETEFKKLGAQFNGAADWTPNAVTDGKLVTGQNPASSK
FT                   ACVDAFLALLKK"
FT   gene            <389564..>390091
FT                   /locus_tag="OSTLU_93459"
FT   mRNA            <389564..>390091
FT                   /locus_tag="OSTLU_93459"
FT                   /product="predicted protein"
FT   CDS_pept        389564..390091
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93459"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93459"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98618"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4U0"
FT                   /protein_id="ABO98618.1"
FT                   /translation="MTLADARDGDAAFEANRVAGNAAYDREAFVEATARYTECVEALEK
FT                   RLGSAEGEGTARRACAIRANRAACFVKRGKHALAMEDASWVIARPLEAGAGILAKALYR
FT                   RARAREGVGDVEAALADLRAAEKIDPHDALIQSALNNFTSVFHIAVVLDRASPEVLARQ
FT                   PAWRNFKPETRP"
FT   gene            complement(<391124..>392371)
FT                   /locus_tag="OSTLU_44108"
FT   mRNA            complement(<391124..>392371)
FT                   /locus_tag="OSTLU_44108"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<391124..392371)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44108"
FT                   /product="predicted protein"
FT                   /note="GO_component: - microtubule associated complex;
FT                   GO_function: - motor activity; ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44108"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98788"
FT                   /db_xref="GOA:A4S4U1"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4U1"
FT                   /protein_id="ABO98788.1"
FT                   /translation="MIRVRPALRRETREGRGAYQRAVAATRGGKACAASAGGERALAGN
FT                   GEGGTFADDGAHERQRTYEFGFDAVYDERATQEEVYARSAKPATLNALRGYNATVLAYG
FT                   QTGTGKTYTMEGDRGTMLAYGQQRFGLPGNAPVTDGRERGIIPRAIEDIFDYIAKDSHA
FT                   RSKYLVRVSYLQIYNETVSDLLKPERTNLNIREDKKRGVFVEGQSEWVVRTPSEIYGLL
FT                   ERGAQLRATGSTKMNELSSRSHAVFTIIIEHSTTEDDEPVDGVDVGEGAPAQRQSITVG
FT                   KLNLVDLAGSERVSLTGATGKRLDESKKINQSLSALGNVISALTDSKGRSHIPYRDSKL
FT                   TRILEDSLGGNCITTVIAMVSPALEAFAESLSTLKFASRAKEIKNTATLNEDLDQKSLL
FT                   RKYERELRQLRTELDTR"
FT   gene            <392946..>394637
FT                   /locus_tag="OSTLU_88630"
FT   mRNA            <392946..>394637
FT                   /locus_tag="OSTLU_88630"
FT                   /product="predicted protein"
FT   CDS_pept        392946..394637
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88630"
FT                   /product="predicted protein"
FT                   /note="GO_component: - cytoplasm; GO_function: - tRNA
FT                   ligase activity; ATP binding; nucleic acid binding;
FT                   GO_process: - tRNA aminoacylation for protein translation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88630"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98619"
FT                   /db_xref="GOA:A4S4U2"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4U2"
FT                   /protein_id="ABO98619.1"
FT                   /translation="MADALASTLDGLTLDGARHRYSKIYDRVPIESVLATAEKDAIGRT
FT                   IVVGGWVKTGREAERGALLFLAVNDGSGPGNLQVVVKSETYAELGELKTTGTSVVIEGE
FT                   LRAPPESAKGQAIEMHATRVLMVGKCDGATYPIAKKKQTLEFLREKIHLRPRTNTIASV
FT                   ARVRSALAYATHTFFNQNGFLYVHTPCVTQSDCEGAGEMFQVTTLLSEAEKPEALEATV
FT                   KPEEIEAKRAEVSACGGEIKSMKESGADSKEVKKAVKTLDKLKQELSQMESAARKIGGI
FT                   QRAEDGSIDYSRDFFGGKSYLTVSGQLQVETYACALSNVYTFGPTFRAENSNTTRHLAE
FT                   FWMIEPELAFADLNDDMQCAEDYVRFCCNYLLENCYGDLEFFAKMYDSTCIDRVKEIAT
FT                   TPFGRVSYTEAIDLLEKAVADGKEFVYPVSWGIDLATEHERWLAEEHFKKPVIVYNYPK
FT                   DIKAFYMRLNDDNKTVAAMDVLVPKVGELIGGSQREERLDVLERRMVECDLVPEEYSWY
FT                   LDLRRYGTVTHAGFGLGFERLILLCTGMENIRDVIPYPRWPNNCIS"
FT   gene            complement(<394731..>395417)
FT                   /locus_tag="OSTLU_93460"
FT   mRNA            complement(<394731..>395417)
FT                   /locus_tag="OSTLU_93460"
FT                   /product="predicted protein"
FT   CDS_pept        complement(394731..395417)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93460"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93460"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98789"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4U3"
FT                   /protein_id="ABO98789.1"
FT                   /translation="MRALAPSRVVAAPRRARKSRCRSTPRPDVAAPLQRVVEYAEDESS
FT                   WELHRGVPSEIQRDIDALIASARVDGGIDNAVRGDGDWRVFAAPHIVRLATPLGVLFHP
FT                   LRYVIRDGTISSDVRHRGRFVPDGWLSASGTVQAAESRVCEGMVRPACRIGFDTFWVGA
FT                   GASADEPRAGPGSGVVDKAINAVGKLGFVDAIATFPVLFYDERAGVVIFQFPPLKSNIA
FT                   AFRRRG"
FT   gene            complement(<395461..>398985)
FT                   /locus_tag="OSTLU_26531"
FT   mRNA            complement(<395461..>398985)
FT                   /locus_tag="OSTLU_26531"
FT                   /product="predicted protein"
FT   CDS_pept        complement(395461..398985)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26531"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26531"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98790"
FT                   /db_xref="GOA:A4S4U4"
FT                   /db_xref="InterPro:IPR024298"
FT                   /db_xref="InterPro:IPR024880"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4U4"
FT                   /protein_id="ABO98790.1"
FT                   /translation="MGERATTPTRREEAAFATTPTTPRAREDAPTGFVEVANGDLGALF
FT                   GGCEGDDDWLTPTGGGGEVGASASASAGAEASAGAVRAAATATAAATYATNAPFASPAA
FT                   SRDDGMGFFDDLDAAEETVSAPAVIPFEARASGAAEAPARETYAASENVAEANEIASVA
FT                   AEARAPVIEATSFAPTDSAPDRAFYEETHAPAAEYPQAEFVGERETSDDFGMGMTSHAH
FT                   ATAYEQHAPEQYARQGFSQPLASASHEDQPNRALELREPPRSAYADYRENDVTADLSAP
FT                   PIVPAYSSENLHSRVSSSNSVSDMQAPPQTPPKPTFMVPTPIEDSPMAYVHAVPHALAS
FT                   ASPVPFTPPPRASAGYDTYEPARVAQPEYPPVPAPSANHGGYAPSYEAHSTQQLEYAAY
FT                   SETETLKPANYDDTDRSPHGRPQHVAMSFGFGGSLILSGPGYPGGRISHGTSIPPCSLR
FT                   VHSVGSMLKDGNTLGMSYVRSMEAFDGPLGNRRQADVTKMMDSALSSGGERQQSEVTLY
FT                   RVLQTMLRHKGEISTPGDLLGENRKGAVAELASVLAGDAQAASDGGWVSANVAASPLNP
FT                   SGEGDAQQIVQIENLLIAGRRGEALQAAVAAKLWPHALLLASHMGGRHYHETVSIMAKS
FT                   VCRVGSPLHTLEVVMAGIPQELTTSGVEAAPNVHGMQVPEVSQIRELLPRWREHIAILC
FT                   SNPAKGSDFVLKALGDELWCQNDITAAHVAYALSKQRPTPYSFNSRLCLIGADHRKFPR
FT                   TYVTPRAVHLTEIFELAVLGSNPQAQLPSLLPYKLLYAGALAEVGKLKPALAYVESVLK
FT                   SVRSLDRNSPEVNGALVGMLAAQMEDRLHNSLRGKTGRLADAAAGAAKVLVSGVKGLLD
FT                   RSVSSLFGDGGEFQASPLGPPHEPRPHTPPDAYQQQPVQMHHTLSSAHSQAAPVVQPPP
FT                   AHVARHERTPSGNLLRSMSSLFGGVAPKPQPANEPTMSQENVFYYDDERKMWLERGRAP
FT                   PKEAPPVGAPPLRSEQSAASEIAGPPPVMAPSTHAKQQGGVHTRYVSTFSTTSTPTVAP
FT                   QGFVPVAPNAGACAQAPAQFFMPSAVAPAHSAHSRNESSESQSSASYAAHERTASQDGF
FT                   YGYEASASESSHPPPAGAIPRPPTIDPALLAPSFATSAPLPVIHHTSASAAPSVDVVAD
FT                   DFTDLRLQ"
FT   gene            399429..400618
FT                   /locus_tag="OSTLU_25246"
FT   mRNA            399429..400618
FT                   /locus_tag="OSTLU_25246"
FT                   /product="predicted protein"
FT   CDS_pept        399875..400612
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25246"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25246"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98620"
FT                   /db_xref="GOA:A4S4U5"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4U5"
FT                   /protein_id="ABO98620.1"
FT                   /translation="MLCELLNDVLKKIVPEACHAVGKLPPVLSIVMDSAQKYASLEMRS
FT                   SALATAALGLDQMHVLGRPLHITRPAGYFDDPDAKRQVLNVEHVLPAPEKLQQVYDYLD
FT                   ARKIEESKSKDEAIERAKKMAVSVSESVAHAAAPTTAEATEYLCLENMVDVKTLLSARE
FT                   RKELRYDIEDECGKCGKVVRVVVPTPSDEEVERKAASRAYVYFARVGSAESAHKVMHGR
FT                   KFGGRIVQARYIEASEFEAFDKK"
FT   gene            complement(<400700..>401719)
FT                   /locus_tag="OSTLU_26533"
FT   mRNA            complement(<400700..>401719)
FT                   /locus_tag="OSTLU_26533"
FT                   /product="predicted protein"
FT   CDS_pept        complement(400700..401719)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26533"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26533"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98791"
FT                   /db_xref="InterPro:IPR024974"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4U6"
FT                   /protein_id="ABO98791.1"
FT                   /translation="MPRVNVLVRALDGRTRCVECDLDDRDRSRDLARVVDALRARDAAL
FT                   VPYGARVAFSRSARARGDATVRASDALIAHVTCGLLGGKGGFGTQLRASARRGTQTTNF
FT                   DACRDLSGRRLRAVNGEKKIAAWEAEKAERDAEAKAEKYLKSQAGGSGAARLRELEEKE
FT                   REAYHAESAKVSESVNDAVASGFKNAAAIEAAKRKKAKKGKAVVGNDDESESESESDED
FT                   FDDSALLFPAAKKARVVPAAPAPALARANEPEASTSQSPTLAPTMAPPVMEQKEEGPLD
FT                   LTRFDSAEALEAVGLERLKAELTAQKLKCGGTLRERAARLFLLRDNTRDEIDKKHWSK"
FT   gene            complement(<401868..>402896)
FT                   /locus_tag="OSTLU_26534"
FT   mRNA            complement(<401868..>402896)
FT                   /locus_tag="OSTLU_26534"
FT                   /product="predicted protein"
FT   CDS_pept        complement(401868..402896)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26534"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26534"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98792"
FT                   /db_xref="GOA:A4S4U7"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4U7"
FT                   /protein_id="ABO98792.1"
FT                   /translation="MSENAAFAVAGTCAIVFIGASCYFEEYVYKSLPNFDYYWTVALAE
FT                   LMVFALISSASSIADGTLFAKRKAPLELYALQALLLAAYSAVGKLCYKWINYATGTVLR
FT                   SSKLVFTMAISAVWLRRTYKPHQVVAASLLVVAVAFFGIAERELGSNEATMPTPATATT
FT                   NDGEAVLGLSEDVKLALGFGLSVVAIFLGSLQTNVSEHAMRNYGAGVRENILYTNAIGT
FT                   VFAFLFVVIFEGSGSITYLRTVKGAFVLLFARSVTFYFGAYFFSTLTRHFGATSATAVT
FT                   TVRKALTVISSFILFPKDKPFAGFFVYGLFFFLLSVLAESSLHIRAFFHRVRAGRRGEY
FT                   SL"
FT   gene            404163..406161
FT                   /locus_tag="OSTLU_46903"
FT   mRNA            join(404163..404717,404841..406161)
FT                   /locus_tag="OSTLU_46903"
FT                   /product="predicted protein"
FT   CDS_pept        join(404325..404717,404841..406133)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_46903"
FT                   /product="predicted protein"
FT                   /note="GO_function: - oxidoreductase activity; GO_process:
FT                   - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_46903"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98621"
FT                   /db_xref="GOA:A4S4U8"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4U8"
FT                   /protein_id="ABO98621.1"
FT                   /translation="MNEVEPEDVIKPGAVITFVVSSTGDGDAPDNCDTFFTRLKRKAKK
FT                   EKGEGAIGVQYAVLGLGDQNYSAFMAVPRQFSQTMENLGAKCFAKRGECDDTLGLYEQV
FT                   DAWTSTFWSHLEVARGNSHKLREGETIWLPKTTEVVANRVAPGPDSEGAYTVSSPYMAT
FT                   IHKREVLTNLKSDRRVLHMEFDLGSSGISYKPGDSIGIVPQNDAELVRAIVDRLGLDQA
FT                   AIFTLNWKKGDTNEHATHPLPHIHTPCTVKSVFTNYIDITGCPRKSLLRVLAEHCGNAE
FT                   EKDALLHLSSRGGRAEYETQIRAQSPTLLTLLNNYPSCCPPLAELLDALSPLAPRLYSI
FT                   TCAPEVAPTTPSVAFSVVRFQVPSGEHRLGVATNWLDEISVDDKCEHKVPVYIKPSLKF
FT                   GLPEDSSAPLVMIGPGTGVAPFRGFLQSRRAKAQKGGRLSEAMLFFGCRKADEDFLYEA
FT                   DWKSFTADGSLTKLVCAFSRETAEKVYVQHKIEEHATEVARLISEGAYVMVCGDGAHMA
FT                   KDVHAALVRVVAQAGVCGVSDVKAAEALLADFTKSGRYVRDIWS"
FT   gene            complement(406419..407535)
FT                   /locus_tag="OSTLU_25248"
FT   mRNA            complement(406419..407535)
FT                   /locus_tag="OSTLU_25248"
FT                   /product="predicted protein"
FT   CDS_pept        complement(406523..407386)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25248"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25248"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98793"
FT                   /db_xref="GOA:A4S4U9"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4U9"
FT                   /protein_id="ABO98793.1"
FT                   /translation="MNRCRRGDMCLRHPARLCAAVAVAIFDWRLVLVESYPTELRLDAR
FT                   CEGGMARVHPTRRAAGHGAPIDATNTSVLLSWANHTDVEDAQYDENEPTRQIPAAWTFP
FT                   PGKREYCDGCRLGLAASHEDPNSMMLITASAGSFHDQGVLLNGNVNRPATACSGRRMYT
FT                   TRKATVHNLIWCAPEKSASIETVEFHITASGGASMPFKRYVFVLQRNITLEPDEDLHGA
FT                   LCFASERSPQNSYFSCLTLVYVTLGLLATTMVSVWAVSTRARRSRCRYSALGAEALDRE
FT                   IEMPQT"
FT   gene            408008..409846
FT                   /locus_tag="OSTLU_26537"
FT   mRNA            408008..409846
FT                   /locus_tag="OSTLU_26537"
FT                   /product="predicted protein"
FT   CDS_pept        408043..409713
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26537"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26537"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98622"
FT                   /db_xref="GOA:A4S4V0"
FT                   /db_xref="InterPro:IPR011643"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4V0"
FT                   /protein_id="ABO98622.1"
FT                   /translation="MQIERRKRNARALCALVVSATLANTASAQLTYIAGYEPRSNVVQH
FT                   SQVDLDIRDIISSFPKWKGGDSIYNGGLLNDCTTVAGACNWNGTSSLYPTLWDGTCTHT
FT                   CPAADSANPGQKCTLSAADACLSTYGIYKYGKGSFKGNNKDDAASMRTLRGFATKLGDK
FT                   GASARVAAKNNPFINKMNKYWAKQGLNELTWGQDIIEAAFKGTCVKNGNSCVKSGGVNL
FT                   LDFGTVGNDFRVEVIKKGIIYLNIFPYVIWEFQDAINDCHGGDLGANDEIPGGGSVHAW
FT                   DEAVAFYTGSLEGILKGGNNGLASCDDGNCELQFQLSDYRCTNFGTCTADADGDPWSGY
FT                   SKNNEEIFKLFQQGEGEITEAAASSNTAATKCDLPDRTHEKAVTKMLVPFVQGCMRYLW
FT                   KTKDSQKAKEAGELFAFASAALPFIDAVDPVAATKLFTRAWKLDFTTYTYEETKQGIEG
FT                   TLSRLGAGEGIGTISCADIGDLVDSSDQLLAAGCTDPSSPSSSNNDTTLGLGIGIPLGA
FT                   IAITALVFVVLLWRKSSANSKRVEELTMQLRGPGKDFYP"
FT   gene            complement(<410384..>410542)
FT                   /locus_tag="OSTLU_26538"
FT   mRNA            complement(<410384..>410542)
FT                   /locus_tag="OSTLU_26538"
FT                   /product="predicted protein"
FT   CDS_pept        complement(410384..410542)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26538"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26538"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98794"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4V1"
FT                   /protein_id="ABO98794.1"
FT                   /translation="MSLAVAATLCTRDLRREHQRKQVSPSRAPSECSSADETASHALRS
FT                   LNVSGDA"
FT   gene            411139..>412578
FT                   /locus_tag="OSTLU_50814"
FT   mRNA            411139..>412578
FT                   /locus_tag="OSTLU_50814"
FT                   /product="predicted protein"
FT   CDS_pept        411373..412578
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_50814"
FT                   /product="predicted protein"
FT                   /note="GO_function: - oxidoreductase activity; GO_process:
FT                   - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_50814"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98623"
FT                   /db_xref="GOA:A4S4V2"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4V2"
FT                   /protein_id="ABO98623.1"
FT                   /translation="MATIHKREVLTNLKSDRRVLHMEFDLGSSGISYKPGDSIGIVPQN
FT                   DAELVRAIVDRLGLDQAAIFTLNWKKGDTNEHATHPLPHIHTPCTVKSVFTNYIDITGC
FT                   PRKSLLRVLAEHCGNAEEKDALLHLSSRGGRAEYETQIRAQSPTLLTLLNNYPSCCPPL
FT                   AELLDALSPLAPRLYSITCAPEVAPTTPSVAFSVVRFQVPSGEHRLGVATNWLDEISVD
FT                   DKCEHKVPVYIKPSLKFGLPEDSSAPLVMIGPGTGVAPCRGFLQSRRAKAQKGGRLSEA
FT                   MLFFGCRKADEDFLYEADWKSFTADGSLTKLVCAFSRETAEKVYVQHKIEEHATEVARL
FT                   ISEGAYVMVCGDGAHMAKDVHAALVRVVAQAGVCGVSDVKAAEALLADFTKSGRYVRDI
FT                   WS"
FT   gene            <412890..>414290
FT                   /locus_tag="OSTLU_2583"
FT   mRNA            join(<412890..413239,413282..>414290)
FT                   /locus_tag="OSTLU_2583"
FT                   /product="predicted protein"
FT   CDS_pept        join(<412890..413239,413282..>414290)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_2583"
FT                   /product="predicted protein"
FT                   /note="GO_function: - hydrolase activity, hydrolyzing
FT                   O-glycosyl compounds; GO_process: - carbohydrate
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_2583"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98624"
FT                   /db_xref="GOA:A4S4V3"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4V3"
FT                   /protein_id="ABO98624.1"
FT                   /translation="FPPSFAFGVGTSAWQIEGNGGDRPRSVWDAFVSELGEEKRVEAER
FT                   GIGFHERYAADAQMMADAGVKHFKMSLSWPRLMRADGSAIDEGFEYYQNVFGALRERGV
FT                   EPHVTLFHWDTPIVCEGAWVKDEILKDFEKYADAVFSRLGKGIKYWTTISEPKTVAEMG
FT                   YGAGLHAPGRRSVEEQLKVGHNMLRAHALAVALYREKYSQFGGKLSINLNSAWVEPASD
FT                   SPDDVRAAANAMDEELGWFADPIYKGDYPASMRARLGSFLPEFTEEERVLVKGSVDYFA
FT                   LNHYTSYFAKHVTDAQASSQLGLSGRPQPWEITLESEKSKKPIGKEAQSDWLHIVPWGL
FT                   EKVLLHIKDRYDDPAIMISENGVDIAERGDIAETLDDTTRVKFIDAYLGAAREAMRKGA
FT                   NVVGYFYWSMFDNVEWVDGRSKRFGLVYVDYDGKYGEKMKRYPKKSLEHFSSYM"
FT   gene            <415746..>416543
FT                   /locus_tag="OSTLU_93463"
FT   mRNA            <415746..>416543
FT                   /locus_tag="OSTLU_93463"
FT                   /product="predicted protein"
FT   CDS_pept        <415746..416543
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93463"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93463"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98625"
FT                   /db_xref="InterPro:IPR008547"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4V4"
FT                   /protein_id="ABO98625.1"
FT                   /translation="VRAIKLAPYCELLTRSNDAERPLAICVGWFGASLKHVKKYAAMYV
FT                   DANCDAVAIAPPSAAMLVPAAVDAYADVILRALARHVRGKCVVHVASNGGFIFAGNLML
FT                   KAANGDATARTIFERTKGVVFDCAPGNLRPDIVARAFAAVVGGASATSEPSPYFEVFAS
FT                   WLLGRRVLSERLLRIDELWGKAGAPESILLRCPSMFMYSEADVLISPREIEAFATLRQD
FT                   QTGHRSTLHKYDDAGHCEIGRDDYEDYKSKVTDFLERVVHSAA"
FT   gene            complement(<416586..>418775)
FT                   /locus_tag="OSTLU_44388"
FT   mRNA            complement(<416586..>418775)
FT                   /locus_tag="OSTLU_44388"
FT                   /product="predicted protein"
FT   CDS_pept        complement(416586..>418775)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44388"
FT                   /product="predicted protein"
FT                   /note="GO_function: - 4-alpha-glucanotransferase activity;
FT                   GO_process: - carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44388"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98795"
FT                   /db_xref="GOA:A4S4V5"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4V5"
FT                   /protein_id="ABO98795.1"
FT                   /translation="VWTIEFQVDASELPFEYSYALRDGDDVVEDARGARECSLSDDGDV
FT                   ANAVERRLIHRDGVFTHGGVWKGSGMALPVFSVRTAQSVGCGDFVDLRQMVDFASTTGM
FT                   SVVQVLPVNDTCVYGTFWDSYPYSSLSVHALHVMYLRVQELSGVTAELAEEIEAARVAL
FT                   DLKEIDYEATVKEKLSFARRAYYTDGEKVLASDDFQTFYKANESWLRPYGVFCVLRDLF
FT                   GTAEHWRWGVFATFSKEILDKIDCPGGDLYESTRFFFYLQYNLHTQLVTTAQYAKSKGV
FT                   ILKGDLPVGVDKRSVDTWMHPRLFRMDTSTGAPPDAFDANGQNWGFPTYNWETMAEDDY
FT                   AWWRARMQHLEQYFSAIRIDHILGFFRIWELPASATTGRMGRFRPSLPLTRDELAARGL
FT                   WDLNRLTQPYIQWHELEVLFGENVHEIAYRYMIEVDDQRGLWQFRREFDTEQAIFAATK
FT                   PRGDFPMHLNDEQLLVRAGLMQLFQNRCLLTDVENIDHFYPRFGLEETTSFQALEGWMR
FT                   DALRDLSNDYYFGRQTNTWRKQARKVLPALLKSTEMLVCGEDLGFTPMCVPPVMDELGI
FT                   LGLRIQRMPPVGESSEFGRPHTYSYLTVCSPSCHDTMTTRAWWEEDAERRARYDEMFQC
FT                   GNDDACTPSVMRRILTQHIESPSVLAIFPIQDVLALDERYAKRPALEETINDPTNPKHY
FT                   WRFRIHVACEELLANASFVKEIKDLVRVRSQTTST"
FT   gene            <419949..>421616
FT                   /locus_tag="OSTLU_44322"
FT   mRNA            <419949..>421616
FT                   /locus_tag="OSTLU_44322"
FT                   /product="predicted protein"
FT   CDS_pept        419949..421616
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44322"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44322"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98626"
FT                   /db_xref="GOA:A4S4V6"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4V6"
FT                   /protein_id="ABO98626.1"
FT                   /translation="MDREARTYATAWANELASTLSEDARALERRLFGDEGGASERGEDE
FT                   DEDASEEETVGTSGRKGKARADARVRRKTRRDWSKVPDEALPRVAVVGRPNVGKSALFN
FT                   RLTGTKRAIVYDEPGVTRDRMYVRAYWGEHEFMMVDTGGLENLPANPEGGPKTDTVGGV
FT                   EILPGMIEAQAAEAVREASVLIFVVDGQVGLTAADMDIFAWLRRTHSKIPLHLAVNKCE
FT                   STTKGEDQILEFWSLGDVTPLAVSAISGTGTGELLDNMCATLPPPPQVSEDENAEEEDI
FT                   PVTVAIIGRPNVGKSSLLNGLAGEARSIVSDFSGTTRDSIDTLVEDKYTGRKFTLIDTA
FT                   GIRRRTQVKSGTDGAEKLSVGRALQAMKRADVVVLVIDGTEGPSQQDFVLAERATQEGC
FT                   AIVLCINKWDLVDKDTHTMNKYTDDMRLKLRVFEYAEIVYTSALTGQRIQKILDAAQVA
FT                   SENHRKRLTTATLNSVVQEATLWKLPPSRNSRKGKIYYITQASIRPPTFVFFVNDPKLF
FT                   PDTYRRYMERQLRENIGFPGTPIRLLWRGKGVEKGPRK"
FT   gene            complement(<421771..>422349)
FT                   /locus_tag="OSTLU_26544"
FT   mRNA            complement(<421771..>422349)
FT                   /locus_tag="OSTLU_26544"
FT                   /product="predicted protein"
FT   CDS_pept        complement(421771..422349)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26544"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26544"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98796"
FT                   /db_xref="GOA:A4S4V7"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4V7"
FT                   /protein_id="ABO98796.1"
FT                   /translation="MDADASATTSGRATTSARGRGRGDGATTTRDAGEDEGARRRSAGA
FT                   VRRTSRASFDSDVARGDGEGGTKEKFECNVCFEVAREPVVTPCGHLYCWRCINTWLSVG
FT                   DNVACPVCKGEMTKDMLIPLYGFGANTARGGAKREGGGAPPLESAAGLATLLGLRSSDE
FT                   LSTEQASQLLLSRYLLAIGTLVIVCLLVI"
FT   gene            <422966..>424252
FT                   /locus_tag="OSTLU_2927"
FT   mRNA            <422966..>424252
FT                   /locus_tag="OSTLU_2927"
FT                   /product="MFS family transporter: sugar"
FT   CDS_pept        <422966..>424252
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_2927"
FT                   /product="MFS family transporter: sugar"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_2927"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98627"
FT                   /db_xref="GOA:A4S4V8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4V8"
FT                   /protein_id="ABO98627.1"
FT                   /translation="TRYRMVVVSLVAFALMLCNADRVIMAVAGVPLAAANGWGERAVGL
FT                   VQSSFLWGYALTPLVGGMLADRYGGKVVLGAGIAVWSLATVATPFAATSGGLAPLLVAR
FT                   AVMGLGEGVALPCMNNVISRWVPRTERSRAVAISMGGFQSGSMIGLLAAPALLARGGVP
FT                   GPFILFGALGLAWAAIWHFAATTYPKDCKMVGARELNYIVDSPGGALTSSSSTLKDAAP
FT                   PPFKLLLSKAPTWACIIANFVNNWGFFILLAWMPLYFKQVVGLNLREAAWFSALPWATM
FT                   AASGVVAGTLADNLINSRGWSVTATRKFIQGVGFIGPAICLIILAAYGAQMTAARAVTT
FT                   LTVACGCTAFTQAGFLVNFQEIGPKYAGVLHGMANTAGSIAGMVGTYATGAVLEATGGN
FT                   WSAVLYITAVVYALGAATWLTMSTGERVFD"
FT   gene            complement(<424821..>425231)
FT                   /locus_tag="OSTLU_17380"
FT   mRNA            complement(<424821..>425231)
FT                   /locus_tag="OSTLU_17380"
FT                   /product="predicted protein"
FT   CDS_pept        complement(424821..425231)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17380"
FT                   /product="predicted protein"
FT                   /note="GO_function: - DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17380"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98797"
FT                   /db_xref="GOA:A4RXW9"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A4RXW9"
FT                   /protein_id="ABO98797.1"
FT                   /translation="MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG
FT                   TVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGL
FT                   FEDTNLCAIHAKRVTIMPKDVQLARRIRGERA"
FT   gene            <425662..>425973
FT                   /gene="HFO3502"
FT                   /locus_tag="OSTLU_44220"
FT   mRNA            <425662..>425973
FT                   /gene="HFO3502"
FT                   /locus_tag="OSTLU_44220"
FT                   /product="predicted protein"
FT   CDS_pept        425662..425973
FT                   /codon_start=1
FT                   /gene="HFO3502"
FT                   /locus_tag="OSTLU_44220"
FT                   /product="predicted protein"
FT                   /note="GO_function: - DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44220"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98628"
FT                   /db_xref="GOA:A4RS62"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="UniProtKB/TrEMBL:A4RS62"
FT                   /protein_id="ABO98628.1"
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEETRGVLKVFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG"
FT   gene            <426411..>426860
FT                   /locus_tag="OSTLU_26548"
FT   mRNA            <426411..>426860
FT                   /locus_tag="OSTLU_26548"
FT                   /product="predicted protein"
FT   CDS_pept        426411..426860
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26548"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26548"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98629"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037898"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4W1"
FT                   /protein_id="ABO98629.1"
FT                   /translation="MVSLTKEQCGGTTARYAWTQSEDEIVVSFAAPADATSRECEVTLT
FT                   STAATVRVRGQTLLDGELTRAIVKDDSYWELESDGSQKVLRLSLTKLRRTCAKFHWPSV
FT                   CVGEPEIDVAAFGDPVMGVTGNLNGDAMKTMMEDVAAMRRDAEKN"
FT   gene            complement(<426906..>427712)
FT                   /locus_tag="OSTLU_17383"
FT   mRNA            complement(<426906..>427712)
FT                   /locus_tag="OSTLU_17383"
FT                   /product="predicted protein"
FT   CDS_pept        complement(426906..427712)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17383"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17383"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98798"
FT                   /db_xref="GOA:A4S4W2"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4W2"
FT                   /protein_id="ABO98798.1"
FT                   /translation="MSTPPTPTARRRARRRARATRLLALLAAVVARAVTRAEARATARR
FT                   PTTLTPGTRARDVELAFGRAHAYDVRDLKANTAYEVKVSYRATSAAAIAVELDSGWLGG
FT                   GGWFGGGGGWVGGTTSDGRTELRRRLLNVEKLVLSRRTLGEGMTRARVVVRAEREGVYW
FT                   AGATAPEYVTYDVEVQPLFAAGKFGEIPRQSLGMICVCVAFVALAIAGARFVGDDVVWR
FT                   ACDALDARKRQYAAAHASAADGLDDAMNVSLRETVPVPVTTITSDD"
FT   gene            427746..429458
FT                   /locus_tag="OSTLU_26550"
FT   mRNA            427746..429458
FT                   /locus_tag="OSTLU_26550"
FT                   /product="predicted protein"
FT   CDS_pept        427917..429389
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26550"
FT                   /product="predicted protein"
FT                   /note="GO_function: - metalloexopeptidase activity;
FT                   peptidase activity; GO_process: - proteolysis and
FT                   peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26550"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98630"
FT                   /db_xref="GOA:A4S4W3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4W3"
FT                   /protein_id="ABO98630.1"
FT                   /translation="MRAESARATFERGQDTLRVSYELHRENRARAVEAMRARGDGDGVV
FT                   AMTGGRQTRRYSTDNEPLFRQESYFHWMFGVLEGDCHGALDARTGKSTLFVPRLPQEYA
FT                   IWMGAIETRESFAERYLVDEVMYADEFEGYLKALDTKIYVLKGVNSDSGDVTDGLGAEL
FT                   EAALGATKIDATDALFNVITELRTVKTAREQEVLKYASKISSMAHVEVIRSLKPGMMEY
FT                   QLESLFKHTCYSRGGMRNESYTSICAAGKNGATLHYGHAGAPNSAQIKEGDLVLMDMGA
FT                   EYHCYAADITTTVPAGGKFTPDAKIIYEGVLAAHQAVLKALKPGCAWLDLQRLAETHIL
FT                   RALVDGGFLVGDIDEMMAKRVSATFMPHGLGHHLGVDTHDVGGYGLPGTPARSTEPGLK
FT                   NCRTASLMKEGNVMTIEPGCYFIDVLLDRALADGSDIKQYFVADRVNACRSMGGVRLED
FT                   NVVVTADGCQSWTSVPRTVAEVEAVMAGASWP"
FT   gene            complement(<429483..>429896)
FT                   /locus_tag="OSTLU_26551"
FT   mRNA            complement(<429483..>429896)
FT                   /locus_tag="OSTLU_26551"
FT                   /product="predicted protein"
FT   CDS_pept        complement(429483..429896)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26551"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26551"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98799"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4W4"
FT                   /protein_id="ABO98799.1"
FT                   /translation="MASRRGVPAGTPRHFATMSARDAETRAPATARGGTAVPAHVLEAI
FT                   YGTTTTTTTTTTTTTKTTVVETATKAARYDESLKTWWRTYSERKNDEEEEHVADSLLYD
FT                   YRHLPRTTPAPNFREDRLAPTSTKETKETKETK"
FT   gene            <430186..>431022
FT                   /locus_tag="OSTLU_93465"
FT   mRNA            <430186..>431022
FT                   /locus_tag="OSTLU_93465"
FT                   /product="predicted protein"
FT   CDS_pept        <430186..431022
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93465"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93465"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98631"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4W5"
FT                   /protein_id="ABO98631.1"
FT                   /translation="VYAEEEEDRDDGVDWDGLPPGADPFGTNKKGGRERGMRKRNQVMT
FT                   FVKHLRALLSLRGRREIKRCVDFGCGTGNVLMTCAATFPEIDFVGVDLNATSIEILNSR
FT                   IRKSGLTNVSAVVGLIEDGDTFGADCALALHVCGSATDRVLNSAVRARIPFVIAPCCVG
FT                   KVQEGGMRSLNRMRNDLISLDKIEDIERPRSRLMRAAGFDFEAYMSAATLADWSGHQGV
FT                   DPSDPNEPLAALPRRAKSAIEADRGEFAREHAYDVTLHKMPAQSGIRDDVLVGIPL"
FT   gene            complement(<431367..>431900)
FT                   /locus_tag="OSTLU_10480"
FT   mRNA            complement(<431367..>431900)
FT                   /locus_tag="OSTLU_10480"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<431367..>431900)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_10480"
FT                   /product="predicted protein"
FT                   /note="GO_function: - RNA binding; pseudouridine synthase
FT                   activity; GO_process: - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_10480"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98800"
FT                   /db_xref="GOA:A4S4W6"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4W6"
FT                   /protein_id="ABO98800.1"
FT                   /translation="RVLYENDAVVIVNKPPGVSFHSEFEPGALARLRASRDAREERLRA
FT                   VHRLDKGTSGTLVFAKTADAAKKLSDGFATRAIVKYYVGISGKKPKKKMGTVTGDMARA
FT                   RRKAYKLTNTKDNPAVTKFVSFGAKGRRMFIFRPLTGKTHQLRVCAKSLGAPLLGDDVY
FT                   SGAVAERCYLHACAI"
FT   gene            <432190..>433293
FT                   /locus_tag="OSTLU_44277"
FT   mRNA            <432190..>433293
FT                   /locus_tag="OSTLU_44277"
FT                   /product="predicted protein"
FT   CDS_pept        432190..>433293
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44277"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44277"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98632"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011084"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4W7"
FT                   /protein_id="ABO98632.1"
FT                   /translation="MASQTGAIKRLASKAFRGVNVDGFAFQSPDVRCYVLTHFHADHYC
FT                   GLSGSFGKDGDEAKIYCSEITARLVVEFLGVKRERVVGCELGRGTTLRGAGTRGDDVEA
FT                   TFVDANHCPGACLVFFRNKITGETLLHTGDFRAAARVRNDGTLRELLTTCRDGSVDEVM
FT                   LDTTYCEKKWTFPDQDVVLNKMRQIARDELAREPRTLFLCGSYSIGKERAIQAVCQGAQ
FT                   SRASVTARRKKSLELSGWWRDDAFVCEDDDAEEAARCQVRVCGLGKGSNHRAMMEIMAK
FT                   EAPRWRAAVAFSPTGWSYTKKMDEDGFNVNPWIENEGRTRTYAIPYSEHSSYTELREFI
FT                   KFLKPKKITPTVNAITPKDREKLVNKHF"
FT   gene            <434200..>434982
FT                   /locus_tag="OSTLU_5051"
FT   mRNA            <434200..>434982
FT                   /locus_tag="OSTLU_5051"
FT                   /product="predicted protein"
FT   CDS_pept        <434200..>434982
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_5051"
FT                   /product="predicted protein"
FT                   /note="GO_function: - protein kinase activity; ATP binding;
FT                   GO_process: - protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_5051"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98633"
FT                   /db_xref="GOA:A4S4W8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4W8"
FT                   /protein_id="ABO98633.1"
FT                   /translation="GSSGEAFLASWRGARVVVKTMKLLHDDDAARRALARRAFVRECEI
FT                   MARLRHPNVLAFYGANANGRDASVVCEYAPGGTLKQWLHENKGKKRSLSARLGMALDIA
FT                   RAFAYLESRTPRVMHRDLKPSNVFVSVDGRALVADFGLARFVAPRGEDLTGETGTYIYM
FT                   APEVIKSQHYDERADVFSYGILLYELVTGIEPYQPHHFTGIQIATAVADRAFRPKIPDS
FT                   THAGLTAIIEMCWQQDASNRPSFERVRESMETMVPDILK"
FT   gene            <435405..>436031
FT                   /locus_tag="OSTLU_7168"
FT   mRNA            <435405..>436031
FT                   /locus_tag="OSTLU_7168"
FT                   /product="predicted protein"
FT   CDS_pept        <435405..>436031
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_7168"
FT                   /product="predicted protein"
FT                   /note="GO_function: - trypsin activity; GO_process: -
FT                   proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_7168"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98634"
FT                   /db_xref="GOA:A4S4W9"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4W9"
FT                   /protein_id="ABO98634.1"
FT                   /translation="CGGTLISNVHVMSAAHCFFDRAGVSNVGAYSSVVVRFGAHADVNA
FT                   GAMTASVVRIDGHPEFSDITWDNDVSVLTLSSPVDVASYPPVVLAWNPADINVGQIAHV
FT                   VGWGTRDDNMLSKVMMEGTVPIVSHAQCTAAGSYAPSEILPSMVCAGYAQGGVDACQGD
FT                   SGGPLIQNSKQIGIVSWGEGCALPQKYGVYFAVRAAQGFLALATDS"
FT   gene            <436593..>436802
FT                   /locus_tag="OSTLU_26558"
FT   mRNA            <436593..>436802
FT                   /locus_tag="OSTLU_26558"
FT                   /product="predicted protein"
FT   CDS_pept        436593..436802
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26558"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26558"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98635"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4X0"
FT                   /protein_id="ABO98635.1"
FT                   /translation="MQEFEAAKSAILKVKPSANVIANRVDAYPITVRVSVGEREVWSGR
FT                   QQLLFRKNGRPAMKDIEEAMRKLG"
FT   gene            complement(<437152..>438339)
FT                   /locus_tag="OSTLU_88641"
FT   mRNA            complement(<437152..>438339)
FT                   /locus_tag="OSTLU_88641"
FT                   /product="predicted protein"
FT   CDS_pept        complement(437152..>438339)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88641"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88641"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98801"
FT                   /db_xref="GOA:A4S4X1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021883"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4X1"
FT                   /protein_id="ABO98801.1"
FT                   /translation="VRTATRTRASDESSSTTTRASYADAATAVNEGLRLFERGEHEAAT
FT                   RAFTRALEMKPNEDEARAASYNRACGYVKMNMYDEAKDDLIAAVNVHNLKFKVLTSDPD
FT                   LDAFRASTQYGEVAAAVKGGRGASTMVNLRAEAQEPFRFFKLYLFGGLAAGAGLGLFII
FT                   GTRLIKAVQGGEGAPDLTETVTNLGINTVGLLAFSVLLRGELQGREKIIQKVEREEELG
FT                   RLGVTLGDGDKNVLFSRLRGSYRVFIVAGSEEHITKTLESLERFKEKLTKNKIVILPVA
FT                   MDESGEESGDELPFGQRRRKAKTSKTTELTASAAAALLGGDKKLKLMPVDNGAWKRWII
FT                   NQIESSGFDPTVRDVFFGVAKNGTIWKSGAGIPNWMKLFEDLPDEDSIQGKVTGV"
FT   gene            <439033..>439692
FT                   /locus_tag="OSTLU_26560"
FT   mRNA            <439033..>439692
FT                   /locus_tag="OSTLU_26560"
FT                   /product="predicted protein"
FT   CDS_pept        439033..439692
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26560"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26560"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98636"
FT                   /db_xref="GOA:A4S4X2"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4X2"
FT                   /protein_id="ABO98636.1"
FT                   /translation="MDVLAFRRLSAMMNTFEKNVETHGIARQVVVITAGADTRAFRLPF
FT                   PSGTAIFECADGTVHTKAAAVMKKVGAKPSKGCSHRRVPVDATATDAAYGDLEERLERA
FT                   GYRPDVRSLWLVQDVHAWDHSRLSNFITESADLMTTGSELIIDASALTSTDDIIRREFA
FT                   SNGVMPEVVRIPADEGREPIRLVLGCAQRVSLKESEYYREQLRAAEDEADEDGFED"
FT   gene            complement(<439736..>442948)
FT                   /locus_tag="OSTLU_88642"
FT   mRNA            complement(<439736..>442948)
FT                   /locus_tag="OSTLU_88642"
FT                   /product="predicted protein"
FT   CDS_pept        complement(439736..442948)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88642"
FT                   /product="predicted protein"
FT                   /note="GO_function: - monooxygenase activity; GO_process: -
FT                   aromatic compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88642"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98802"
FT                   /db_xref="GOA:A4S4X3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011632"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4X3"
FT                   /protein_id="ABO98802.1"
FT                   /translation="MGKKERAKARARALEVGGMSRADARAACGLGATPAPAARKTNAMT
FT                   TMGTTTGGSGGARRGNAPSPALLTANVKNARSLREVYALRDESAGRMNHIHLSAVWTSV
FT                   GRMRCDGERASSSDGDGMNDAHERLIAHTIEFVRDERSKMGGRELANVAHGAAKGGGSE
FT                   ELFAALAKAIERHLGGIDRGQELANIAWAFAKADYKCERLFSALARMAERHAERFNSQE
FT                   LTNTCWAFASVGHADARLFKALARCVERRLGEFNTQGLSNTAWGFAKSGFVDVGLFRAM
FT                   SQKAQERLDDFNAQDFSNLIYAFAKAGQYDAKLFTTLAKHAERHLSALNAQGLTNTVWS
FT                   FSKCGHLDAELFSKFGRSIERRMTANASEFNSQDIANTAWAFGKACHHDEKLFTSLASL
FT                   SERCLADFNTQDLVNTTWAFAKLGRYDAKLFVAARKSILDHRLNDLDAPNIANIVWTFD
FT                   QASQLSEALFVALASAAEHQADNFNAQDLVNVAWTFANSGQVNDALFTALARSVKRLMD
FT                   EFSDEELNNLEWAFTTAGQHSVVKHLKQQRHGANNEKYGPPVDVSKCGRVIIAGGGIGG
FT                   AAAAVALQSKGFDVIVLESDESFDARAQGYGLTVQAQDAIQAMGVDISQDDAPSTSHYT
FT                   FDAEGHIIGFFGEAFGAKSRERREVQNSGRFIHIPRQVLRSRIIEAVQPGTIRWNSKLK
FT                   SFVARENGVSVASTDGTELDGALLVGSDGIFSTVRRHLDLPGDRLNYVGLCVVLGIVDE
FT                   KIMNVPLAHRRIFETVDGATRLYAMPFTTTSTMWQLSFPCSEETARQYTKDATTLKEEI
FT                   VRRCAQWHDPVPDLLRNTPLDCMSGYPVYDRELLDPVLLRPTDESKRRVTLIGDAAHPM
FT                   TPFKAQGANQAMSDAVLLADTLVDGVRKHGPNSGFDFALPIFEQKMLSRSSRMVVGSRE
FT                   KAKEMHSPLALQPARKAQREAEFDMQKTLRVLREKGIGAQNASDPRGLDDLIETEAISS
FT                   PLDSTSDHTAIDWMEQGGGDSQGKKVVFEDSEADEDAPEAEVKDKKRKTHEFKKEKKAK
FT                   KAKKEKKEKKEKKEKDGKKSKL"
FT   gene            <443047..>443763
FT                   /locus_tag="OSTLU_26562"
FT   mRNA            <443047..>443763
FT                   /locus_tag="OSTLU_26562"
FT                   /product="predicted protein"
FT   CDS_pept        443047..443763
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26562"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26562"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98637"
FT                   /db_xref="InterPro:IPR019331"
FT                   /db_xref="InterPro:IPR039845"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4X4"
FT                   /protein_id="ABO98637.1"
FT                   /translation="MAPGVEMVRVERAERAYDREKALGRDAASVFPSLARDGDGAADGD
FT                   ARKDDDDATRKKFVTESELERLRALGGSDGGDASGASDARNDDANAGKPLYQILAERRE
FT                   EKDREFQEQWASMKVGKNKPLDEEEVEFLDEIESERRAAETKRKREEDGELEAFKRAQR
FT                   GDDQGGMTTTKGDGETATTSAPAAVVARKRPSAGVRAKPKTAIASETKETDDASEGLGG
FT                   LLGDYGSDSDDDIADS"
FT   gene            <444496..>446874
FT                   /gene="HMA3"
FT                   /locus_tag="OSTLU_13063"
FT   mRNA            join(<444496..444612,444700..>446874)
FT                   /gene="HMA3"
FT                   /locus_tag="OSTLU_13063"
FT                   /product="P-ATPase family transporter: copper ion; heavy
FT                   metal transporting P-type ATPase-like protein"
FT                   /note="Has EST support"
FT   CDS_pept        join(444496..444612,444700..446874)
FT                   /codon_start=1
FT                   /gene="HMA3"
FT                   /locus_tag="OSTLU_13063"
FT                   /product="P-ATPase family transporter: copper ion; heavy
FT                   metal transporting P-type ATPase-like protein"
FT                   /note="GO_component: - membrane; GO_function: - ATPase
FT                   activity, coupled to transmembrane movement of ions,
FT                   phosphorylative mechanism; GO_process: - cation transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_13063"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98638"
FT                   /db_xref="GOA:A4S4X5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4X5"
FT                   /protein_id="ABO98638.1"
FT                   /translation="MLDVHGMHCGGCAASVRKILEGDDAVRSASVNLANESAMLAELVT
FT                   AAGFPTSLRDAGGVAVAGVTGAEATKLKRDERLRRIKESTQRVIVAWALASACLLGHVS
FT                   HFFHASAPWLRVLHSNPVHITLSLFAMAGPGRQILIDGWQSLRRGGPNMNTLVSLGAMA
FT                   SFSMSTAAMMLPGLGWPTFFEEPVMLLAFVLLGRAVEERAKLQATSDMSALLNLVPETA
FT                   RLVSSTSTANGDEPYYRTVPTSVIEVKDKIIVLPGDRIPIDGTVVSGCSTVDEAAITGE
FT                   PIPRPKKAGDTVAAGTVNCDGVLTIEVVSSGEETQVAGIVRMVESAQQREAPVQRLADQ
FT                   VSGKFVYGVMAASAATFTFWSTVGTKVFPGVLATAASATNAPILIALQMTASVLVVACP
FT                   CALGLATPTAVLVGTALGARHGLLIRGGDILEKANNLDTVIFDKTGTLTIGKPVLTETR
FT                   TSGGFSDAEIIALAGAVERNCRHPLALAITEAADKQGIPRHSVDEGTFKQEPGAGASAV
FT                   VNKKLVSVGTTFYIQGNNTVPMELINAVDNPGRTPVYVGIDGKIVGVLEMQDEIRKDAA
FT                   ETIKRLHAKNIQTIMISGDRLETAQAVGKLVGIDEKYVYGDVRPEGKAELVQDFQSKGK
FT                   CVAMVGDGINDAAALAQADIGIAMAGGVGAASEVASIVLLGDRLPQVGDAIDLSRATFN
FT                   KIKQNLCWAFGYNLIGIPIAAGALLPAYGLSLTPSVAGAIMGFSSLGVMGNSLLLKLKG
FT                   RELSKAEEDD"
FT   gene            complement(<446950..>447738)
FT                   /locus_tag="OSTLU_26564"
FT   mRNA            complement(<446950..>447738)
FT                   /locus_tag="OSTLU_26564"
FT                   /product="predicted protein"
FT   CDS_pept        complement(446950..447738)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26564"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26564"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98803"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4X6"
FT                   /protein_id="ABO98803.1"
FT                   /translation="MRTKTTKRFVVAHAAGKDNAVSELAAMDAVIDLMLASASEEELGK
FT                   IVVENVLMFDQKMWMRFASRSDTATESATKTKIMDTATKCMKLIEAMVEKTESTMEEAS
FT                   ESLQRVVGAAADPSSGEFDVPLRADALERMRNELQAVTVDERTLNTLYAWIRKSDENGL
FT                   DGMVHILQRLLQLYAARELDEKSSALDKVIRSNAEAWPTSFAEISNEGYNETAFAKDLQ
FT                   RRMEGVVLNLPNGSYAQRVQAEYLKEIEDRGKEFFAQAQK"
FT   gene            <448037..>448849
FT                   /locus_tag="OSTLU_44289"
FT   mRNA            <448037..>448849
FT                   /locus_tag="OSTLU_44289"
FT                   /product="predicted protein"
FT   CDS_pept        448037..448849
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44289"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44289"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98639"
FT                   /db_xref="GOA:A4S4X7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4X7"
FT                   /protein_id="ABO98639.1"
FT                   /translation="MASTSKSPRDDPIWTSLRAGAQALVDKEPLMGGFVYATILNQPTF
FT                   ERALGFLLASKIANATILAGQWNDLIMDAMNATNEGKNREYNGPGTGSIGDAARADLKA
FT                   IVERDPACPSYTHAFCFFKGFQGLQAQRVAHWLWGHQRKVLACKMQSLISEVYGMDLHP
FT                   AARFGRGIMIDHGHGVVVGETAVVDDDCTLLHGVTLGGTGKVRGDRHPKLGKRVVVGSN
FT                   ASVLGNIKVGHDCKIGAGAALMHDLPPRTTVVGHKGRVVTKKQITSKL"
FT   gene            complement(<448943..>451909)
FT                   /locus_tag="OSTLU_17395"
FT   mRNA            complement(<448943..>451909)
FT                   /locus_tag="OSTLU_17395"
FT                   /product="predicted protein"
FT   CDS_pept        complement(448943..451909)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17395"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17395"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98804"
FT                   /db_xref="GOA:A4S4X8"
FT                   /db_xref="InterPro:IPR019035"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4X8"
FT                   /protein_id="ABO98804.1"
FT                   /translation="MRPGRHFVDDPRCAREDMTKPRETTTTRARASSSSRPAIALGRPV
FT                   RAHVEPPPRTRAEARDGTRFPSEKLTRELVRRGYDEEKHREWRIARTVKTIDGKTTFDD
FT                   GTFMSPRALQEMLTRMATSETLKAIRANANEGAKETRRVPKRGRRDDGSYDVELRGEAL
FT                   KTWSAPELVHARAEESAAFFRDLASDVGLHALERRVPHGVRKRNLFETLHGYNVPIHRA
FT                   MWMVKVNYLSQCKRDFDACRRAWTEDLLAHIFDVLRDEEMVAQSGEGVETELKYVLALA
FT                   NYSVEEDLVDQQKYLHEFLRFMNEQKRQRTGSAHDFARALSPALRTLVPQASKSHADSV
FT                   GLVDRVSWCLQEILKERGQSDKYLVISLSDVVASVAAANMDAFVAAPRDGGLNIITNLR
FT                   RDFQRKKMPLSQRLCSVLDDVDNRVKSLAQAASPELITIKARNLIETLHKLLESNLDQV
FT                   ASRTIARKYIDREESEELAMKSMVKTSCDWCMDVSEDEAMKRRTAVRIFFVELAETSSR
FT                   LNIYVFDWIKERTMIVAREDYTKCISELLIELLWGKVVDLSQLLNFIMVEGIVEHKDSG
FT                   ASQKSLAAFREYMSQIVRNNDERESKLDDSMVRTLKQLLESANEMSDATISRALTPPHS
FT                   TADVSKHFEISTDEEKRLLELFHAVTYADLLSKLEELKCVHDEFKCSRDAHSVFSRVVV
FT                   GALVLKPSRVRLLAELVGGIGDDVTTDVLSYVGGRVCDDANVDGVLQGAYWDDSNAARR
FT                   WEIAQSLVEFRLCLLHNIVKRKRDAAIGIVKGAIQQLKELALSTRDVSHKLLLIWVQIL
FT                   TLIPLIGYVLMSNELKDDFLQLIVEVLDSFIGKTIVEESEEDLVAESFAGESLVDRLIA
FT                   LFSVIWRSEVPQWLPAIPKLPFWDVSSKMVPMTEFIDSKTLAGVVCVRLKRAIGGPARG
FT                   KLGDVNAWKTLASGASTLSARSKISEKAEFWLQGTVRRPGGNLAWENVSAEPNADHLK"
FT   gene            <452078..>453841
FT                   /locus_tag="OSTLU_17396"
FT   mRNA            join(<452078..452764,452798..>453841)
FT                   /locus_tag="OSTLU_17396"
FT                   /product="predicted protein"
FT   CDS_pept        join(452078..452764,452798..453841)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17396"
FT                   /product="predicted protein"
FT                   /note="GO_function: - amidase activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17396"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98640"
FT                   /db_xref="GOA:A4S4X9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4X9"
FT                   /protein_id="ABO98640.1"
FT                   /translation="MEKTTEADELGAFVEAAEDLSERLTTTTTTTTTTTTHRPLKNVKF
FT                   VVKDIFDIEGRRCGFGSPAFKRTGGKGGTAGAKRHARCVRTLLEAGASAVGMTTMDELA
FT                   YAINGENAHYGTPINPRARALVPGGSSSGSAVACAAALRGCEFALGTDTGGSVRVPASY
FT                   CGVYGIRTSHGSVSMRGVQALAPSFDTVGWFARSIDVLQRVGDVLLPEPDKHAPTEPSR
FT                   WLLLEDACAAVAAVTALHEIAPADFKRMNLTEHLLVGCPKFRSLVNGREDYGLDCLREM
FT                   VRVLMGAEIWENLGKWYTEEKPKLGAAVKARMEAASKLDADEVERLKEVREEVREEVDR
FT                   ILDGGAIFILPTTPGKAPKRGQSDQATESWRRKCFELLCIASLCGLPQVSIPLEAPNIE
FT                   GPQGLSLIAGYQMDKMLIGAARQIVPALVEAYPDILEAELERLNPPEAPGESEKTKGNE
FT                   ALKQGKYQDAIEYYSVAIGKNPKSKIFVANRAMAHLKLGNYQLAEDDCTEAIKLDARYV
FT                   KAYLRRAAARSVAGNYLEALMDYEEALRFEPNNSDAKREVYRMKKIIGMADPGMDVGDM
FT                   "
FT   gene            complement(<453876..>456105)
FT                   /locus_tag="OSTLU_43956"
FT   mRNA            complement(join(<453876..453995,454056..454391,
FT                   454444..454758,454837..>456105))
FT                   /locus_tag="OSTLU_43956"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(453876..453995,454056..454391,
FT                   454444..454758,454837..456105))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_43956"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nucleic acid binding; helicase
FT                   activity; ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_43956"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98805"
FT                   /db_xref="GOA:A4S4Y0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Y0"
FT                   /protein_id="ABO98805.1"
FT                   /translation="METLREGRERGGGDASTSDARKANGAPTGAKREEIDRVRKSLPIY
FT                   RAKDRLMEEIRKSETVIIIGETGSGKTTQIPQYVYEDMTLTNGLMIGVTQPRRVAAVSV
FT                   SRRVADETGTAHGTLVGYAIRFEDVSSEETRIKFLTDGMLLREAVGDPLLSKYGVIMID
FT                   EAHERTLQTDFLLGTIKGVQRRRRESLGEDQYGRALPPLRVIVMSATLEASSFSKFFDG
FT                   APVIYSRGRTFPVEMFYTEEPEEDYLDAAMWTVLQVNEEEAAGDVLVFLTGQEEIESLG
FT                   RMLREKASELPSNVLKLNVVLLFAALPPEEQMKVFEPTPLGTRKVVLATNIAETSLTIN
FT                   GIRYVVDSGLSKLRTHHPRSGVDELLVTPIAQSQAQQRAGRAGREAPGKCFRLYTEEIM
FT                   PSLEKYVKPELLRTNLSGVVLQLKAMQVDDILSFPFIDPPPKEALLRSLELLYSLDALD
FT                   DDGKLNDVGKKMARFPLEPMAARCVIAAEIEGCAIETLAVLSMLSTDSVFQFSREADGQ
FT                   KNVARHKLKRKEGDHLTLLRVFNEFSACSPKRSRDWCREHQINHRAMTKAVKINEQLTR
FT                   AAMSQGINLTSCEDDFTLVLRSLVSGFFMNTASKEMDGSFKVFTTGQKLTIHPSSVMFQ
FT                   SPPETILFNELVRTNKMYARDVSSIKKSWLSELASKTFSRRSTN"
FT   gene            <456546..>457265
FT                   /locus_tag="OSTLU_93468"
FT   mRNA            <456546..>457265
FT                   /locus_tag="OSTLU_93468"
FT                   /product="predicted protein"
FT   CDS_pept        456546..457265
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93468"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93468"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98641"
FT                   /db_xref="GOA:A4S4Y1"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Y1"
FT                   /protein_id="ABO98641.1"
FT                   /translation="MWTIRRRLRTTRIASLTRDALARALATAPAGDDARGVVLRCALRV
FT                   DGGTASSTRARREGRVPGVVFAPGSERGTMITVCEREMNAAVRKHTLAGVACEVFDLEV
FT                   QTTTATGEESGETRRVRALAKQVQMHAYNQMVDNVCFLEVKPETEVKVRVPVATQGEDV
FT                   SPGVKRGGFVQIMRQTVPVRCRSDSIPKRFLMDVSTLDAGKVIKIGDVTVPEGVKLLDA
FT                   DLNLPLVRIGGRVKSAE"
FT   gene            complement(<457349..>458800)
FT                   /locus_tag="OSTLU_44173"
FT   mRNA            complement(<457349..>458800)
FT                   /locus_tag="OSTLU_44173"
FT                   /product="predicted protein"
FT   CDS_pept        complement(457349..458800)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44173"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44173"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98806"
FT                   /db_xref="GOA:A4S4Y2"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR031127"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Y2"
FT                   /protein_id="ABO98806.1"
FT                   /translation="MIERAKALLDVRTEEAEALLSHFSYDFEAAATAWFEDTRKVRETS
FT                   GLIDAKTRRENSEAAMSSGGTRGCGICFEDFPGDALTTVGCAHEFCDECWSGWVTSKVN
FT                   DGLSVVNTRCPMCPAKVPESMIRKFLSDEDETKFDTFLRRSFLENNAKLRPCIGVDCEC
FT                   AIAVEQLPTNPVSVKCNCGAEFCFSCQSEPHVPVNDCEVAKKWMDKINSDGVNSEWMLA
FT                   NTKGCPKCHRPILKNGGCMHMHCSQCHCSFCWLCLGPWDSGPYACARRCNKYSGDKTGD
FT                   ENRRKRARDSLERYVFYYERYRAHEDASKKAEQDVERFKDSVLDILIDLQRTSKQQVVF
FT                   IMDALRQVTECRKILKWTYAYAYYEFADDQSKKEFFEYIQGDMERCLELLSRMIESDIK
FT                   PFLPPEPEDDEQKQNVSPPSTLTDELQDGKYQYAPEKQESLENDFALYKARLIDTTAVL
FT                   RKFTDTLVSEMAKGLLGARNIDKTD"
FT   gene            complement(<459185..>460131)
FT                   /gene="RPS19"
FT                   /locus_tag="OSTLU_44019"
FT   mRNA            complement(join(<459185..459535,460039..>460131))
FT                   /gene="RPS19"
FT                   /locus_tag="OSTLU_44019"
FT                   /product="Ribosomal protein S19, component of cytosolic 80S
FT                   ribosome and 40S small subunit"
FT   CDS_pept        complement(join(459185..459535,460039..460131))
FT                   /codon_start=1
FT                   /gene="RPS19"
FT                   /locus_tag="OSTLU_44019"
FT                   /product="Ribosomal protein S19, component of cytosolic 80S
FT                   ribosome and 40S small subunit"
FT                   /note="Cytosolic 80S ribosomal protein S19; Cytosolic 40S
FT                   small ribosomal subunit protein S19; GO_component: - small
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44019"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98807"
FT                   /db_xref="GOA:A4S4Y3"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038111"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Y3"
FT                   /protein_id="ABO98807.1"
FT                   /translation="MATKNAPRTVKDVPAQEFVIALAQYFRSTGKMEVPQWVDTVKTAT
FT                   YKELAPYDPDWFYIRAASVARKLYTKGNMGVGALRKSYCGAGNKGVRRHHHQIGSGSVA
FT                   RAVLKQLESIGVVEKDAKGGRRITPSGQRDLDRIAGRVSVPSF"
FT   gene            <460302..>460876
FT                   /gene="RPL29"
FT                   /locus_tag="OSTLU_26572"
FT   mRNA            join(<460302..460359,460652..460695,460805..>460876)
FT                   /gene="RPL29"
FT                   /locus_tag="OSTLU_26572"
FT                   /product="Ribosomal protein L29, component of cytosolic 80S
FT                   ribosome and 60S large subunit"
FT   CDS_pept        join(460302..460359,460652..460695,460805..460876)
FT                   /codon_start=1
FT                   /gene="RPL29"
FT                   /locus_tag="OSTLU_26572"
FT                   /product="Ribosomal protein L29, component of cytosolic 80S
FT                   ribosome and 60S large subunit"
FT                   /note="Cytosolic 80S ribosomal protein L29; Cytosolic 60S
FT                   large ribosomal subunit protein L29; GO_component: - large
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26572"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98642"
FT                   /db_xref="GOA:A4S4Y4"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Y4"
FT                   /protein_id="ABO98642.1"
FT                   /translation="MAKSTNHTAHNQSYKNHRNGIKKPKRVGKPSTKGMDPKFLKNQKF
FT                   AKRGSLKAAGKK"
FT   gene            <461263..>462339
FT                   /locus_tag="OSTLU_26573"
FT   mRNA            <461263..>462339
FT                   /locus_tag="OSTLU_26573"
FT                   /product="predicted protein"
FT   CDS_pept        461263..462339
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26573"
FT                   /product="predicted protein"
FT                   /note="GO_component: - integral to membrane; GO_process: -
FT                   cell adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26573"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98643"
FT                   /db_xref="GOA:A4S4Y5"
FT                   /db_xref="InterPro:IPR006773"
FT                   /db_xref="InterPro:IPR032368"
FT                   /db_xref="InterPro:IPR038108"
FT                   /db_xref="InterPro:IPR038633"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Y5"
FT                   /protein_id="ABO98643.1"
FT                   /translation="MGDSVPNFFGGQGGGASGLSFGGGASFGADAGPLFEMKCGKLVRD
FT                   GAKMRADPRRGTLKIVKSEVDDTLKQIQWGVRDPSTAFEAEDDFIILPDEAVLKTMKRD
FT                   GCFMLAFIEERDRDMYFWSQESDGKDAMEAKLLKFNRAVNTNVGEALEENIAASEAQTA
FT                   METGDAPNAVPSETPAATTLMPPPANVIPSPVDPTPAPTSFPAQTPAAPAKVSEGMRTP
FT                   ASAGNFTPIVSSDALKGVFASLGGATPQTPPVGLPEILTPELVGPLLRDEQIRGRLLEY
FT                   LPEEHRETQDLEELIRTPQFRSQLETFSQALQSGEMDMAQFGLKQNGVANLETFLKAIQ
FT                   AEVDESSGKNEEEDAMES"
FT   gene            complement(<462461..>462868)
FT                   /locus_tag="OSTLU_26574"
FT   mRNA            complement(<462461..>462868)
FT                   /locus_tag="OSTLU_26574"
FT                   /product="predicted protein"
FT   CDS_pept        complement(462461..462868)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26574"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26574"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98808"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Y6"
FT                   /protein_id="ABO98808.1"
FT                   /translation="MRDADADGVSVRAETTTVDGTKTTKTTKTTKTTKTTRARGAQVEN
FT                   ETVERGVQSERGGLVNAGVACADESDGDGEVLDDETFARALGGALRRCEEALTARRSYG
FT                   DVMEDEFARMRRYAEQNSLWTRLGAHRRAEG"
FT   gene            <463383..>464080
FT                   /locus_tag="OSTLU_17401"
FT   mRNA            join(<463383..463602,463706..>464080)
FT                   /locus_tag="OSTLU_17401"
FT                   /product="MC family transporter"
FT   CDS_pept        join(463383..463602,463706..>464080)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17401"
FT                   /product="MC family transporter"
FT                   /note="GO_function: - calcium ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17401"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98644"
FT                   /db_xref="GOA:A4S4Y7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Y7"
FT                   /protein_id="ABO98644.1"
FT                   /translation="MESTKMDAEALREKLVAVREKTQEAMKKIEVPKVEDLRMLIEDIR
FT                   QEQTEAKYHPDRRRLESVADFFAYTEEEGRKFFDEVDRSKKGKLTLDDLKFAMKKRNLP
FT                   QSYAKSFMEKAKGPKIFARTITWGDFQSVMNERESTMLRTFNSMSASRNGLLKTSDVKQ
FT                   VLEGLGLAATDENARAMVRHLRGSSEYSRQGYVTY"
FT   gene            complement(<464245..>466433)
FT                   /locus_tag="OSTLU_25255"
FT   mRNA            complement(join(<464245..464273,465299..>466433))
FT                   /locus_tag="OSTLU_25255"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(464245..464273,465299..466433))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25255"
FT                   /product="predicted protein"
FT                   /note="GO_function: - hydrolase activity; hydrolase
FT                   activity, acting on ester bonds; GO_process: - mRNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25255"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98809"
FT                   /db_xref="GOA:A4S4Y8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR007708"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041816"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Y8"
FT                   /protein_id="ABO98809.1"
FT                   /translation="MKIAIEGCCHGELDAIYAAIAHLEVVEKVKIDLLICCGDFQAVRN
FT                   LDDLECMSVPDKYKELGTFYKYYSGEKTAPIPTLFIGGNHEASNYLWELYYGGYVAPNI
FT                   YYVGHSGVVNFGDLRIGGLSGIFKTHDYKKGHHERPPYSGHAVKTAYHVREFDVFKLKQ
FT                   VKSEIDVFLSHDWPRGIAQFGNKHELFRKKKFLKDEIESNTLGSPPAEELLKRLKPKYW
FT                   FSAHLHVKYAALVKHEDEKTTKFLALDKCLPHRDFLQVIDLPEKSAEGGFALDEEWLAI
FT                   LKANHEYHSVTHRPAQLPAYGTPEAIDLEPHKKWVSERLQAAGSSATVPPEFVATRPAY
FT                   DPSSETRRKGRAPADVDVNPQTKALMDLLELDLKITTPRMHHTRRRR"
FT   gene            complement(<466615..>468948)
FT                   /locus_tag="OSTLU_44386"
FT   mRNA            complement(<466615..>468948)
FT                   /locus_tag="OSTLU_44386"
FT                   /product="predicted protein"
FT   CDS_pept        complement(466615..468948)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44386"
FT                   /product="predicted protein"
FT                   /note="GO_component: - COPII vesicle coat; GO_function: -
FT                   protein binding; GO_process: - intracellular protein
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44386"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98810"
FT                   /db_xref="GOA:A4S4Y9"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR036174"
FT                   /db_xref="InterPro:IPR036175"
FT                   /db_xref="InterPro:IPR036180"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Y9"
FT                   /protein_id="ABO98810.1"
FT                   /translation="MPGAASATGATSRIDPSQIPRPQYASHEERVTYNTRSEMDQATHP
FT                   PSATLEYVGCDLGSANPRYMRSTLSSLPNTGDLLTTSGMPLSIMTRPLALPHPEEAPIH
FT                   LIDNGKTGPIRCGRCKAYMNPYMRFLDHLRFECNFCYFVTEVPHEYMCNLGANGKRTDW
FT                   TERQELCRGTVEYVAPQEYMVRPPMAPTYLFLIEVTSQAIHSGVTTSACEVIMRTLDSV
FT                   PKDAQVGIATVDSAIHFYHLKDGAEKPSMLIVPDVEDSYAPLKSGLVVSLAKNREAIES
FT                   LLKMIPETFSSTAPGPNASTAAIKAGIECLKPTGGKVMAFMATIPNVGLGKLEARTGTA
FT                   GQRTGNIEKEPLKCMAPADKAYHTMATYAAEHQVCIDLFLCVSSAVDVATLGVLPRLTG
FT                   GSLYRYPGFNVQQDFAQLHNDLRWNFIRPQGLEAVMRVRASSGLGVQDYNGFFCKRTMT
FT                   DIDLPAIDSDKTIAVTLRYEDKLVDGREAYVQCALLYSTTSMERRIRVHTIALPITSVL
FT                   GALFRSADLDAQSDWAVRKAANALLSGNGTLASAKDASLQQCIATLFAYRRFCASNNSS
FT                   GQLILPEGLKTLPLYTLGLHKSYGLRSDASPDDRAAWLYRALHAPPELATPAVYPRLFS
FT                   IHDLPQDSSFPPIPPCMWLSSEKLNQDGAYLLEDGQEILIWIGRQLPVETLRDLFGTEN
FT                   VDDIVSTRATIPNLDTPASKALNSFINAIRKQRGAFMRARILKRGDTLEALFYNRLSED
FT                   RSPAGMSYVEFLCHCHRLIMNKSN"
FT   gene            <470096..>471388
FT                   /locus_tag="OSTLU_2890"
FT   mRNA            <470096..>471388
FT                   /locus_tag="OSTLU_2890"
FT                   /product="CaCA family transporter: sodium ion/potassium
FT                   ion/calcium ion"
FT   CDS_pept        <470096..>471388
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_2890"
FT                   /product="CaCA family transporter: sodium ion/potassium
FT                   ion/calcium ion"
FT                   /note="GO_component: - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_2890"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98645"
FT                   /db_xref="GOA:A4S4Z0"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Z0"
FT                   /protein_id="ABO98645.1"
FT                   /translation="GGIFAYLVGVIYLFIGIAIVCDDFFVASLEKICEALGLSDDVAGA
FT                   TFMAAGSSAPELASSAMSLINSGTDNALGVGTIVGSAVFNILVIIGTTVIFAGQTLKLD
FT                   WKPLARDCSFYFAAIVGIVATFNGGRVNWWEGLIYVFLYCLYIAFMWKNVYFMKLLDDK
FT                   FGDYLGRPDAAVEMEEAAGGGLGAQSASKATTSAMSKELSFTGSIYVGFAAQRFKAGLG
FT                   NKQHRAKALSPGQLRAIRNATEKVTWSHHHVKHAPTEDGVASEDGDDETNPFVMPAEWK
FT                   DRPIWALSLPWYALFTISIPPCHNPKWEKWYFGSFLASIGWIGIISHFMVEWCARIGCL
FT                   LKIPAIVMGTTVLAAGTSIPDALSSISVAKDGFADMAVANAVGSNVFDIWLGLGLPWLL
FT                   YLSWQKPSYITVSTTELLPSSLILLGVLILYV"
FT   gene            complement(<471572..>472243)
FT                   /locus_tag="OSTLU_26579"
FT   mRNA            complement(<471572..>472243)
FT                   /locus_tag="OSTLU_26579"
FT                   /product="predicted protein"
FT   CDS_pept        complement(471572..472243)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26579"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26579"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98811"
FT                   /db_xref="GOA:A4S4Z1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Z1"
FT                   /protein_id="ABO98811.1"
FT                   /translation="MDGVEIEGSPFEVFYSAPLDGPLVNERRARGVPLLARGEPAPAGV
FT                   CRDFLLGNCDRVICKFKHDVPPPPPPPPPGASGGDAVGVVNVPPPPVPEELRRTAHVSN
FT                   YPVGLTTEQVKQLFSFCGSIAECREGGPGKNFCFIEFESNKEALAACALNGMQVGGRNL
FT                   RVELAKTPKLLNPRSFSLAPAPAKVDIDAKAAQSEAAARAAAISARLAAKGGSSVRHKP
FT                   Y"
FT   gene            complement(<473735..>474522)
FT                   /locus_tag="OSTLU_26580"
FT   mRNA            complement(join(<473735..474040,474094..>474522))
FT                   /locus_tag="OSTLU_26580"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(473735..474040,474094..474522))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26580"
FT                   /product="predicted protein"
FT                   /note="GO_function: - DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26580"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98812"
FT                   /db_xref="GOA:A4S4Z2"
FT                   /db_xref="InterPro:IPR003657"
FT                   /db_xref="InterPro:IPR036576"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Z2"
FT                   /protein_id="ABO98812.1"
FT                   /translation="MATTTTHGTRVYDDDAGDRPRRSYPHSTSRSTTTVAAHAPSSAHA
FT                   DGYRWRKYGQKNIKGSSFPRSYYRCTERGCPARKKTELRRASEDGEMETVVCYEGEHTH
FT                   AKPSGGGGRAETLAPGSTKSFGTRASGDSTATNARRGTTRFHDVCGGGGGGGKSSSGQA
FT                   TESDAEDSAASEEDSTRTAVEHDETEALGVRKIAKWSSITDDVQRIRTVRARAPRILVQ
FT                   RRRGEEAETRRESAEPVVRRHG"
FT   gene            <475291..>475959
FT                   /locus_tag="OSTLU_17407"
FT   mRNA            <475291..>475959
FT                   /locus_tag="OSTLU_17407"
FT                   /product="predicted protein"
FT   CDS_pept        475291..475959
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17407"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17407"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98646"
FT                   /db_xref="GOA:A4S4Z3"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Z3"
FT                   /protein_id="ABO98646.1"
FT                   /translation="MSDGAMRPWFLRDEDRRRSLVYGVGAVAFALLGLVVTTGSRTEYK
FT                   VVAYKPSLYEHVGSHQVKAHYDIYPDTHDIHQADHPSEDPADPEEELVYKYNGKHVSSA
FT                   NENRIRALYSPSGSSFIDVVKREGVDDATIFETCLYPTVTAEFRTYYGHDLTIEPDTTS
FT                   KDLGKPVNQVEAHQFGCVWEKLLNKLAESNWKFVTSETIMTEKTFYEMHMITFSRKKTT
FT                   "
FT   gene            <476665..>476886
FT                   /gene="RPL38"
FT                   /locus_tag="OSTLU_17408"
FT   mRNA            <476665..>476886
FT                   /gene="RPL38"
FT                   /locus_tag="OSTLU_17408"
FT                   /product="Ribosomal protein L38, component of cytosolic 80S
FT                   ribosome and 60S large subunit"
FT   CDS_pept        476665..476886
FT                   /codon_start=1
FT                   /gene="RPL38"
FT                   /locus_tag="OSTLU_17408"
FT                   /product="Ribosomal protein L38, component of cytosolic 80S
FT                   ribosome and 60S large subunit"
FT                   /note="Cytosolic 80S ribosomal protien L38; Cytosolic 60S
FT                   large ribosomal subunit protein L38; GO_component: - large
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17408"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98647"
FT                   /db_xref="GOA:A4S4Z4"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="InterPro:IPR038464"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Z4"
FT                   /protein_id="ABO98647.1"
FT                   /translation="MRKQPKEISEIKDFLHTARRKDARSVKIKKTAGVTKFKVRCSKYL
FT                   YTLCVKDSDKASKLKQSLPPGLQVMEVA"
FT   gene            complement(<477054..>478227)
FT                   /locus_tag="OSTLU_26583"
FT   mRNA            complement(join(<477054..478001,478117..>478227))
FT                   /locus_tag="OSTLU_26583"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(477054..478001,478117..478227))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26583"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nucleoside-diphosphate kinase
FT                   activity; ATP binding; GO_process: - GTP biosynthesis; UTP
FT                   biosynthesis; CTP biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26583"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98813"
FT                   /db_xref="GOA:A4S4Z5"
FT                   /db_xref="InterPro:IPR006602"
FT                   /db_xref="InterPro:IPR011410"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Z5"
FT                   /protein_id="ABO98813.1"
FT                   /translation="MRTESRLGFQAVWVDPAQDFERAFTLFYYPEDGDVELIEDKRKKA
FT                   FLRKCAPETPIALDELFIGATVTIWSRRLTVRGYADERTATAMKTKREESFALVSSENV
FT                   CRIGRIVHAMQENGLTIAEMKTVAFGTSRLEELETALPRNARALASGTSCAIRAIGCEA
FT                   NAILARLFAHTNDVVRSMDEEHARALGELATGSSSKSPTEHSSLVVVKPSGMAHLGAIL
FT                   DFLCEKKGLDLIQARTLALTRLEAEAFYAVYVDVLDKEEVKMMIDELSCGACVALQLSR
FT                   LRSPETLVDDIREIVGPRDPEIARVLRPESLRARFGEDKQRNAVHCADLTEDGELEVDF
FT                   MFNLPRRTSVVA"
FT   gene            complement(<478345..>479673)
FT                   /locus_tag="OSTLU_26584"
FT   mRNA            complement(<478345..>479673)
FT                   /locus_tag="OSTLU_26584"
FT                   /product="predicted protein"
FT   CDS_pept        complement(478345..479673)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26584"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26584"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98814"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="InterPro:IPR036464"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Z6"
FT                   /protein_id="ABO98814.1"
FT                   /translation="MPATAARVDARLARPSRARSTRARRASTRRAVADADARGTTTFDP
FT                   ASTLRHARVDVGAHGRGLFVTGTGSALVSVAIDALVCAPAAVGEGAEGRAATAIRETYR
FT                   EGWRRHFGVDVPECLIEFVISAPFAKDVRLAAMLAWAVKNAEAWRAYGAEVVPAAFDCG
FT                   YLANEEELEMLQDAEIRVMAERSKAGYEATWNAAMEAFPDVKAALGTSSEDELRWCRSW
FT                   VHTRAISGKLGDADCAFLAPTIDLANHRVESTAKYGVSADGKNFELTWNEDSIEGPTPV
FT                   ANTEVFISYGDRMNNALLMLHYGFIDDENRNERLPMEFIAPGARRVHGSRVADACKALD
FT                   DAGDKAAALAGSNLLMVASRGPPPGVADAPAPPETDPEVIQALRQAVDSYLSACPTTLA
FT                   EDEALLASAEAASLSPRALLAVRYRASRKRAAEAYLRFLSILK"
FT   gene            complement(<479862..481138)
FT                   /locus_tag="OSTLU_26585"
FT   mRNA            complement(<479862..481138)
FT                   /locus_tag="OSTLU_26585"
FT                   /product="predicted protein"
FT   CDS_pept        complement(479862..481082)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26585"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26585"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98815"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Z7"
FT                   /protein_id="ABO98815.1"
FT                   /translation="MCVAFIALVRTTSANAPIKLLVAFNRDEDYARPTKACAAWPSERD
FT                   DEAYEIFGARDELGGGTWFAMCRKTGRWGLVTNAANGTTTTTTTTTNGGTTKSPKKTVS
FT                   AYVTRGMLVTDYLKSPEIDSGKYAMEVFAKRMRFDGFNLVVGDASRGTAHYVGNRGSAN
FT                   AETPMELRAGRVYGLANDVLDAPWPKVVRGKAKLEEILRAYSRYSADALPTRALEEQVL
FT                   RDVLHAPLDARPLAIDAAERLSYSSSDRDAPAPSAAARELWRHQQSFVAGGRRRESHVD
FT                   CDDDVDASIDIDVDEDDEEDEEFVVEQIEACESERSFVRPGELPGLPNCGTRTSQVVLV
FT                   SADGRCSWCEHHFVPVLPDRRRARRPAAVARASAAAPDAFLVAALERASHAFVIPAVAP
FT                   RPRTPIA"
FT   gene            complement(<481337..>482779)
FT                   /locus_tag="OSTLU_93472"
FT   mRNA            complement(<481337..>482779)
FT                   /locus_tag="OSTLU_93472"
FT                   /product="predicted protein"
FT   CDS_pept        complement(481337..482779)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93472"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93472"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98816"
FT                   /db_xref="InterPro:IPR032698"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Z8"
FT                   /protein_id="ABO98816.1"
FT                   /translation="MTTTTTATTATTATRGRGRRALSTTTTTATRARGRGATARAARFE
FT                   REGGFRRRRGRANARTDGATSEDGEEEGRTFLGRTGRRTGDAESIAKNYAEKEAETLAK
FT                   SAGRQYAFGKPQSPKETWEPFAREARMGLVEEYRRGAKGDAVTASMHLAVEDDAVQGRT
FT                   SVCLPREAYTKRMDKLVNEFVQRDLSYMSAEDKADADKMIEAVERYLFEEQQYRTPTGW
FT                   REAFSPYRTYFHNVIAQKVGIPATLAAIYIGFLERLKAKGELDACGDIKVLLRVRRGAD
FT                   PTPRRPQGIKASDAAPDGSVVCTPDMVVRMQLMALKRAFWPWEWDDSRDSGFLLAVEAA
FT                   AYGKDDRMNTAAGVVGIIQPTGRPFGDLQMALLVTERLAELDENVGYEQRDMGVLLYHS
FT                   GYRRDALDALVAFENWKATTKLAAVEIDDSSSYSINAPTPDFAWESGDPVEAARLALRE
FT                   DEALAKVILELNRDVLERQFDV"
FT   gene            <483314..>485488
FT                   /locus_tag="OSTLU_26587"
FT   mRNA            <483314..>485488
FT                   /locus_tag="OSTLU_26587"
FT                   /product="predicted protein"
FT   CDS_pept        483314..485488
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26587"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26587"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98648"
FT                   /db_xref="GOA:A4S4Z9"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A4S4Z9"
FT                   /protein_id="ABO98648.1"
FT                   /translation="MLASTNSFRAPRAGTKAALEVHVSTWNVGNKAPRADAASGWLRDA
FT                   RRSDIVAVGAQEASYVKTRKTIKPVAVSAACGDEANFKSRFRKGFFKSTKWTRVGMVAG
FT                   GAFAGGVMAAPVAPMGVMCGMFTGWFASKRLVQEIKVRIHWFDFLHSALGHEFELLQTQ
FT                   ILLQMRLAVFVKKELVPRIRSVKVGSKATGLGNLVGNKGGLLVHIELENGETIAFLSCH
FT                   LAAHEQPKYLEARNHMVHEILEGTWIDCVEKPKCALPVVTDVNSALFDAGSEMINKMKG
FT                   TSRQVYERTSDAFQGATGARLAIGSGMAPRKNQAPELLDVATHVFFFGDLNYRLDPGKV
FT                   VGNEWDTHWDKTAPEMTSTKLANKYDVDKVPLSKFPAARPVAQPGMIEEESDDEITESS
FT                   PFQIGRTAVIESVGAQEFDQLVKADQLIKSMKEGKVFANFHEMPLKFFPTFKRASNNLK
FT                   DGKGKKAPAQEQSVAEPGSAEYYNEKRVPSWCDRVLVHSLTGAKDSCSPLEYGARHDVT
FT                   TSDHAPVYARFRVRLRDLPPLKALPRAKLTLTNLSVTRNTIEDDFRGSSVYVHLFVPHT
FT                   RTVVPEAREVSSGHVARDESQPKTIGKYTFSGDVLPSCIVGYDAADEVTFAEQEKAAAR
FT                   FALLTTEERIALKENEDAEKSEELPTPVGMDAYGKFVGIITLVDSRYGDKLGTCTVLLP
FT                   SKGSSSFDVPLLLRSANVGRIKGSWELSSI"
FT   gene            <485594..>486451
FT                   /locus_tag="OSTLU_44281"
FT   mRNA            <485594..>486451
FT                   /locus_tag="OSTLU_44281"
FT                   /product="MC family transporter: 2-oxodicarboxylate"
FT   CDS_pept        485594..486451
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44281"
FT                   /product="MC family transporter: 2-oxodicarboxylate"
FT                   /note="GO_component: - membrane; GO_function: - binding;
FT                   GO_process: - transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44281"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98649"
FT                   /db_xref="GOA:A4S500"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:A4S500"
FT                   /protein_id="ABO98649.1"
FT                   /translation="MPLRAHEEITAGFLAGCADALACHPVDVVKTQAHVNRGANVPFTQ
FT                   ALVAQARAHGLPSLYRGVLPACLRPQALCMYVGYEWSKKAVCEDAKKMTTREAFVAGWL
FT                   TAYVESACVTPFETVKVRMQTKENMSRYASSLGCAREIARTEGMKGLYAGFWPTCLRNN
FT                   VFNSFYFGTIHYCKDEYLSAPDSLVEQAAQNVGVGIIAGLVATVFKMPFDILKSRMQGQ
FT                   VPNASGALEYPTMMEAAVRIFRNEGVGAFYKGTGVTAARITLGFPVSFVAFEAVASMFE
FT                   NEIR"
FT   gene            complement(<486544..>488019)
FT                   /locus_tag="OSTLU_88658"
FT   mRNA            complement(<486544..>488019)
FT                   /locus_tag="OSTLU_88658"
FT                   /product="predicted protein"
FT   CDS_pept        complement(486544..488019)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88658"
FT                   /product="predicted protein"
FT                   /note="GO_component: - cytoplasm; GO_function: - tRNA
FT                   ligase activity; ATP binding; nucleic acid binding;
FT                   GO_process: - tRNA aminoacylation for protein translation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88658"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98817"
FT                   /db_xref="GOA:A4S501"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A4S501"
FT                   /protein_id="ABO98817.1"
FT                   /translation="MAALQAAPDALAHRYGDAEMVQSKEITGRAWTRVDALNETLKDRE
FT                   VLLRGRVHNVRGKGKSAFIVLRQQTATVQVTLFVDDVNVSKGMVKWASALARESVVDVK
FT                   GLVVHPEVPIESCTQKEVEVVCREIHCISRSDPELPFLIEDASRPDSAFEAEDTQFVRV
FT                   LQDTRLNNRVMDLRTPANNAIFKIQSGVGTLFREALLRRNFTEIHTPKLIAGASEGGAA
FT                   VFKLDYMQVGPACLAQSPQLYKQMAIMGDLEGVFEIGPVFRAEDSNTHRHLCEFTGLDM
FT                   EMTIKEHYDEVLDVLDELFVSMFDGLNERFKREIGVVNEQHPFEPLQYCRPSLRLTFEE
FT                   GVKMLQEAGEEVDPLGDIGTETERVLGRLVKEKYGTDFYMLTRYPLNARPFYTMPAPDD
FT                   PNYTNSFDIFIRGQEIISGAQRIHDPKLLAERAEACGIELPTIQPYIDSFKYGAMPHGG
FT                   CGVGLERVAMLFLNLPNIRKTSMFPRDPKRLTP"
FT   gene            complement(<488410..>489927)
FT                   /locus_tag="OSTLU_17414"
FT   mRNA            complement(<488410..>489927)
FT                   /locus_tag="OSTLU_17414"
FT                   /product="predicted protein"
FT   CDS_pept        complement(488410..489927)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17414"
FT                   /product="predicted protein"
FT                   /note="GO_function: - diacylglycerol kinase activity;
FT                   GO_process: - protein kinase C activation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17414"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98818"
FT                   /db_xref="GOA:A4S502"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A4S502"
FT                   /protein_id="ABO98818.1"
FT                   /translation="MATVDAVARVATTGRGRATLVLGDGTRVVRVEDVVRVEVRRRRRR
FT                   HRHHRDEDDDARTLAVTAIARRRGFPGISTRKRSARRLKTHETACATAAVANEARTRCA
FT                   EACGLDDADASGTARERRRRVLVIVNPRSGRGEGTKIWETKARAVLEAANIECATRTTK
FT                   ARGEATNIARELDASLYDGVVAVGGDGTVAELFQGLSEREDREEIYAKMPIGIVPAGSG
FT                   NALCKSIQHAGGEPCDPVSCALTIARWRTRALDRSEVRFQDSKTASGWGDDSKVTHSLL
FT                   STSWGFFSDVDIESERFRFLGGARFTLQAIVRILARRKYQCELLYETTEEGEAYNAQHC
FT                   DGPHGEPVPGRPGWRRVAGDVLGLWALNVPWGTESTLAAPHAKFDDGSIDVVLVNVTNR
FT                   KNMLKLLLDFDAGDHARNRAVRYIKAKSFEIYPAAAAAAAATAAAIVDASSETNATAPG
FT                   GGGYIAVDGEVLASRRFRAAAAAAFPYGPFRCDVIRAACAVFAPPSA"
FT   gene            490220..>490851
FT                   /locus_tag="OSTLU_26591"
FT   mRNA            490220..>490851
FT                   /locus_tag="OSTLU_26591"
FT                   /product="predicted protein"
FT   CDS_pept        490486..490851
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26591"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26591"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98650"
FT                   /db_xref="UniProtKB/TrEMBL:A4S503"
FT                   /protein_id="ABO98650.1"
FT                   /translation="MPMRAIADAIGDAFGPALDAIAEERRRRGEARRDGGETEDETEAG
FT                   LYVPDIPAFLCATRLARDSPMVRSVLVVDERAPRTKPRLSWYDVDDEGWAPRGWWEDGV
FT                   KADFAYYFGERRESSTR"
FT   gene            <492403..>492630
FT                   /locus_tag="OSTLU_26592"
FT   mRNA            <492403..>492630
FT                   /locus_tag="OSTLU_26592"
FT                   /product="predicted protein"
FT   CDS_pept        492403..492630
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26592"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26592"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98651"
FT                   /db_xref="UniProtKB/TrEMBL:A4S504"
FT                   /protein_id="ABO98651.1"
FT                   /translation="MDVSGVGESAGGETGAAAAAAAAAAAPARTPRKKYEDVDESELVP
FT                   GTTLPDGRVVVEDWKGDPMVLNPGDRMPRF"
FT   gene            complement(<492790..>493605)
FT                   /locus_tag="OSTLU_17416"
FT   mRNA            complement(<492790..>493605)
FT                   /locus_tag="OSTLU_17416"
FT                   /product="predicted protein"
FT   CDS_pept        complement(492790..493605)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17416"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17416"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98819"
FT                   /db_xref="GOA:A4S505"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024766"
FT                   /db_xref="UniProtKB/TrEMBL:A4S505"
FT                   /protein_id="ABO98819.1"
FT                   /translation="MTDIMRTPTSTPTSTTSRERDSIFSSSPPLSRASVGSASSEEAAE
FT                   MLADAIRDGLLFATPKATSGGRGLVMKTPGSVKTPRYAYGESDCAVCQSPLDRTRPEAS
FT                   DNPDKVELVTGLTCRHVFHRCCLVQCREHNIQKCPTCQAPLPRGFTPENVREEREKHRI
FT                   RDRIIARSRRATDAIRLARARAIANGTLSPGMGSMSDSARTPGTPGMVSLSQDTGTDAY
FT                   DAGLPPRAPRFAAEREASSSSRAHPYSPLTRSPTSESGGDDEFFITMTQ"
FT   gene            complement(<493850..>494467)
FT                   /locus_tag="OSTLU_26594"
FT   mRNA            complement(<493850..>494467)
FT                   /locus_tag="OSTLU_26594"
FT                   /product="predicted protein"
FT   CDS_pept        complement(493850..494467)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26594"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26594"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98820"
FT                   /db_xref="GOA:A4S506"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:A4S506"
FT                   /protein_id="ABO98820.1"
FT                   /translation="MGASARDGDDAGDGVRDDGDDANDANDEEEEEEDFVGACRVCLFD
FT                   VTREDIRDARAVRLGCACVSGVVHVDAECLEAWVLRAPRKSADCEICLERMTNVPTRAE
FT                   LRKERRLRREKYRARTVSSSSSASARDDDARDDDARARDLEIGAERIGDVSRGERCCLY
FT                   ACAPLACAYAIVHAFCAHRSCVFAFILLAIGVAVLTRVSILL"
FT   gene            <495479..>497158
FT                   /locus_tag="OSTLU_1511"
FT   mRNA            <495479..>497158
FT                   /locus_tag="OSTLU_1511"
FT                   /product="predicted protein"
FT   CDS_pept        <495479..>497158
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_1511"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nucleic acid binding; helicase
FT                   activity; ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_1511"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98652"
FT                   /db_xref="GOA:A4S507"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4S507"
FT                   /protein_id="ABO98652.1"
FT                   /translation="SFEECGLPASMVKHLMENVGFGAPTAVQAKTIPRLLAGRDVLVRA
FT                   ETGSGKTLSYIAPLYSKIGGITPRVTREEGTRGLVLVPTRELATQVEDTARRVGRPFHW
FT                   VVTSSIMGGENRAKEKARLRKGVSLLIATPGRLLDHLRMTESFNVDNLRWLVLDEADRL
FT                   LDLGFEEDLNAILNEIGRRTEGASLCTALLSATLTPGTARLAERMTDPVTIVVEPEKDD
FT                   LEIVGADGSDDEEGGTMDVDGLKRMAKIMAGGERVRMPEGLNHTVVEVSMKARLPALAG
FT                   LLAGWMQGSISKAIVFFSSCESVEYHYKTLRWLAAGGKGKVKDDDDSIQGPYEIFRLHG
FT                   LLSQGDRASVFRNFANTKAGVLLCTDVGARGLDFVGVGATVQVDAPTDATTYIHRVGRT
FT                   ARLGSEGEAVLFLQPKEREFAEVLTEKGVNFANGSVVAMLDVLEDSKDASERDKSMFKS
FT                   MPHLHPASQRMLKKLVAKVASDKQYDVLAKDAFRAHVRAYATFPSAFKHIFHVKRLHLG
FT                   HVAAAFGLKDAPQLIGASATKAALKAQKDAARKKSNVDARRKK"
FT   gene            <497716..>498405
FT                   /locus_tag="OSTLU_6595"
FT   mRNA            <497716..>498405
FT                   /locus_tag="OSTLU_6595"
FT                   /product="predicted protein"
FT   CDS_pept        <497716..>498405
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_6595"
FT                   /product="predicted protein"
FT                   /note="GO_component: - membrane; GO_function: - molecular
FT                   function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_6595"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98653"
FT                   /db_xref="GOA:A4S508"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A4S508"
FT                   /protein_id="ABO98653.1"
FT                   /translation="TILGSCVLMGLILYISLDLGSTTFVNNAWQKVVNATAKSGFTAAF
FT                   ALIFVSELGDKTFFIAALLAMRLGRLRVLVGATSALAAMTVISVAIGRAFQRLPSSLMT
FT                   TLPVGEYAAVAMLLFFGIKTLRDALSMDPSGATPEDHGELAEATEVVCKSTSAQKRSPG
FT                   LAALIETFSLIFIAEWGDRSMLATVALGAAQNPVGVAFGASLGHFIATSIAVVGGSLLS
FT                   KRISERTV"
FT   gene            complement(<498547..499510)
FT                   /locus_tag="OSTLU_26597"
FT   mRNA            complement(<498547..499510)
FT                   /locus_tag="OSTLU_26597"
FT                   /product="predicted protein"
FT   CDS_pept        complement(498547..499233)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26597"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26597"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98821"
FT                   /db_xref="GOA:A4S509"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A4S509"
FT                   /protein_id="ABO98821.1"
FT                   /translation="MAKYAGDAARGAARAAKGALRGAGPSRRTAAYDGVFALLFINFAL
FT                   FACDHWAHMAFVKTLYLNHAKPTWWQFATSTFCHANWAHLSSNIFFLYIFGKLVEEEEG
FT                   AFGVWMSYLVTGIGANVASWLLLPKSVGGVLGIGGAATVSLGASGAVFGLFAVSVLVKL
FT                   SWNWRRLLEVVILGQFVVDRFLSEAKMVAAAGSGVGAGNVNHVAHLGGAFAGVLLIFFL
FT                   TRMVPP"
FT   gene            <500237..>501334
FT                   /locus_tag="OSTLU_2831"
FT   mRNA            <500237..>501334
FT                   /locus_tag="OSTLU_2831"
FT                   /product="predicted protein"
FT   CDS_pept        <500237..>501334
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_2831"
FT                   /product="predicted protein"
FT                   /note="GO_function: - ferrochelatase activity; GO_process:
FT                   - heme biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_2831"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98654"
FT                   /db_xref="GOA:A4S510"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:A4S510"
FT                   /protein_id="ABO98654.1"
FT                   /translation="KVGVLLLNLGGPETLDDVQPFLYNLFADPDIIRLPPPVQFLQGFL
FT                   ANTLSASRAPKSREAYESIGGGSPLRRITEDQANALQAAMQARGIQAKTYVGMRYWKPF
FT                   TEDAIDAIKRDGVTRLVVLPLYPQFSISTSGSSLRLLEQYFAEDEELASVRHTVIPSWY
FT                   QRPGYVKAMAVMIAQTLKTKFEDDKEPLIFFSAHGVPVSYVEQAGDPYKDEMEACVRLI
FT                   TEELGSMGVNNEHVLAYQSRVGPVEWLKPYTDDTIRELGKKGTEALCAVPISFVSEHIE
FT                   TLEEIDMEYRELAEESGIKKWGRVPALDTDPLFIDDLADAVIEALPYTTRMSKTRASAS
FT                   GLNVPPAEVGELLASYDRAKLAIPVP"
FT   gene            <502172..>503407
FT                   /locus_tag="OSTLU_44068"
FT   mRNA            <502172..>503407
FT                   /locus_tag="OSTLU_44068"
FT                   /product="predicted protein"
FT   CDS_pept        502172..503407
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44068"
FT                   /product="predicted protein"
FT                   /note="GO_function: - catalytic activity; molecular
FT                   function unknown; GO_process: - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44068"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98655"
FT                   /db_xref="GOA:A4S511"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4S511"
FT                   /protein_id="ABO98655.1"
FT                   /translation="MSHCELSVALCSDEYIRSLNAGYREKDSATDVLSFPAESFGPMAV
FT                   LGDVIVSVDTASAQAREVGHSLRDECRVLLVHGTLHLLGMDHEVSESEAEVMAAAEQEV
FT                   LKALGWKVTGLTRRASGESTSDSSSTTLTTQRSVLVTDLDGTLLNENSVITPRVADALR
FT                   RAMASGVEVVVATGKARPAAIKAAATQGLDGIIVGKNTPGVFLQGLEVYGRGGALVYEA
FT                   KMPEDVTRDAFMMMDDVVHDGLALTAFCGDNCATLAPSVLLDELHHTYHEPASEIAGSV
FT                   DEILSNNTVRKLLLMGPSKESIDGVRSIWEAAFRGRAEVTQAVADMLEILPLGNDKSKG
FT                   VRAVLKSMDVNPMTDVVAIGDGENDAEMLRFVGCGVAMANATEKTKSGAAHVLDASNTQ
FT                   DGVAEAIDRFVL"
FT   gene            <503692..>504678
FT                   /locus_tag="OSTLU_44226"
FT   mRNA            <503692..>504678
FT                   /locus_tag="OSTLU_44226"
FT                   /product="predicted protein"
FT   CDS_pept        503692..504678
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44226"
FT                   /product="predicted protein"
FT                   /note="GO_function: - subtilase activity; GO_process: -
FT                   proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44226"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98656"
FT                   /db_xref="GOA:A4S512"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR034193"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A4S512"
FT                   /protein_id="ABO98656.1"
FT                   /translation="MRFARLFAVFADDKEVNALRTCVPALDFEEDVEVFSQGVTTWSRD
FT                   RLNGRDGLDGKLLPRDPPEDGYGSIVHVYLLDTGVRRTHVEFKDQAFGRGVDLVDDDAE
FT                   PDDCDGHGSHVASTINQIAYSGKTVLHSVRVLDCNGNGELSGLIEGLEWVLGVATPSEP
FT                   AVVSLALGVRNGIWSRALERVVQTLTGRGVFIVCAAGNQKGDACTISPGNVAETLTVAA
FT                   SDQADAPYAYGNSGRCVDLFAPGVQILGACGGSTACEHPSDTAYAFQSGTSMAVAHAVG
FT                   AATRLLMFSPRMSPENLKKHLTSTASRDKIRGGSLLPGTPNLLLYVK"
FT   gene            complement(<504747..>505523)
FT                   /locus_tag="OSTLU_26601"
FT   mRNA            complement(<504747..>505523)
FT                   /locus_tag="OSTLU_26601"
FT                   /product="predicted protein"
FT   CDS_pept        complement(504747..505523)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26601"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26601"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98822"
FT                   /db_xref="GOA:A4S513"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A4S513"
FT                   /protein_id="ABO98822.1"
FT                   /translation="MSRIVAVASPTPSTAPRTTLRRRDTFIAPLLASCLVRPARASLVD
FT                   ETSATRVFAETSKSVARVAVVAPNGEISGRGSGVVWYIDDAYAYIATNAHCVVKGNENE
FT                   KLVVMLASGAAAALDKDASYFVNRSTDIGFLKVPIGSFGADAPVAAKIGTSDNLRVGQS
FT                   AFSLGFEEDGAAVLSSGTINGLKRKIPSRNGVGLKGLIQTDAQVTEFTSGGALCDSAGR
FT                   VIGLNVVAYAGSQKRDPQGVNFAIPIDAVRLAAEQM"
FT   gene            complement(<505619..>509131)
FT                   /locus_tag="OSTLU_25262"
FT   mRNA            complement(join(<505619..507492,507817..>509131))
FT                   /locus_tag="OSTLU_25262"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(505619..507492,507817..509131))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25262"
FT                   /product="predicted protein"
FT                   /note="GO_function: - transferase activity, transferring
FT                   groups other than amino-acyl groups"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25262"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98823"
FT                   /db_xref="GOA:A4S514"
FT                   /db_xref="UniProtKB/TrEMBL:A4S514"
FT                   /protein_id="ABO98823.1"
FT                   /translation="MMKFIVRRPRDDVNERTVAEDKIEMTAAESHGDAAGESQPNPRAE
FT                   MVDQSPDEASGGAPVVAQRVLNVDEIDTSAITGLRAITALQIACGHWLLFYGNSESPYL
FT                   DFQGGVAVSIFFLITGFVMYIAYHEKVEKQGFKYWEFIKRRYIRVLPLHWFALAWFAPF
FT                   LAFNYRTIVADYNFWQNKSGEVNLIMGIVLTPLLMQSWIFSLCYWNSVCWSLSCQLGYY
FT                   FCFPWLTRKLNALVRKFEEKAAIDFPIADDLENKSSTESSRFDSVQKSCRKYLMYAYHA
FT                   SYMAPLGVMGAVNSPAFRNVWRDANFESRAHVVVTALDGDMDGMRAYFCGRAWFPVRIP
FT                   LFFMGMLVGAMRLRLARRGVTPQTERFWAKFTDYFSLGFASWLIGSVITSGLVADSKNV
FT                   RIFNEFFLTAPCAFWLYGLTVTRKSYTVQVLRNPVAQAIGHTSSDAHGAALSLKDAQTT
FT                   DTRVMHAVDAARALTTRRGRSLLDHCWGDAAHASSNHTGGEWMRFIAWLVMLCMAVVFL
FT                   IVAVKKWPPPQRVFPRRKPLMSVPWCLAARLLGYGVFDWRTGKLTPWWDFIKERHDILN
FT                   IFAGDAAFITQRGRFAHLATELASTAAASMVLTDLTSARVSGGFWTNQIWVFVLLLTYD
FT                   IVLGIALRLATLGATKVSFEAAENVGFMCAESGEIQDLEDEEQLIEMGIKASHAFNLTQ
FT                   YRLLEACVAFSFVNVLVCSLWAHLANPADGCGDAFNTFVAYIYVFGLYQGFSLTVISPF
FT                   ALTVRWCAAAFLITRIDEVQTPEETMDCCWKHMCPRLCGCRPPLVTPLEQRTVSKLFMS
FT                   PRKDNGVMTGNIVKAAAVVGKSRYDAQDSPLTPRPESMNRDVESGSADLFTSATEGKED
FT                   TDDETPENIGARPQLTLSPSEKYAIFRRQASLRKDIALEDIDCAQYPDGDFDHRPSYEL
FT                   GHSDQIAGESAFAAARMALISAGKLTPEQVVRTRDFKHDWSARKSRYDSASDSGGESTE
FT                   DSDPELGVNDKTADDVDDVIVRTDVANMESSASPTVRWSRKLKDAASPADDTIDDDELF
FT                   DEELDSDPWGDGSA"
FT   gene            <509406..>510584
FT                   /locus_tag="OSTLU_17423"
FT   mRNA            join(<509406..509525,509667..>510584)
FT                   /locus_tag="OSTLU_17423"
FT                   /product="predicted protein"
FT   CDS_pept        join(509406..509525,509667..510584)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17423"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17423"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98657"
FT                   /db_xref="UniProtKB/TrEMBL:A4S515"
FT                   /protein_id="ABO98657.1"
FT                   /translation="MARHRRDLNHGIVLNTESERIARKWRARQPNRVQQNQRYLPVETK
FT                   TAKLDLAADSAADSAADWVVDWVADWAADWAADWAADSAADWAADWAADWVVDWVADWA
FT                   ADWAADSAADSAEDLVADSAEDLVADSAADSATDSAVDLVVDSAVHLVADSAVDLVADS
FT                   AVDLVVDSAVNLVADSVADSAADSAADSAADSAADLLATPKALVEIAVVADLAADLAAD
FT                   SAVDLVVDLAADSAADSAADSAVDLVVDSAVDLVADSAVDSMVDWAVDLVADSAVDLVV
FT                   DSAAVDSAVDLVATPKALVEIAVVADSAADLAVDSAADWAADLSVDSAADSAADSAVDS
FT                   AVPPP"
FT   gene            <511135..>512418
FT                   /locus_tag="OSTLU_44170"
FT   mRNA            join(<511135..511185,511318..>512418)
FT                   /locus_tag="OSTLU_44170"
FT                   /product="predicted protein"
FT   CDS_pept        join(511135..511185,511318..512418)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44170"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44170"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98658"
FT                   /db_xref="GOA:A4S516"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:A4S516"
FT                   /protein_id="ABO98658.1"
FT                   /translation="MKITSRAFEKNAKGWIKFVPESADDVWHAYNLIAVDDEVECATMR
FT                   KLKNEHAGELRESSSKVVKLTLRVRCEDVEYDAEGATIRVKGQNKTECEEVKLNAYHTL
FT                   EIGIGRAVKIEKTAWDSVDVGRLEEAADPSATADLAAVLIVDGLANVVLVGATQTIVKG
FT                   KIEASMPRKRGMALMGYEKAETKFFSNVASVVERHVDFDRVKCLVIAGPGFTKDTFTDF
FT                   LKLEAVRKNWKTLQTNFSRVIKAHASSAYVHSLSEVLENPTVRALISDTKAASEVKALD
FT                   DFFEMLANDPARAFYGPAHVMAAHELNAIDKLLITDTVFRTRNVAQRKMWVRVTEEVTK
FT                   SGGIVHIFSSAHASGEQLEQITGAAAILRFPLPDLADAELPAL"
FT   gene            complement(<512489..>513298)
FT                   /locus_tag="OSTLU_88668"
FT   mRNA            complement(<512489..>513298)
FT                   /locus_tag="OSTLU_88668"
FT                   /product="F-ATPase family transporter: protons (vacuolar)"
FT   CDS_pept        complement(512489..513298)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88668"
FT                   /product="F-ATPase family transporter: protons (vacuolar)"
FT                   /note="GO_component: - proton-transporting two-sector
FT                   ATPase complex; GO_function: - hydrogen-transporting ATP
FT                   synthase activity, rotational mechanism;
FT                   hydrogen-transporting ATPase activity, rotational
FT                   mechanism; GO_process: - ATP synthesis coupled proton
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88668"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98824"
FT                   /db_xref="GOA:A4S517"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:A4S517"
FT                   /protein_id="ABO98824.1"
FT                   /translation="MSSAGARLNVTPTVTTLAVIKSRLAGAQRGHRLLKKKADALTLRY
FT                   RGILRDIVEAKRKLATSMRDAHFAWTRAKYAGGDAVKHAVLDGVDRANVRVMAHEDNVA
FT                   GVKIPKFTCRKCGADERRMELTGLARGGARVREAKASYGEAIGLLSELASLQTAFVTLD
FT                   EAIKTTNRRVNALENYVTPRLQNTVKYILSELDELEREEFFRLKKVQAKKKKDIEETEM
FT                   MEAEEEKRITQAVDAELRAFGDVIGGEGGRGAGGNLIESEHDEDLLF"
FT   gene            513380..514610
FT                   /locus_tag="OSTLU_26607"
FT   mRNA            513380..514610
FT                   /locus_tag="OSTLU_26607"
FT                   /product="predicted protein"
FT   CDS_pept        513547..514578
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26607"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26607"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98659"
FT                   /db_xref="GOA:A4S518"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A4S518"
FT                   /protein_id="ABO98659.1"
FT                   /translation="MANLDSALGTRARDGDGAATREARSTRDEASDDATRGRADPLAAY
FT                   DADRDWLGAGPRWDVPHGGARFAATMLAVDASFYAAGCLAPMVEHAARASREGRDAPES
FT                   AEALAEDLRRAFDDPSAFADILLDAEIIQIALGAGILALSVKKFAPLPLGWFNDAFSSS
FT                   DAAVNATGRDASKWKRDAAAKAQNERASASASEAGRAILGTFLGVALVTWVLYAAGLRG
FT                   GDGNGSSSVDVIEKAFAAGPHGIANLVVTTVILAPIFEETVFRGYMLPSLTKFMDTTPA
FT                   IGVSALIFALIHQHGVGDTVQLVAVGLATGIVYARTRNLAASIAVHAAFNASVIALFAL
FT                   WVS"
FT   gene            complement(<514617..>515387)
FT                   /locus_tag="OSTLU_26608"
FT   mRNA            complement(<514617..>515387)
FT                   /locus_tag="OSTLU_26608"
FT                   /product="predicted protein"
FT   CDS_pept        complement(514617..515387)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26608"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26608"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98825"
FT                   /db_xref="GOA:A4S519"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4S519"
FT                   /protein_id="ABO98825.1"
FT                   /translation="MGAAGVGQWLVWEDVGRVTLEDVLARGDGLALARETFGDLSDDAA
FT                   AFRFLASTLARAVASVHAFDMIHRDVKPANVILSDARKRTLLCDVGACADVQTGRNMDG
FT                   AEAIFDPTYGAPEQFRKVASSPPLGGFPSIGGLFGRKKNAEASSANGFTLEPSGEPPTV
FT                   LLDAYSLGVTLLRCGVPSLRGESAIVRARKDIDACGGDLDLWRREVCVPGVNDFTLLDE
FT                   LGAWATITRLAAVDPNERFSVRRALDADEFLSSA"
FT   gene            complement(<515843..>516781)
FT                   /locus_tag="OSTLU_17427"
FT   mRNA            complement(<515843..>516781)
FT                   /locus_tag="OSTLU_17427"
FT                   /product="predicted protein"
FT   CDS_pept        complement(515843..516781)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17427"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17427"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98826"
FT                   /db_xref="GOA:A4S520"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4S520"
FT                   /protein_id="ABO98826.1"
FT                   /translation="MSTARARDAAVVAVRSRGAVDRRRRRDARGRRRGGANANANGNGT
FT                   TTTTTTIGRGARVVVVGARGGVGQVICAKLHARGYDVVAVSRGRGTEETTTTGPRSVGG
FT                   VDCRDARSIEASGAFDGDVEAVVCCLGTTAFPSARWRDEDGKFTNGPEATDYVGARNVV
FT                   EATKKLAPNLKRFVFVSSVGVLRTNVMPFVVLNAFGVLKWKRKGEECVENSGLPYTILR
FT                   PGRLTDGPYTSYDLNTLLKATSGARRDVQIGGGDDKLLPEATSRLVVAEAACAALVCAS
FT                   AAGRAYELGSTEGGDGPQDDVQKWQKLFDSV"
FT   gene            <517387..>519159
FT                   /locus_tag="OSTLU_17428"
FT   mRNA            <517387..>519159
FT                   /locus_tag="OSTLU_17428"
FT                   /product="predicted protein"
FT   CDS_pept        517387..519159
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17428"
FT                   /product="predicted protein"
FT                   /note="GO_function: - glucose-6-phosphate isomerase
FT                   activity; GO_process: - gluconeogenesis; glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17428"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98660"
FT                   /db_xref="GOA:A4S521"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:A4S521"
FT                   /protein_id="ABO98660.1"
FT                   /translation="MGTQGGTALISTTAEWRALKEHFANEIDKTHLRDLIADAKRCEEL
FT                   VIESDGVYCDFARQRVTHDTMTKLYDLARAAGVKEKINAMFNGEAINSTENRAVLHVAT
FT                   RAPKDKVINVDGKNVVPDVHDVLDKIKDFSERVRNGEWVGETGKPLKDVVAIGIGGSFL
FT                   GPLFVHTSLRTNPEAADEARGRQLRFLANVDPVDVARSLNGLDPETTLVIVVSKTFTTA
FT                   ETMLNARTVRAWIRASLGEAAVSKHMVAISTNLKLVEEFGIDPDNAFAFWDWVGGRYSV
FT                   CSAVGMLPLSLQYGYDTMEQFLKGAWSMDQHFANAPFEKNLPLTLGMLSVWNVSFLDCP
FT                   ARAILPYTQALAKLAPHIQQVAMESNGKGVAIDGTPLDYETGEIDFGEPGTNGQHSFYQ
FT                   LIHQGRTIPCDFIGIIKSQQSVYLKGEIVSNHDELMCNFFAQADALAVGKSAIELRAES
FT                   CPDALIPHKTFTGNRPSLSILLPELNAYTTGQLLSLYEHRVATQGFVWGLNSFDQWGVE
FT                   LGKVLASRVRTSMNSKRTKGEIMTPGDGFNPSTTALLNRYLAGKAKLIYPEPKDVFPCD
FT                   LIDGDECRPPTSYV"
FT   gene            <519451..>520218
FT                   /locus_tag="OSTLU_88671"
FT   mRNA            <519451..>520218
FT                   /locus_tag="OSTLU_88671"
FT                   /product="predicted protein"
FT   CDS_pept        519451..520218
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88671"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88671"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98661"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4S522"
FT                   /protein_id="ABO98661.1"
FT                   /translation="MIARLARSRVARASNGEGDEEFRASVDGLREPCDDFVCKSSPAVE
FT                   NTLKSLIKDINAARGTNRSAAPYSPDVTYDDGALRFAGSEKYKRYCSYIENNLRQVTTR
FT                   VTEISMEGSLDVATVKWELNAVNDIGRVGVDVTATYKMNLITGRVLEHREQWVVNPART
FT                   DAQAGALLESTRKAHALPLNAMEVADEAKKKFREISKSFASEDDQENSNIYVDPNDPMK
FT                   FFQQDDTSKTDLLQLSLVAAVIYLLTKVFQVLN"
FT   gene            complement(<520252..>521238)
FT                   /locus_tag="OSTLU_26612"
FT   mRNA            complement(<520252..>521238)
FT                   /locus_tag="OSTLU_26612"
FT                   /product="predicted protein"
FT   CDS_pept        complement(520252..521238)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26612"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26612"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98827"
FT                   /db_xref="GOA:A4S523"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A4S523"
FT                   /protein_id="ABO98827.1"
FT                   /translation="MSNARSRATRRRATWYVTLFACASAFACVASRVRGVEASTTYEFI
FT                   HYARNDFYGALDVARDANSTIIAKKYRKLALSLHPDKLPKEMDRAQRQKAKKHFEVIAE
FT                   AKKILLDETLRKEYDDVIASLPKFARPKFGKRSAFDKEEVKFSAWLVMTVFTAFCVSFV
FT                   SVAQYTSRAADKQSLMQSAFYLQKLKSRNKNLPKPDRVTAEEYFEEFLVEFGLTDLTGW
FT                   EHTTGGKLLARLRGRIPENEKAETTEATETSDASTSASASASGRDGEDAVTSLRRRGKK
FT                   KGKNKGRRDGGSSGGGSVDRRAATALKHLRSEGEARRMMFGDSYDIE"
FT   gene            complement(<521380..>522333)
FT                   /locus_tag="OSTLU_17430"
FT   mRNA            complement(<521380..>522333)
FT                   /locus_tag="OSTLU_17430"
FT                   /product="predicted protein"
FT   CDS_pept        complement(521380..522333)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17430"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17430"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98828"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="UniProtKB/TrEMBL:A4S524"
FT                   /protein_id="ABO98828.1"
FT                   /translation="MKRATKPARVDDADVARVVLRYLERQGYEGARKAFLKDAATTLGD
FT                   DAPRGGGRKTKDLKRVIDEYVRLKDAEHRRRHCTGVVGKMMKVIDDALAGRESKSRDEG
FT                   RGRGRRGTRDDASGASGSESDAVDDDERSESESEEIVEREIAATRRAADAAPAPAGSNR
FT                   RKKASVAPKRFVPGRGPTANGNAVASTSGARSMHGTPKLTPLSAKAPLGSLRPFHMPEL
FT                   ADGAAQKKMADVIVGALGGRGKVQLSKYGDPAKGELIDEGTVENVMQSLMDADDELGEF
FT                   LFSMIDEVERDVALRAVDAQGPPEHAFGSPRKKSKN"
FT   gene            522446..524130
FT                   /locus_tag="OSTLU_26614"
FT   mRNA            522446..524130
FT                   /locus_tag="OSTLU_26614"
FT                   /product="predicted protein"
FT   CDS_pept        522562..524076
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26614"
FT                   /product="predicted protein"
FT                   /note="GO_component: - cytoplasm; GO_function: - disulfide
FT                   oxidoreductase activity; oxidoreductase activity;
FT                   GO_process: - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26614"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98662"
FT                   /db_xref="GOA:A4S525"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4S525"
FT                   /protein_id="ABO98662.1"
FT                   /translation="MFSSVAIGTPRKLVTPRKPLARTLARAFATSGEEQDVVIVGGGPG
FT                   GYVAAIKAAQLGLKVTCVEGRGTLGGTCLNVGCIPSKALLNASHKYEEAKHGMAKHGIT
FT                   FGGEVAIDVETMMGHKSKAVTGLTKGIEGLFKKNKVTYAKGWGKLLSANEVNVTMEDGS
FT                   SEVIKTKNVVLATGSVPSALPGVDADEETIVTSTGALELKKVPETMVVIGGGVIGLELG
FT                   SVWSRLGAKVTVVEFADKICGAGIDDEIRTTFQRSLKKQGFNFKLSTKVTKAVKKPEGG
FT                   VTLTLEPSAGGEQTELEADIVLVSTGRRPFTDGLGLEDVGVETNRMGQIVIEPHTFKTN
FT                   VPGVFAIGDIVAGPMLAHKAEEEGVSVVEQIAGKKGHVNYDTIPSVIYTHPEVAWVGKT
FT                   EAEVKEMGIEYIVGKFPLAANSRARANDDSEGVVKFLTDKATGKILGAHIVSGGAGELL
FT                   AECVLAMEYGATAEDIARTCHSHPTVSEAVKEAAMAATPGMGSIHF"
FT   gene            complement(<524127..>524948)
FT                   /locus_tag="OSTLU_88673"
FT   mRNA            complement(<524127..>524948)
FT                   /locus_tag="OSTLU_88673"
FT                   /product="predicted protein"
FT   CDS_pept        complement(524127..>524948)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88673"
FT                   /product="predicted protein"
FT                   /note="GO_function: - protein tyrosine/serine/threonine
FT                   phosphatase activity; GO_process: - protein amino acid
FT                   dephosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88673"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98829"
FT                   /db_xref="GOA:A4S526"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR016278"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A4S526"
FT                   /protein_id="ABO98829.1"
FT                   /translation="LRRQGRIDASRTLVVPLPDDDLADLLGVVPEATTFIETALASASS
FT                   SVVAVHCHAGESRSAAVVAAYLMRFEQLEIEQAMASVEARGGAPNEGFQAQLSLWAQMG
FT                   CRVSTANEAYKLWSVAKVARERDERGYLESTSVMRDPGAADAVDDPEGGGWLACRKCRR
FT                   RLARSTHVLCHEHGEGIDAFSWKARRKEGSKGINRDCAGARQCSSMFLTPLSWMKGIED
FT                   GDGGETRGKLCCPQCETKIGAFDWAGIQCSCGAWVSPAFQIQRAKTDAFGM"
FT   gene            complement(<525222..>526592)
FT                   /locus_tag="OSTLU_17433"
FT   mRNA            complement(<525222..>526592)
FT                   /locus_tag="OSTLU_17433"
FT                   /product="predicted protein"
FT   CDS_pept        complement(525222..526592)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17433"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98830"
FT                   /db_xref="InterPro:IPR026504"
FT                   /db_xref="UniProtKB/TrEMBL:A4S527"
FT                   /protein_id="ABO98830.1"
FT                   /translation="MRALAREREARQLEARERERWNRDVREALRRGTREEALQRRLEAL
FT                   DAEFGDDAARATTAATRGDATEGGRDGARDDTMRRASTLERASRAKANEERRASREAST
FT                   AARALETDAMRALRARLSAMETHAIRNNQIEEKKALEKLEMERQRALDAEMERERLEGV
FT                   ARDERERAAKLAKKIAAREALDAQHAERALRMSKRAMEKEDERRKMAQLVKKIEAEDEE
FT                   ERREAIARRECAKRDAAKALEEKRARVAREAEAVKALEEQIMRHDEMVARREAKEEEEK
FT                   RKEEKRKERARVSVETSQTRAAQERADFDELISRLRFEEFEEACRVKEAEERENAARRR
FT                   DEQRREYEAAVAAREAREAQALEEKKQFQRDLAAKLAEDDRVEQLSAQKRRMKLLEHSR
FT                   EVRRLAEEKFAEREARLELERRELDASRREREAMDAAIECGREKLLAEFHNKTASLA"
FT   gene            <527206..>528119
FT                   /locus_tag="OSTLU_17434"
FT   mRNA            join(<527206..527947,528049..>528119)
FT                   /locus_tag="OSTLU_17434"
FT                   /product="predicted protein"
FT   CDS_pept        join(527206..527947,528049..528119)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17434"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17434"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98663"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A4S528"
FT                   /protein_id="ABO98663.1"
FT                   /translation="MPPRRDAPLEACEACSTDDEDALRATLATTPCTIVDARGNTLLHL
FT                   CCANDALRCAKLVVSRCVFASTPPERAYLTLRNSDGETAADVAEACGSARCAEWLAKMT
FT                   GAERVATNDARRKDVGKGERRRADDERRRKRSGDGETEATTRARESLVRSIREALNIGP
FT                   GDDGDERAAVRQVLREVLNLVSDRESARRELEEAHRKIEAMERDAERERANVVEALGMA
FT                   EKRAKEMISEREAREKDICAEKTALNEAREERFREQRVGERDAGAGDG"
FT   gene            complement(<528346..529094)
FT                   /locus_tag="OSTLU_26618"
FT   mRNA            complement(<528346..529094)
FT                   /locus_tag="OSTLU_26618"
FT                   /product="predicted protein"
FT   CDS_pept        complement(528346..528987)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26618"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26618"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98831"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A4S529"
FT                   /protein_id="ABO98831.1"
FT                   /translation="MATCLDWRSDGALAASAADGSFRVMREDASAIEIVDTVEGAHDLE
FT                   MWAIAFDATRADVLYTGADDCAFKAWDLRDASRAQMVNRKTHCAGVTCVVPSPRDENTV
FT                   VTGSYDDHVRLWDVRSMKSPVSELNVGGGAWRCRWHPTRNALACAAMGGGAVLVDVDDA
FT                   SGALKEVFTYDEHESIVYGADWVQLDGDDDSSDVLVTCSFYDKSVRCWHV"
FT   gene            <530216..>531058
FT                   /locus_tag="OSTLU_44336"
FT   mRNA            <530216..>531058
FT                   /locus_tag="OSTLU_44336"
FT                   /product="predicted protein"
FT   CDS_pept        530216..531058
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44336"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44336"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98664"
FT                   /db_xref="InterPro:IPR000007"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="UniProtKB/TrEMBL:A4S530"
FT                   /protein_id="ABO98664.1"
FT                   /translation="MSCPAPLPPWADARARRKFTLEALPNDGTHARCHVLRKRGPLGVF
FT                   PTYVLYLDGRETTTATLGDAVPILVARKRKKSKCTHYVIGDDGAERAVNEAHASYVGKL
FT                   KANFIGTHFELLDSGVRPRAWGAPRHLDDEADDEEQGPPRRALANIRYAVNVLGAGGPR
FT                   ALSVSLLGDDVDDPNAVAHELESARPTWNPSAQAYVLNFNGRVTRPSVKNFQLVSSGLA
FT                   AAGAPSRADAESRTLTRGVLQFGRVDDDLFTLDFAHPLSPLTAFAACLSAFESKFARE"
FT   gene            <531156..>531566
FT                   /locus_tag="OSTLU_93480"
FT   mRNA            <531156..>531566
FT                   /locus_tag="OSTLU_93480"
FT                   /product="predicted protein"
FT   CDS_pept        <531156..531566
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93480"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93480"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98665"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:A4S531"
FT                   /protein_id="ABO98665.1"
FT                   /translation="VTSWHDFDGDARVARSTIEGAGYGLFARRRLATGDVVERATYSGD
FT                   VLSLAEALKLGDDEKAYVMAMHFNVHVDARRHYGYLARYVNDAEGTPFETNVKFEKDVA
FT                   QRRATLRAVKDVEVGEELFAAYGRGYWRAKVG"
FT   gene            complement(531564..>533593)
FT                   /locus_tag="OSTLU_50812"
FT   mRNA            complement(531564..>533593)
FT                   /locus_tag="OSTLU_50812"
FT                   /product="ABC(ABCB) family transporter: mitochondrial
FT                   ATM1-like protien (ABCB)"
FT   CDS_pept        complement(531647..533593)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_50812"
FT                   /product="ABC(ABCB) family transporter: mitochondrial
FT                   ATM1-like protein (ABCB)"
FT                   /note="GO_component: - membrane; integral to membrane;
FT                   GO_function: - ATP binding; GO_process: - transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_50812"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98832"
FT                   /db_xref="GOA:A4S532"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A4S532"
FT                   /protein_id="ABO98832.1"
FT                   /translation="MPARESGDENAYFRAGDVSLDGPIPPPPRTSDLRDVLPYLFAVSL
FT                   SRRGTAWRLCAALTFLVIQKSFGLAVPVLFKVAVDHCTAAAAATGMVATEAAKAAAAAL
FT                   LVSGCLKAISGVATELRTVMFTPVAQASGRRVALEVFNHVLNLDLSFHLERRTGALQRI
FT                   IDRGTRSVSMVFRAVVFTFLPTAMELALVCGLLWHAFSWHFVVIVLTTFVAYVWWTMHM
FT                   TGVSAEKRKLANHMDGLSTGKAVDALLNYETVTFFGNVELESQQYDKLLRGYHEAALGS
FT                   ERASSLLNAGQAVILACGMTTILSCAALGLWKVDPAGGLASRVGDLVMANGLLLQLWAP
FT                   LQFLGFFYRELRQSLVDMEAMFDIMATETKIPDGEIALPAHAGGADLELDNVTFRYGNG
FT                   RDVLKGVSLKLKPGESVGIVGPSGSGKSTLLRLILRVYDVSSGKISIDGYDVRDLKIDS
FT                   LRDSVAVVPQDTVLFNDTLDHNIRYGRPTANDDEVAMAATRARLNKTIEQMPKGRETMV
FT                   GERGVKLSGGEKQRVAIARAFLREPRMLVADEATSALDTATEQGILESLEDVARGRTAV
FT                   FVAHRLSTVRSCDRIIVMEQGRIVEEGTHAELLDGTSRGTKIGMYAAMWKAQAQEDEKE
FT                   RSSVVKPDDMVMV"
FT   gene            <534515..>536038
FT                   /locus_tag="OSTLU_1996"
FT   mRNA            <534515..>536038
FT                   /locus_tag="OSTLU_1996"
FT                   /product="predicted protein"
FT   CDS_pept        <534515..>536038
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_1996"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_1996"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98666"
FT                   /db_xref="GOA:A4S533"
FT                   /db_xref="InterPro:IPR008380"
FT                   /db_xref="InterPro:IPR016695"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4S533"
FT                   /protein_id="ABO98666.1"
FT                   /translation="WSTTNEAERAERAATKVFCNRSLNMKRINAIGFDMDYTLAMYKPE
FT                   TFEMMSYSETKKKLVESYNYPRALLESFEFDPDYMVRGLVVDKKRGNVLKMDRHNYVKV
FT                   AYHGFTALDTDERLATYCETSKRQSFDGPEFSALDTLFSMGEAYLFSQLVEAKDSGKHG
FT                   EFFERKTFMQMYDEIRAAVDLCHRDGSLKHAVAENPSKYITKDADLVPLLKALRASGKQ
FT                   VFLLTNSLWDYTNVVMNYLIDDNVGDQKKLEWLNLFDVVVTGSAKPGFFANDSATIFEV
FT                   DTATGLLHNTDNGAPLTPIGSVSDSTHKRALASGLRATGKGPARVYQGGSYTHLHAMLG
FT                   IEIGSRLLYVGDHIYGDILRAKKEIDWRTMLVVPELAHEIDCLERMKEKPHALRRLRTL
FT                   RDSLDDQVARHAWLAANAADPKANEEELERARQLSATARTAHREGMREYHKSFHYVWGQ
FT                   LMKAGSQNSRFAFQVERYACLYTSHVRNLWGYSPEKVFRAPADFSPHDLD"
FT   gene            complement(<536169..>536744)
FT                   /locus_tag="OSTLU_26622"
FT   mRNA            complement(<536169..>536744)
FT                   /locus_tag="OSTLU_26622"
FT                   /product="predicted protein"
FT   CDS_pept        complement(536169..536744)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26622"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26622"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98833"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:A4S534"
FT                   /protein_id="ABO98833.1"
FT                   /translation="MGKREQFGIDLKSLCVKPGRARWTLTVDCACACDRGSMLDALSVG
FT                   VRAALADTKIPKVTVAGVGEDGAGGELEIDDDPEACSRVDVSRCGVVVTTTKIGRHGVV
FT                   DATEEETACSEATMSVGVDREGTICAEFGAGGESLDRGTAQAMRKLACKVGVELIEHMD
FT                   GYLARAIAVDVDDDDEGDDRVLKVKIRR"
FT   gene            <537667..>538503
FT                   /locus_tag="OSTLU_6042"
FT   mRNA            join(<537667..538051,538103..>538503)
FT                   /locus_tag="OSTLU_6042"
FT                   /product="predicted protein"
FT   CDS_pept        join(<537667..538051,538103..>538503)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_6042"
FT                   /product="predicted protein"
FT                   /note="GO_component: - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_6042"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98667"
FT                   /db_xref="GOA:A4S535"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/TrEMBL:A4S535"
FT                   /protein_id="ABO98667.1"
FT                   /translation="QMASAIGHGIHRTSLKLERLNQLAKSSSLYDDKSREIAETSAVIK
FT                   LDIQALNESIVELQGAAARTRERGEANKSASDHSVTVVDTLKNRLATATKTFKETLTTR
FT                   QANIKAGEERRAMFGASAGPSAFDGASGFGNLQGNANAFVPRPSAPGAGVSGAPMMQTQ
FT                   GQMQLYNQNTAYADSRQEALQNVERTITELGGIFQQLATMVSEQGELAIRIDENVDDTL
FT                   ANVDSAQTQLLKYLNTVSSNRWLILKIFAVLISFFSFFIV"
FT   gene            <538626..>539654
FT                   /locus_tag="OSTLU_17441"
FT   mRNA            <538626..>539654
FT                   /locus_tag="OSTLU_17441"
FT                   /product="predicted protein"
FT   CDS_pept        538626..539654
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17441"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17441"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98668"
FT                   /db_xref="UniProtKB/TrEMBL:A4S536"
FT                   /protein_id="ABO98668.1"
FT                   /translation="MKRGSDADDPRAPALTSVSRAVSGETFRILTRASTSAIDVSARDA
FT                   SGKTFVGRLDLQRAPFERFGEFARAALGDPRRERVERAFTFTFERAEENGDEYELVWRF
FT                   REAEAEATLDDGAEFATTRAKTANDGKNYGAVRTGVCGMRRVESDDAFCDGGFAYEALG
FT                   EALEMEARRRFNAERDGKRAIEARERANENCETALREMDALKERLAQNFLSLLNEKKKG
FT                   MRKMAEELEAARAENDELKADLASARLEHSKPDVDGFVAVKGERSVDADVDEDRDESED
FT                   EYNTDDETERTRRRGRKRDASQPSQRKSQPSQSQPSQKRARNATAKKKSFLADTLALLD
FT                   AD"
FT   gene            complement(<539698..>540168)
FT                   /locus_tag="OSTLU_88679"
FT   mRNA            complement(<539698..>540168)
FT                   /locus_tag="OSTLU_88679"
FT                   /product="predicted protein"
FT   CDS_pept        complement(539698..540168)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88679"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88679"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98834"
FT                   /db_xref="UniProtKB/TrEMBL:A4S537"
FT                   /protein_id="ABO98834.1"
FT                   /translation="MTAVSDEANDRVAWANAMRLCVTRRDALNDDGSIDQQFFKPKRVV
FT                   FETRAKKWGDEERAKLYEGIETYGIQEWGTIRENLLPDWDTLNLRVKAARLMGTQSLSR
FT                   YPKGWKGTKAEVEAEYAKHKKIGEATGCWKNGQLVEDDNGTAAKYMAEHGLL"
FT   gene            <540450..>540875
FT                   /locus_tag="OSTLU_26625"
FT   mRNA            <540450..>540875
FT                   /locus_tag="OSTLU_26625"
FT                   /product="predicted protein"
FT   CDS_pept        540450..540875
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26625"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26625"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98669"
FT                   /db_xref="UniProtKB/TrEMBL:A4S538"
FT                   /protein_id="ABO98669.1"
FT                   /translation="MSKKNNRTTAANRVEHAKRVEREALVKKEARRVRKMAAMALASDA
FT                   MAVDGAGGKGGTAGRARLEAKNVRKAQSLRLAGGVRKVRAGKNTHKVVRGVPVGKAKLR
FT                   KNAVVMGIKIVDAATKQAALDAIAEARGDGGATAMRR"
FT   gene            complement(<540978..>541658)
FT                   /locus_tag="OSTLU_17444"
FT   mRNA            complement(<540978..>541658)
FT                   /locus_tag="OSTLU_17444"
FT                   /product="predicted protein"
FT   CDS_pept        complement(540978..541658)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17444"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17444"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98835"
FT                   /db_xref="GOA:A4S539"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4S539"
FT                   /protein_id="ABO98835.1"
FT                   /translation="MAPSPSNLASMAKIATHESVYPPAEDSFLLVDALAALWDDELARS
FT                   RPKLCIELGTGSGYIACSNALLARAHGCGDVTRTRASDINPDAVAACRATCEAHGVSGT
FT                   ECATALGDLLEPHADALADAGGCDVLVFNPPYVVTPSEEVGGRGIEASWAGGARGREVL
FT                   DRLLPSVRSALAPRGMFLCILLAQNEPEEVMEIMRRDGLRCSLVSSCNADEEALFVLRC
FT                   DRDA"
FT   gene            complement(<541752..>543932)
FT                   /locus_tag="OSTLU_93482"
FT   mRNA            complement(<541752..>543932)
FT                   /locus_tag="OSTLU_93482"
FT                   /product="predicted protein"
FT   CDS_pept        complement(541752..543932)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93482"
FT                   /product="predicted protein"
FT                   /note="GO_function: - zinc ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93482"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98836"
FT                   /db_xref="GOA:A4S540"
FT                   /db_xref="InterPro:IPR001293"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:A4S540"
FT                   /protein_id="ABO98836.1"
FT                   /translation="MSRPRRDAVRGARALAPAVEDAPVRTRDDARSSDSSEDEARARRR
FT                   DKHLTTQKFVESIANAKGALLAEDVERLYAARCEEVAHDGRDQSDTESDASEEERGKWW
FT                   PLTAVTTPKSAAEACAAEAKRAEEEGIVPEGTMATSELMIHNWFHLSESLTRWRRAGTM
FT                   VLTPPPDELRCHTCRDFAAEPLVNAQGRLFCAPCGRENEGDARAKLFGLDVQTQMRLDA
FT                   LPVMCCNVATPHAGGDNLVWKVALDGCRAVSTLGKVRAHEETCEYTLMRCSLPAESTNK
FT                   AEKCHAVVPRRTMDSHRATCEYRIQKCADCDRSVQVRKMRAHVMICGQIEVHCPYRRCK
FT                   WRGARDGVDAHVATECLLHPVVCRLEDSETRETCKETVPRERIAQHRASCQYQQRPCEY
FT                   CTREVSLRRMGDHKLRCKAREFQCPLCRRIMPAEQRESHEKTTCPMIESVCEHARFGCD
FT                   VKVPKEHYRQHAIECFPEHVAHVAFGTDGVSEFVSAPSDDQVDAVELLKRMQRNREAML
FT                   ADFASFETMCHKVSCKLNARAELCSTASHAAKDVEETTAAFERQAERERCASAFALREK
FT                   HSLDRDEDYNDMIVSRNLVGARIIDEMRRFDETTAKLRLKSEALYAALDEKRDFATRRL
FT                   EDEIDAHTPAADLIADAKDEATKYVATVDAERRRLAARLIDMKSNVFSAKMSLVENVEH
FT                   RKRRSETLRAKLTAFARGERFVDGDGVHTTHS"
FT   gene            complement(<544063..545037)
FT                   /locus_tag="OSTLU_26628"
FT   mRNA            complement(<544063..545037)
FT                   /locus_tag="OSTLU_26628"
FT                   /product="predicted protein"
FT   CDS_pept        complement(544063..544902)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26628"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26628"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98837"
FT                   /db_xref="InterPro:IPR021867"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4S541"
FT                   /protein_id="ABO98837.1"
FT                   /translation="MGTPRGKKRKATKPLFASMKSMKRARAVTTEFHGVTRVLDDAKAS
FT                   KEAKARAKATLEAIGGRDAYQEASALTTRRHRTAKWTFSVLTKKNRRPKRGERALKTLE
FT                   VGAINTDLMSAKFLDVRAIDVKSRHPKIEQLDFFDMPVEAESYDVIHSSMVVNCVPTAE
FT                   LRGEMIARTATFLRPKGLFFMMLPLRCVTASTRMSQEKMSRLLRACGLRVVEQKRTPKI
FT                   VFYCCEKLGKPTETLIGKDLVKRDAREAFAKSERAKDAGGDPSHFGIILKDEHLCGY"
FT   gene            <545658..>546560
FT                   /locus_tag="OSTLU_6061"
FT   mRNA            <545658..>546560
FT                   /locus_tag="OSTLU_6061"
FT                   /product="Annexin family transporter: Annexin A13"
FT   CDS_pept        <545658..>546560
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_6061"
FT                   /product="Annexin family transporter: Annexin A13"
FT                   /note="GO_function: - calcium ion binding;
FT                   calcium-dependent phospholipid binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_6061"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98670"
FT                   /db_xref="GOA:A4S542"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="InterPro:IPR037104"
FT                   /db_xref="UniProtKB/TrEMBL:A4S542"
FT                   /protein_id="ABO98670.1"
FT                   /translation="EAQTVMRAIKGFGTDEATLITILCTLAEEDILPLQMAFSSRYEKS
FT                   MEQAVLSETSGKFKRVLLLAGCDGVGESYAKVINSAVAGLGTDTKAIIRLMVTATPEQL
FT                   DATREAYSRIYKKDLIRAVGSEWKVRGDFKRIIEALAKRHPANVNDDADIDYSADVRAM
FT                   RNAVEGMGTDEAAVIALLANKSHKQIEAFREAYKIETGELLRERIRNETTGLFESKLFR
FT                   ETLMGLLTPREEQIAIYLGEAMAGWGNDDWGLISMLVHRTEEEKMAIRTKYTEHFGGDL
FT                   IADIRSNCRGDYEDALVACI"
FT   gene            <547458..>549044
FT                   /locus_tag="OSTLU_44385"
FT   mRNA            join(<547458..548399,548622..>549044)
FT                   /locus_tag="OSTLU_44385"
FT                   /product="predicted protein"
FT   CDS_pept        join(547458..548399,548622..549044)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_44385"
FT                   /product="predicted protein"
FT                   /note="GO_function: - pepsin A activity; GO_process: -
FT                   proteolysis and peptidolysis; lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_44385"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98671"
FT                   /db_xref="GOA:A4S543"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR007856"
FT                   /db_xref="InterPro:IPR008138"
FT                   /db_xref="InterPro:IPR008139"
FT                   /db_xref="InterPro:IPR011001"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="UniProtKB/TrEMBL:A4S543"
FT                   /protein_id="ABO98671.1"
FT                   /translation="MDASDEERSAPKRGGVDVHNYMDAQYYGEIEIGNPRQKFQVVFDT
FT                   GSSNLWVPSSKCGFLQIPCDLHAKFDSRASETYEADGTPFAIQYGSGSLSGFLSKDEVK
FT                   VGDLVVQGQYFAEATKEPGIAFLFSKFDGILGLGFDNIAVDKVKPVFYNMMEQGLVENK
FT                   MFSFWLNRTSTKDGMPSEVGGELIFGGSDPDHFIGEHTYAPVTREGYWQIKMDDFKVDG
FT                   RSLGACDGDDGCQVIADTGTSLLAGPTEIVNKINDYIGAHSMIGEECRLLIDQYAEQFV
FT                   EDLENYSSEQICASIGACDADGVEAMEADDDDDLGKSSSSFEGQIACTACKTVVNYAQD
FT                   MLAQNVTEKIIVNEVKRVCDMVPSVGGTASVDCDNIPNMPDVEFVIGGVPFKLTPEQYV
FT                   LKVYQDGEAQCVSGFMGMDIPKPAGPLWILGDVFLGPYHTEFDYANRRVGFAPAA"
FT   gene            <549309..>549563
FT                   /locus_tag="OSTLU_9831"
FT   mRNA            <549309..>549563
FT                   /locus_tag="OSTLU_9831"
FT                   /product="predicted protein"
FT   CDS_pept        <549309..>549563
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_9831"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_9831"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98672"
FT                   /db_xref="GOA:A4S544"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024991"
FT                   /db_xref="UniProtKB/TrEMBL:A4S544"
FT                   /protein_id="ABO98672.1"
FT                   /translation="LNVKTWHGVGAWTWGAGDVGDVCGICRIAFDGCPPDAKFPGDDSP
FT                   VVWGKCGHAFHLQCITKWLSGANAEAPRCPICRGAWEFKE"
FT   gene            complement(<549750..>552104)
FT                   /locus_tag="OSTLU_17449"
FT   mRNA            complement(join(<549750..551613,551815..>552104))
FT                   /locus_tag="OSTLU_17449"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(549750..551613,551815..552104))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17449"
FT                   /product="predicted protein"
FT                   /note="GO_component: - nucleus; GO_function: - DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17449"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98838"
FT                   /db_xref="GOA:A4S545"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4S545"
FT                   /protein_id="ABO98838.1"
FT                   /translation="MAAKAQGARDAAPVPSGKARGASASAKRAKEDARKRAGKRGAAAT
FT                   ARDDGATTAREASGVRGYWQAPEEQALKRAVRKHGIGAWEKMRNDPEFAALRSRTGVQL
FT                   KDKWRNLIKFQHLRVDEAAKVPYKAAVKAANAANATGGKAGRGADKGGARGASAANAKG
FT                   GKAASAASARKTNAAVNAKKGKGASASSAKKGAGGKKTMAVSRDALPKKGGGGTTNVAG
FT                   APTMSAKEKLKARFGHRHDDDDQDEDDEYEEIAGVGRPSTGAKAKFDAGVDAVVTQLKA
FT                   KRAGMVNEVEHAESELARMKTVVEEAEAVYSSARARVHEALVGAHGEDEYYEDGEGEDT
FT                   ADWDKYLHFGEHEDEDDDEEVARAAEAAAEAHEAVKRGIKKPSEKKPSEKRPKAAVDED
FT                   ATDHDDDSDEEIDEDLVDSDEDDDDLDEEERAVRIANEVLAEAGLPPMHEIEHVLLTEL
FT                   KKLEAANAAVVHARLALEAVDAEFAEALVSAHNNAAANAKATTSAAFDHDDDLEKSFTM
FT                   DGDEDEDDEDEDDEVDDEDDEEIDEDLVDDEEIEEEIRPQPTSKSKAKPKAKSAPSQND
FT                   GADAAGGRVVEDRRYGIYDARRYRSEAENDAAEAAASKGGKVSAASKRKAPTSSSAAAP
FT                   KKSAKQTVKVEDTEIWYEQPNVAKAGAAVMPKKSQQFRAAPQSAPGSIPSWRRKRAATR
FT                   VTIGRPVAGPTSWAAIGQHIIKE"
FT   gene            <552668..>553465
FT                   /locus_tag="OSTLU_26633"
FT   mRNA            <552668..>553465
FT                   /locus_tag="OSTLU_26633"
FT                   /product="predicted protein"
FT   CDS_pept        552668..553465
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26633"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26633"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98673"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A4S546"
FT                   /protein_id="ABO98673.1"
FT                   /translation="MRATRRRRLVAVVAGDSTACGVGCGDDGRGRTRGETAAGEAGPTL
FT                   ARAFARGLGERMTADVEWRALGFKGADVRGLRDKLIPALREATEGAGGRGDDDDDASER
FT                   DGRGRRASVDAVVIMCGLNDLKHSIVGRRSETFRTELRELVREVRDVVGDECVVVLPAT
FT                   PLEAATLFPPPLAWVATRMNDLWDEQKAHVSRLFAHNVLFVSKPSLDAMRERAAKHTGR
FT                   VAESISLICGDGIHPNDDGYDAWARHIADECVPSLERALAAQK"
FT   gene            complement(<553584..>554291)
FT                   /locus_tag="OSTLU_6627"
FT   mRNA            complement(join(<553584..553854,553924..>554291))
FT                   /locus_tag="OSTLU_6627"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<553584..553854,553924..>554291))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_6627"
FT                   /product="predicted protein"
FT                   /note="GO_function: - phosphoribosylanthranilate isomerase
FT                   activity; GO_process: - tryptophan metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_6627"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98839"
FT                   /db_xref="GOA:A4S547"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4S547"
FT                   /protein_id="ABO98839.1"
FT                   /translation="KPIVKVCGITTVRDCESACEHGANFVGMILWPKSKRSVDEATAKE
FT                   IVACAKAKGAVPVAVFVDEDASEITRVCDAIGCDHAQLHGDGARDALETLPMRLKAIWV
FT                   LNADANGQIVSKFPGDEENGPRRVVDWLLIDGVNAGSGTAFDWSKLKAPRGASRKGWLL
FT                   AGGLNPENVAQAIETANPTGVDVASGVADEGGVVKDAAKIAAFIGNARAA"
FT   gene            <554798..>555412
FT                   /locus_tag="OSTLU_26635"
FT   mRNA            join(<554798..554805,554986..>555412)
FT                   /locus_tag="OSTLU_26635"
FT                   /product="predicted protein"
FT   CDS_pept        join(554798..554805,554986..555412)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26635"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nucleoside-diphosphate kinase
FT                   activity; ATP binding; GO_process: - GTP biosynthesis; UTP
FT                   biosynthesis; CTP biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26635"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98674"
FT                   /db_xref="GOA:A4S548"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:A4S548"
FT                   /protein_id="ABO98674.1"
FT                   /translation="MIKPDGVQRGHVGEIISRFEKKGMVMKALKTYQCPKAVAEEHYQD
FT                   LSSKPFFGDLVNYICSGPVVAMIWEGPGVVKSARLLIGATNPLESAPGTIRGDLAVEVG
FT                   RNVIHGSDSVESAEREIELWFGDKAGCVDWQPTITPWVRE"
FT   gene            <555560..>556570
FT                   /locus_tag="OSTLU_26636"
FT   mRNA            <555560..>556570
FT                   /locus_tag="OSTLU_26636"
FT                   /product="predicted protein"
FT   CDS_pept        555560..556570
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26636"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26636"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98675"
FT                   /db_xref="InterPro:IPR029157"
FT                   /db_xref="InterPro:IPR033603"
FT                   /db_xref="UniProtKB/TrEMBL:A4S549"
FT                   /protein_id="ABO98675.1"
FT                   /translation="MADVDGACARLKRALRRAKFPRSRAGTRIDTELKRGDGKTFVAIL
FT                   RHALCARSKPVSRRVYDRGHDLVGVESPLRFTERAFRATIDVFGYKPKLSASQFASTNG
FT                   FAVVKMMTVIDVLAHVEAMEVNIEREVAREASRRRTSGGLTGSLLDAGPRRRSALEPRF
FT                   ARGRVEDERGVDESNDAHAHTFCDTDNWVTRLGDEYDDVVYEAPIRGVVYTNPGYVVHR
FT                   RARSPREPVFDASVSIDSLRVEFAEVLGRLTRVENELTEVAARCLKLERREAQTLKKVD
FT                   RAPAASRDASPSILSDSVEIRQADSPSKESTEEFIARYLRKLRDVVREEETRFDC"
FT   gene            complement(<556616..>557419)
FT                   /gene="TPR3a"
FT                   /locus_tag="OSTLU_26637"
FT   mRNA            complement(<556616..>557419)
FT                   /gene="TPR3a"
FT                   /locus_tag="OSTLU_26637"
FT                   /product="TRP-containing protein"
FT   CDS_pept        complement(556616..557419)
FT                   /codon_start=1
FT                   /gene="TPR3a"
FT                   /locus_tag="OSTLU_26637"
FT                   /product="TRP-containing protein"
FT                   /note="contains a tetratrichopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26637"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98840"
FT                   /db_xref="GOA:A4S550"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4S550"
FT                   /protein_id="ABO98840.1"
FT                   /translation="MRVGERVGIVVPSGGAPFASEPFSPAPRNVYVEWEVELLSVTREE
FT                   KPSVDASVEEVLRYCERKKEEANALFARGEEENGYARALRRYEDAATALRRTIMSTARA
FT                   GAKDALALAVKCHVNSATCLSKLQRHSEAILHAEAALDLDATAVKAMYRKAMALEQQGR
FT                   DEEALTSLRDALELSKDRAIREAFVRVRRRMNAVHEGEREVCARMVQTDPTTEPTTRGF
FT                   GERAAQLYRKRPALAGAITVAAFAAMVMYFRRSEKSASTTTATSD"
FT   gene            complement(<558042..>558293)
FT                   /locus_tag="OSTLU_26638"
FT   mRNA            complement(<558042..>558293)
FT                   /locus_tag="OSTLU_26638"
FT                   /product="predicted protein"
FT   CDS_pept        complement(558042..558293)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26638"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26638"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98841"
FT                   /db_xref="UniProtKB/TrEMBL:A4S551"
FT                   /protein_id="ABO98841.1"
FT                   /translation="MTDGAATQYGFPQYDAPARAASRQLGFKVGKEHETVALTRGRDGA
FT                   DAYEAIANTAYLKQAAANAMKYGWEKSKQTPGVRKYMK"
FT   gene            complement(<558657..>558971)
FT                   /locus_tag="OSTLU_26639"
FT   mRNA            complement(<558657..>558971)
FT                   /locus_tag="OSTLU_26639"
FT                   /product="predicted protein"
FT   CDS_pept        complement(558657..558971)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26639"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26639"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98842"
FT                   /db_xref="UniProtKB/TrEMBL:A4S552"
FT                   /protein_id="ABO98842.1"
FT                   /translation="MSEFAPPSYTGDPNLARCSEEYFKLGFWGLQFGLAFCALGGARFS
FT                   RIAPGLSGDTALALSEEAANRRREKAGKRRRSHLQKGFGDKTGNAYQLRALDFRRQNMM
FT                   "
FT   gene            complement(<559178..>560053)
FT                   /locus_tag="OSTLU_17454"
FT   mRNA            complement(<559178..>560053)
FT                   /locus_tag="OSTLU_17454"
FT                   /product="predicted protein"
FT   CDS_pept        complement(559178..560053)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17454"
FT                   /product="predicted protein"
FT                   /note="GO_function: - catalytic activity; GO_process: -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17454"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98843"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A4S553"
FT                   /protein_id="ABO98843.1"
FT                   /translation="MTSARARGLASIAFASVCAGLGVQGVAVSPHARAEPSVAAAEAAR
FT                   LSKRKIIVDARARTSWDWNWDGRSSGGDPTPSDSVAASAAPTKVYWLVRHGQATEETPE
FT                   TDAAADGERKLTDLGRKQASFTARRLKELIPSTASVKMTHSTMVRAKETADIIAAEAFP
FT                   NATRKSSELIREGAPVRPEPDTWRQAEHVHVTDAPRIEAGFRETFHRAPSPSSAATKPP
FT                   PPEHEIVVCHGNVIRYSVLRALQLPPDAWLRIGLYNGSITRVEVRGDGGVSLRCLGDAG
FT                   YMTADMLTHN"
FT   gene            complement(<560289..>562223)
FT                   /pseudo
FT                   /gene="SUT2"
FT                   /locus_tag="OSTLU_2073"
FT   CDS_pept        complement(join(<560289..560738,560836..561476,
FT                   561681..561877,561977..>562223))
FT                   /pseudo
FT                   /codon_start=1
FT                   /gene="SUT2"
FT                   /locus_tag="OSTLU_2073"
FT   gene            complement(<562803..>563344)
FT                   /gene="RPL28"
FT                   /locus_tag="OSTLU_26642"
FT   mRNA            complement(join(<562803..562865,563042..>563344))
FT                   /gene="RPL28"
FT                   /locus_tag="OSTLU_26642"
FT                   /product="Ribosomal protein L28, component of cytosolic 80S
FT                   ribosome and 60S large subunit"
FT   CDS_pept        complement(join(562803..562865,563042..563344))
FT                   /codon_start=1
FT                   /gene="RPL28"
FT                   /locus_tag="OSTLU_26642"
FT                   /product="Ribosomal protein L28, component of cytosolic 80S
FT                   ribosome and 60S large subunit"
FT                   /note="Cytosolic 80S ribosomal protein L28; Cytosolic 60S
FT                   large ribosomal subunit protein L28; GO_component: - large
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26642"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98844"
FT                   /db_xref="GOA:A4S554"
FT                   /db_xref="InterPro:IPR002672"
FT                   /db_xref="InterPro:IPR029004"
FT                   /db_xref="UniProtKB/TrEMBL:A4S554"
FT                   /protein_id="ABO98844.1"
FT                   /translation="MISHVPASDDFLWQVTKKHNAFTRASTSGHGARFSAEPGNVTAEV
FT                   SFRASGLANAKTIDIREHDGGKGKPAATCDGKKLCGSFKSQAGEVKIAAKARPDLEKAA
FT                   LARISAINKAGRVKCAA"
FT   gene            <563531..>564123
FT                   /locus_tag="OSTLU_26643"
FT   mRNA            join(<563531..563572,563710..563772,563854..>564123)
FT                   /locus_tag="OSTLU_26643"
FT                   /product="predicted protein"
FT   CDS_pept        join(563531..563572,563710..563772,563854..564123)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26643"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26643"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98676"
FT                   /db_xref="UniProtKB/TrEMBL:A4S555"
FT                   /protein_id="ABO98676.1"
FT                   /translation="MAIDKLMMISGAGTLSYGVQMKFMPKVASKMYWKEGERNNIDTVQ
FT                   SGWLGTVLLGSGALQVMSALDGECTKNQMGGAALAWAVTLPEYVAQRDDFKGPMLYANT
FT                   AMATALTAVLVKSYLDKRDK"
FT   gene            <564302..>565765
FT                   /locus_tag="OSTLU_26644"
FT   mRNA            <564302..>565765
FT                   /locus_tag="OSTLU_26644"
FT                   /product="predicted protein"
FT   CDS_pept        564302..565765
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26644"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nucleotidyltransferase activity;
FT                   GO_process: - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26644"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98677"
FT                   /db_xref="GOA:A4S556"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039741"
FT                   /db_xref="UniProtKB/TrEMBL:A4S556"
FT                   /protein_id="ABO98677.1"
FT                   /translation="MGCASSKSSSLTLARARYASLPGPEQKTIVGALERAATSDADAAR
FT                   LCAALANVECERAVDVFQRSALAHETSTSGTLEPVRCDCEIVPGSDDAERWRRRGLECV
FT                   KRGKLAVVLLAGGQGTRLGSANPKGMYDIGLPSKKTLFELQGERLAKLGALAGARAPTW
FT                   YVMTSPFTHDATVAFFKSRDYFGLNARDVVFFKQGTLPCFTEDGEIILKSFGEVSEAPD
FT                   GNGGIYAAMAREGVIADMRKRKIEHVYAYCVDNALVQVGDPTFVGCCVERECEAGAKVI
FT                   AKAYPTEPVGVFACRKNEATGAKEYHVVEYSEIPESLATAKDKKTGELKFNAANIALHY
FT                   FSFDFLSRCCLDIALPHHVARKKIPYLDVNTGKTIEPSSPNGIKLEAFIFDTYKYAKSV
FT                   CVVRGDRALDFAPVKNAEGAGKDSPDTAREAILSLHARWILQAGGVIVDENDVPVPTDR
FT                   ARCEVSPAVSYAGESLASRLRVRVGGVVR"
FT   gene            <566308..>566949
FT                   /locus_tag="OSTLU_43913"
FT   mRNA            <566308..>566949
FT                   /locus_tag="OSTLU_43913"
FT                   /product="predicted protein"
FT   CDS_pept        566308..>566949
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_43913"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_43913"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98678"
FT                   /db_xref="GOA:A4S557"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034261"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039780"
FT                   /db_xref="UniProtKB/TrEMBL:A4S557"
FT                   /protein_id="ABO98678.1"
FT                   /translation="MELASKDDAKGRCPACRTEYDEDAISFDAVPEEELAANAQRAKKR
FT                   EGKAGAANANANGTNGIKAGSGTGANAAQSQSRKHLQNVRVIQRNLVYVVGLSARCCKE
FT                   EVLRKNDFFGKYGKILKLQVSVNRNGSSSYAGRNADDTGSAYVTFYEENDAMQCIQHID
FT                   GTPLDGRILRACFGTTKYCNAFLKYQPCNNPDCLYLHDIGRDNDSFTKEEM"
FT   gene            complement(568220..569958)
FT                   /locus_tag="OSTLU_50892"
FT   mRNA            complement(join(568220..569669,569854..569958))
FT                   /locus_tag="OSTLU_50892"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(568237..569669,569854..569929))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_50892"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_50892"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98845"
FT                   /db_xref="GOA:A4S558"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019382"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4S558"
FT                   /protein_id="ABO98845.1"
FT                   /translation="MASASARDAVKQFVTYFYRHIREKNVYETLTMYERSFPAIGERFF
FT                   KKTAWPTPDAIATYAENDPVFKMLYAELYYRHLHQATTPSANERKGSWENYCELFGALL
FT                   HGDANMQLPNVWLYEMVDEFVYQFQSFRQFKGSSKRTSEELQAIKALDAQVWDRTSMLN
FT                   FLKALVDKSDIVRVLERERAGEISFAANEGYALDSSNVLPTLGYCAQIGICRLHVLTGD
FT                   YEGALAALDAVDLDKDGLFKKIPGAYVATSYHVGFAYFMLGRYTDAIRHFNESIQYVER
FT                   LRFGAARPHALPLLLKKQEQMYALIAITMALVPGQQYLLDGSVSLGLHQKYSEKVNRMT
FT                   SGEVAVFDDLFSYACPKFVASGDGDNSEAHKTQLKAFLDSVATHAVIPKLRGYLRMYTS
FT                   IKLDKLAALVETPVESLKASLKAFVQGYTVKEWTGGASALDGEEVYCGDMSVILDGDVV
FT                   RVEETKKAKSAREFFARTNQKLAASLEDLAQAKPLLIKPSAIVG"
FT   gene            <570214..>573162
FT                   /locus_tag="OSTLU_43971"
FT   mRNA            join(<570214..570341,570402..>573162)
FT                   /locus_tag="OSTLU_43971"
FT                   /product="predicted protein"
FT   CDS_pept        join(570214..570341,570402..573162)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_43971"
FT                   /product="predicted protein"
FT                   /note="GO_function: - RNA binding; ribonuclease activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_43971"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98679"
FT                   /db_xref="GOA:A4S559"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033770"
FT                   /db_xref="InterPro:IPR033771"
FT                   /db_xref="InterPro:IPR041505"
FT                   /db_xref="UniProtKB/TrEMBL:A4S559"
FT                   /protein_id="ABO98679.1"
FT                   /translation="MHRVGKTFVKTTKRGQAVTKVRRERYLRDDVYVGCGDAAVEARER
FT                   TIALIDSNVALHQMDALADARVTDVVICATVMEETRNKSRTSYERLRGLCKDKEKRFYV
FT                   FSNENHAETYAEDVAGESANDRNDRAIRKAAAFYRRAIPRAACERVTLVTNDRGNARKA
FT                   REENIDVMSVIEWIQSISNDASLVDLVVPGGGAEIPEDERDAKRAKSGGGASASVFEAY
FT                   LDANDIKEGLASGKLIKGGVRTSRYNPFEAHVMNEGTGEGVLLSGRAAMNRAIDGDLVA
FT                   VEILPESQWIRPGGMIITGTAEEDKETSSADVDAKDDAGGLAPETADETDVAVAATKAS
FT                   GVVPTGKVVGIIRRNWRERGYAASVDMGRDGKGPTAAGGGFASRVLCVPSDRRFPKIRI
FT                   QTRQLEGLLDQRIVVVIDDWPADSMYPEGHYVKSLGLIGSVDAETQALLLENDVDDRPF
FT                   APAVYACVPALPWKVTDDHLAEPGREDLRDLLVCSVDPPGCKDIDDALSARDIDDERIE
FT                   IGVHIADVTSFLFPDTAMDEEAARRGTTTYLVQRRLDMLPGALTTDICSLVGGQERLAF
FT                   SAFWIVQKSTMLPDETVKPRFTKSVIKSAAALTYEQAQTRIDDASLNDDLTLSLRRLRD
FT                   VARQLRKRRMANGALTLASPEVRFEMDQQSSDPLDVGMYVTRETNQMVEEMMLLANVST
FT                   AERILQAYPAAAMLRRHPIPEQKMFEPLLKAAKACGVDIDTQSNRTLAASLDAAVRPED
FT                   AYFNTLLRLQATRCMSQAVYCSSGQYAGPERMHYGLAMPLYTHFTSPIRRYADVIVHRL
FT                   LSAAIGLCPRHKSLEDSDHVKSVADVCNVRHRNSQQAGRASVELHTLVFFRKRKIVADA
FT                   RVFKVRANGLVVFVPKFGIEGPVLFVEGENSDTATCTLDEDAMTVTHKGKTWKVFDRLT
FT                   VRVEVEQLPAHRSRLLITIVPDDTPRGEIASA"
FT   gene            complement(<573221..>573925)
FT                   /locus_tag="OSTLU_88691"
FT   mRNA            complement(<573221..>573925)
FT                   /locus_tag="OSTLU_88691"
FT                   /product="predicted protein"
FT   CDS_pept        complement(573221..573925)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88691"
FT                   /product="predicted protein"
FT                   /note="GO_component: - intracellular; GO_function: -
FT                   exonuclease activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88691"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98846"
FT                   /db_xref="GOA:A4S560"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4S560"
FT                   /protein_id="ABO98846.1"
FT                   /translation="MQSPARDETRTYDPYAVSPRVVSIDVECVANGTTHNDRAVAQIAI
FT                   VDARTEQTLLNVYVKQEKPVVSYLTPLTGLTEQLLAERGVSFAEAVAATKKALDARCVI
FT                   VGQGVLKDVEQWLGLVRGVDYGDLIDLCGIWRVFNAQYKSWSVFGQDHLVRCLLATEVA
FT                   ETHDAAGDCVKSVRLYRHWYALKDDDEKLACEKAKLLAIAPEPSFSKRFPSFEGVCQGN
FT                   RRTCVCKAPFFS"
FT   gene            complement(574046..>578548)
FT                   /locus_tag="OSTLU_26649"
FT   mRNA            complement(574046..>578548)
FT                   /locus_tag="OSTLU_26649"
FT                   /product="predicted protein"
FT   CDS_pept        complement(574094..578548)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26649"
FT                   /product="predicted protein"
FT                   /note="GO_function: - serine-type peptidase activity;
FT                   GO_process: - proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26649"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98847"
FT                   /db_xref="GOA:A4S561"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR012393"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028204"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A4S561"
FT                   /protein_id="ABO98847.1"
FT                   /translation="MASVRAEAAMKITRALGDAGTGTPALGLSQYERDLARAKTAENRA
FT                   LRRAPRPPTSARTFSASGTPRLGRDASNATSGARNATTTGYPSEDDEDAYGDEQDGYSD
FT                   ETEPERDERLVIKGVETVLERTRERLIDADSEDESVLGYYRLPTMASGKIAFVSETNIW
FT                   IASADGGVASRLSSTYSREGVPRLSPDGSHIAFLGLTYDGYDVFVAPTDGGVATQVTFG
FT                   GKTQDIADWPEDNEILLISTAFSKSASTQLVTLNPDTRAMSPLPFARAIEGVKESGGCY
FT                   VFVPLRQTSSTKRYEGGEQSRLWRWCRADSEAKPLTPEETWGVRGAWSPSVSVAKGLEN
FT                   FIFFISDKSGVANVWSMTTDGEFAMQLTNECLFDVQEFTVDGDVLVYRRGGSLYRRAIS
FT                   AHTARAPALGEEVELTYSLVSEFRKTMPTEIEDPYSSISELVLTNDGAFAAFVIRGQVF
FT                   HSALVPFLGTRVEKVTRYSGAVRYKHIQFVNDASSDGQPKLLALSDASGEYEYVLLERQ
FT                   IEGGPWRETKITTGGKIKGAMEFSSISPDNTALLLADTDGNLKLVNLTETAVNTALYRT
FT                   TEPEPISAKLAKRQSKPGRPDASPAGPQRPKPMLGRSPAARRAARRAARVGRRVSGRRA
FT                   SLHLASIGLGKEKSDDKASSVYADIDGIASIDTMLNGFRPEGVYGLAWSPDSSYIAFAK
FT                   DEENDFSSIHVLNVTSGESTRITTPSYNAHSPKFSPDGLYLYYFSDQQIASGGSSPYGA
FT                   RGAEPMFYETSRLMCVPLRIGMTCPFFIGDELNPEGSVFDAEFGKALPTMISTKNIEQR
FT                   AQVVPDLPEAQYLGFNIIGDGSGMLLTLVEDDQVIVAVYSMYSRQILPLYPDPMAVVVS
FT                   GDMQVFTLVTEQGVALLSAKGVLQPGLDQESALRGAEVWYPPDTFGVIVNPREEWLQMY
FT                   EEAMRNMRDAFYDPKLHGVDWTSITDRYRPLVYKISAKGELRDILAQAFGELSALHVFV
FT                   SVHSDDPVLPLGSPSACLGANFEMTPLGLKIAYIHESSGILEAPQSSLSRSSLYSHVKL
FT                   QAGDIIAKIDGVLVNSTELPLSNLLRGKAGMQVLLEVIKSPRSEQERKDEEDLQKMKEL
FT                   RMMQQMMGGGMGMASSQLGGASTATKTLRDPHMASLVRKHATPGAPRLPLGQPRHSVGP
FT                   LKNGDVHADAKLAGKEHKGDDENEQPAPTTEMIIVMPLMLEECDVLEAADAVVQKREYV
FT                   KSQTNDDVAYVYLEDMEQEGRGSSNSFDDFAAQFYPNVRKKGLIIDVRRNAGGNIDTWL
FT                   LERLRRVAWMFDTERSGAGDTTMQYTFRGKVVVLIDEQTSSDAEMFALGIQQLGIGPVI
FT                   GERTWGGAIGYSGHPELRLVDGSGFTIPSFGPYINGDWAIEQKGVTPDVLVSNLPVATF
FT                   HGKDAQLDAAIASILDLMGTESVELPPKPTYPNRAFDSTSCAAGETGVDSAYLVSTQAA
FT                   QDDASTPAVESATQVIQAETAVP"
FT   gene            <579194..>580482
FT                   /locus_tag="OSTLU_17464"
FT   mRNA            <579194..>580482
FT                   /locus_tag="OSTLU_17464"
FT                   /product="predicted protein"
FT   CDS_pept        579194..>580482
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17464"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17464"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98680"
FT                   /db_xref="GOA:A4S562"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042296"
FT                   /db_xref="UniProtKB/TrEMBL:A4S562"
FT                   /protein_id="ABO98680.1"
FT                   /translation="MASRRRDAPRGDARASARRERGRDIRVTTTTFYRAESAQGRDLGV
FT                   LAALTTRRRLEVLDATCASGARAARYAEAGVLKSMHANDVNADVEDVVRENLADLLSPA
FT                   SEVDVKLTFDDAQRVFARAWLEKTFYDVVDVDGFGAANFGDALKCVKYGGLFYATSTDA
FT                   RALCGQNPETLSRAFGNAVVAPSRPGVNEIALRVFIGDVVRRGAAIGISATPLFSLFHP
FT                   HGPVFRVMFRVEKARGGAYDAFASNRDAAMGFVGFCDRCGDTSVVRAPLIDVYGHTKTI
FT                   APGDDDATTQCARCRGEGSAEDTRSAALAISGPLWLRSLHDRDTVLAMIEAADAQGWFA
FT                   ADDESDTGPVKGQLSLRDLLDAFVGEADAGLERTPHHLRTDELGRRGRAKRVPPRDVLI
FT                   TALRAEGFAATRSHIDPRGLKTNATMADVVA"
FT   gene            complement(<580593..>581639)
FT                   /locus_tag="OSTLU_17465"
FT   mRNA            complement(join(<580593..581399,581562..>581639))
FT                   /locus_tag="OSTLU_17465"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(580593..581399,581562..581639))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17465"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17465"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98848"
FT                   /db_xref="GOA:A4S563"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037363"
FT                   /db_xref="InterPro:IPR037596"
FT                   /db_xref="UniProtKB/TrEMBL:A4S563"
FT                   /protein_id="ABO98848.1"
FT                   /translation="MHDCAYDYYGRRVATCSSDRTIRIFDGEANRARGTHVATITGHDG
FT                   PVWSARWAHPKFGTLLASASFDHHVRVHKETEPNAFSLAYQTPTGTHDGSVNAIAWAPH
FT                   EYGAKLACASSDGSISVISYDGQASWTVEKIPNAHAIGCTGVSWAPAATPGALVSAGGG
FT                   ASVVDAKRLVTCGCDNLVKIWRFDEERRVWGCEATLSAHGDWVRDVAWSENMGLPMNTI
FT                   ASCGQDGKVFIWTQSEPRGAWQSRELHDFGAPVWRVSWSTMGNILAVSDGNNTVTVWKE
FT                   SLDGAWNQISAAA"
FT   gene            <583157..>584497
FT                   /locus_tag="OSTLU_1531"
FT   mRNA            <583157..>584497
FT                   /locus_tag="OSTLU_1531"
FT                   /product="predicted protein"
FT   CDS_pept        <583157..>584497
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_1531"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_1531"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98681"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A4S564"
FT                   /protein_id="ABO98681.1"
FT                   /translation="YVHELRYVDLSDNLFTGDLPRDLFKMTQLQSLVLSGNRITGALPE
FT                   DVGALTNLRHIDLSANAMRGALPESLGALSELKVLYLGESGLENKNDFAGPIPESWRRL
FT                   KSLKSFSLAGNSNIGGTLPDWLLNNLDSLEELTLSRCGLTGEIPPNVDQMKSLRVLDLG
FT                   ENSFSGVVPVESLSRLRRLKHLRLAGNALIGSLGPSVAHLREIETFDVSSNRLTGDLPK
FT                   ELFSLRLLEILDVSNNAFTGTLAPPDGAETSNLRVVDAESNRLVGVLLDGEFFKRAPHL
FT                   RYLRLSNNRISGAFTDGAFDDAGELVELHASNNDLLGPLPDSVRHLTKLKSLRLSGNAR
FT                   LGAGRGMPDALSECWNLRVVELARAGFEGDIADDAFARMRRLSSLNLAENKFSGNVPAS
FT                   LKSAEFLRKLEIQNNAFVGEIPSWLVELPHLELADFTGNKFTGAIPDS"
FT   gene            complement(<585015..>586592)
FT                   /locus_tag="OSTLU_88696"
FT   mRNA            complement(<585015..>586592)
FT                   /locus_tag="OSTLU_88696"
FT                   /product="predicted protein"
FT   CDS_pept        complement(585015..586592)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_88696"
FT                   /product="predicted protein"
FT                   /note="GO_function: - tRNA ligase activity; ATP binding;
FT                   GO_process: - tRNA aminoacylation for protein translation;
FT                   protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_88696"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98849"
FT                   /db_xref="GOA:A4S565"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:A4S565"
FT                   /protein_id="ABO98849.1"
FT                   /translation="MTTEGDEPAVAPDAAASGEKSEKLLKREAEKAAKKAAKDAAKASK
FT                   AAAAEQRSRGQNAVVSVQCSTTPPVELEACSGTRDWYPEEFRLQRWLYEKFRATARATG
FT                   FEEYDAPVLERQELYKRKAGEEITQQMYAFVDQDGVEVTLRPEMTPTLARMVLGRAQSM
FT                   MLPLKWFSIPQCWRFETTQRGRKREHYQWNMDIIGCKSVSAETELLFAVCEFFKSIGIT
FT                   SADVGIKVNSRKVMASVLDSYGITAEKFAPVCIVMDKLDKIGADAVKAELVDTQGLPAE
FT                   TAAKIVECLACKTVSDLEALCGEGADQTGIDELKRLFELAEDYGYGDWLIFDASVVRGL
FT                   AYYTGIVFEGFDRAGELRAICGGGRYDRLLSLYGAVTEVPACGFGFGDCVIVELLKDKG
FT                   LLPELPKSIEFVVAAFNEGMQGKAMKAASMIRAGGSDVDMLLEPKKKVASTFDYANRIG
FT                   ARYIVFVAPQEWENDMVRIKDLRADYTDKDEEKQLDVKLSDLGRVSEVLAAHAAAIGAA
FT                   NKMGGMAV"
FT   gene            complement(586721..589302)
FT                   /locus_tag="OSTLU_26654"
FT   mRNA            complement(586721..589302)
FT                   /locus_tag="OSTLU_26654"
FT                   /product="predicted protein"
FT   CDS_pept        complement(586724..589225)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_26654"
FT                   /product="predicted protein"
FT                   /note="GO_component: - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_26654"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98850"
FT                   /db_xref="GOA:A4S566"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="InterPro:IPR033507"
FT                   /db_xref="UniProtKB/TrEMBL:A4S566"
FT                   /protein_id="ABO98850.1"
FT                   /translation="MVGFSKTLNRYRVGEWHTMYIDYEQLKTLVTEQKRIRELEAPAGT
FT                   TSADDDYRGRDSVDETQWNRYANAPTLTTELVEIEKTPGEREALETLWDALGMDYEPML
FT                   AVKSTLQDNGNGVAEVLVRFYQALDVQANRCNSFYETLVEMQAKALATALKRVEVIDAS
FT                   LNVATPVVSPRESEAEVDQGGETEIKPVRAGGRHSRHGSLSTTSGTDLHALFSKYKEKD
FT                   KITDSSEAAAKRAAQALVDTNTSSSTAKSRETTVKALLHDIKEIYYSVCMIQNFSTLNA
FT                   VAIRKITKKMDKEAGTRTSGIYCTTCDELAFWPDLKESTFQCKTMAKLCEEAFLTCHAL
FT                   IRRIEATKTGLVRFNTRTQSFATLRRKERVELLEKLRSTGNRIKDDGTKVNLDRDSPDN
FT                   PILYFTGGFFWGIAFPALLIPLWYLVVSCGLQSTDDRCRRELAAFVTLRGAMLVFGQSL
FT                   LWGPTVYVWQKLMVHWELIFFRSAGKTGLRAEYAIIATVLPWICFVIILTTSTVLWSSG
FT                   NANTQWVKPLTMALFIAFAVPVPASWEWADNPRYWFIQPPMTTRRFIGRHVMRIMSTPW
FT                   TNVVFPDFFIADQLTSQSTAIADLMITFHLASETASTRVIAATIPHYWRFIQSFRRARD
FT                   SVVHKRGGALSTHLLNAGKYGCSIVAIWLRFWALRSSQSDNHSSPPWIVAYIATASSVC
FT                   YSLYWDFFMDWSIFTFNPESKWRVEFLSRRSLVKSRAVWVAAIVFNVFARSAGLFAAVP
FT                   GLPMRHLSTQVLVTGLSAVEVIRRAIWNVFRVEAEHAVNCGGFRASADSQFDALEDPFV
FT                   AHVDELSRELQYVPVKGGQKV"
FT   gene            <589550..>592843
FT                   /locus_tag="OSTLU_17468"
FT   mRNA            <589550..>592843
FT                   /locus_tag="OSTLU_17468"
FT                   /product="predicted protein"
FT   CDS_pept        589550..592843
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_17468"
FT                   /product="predicted protein"
FT                   /note="GO_function: - triacylglycerol lipase activity;
FT                   GO_process: - lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_17468"
FT                   /db_xref="EnsemblGenomes-Tr:ABO98682"
FT                   /db_xref="GOA:A4S567"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4S567"
FT                   /protein_id="ABO98682.1"
FT                   /translation="MRERAVRATPRAGPSTSTRRLKSSTPSRASIVRRARGKGDKDDAS
FT                   TPTSSTPDPEELKLALARARTRLERSRKGLPALVEENESEGFTSDEVVEESSTAENGDL
FT                   RRIVSDWFGAVGGVFDSLNSDDEAMDARDENPAIAAQDDASSSRDDDEDSSAPVEAGGW
FT                   FRWKSPWRVSGVGESIATATSSWMPNKSVDGDGSFVVNTDAIGVSTASDGASSSSSDRG
FT                   VEPTNLLERVPLPPWIRQRVDGSSDGDSSSDDEEDDEMAYDTTISNENVGSAIRDASET
FT                   AVSVTTAAVEKLNSALLGIETVEKSAVKDGRFENNASALKALQESLRDARASAKEAREA
FT                   SQSLEEAVREVSRAQEALRAEGDLKKEEAIKALEAAKAAVIRQATSSNAAVADALRQVS
FT                   YVATRVEKLGSWTLEDDGEASSRALDTSKAQKRGVRRGLMGAIASARESAQDALVASEL
FT                   TQTVSRLASLATQRGDGKSKKSEELSEMVKPALQRVVANSLVPVESDIEIGSARLACSL
FT                   AAWVYYLPQMQHALPRNGLKLITSSLDVEEIIPSTEFRAGKSLLEESAWRAEQAVEEAV
FT                   VAARVAASKDAKLEIAASKAAAESAELAAQALKLAAELRSQDAQDESTRLKARKTARAA
FT                   KALAVEAQKKLDEASAIAERNKRKLKKWAMQRELADLQSQMQQTVIEQQRKVEAERVRQ
FT                   ERAENASLPVNFCVAAQDDTATLWVVVEGSTNFASWQANLTFQPVTFEDPALGVEVHRG
FT                   AYTAAKTMYRRIEKAVKEHVAKHGARARVRITGHSIGGSIAMIIAMMLLVRNGAPRYAI
FT                   ADVWAFGAPYVMTGGEALMTRLGLPRSFIRMIMMGDDVVPRSFSCYYPQWARRVLDNAP
FT                   GPFNVNTSTANFLDEQMFYTPMGDLYVLQANNGSEHPLLPPGPGLYILDGDGVYEMLAT
FT                   RARLGENEDGDDESWLNRRPSSKHWDEAAAYDVDGDFSSSEDEKANKLRMHQLACLTQS
FT                   DAALTASLIISHIKQDELLPSEGGIAEVLNQRGRDAAQRVLFNSPHPLSILSKPDAYGD
FT                   AGIISRHHNPFQYAKSLSLSRKRKPGVADLISSLPKKSIDGAPASGGPR"
XX
SQ   Sequence 593542 BP; 114287 A; 182389 C; 183150 G; 113716 T; 0 other;
     ctaaacccta aaccctaaac cctaaaccct aaaccctaaa ccctaaaccc taaaccctaa        60
     accctaaacc ctaaacccta aaccctaaac cctaaaccct aaaccctaaa ccctaaaccc       120
     taaaccctaa accgaaaccc taaaccctac gcatgaggga gggaggcgct tcgggagaag       180
     tgccgtaacc gaccgactag ctaatactta ttacacccaa ccctataaac cctaaaccct       240
     aaaccctaaa ccgaaaccct aaaccctacg catgagggag ggaggcgctt cgggagaagt       300
     gccgtaaccg accgactagc taatacttat tacacccaac cctaggttct ctggatcgta       360
     ctaaacccta aaaagtcact agcattcgca tccttcctgt gcaccttcac gacaccctac       420
     ggccagcact cgtcgaccag cacggcaccg cagacttccc cctcgacgct ccggacgtct       480
     ccggactctt gcgtcaaagt tccttcttca gtgttcgtgt tggacgacaa acgaccagtc       540
     gtagtttgtc ctctgtgaaa ataatggaac cctaaaccct tctatttcta gcgagcaatc       600
     gttcattttc ggtccccgtg tggttcacac atgtgtatct tcacgcgcgc tcgctcgaga       660
     atgacgcggg ggcgacgacg gcgacgtgcg agtagcgcga acactcgtta cgttcgttta       720
     tcgttttctt tgcaaatgtg caaatcaatt tctaagtttc tacgctttcg ctcaagaagt       780
     cgttcggtgc tttcaccatt gacgctcgtg cggtgcgacg attcaaccat tctaggtttc       840
     tatgctggat gtctacgtgc acttcgcgag ctgccgccgc acgcctaaca tggtgatcca       900
     gaaagcgtcg ccgaaaatac taccacgatt gtggtattga aaaaatgaat gaactttcac       960
     gagctctctg cgcaaagaat cataatcagc gcggtcgaga atgcttggca aagtcgctac      1020
     gtcgtcttcg agcactctca cgctgaattt cgaccaatcg aagagccaac tgaacggtag      1080
     atcatagccg tccgcgacga tcacgggcac gcacccaaat gtgatgatgt cgtacaaccg      1140
     cgcggtgtgc gcgcgatcgc cgtagacgta caggcaatat ttgctcttgg acagcatcgt      1200
     catgtagtct cgcggcttgt cttgtccgct cgtactcaag tcccaccccc gtcccgcctc      1260
     cgcttgcttt aaagttggaa acacgactcg tcgcacgcca ccccgatgca tggatcctcg      1320
     gaacgaaact tcaatggttc ttacgttcgt cgatttgagc gcgcccatgc gcacgacttc      1380
     gcgaggtaga tgactcgaaa ttccgaacca gatagcgacg tggcgagccg gatcaaaacc      1440
     agcttgcact gcgttcgctc ttctcgctct cgcctcgtcg tctttggcgt cttctgaatt      1500
     ttgtatcggc aattcagagt tgccagttat caccacagca ccgtgtcgga cttcgtcatc      1560
     ggaggaatcg aacgccgaga gtccgatatc tatattcgtc atgacgacgc gcgcgcactt      1620
     ttgtttggac gtccacgcct cggcgttgat cgctttcacg cgctcaatgt cgcgagatag      1680
     tctatcgcga atcgcttgac gaatcgcacc gttgttgttc gaccctttag ccgggcctgc      1740
     catgacgtac gcttcagccg tgagcagtcg ctggaggtac ggtctgacgg ggatgaagat      1800
     cgccgtcgcg tccttgaacg accgcgtcgc gaatggacct cgttcaatct ctcgagctag      1860
     gtaagtctcg acgccgtaac cgcgattaaa cgttggtatt ttttctgcga aggcgtactt      1920
     caagcgcgtg acgcgcggcg ttttcaacgt gtacaaccgc aaagtaccag gcaaatcgtt      1980
     gagcgcttcg caaagcgcgc gcgaatccga aaatccagat gagttcacgt tcaaaggcca      2040
     atacgtggcg ctgagcgagc ctaccgcgat ttcatcgcac atactttgca ctcgcctcaa      2100
     accaaactca tcgggaaact tcgccgcgtg cgcgccgacg ccgttccacg cgctcacgcg      2160
     ttcttcgatg gcccaacgca cggtgccgcg accggcatca accaccttgt aaacttctgg      2220
     cttcctcatg ttcgcgtata ggtcattctt cacgcacgcg aacgtcacca acgccgtcgt      2280
     caacgcaaaa gtaatccgtc gaaggaatgt cgtcctcgcc ggtggacgtg cttttttact      2340
     cgacacgcgg cgttcgacga cagcttcgat atcatcaccg tcttcggcgc gtcttcggcg      2400
     attcatgacc tgcgccgcgc gcccgcggcg acggaggagc ggacgcgcgt tctggcgttc      2460
     tctcaaggtt cttggtctcg ctttctcgct acagtacata cgcgcaagcg ccgcacaacg      2520
     cgtcgtgacc tgcgcgtgcg tagtcagtca tacgttcgcc tcgagcgaaa gaaatcgata      2580
     aaggttgatt cgtgtgcgac aacgcgaccg cgatcgcgcg cgtcgccttc cgtcgcgtcc      2640
     gttcgcgcgt gcatggggaa gaagcattcg ggagccgcct ttcaatcgcg gctgaatcaa      2700
     cagcgacagc gacagccagc gtcttcgaat aacggtgtga aaggcttcgt cggcggtaca      2760
     acagcggtga aagaacggcg cgtgcgcttc gttcgagcca gaagacccga tcgcccgctt      2820
     gttgacgtcg acttgctgcg aaacgtcatc gttctgaacg gcgacgtcgc cgcgtttgaa      2880
     gacgccggag cgaccatgat cgcagaaacg catgagcatc gacgtgggat gagcacgaga      2940
     ggtaacgaca gaggtgacga cttgtacgcg ttgtgcgatg tgcgtatgaa atgggccggc      3000
     gcgcgacgag cgggcgcggg gctggccaac ctcggaaaca cgtgctttct gaattcggtc      3060
     ctccagtgct taacacatac accggcgttg gcgaacttcg cgctgcgcgg agagcacaag      3120
     aaatataaaa cgggcggttc attcaacgct ttgtatgaaa tcggtgagca cgtggctcgg      3180
     gcgttgaact cgagtgggag aacgattgcg ccgacggcgt tggtgaagaa tttaagagcg      3240
     ctttcaaaga cctttcgtaa aggtcgacag gaagatgctc acgagttggc gcgttgtttg      3300
     ttagatgcga tgcataagaa gtgtgtcgaa gtagttaagc caaagatatc gccgaattcg      3360
     gcgcgtgcgg agacgagctt tgtttggaag gtttttggag gtcggctgcg ctcacaggtg      3420
     aattgtaaga cgtgcggtcg caactcggag acgttcgatc catttcttga cttatccttg      3480
     gaagttggcc gggcgaaaag tgtattaggt gctttcaaga tgttcacgca cactgaagtg      3540
     ctcgacggtg acaacaagta taggtgcgaa ggcaaaagcg cgaattcaaa gagtcacttg      3600
     acgaaggctt cgaagcagtt cacggtgaat caggcaccaa acgtgctcgc gttacagttg      3660
     aagaggtttg catacgtgcc tttcgggaga ggaaagctga atcatttcgt tgagtaccct      3720
     ctggagctcg atatcacgcc atacacttca gacgaaggtc ttacgtcgag aggaaaggca      3780
     gtttacgatt tgtacggcgt gctcgtgcac gcgggtaaca gctcaaatag cggtcattat      3840
     tactgttttg tcaaggtggc aacgggaact tggtgcttga tggatgacga tgaaattacc      3900
     tcagtgagtg aaaaagtggt gctcaagcag caagcgtatt tactctttta tgctcgccgc      3960
     gacgcgcctg gaacgtttga ggaagaatca acgacggcga ttcatcaaaa tattccagac      4020
     ttaacgaaga aagctgcggc ggcgcaaaag gaacaaaagg cgaagcagaa gatgaaaaag      4080
     aagtccatcg aagccgaagt tgtgccgaag cgaaaggttg agccgaagcg aaaggttgag      4140
     cctccgccac tgcctcgtca atcggaagtg cgaaaactac acgaaaaggg tagagaaaag      4200
     aagaggctgc gcgcatctgc gtcaccgatc ggaaaatcta ttcgagcggg gcgcagtaag      4260
     tcgccttcgg tgcgcagtgc gttcgattca gccaagcgcg cgttattgca tcgtcgattg      4320
     aaacgattga gcgtcggcgt taccctcgaa gatattccga gcgtatcgct cgattctccc      4380
     gtgagaactc ggaacgcgaa gaagtatgtg agtggcggtt tcaaagtgaa ggagtggatc      4440
     gaaaatatgc cttctacgaa atgggaagat tgcgacgacg acgatgacga gcgcgagagt      4500
     gatcaaggtg gcttcaagaa ggcggcgacg gcgaaacgct tgcgtcgcga atacgatcag      4560
     ttcgacgagg aatacgaccg cggtaagcta cccaaacaca aacgtagaaa agctaaaggc      4620
     gtaaaagcgc cgcctatgcc tcgaaaatcg aatccatttc agcgtcgctc aaagtctagg      4680
     tagttgtgta gtcggtgctg ttttgctgtt ttcgcgcttt gctacaactc aactcgccgt      4740
     gtcatctact tcggcctcgt ttcgggcctc attcgcgcca gattcggcgc tcgaagtgtc      4800
     gaaatctttt ctaggcaagc gctcgagcgg ctcggtcgcg tcgtcgcgcg cgaacgcgcg      4860
     cacgcgcgcg tcaaataggc gattcgcgaa cgcccacaat tcgtaatcga gaaaattcaa      4920
     ctcgtcgacg cgagcgatga cgcgctgaga aattctcttc cgtccgcttg aactgaaagt      4980
     ctcgtacgta ccgtcgatgc gatcagtgat gtgtttgaga gcgtttttac gcagtcgctt      5040
     gtacttggcg aactgattcg cctcgcacac gcgatactgc tcgccgacgt ttcgtcgcac      5100
     gttcttcgat cgtttcaccg tcgtcccgga atcgggtttg cagtcgataa acaccccgaa      5160
     agcactgacc tcgaacgatc cgtaggtctc atccgtatta acgtttggtg cgatgagcgt      5220
     ctcgaaggct ttatgacgtt ccaggactgc gaacaacgct cgagcggatt ctggtacgtc      5280
     gtcgtaagac gcctctgcag aatcctcccc accttgacta tctacgcgtc gcgtgaacgc      5340
     gacggtcatg atgtgaaacc cttcaaaatt ctttgtccag tcgtcatcgc tatccatggg      5400
     ccaaatctgc acgtttgact tgtccacgcc acatctcatg gacactcctt cttcgagcac      5460
     cgacgcgtag cgctcccgaa acgacgcttc tttcagcgct tcacttttga gcttgctaaa      5520
     tctaaatgaa aaccccacca catccacgca atcgctcgcg tcatcgcttt tgaacgaggt      5580
     cccaaccttg gaaattcgac ttttaacgtt ttgagcgtcg atttgagtcg gatcggcaaa      5640
     gtttgcgttt gcgctgagcg gcaaatcgag ctgtcgcgcg gctaattcta tggactcgtc      5700
     aagtcgctcg tgcagagcca gtacgtccac ctcgtgctct agacgttctt tcgcgtaatc      5760
     catcatcatt ttggatgctt ttgtacctcg ccaaagcgcg cactcccgca attcagccgc      5820
     tcgaggttcc accgcgtcgt cggtgttatt cgtcaacccg agcaattgga agaactgtcc      5880
     attgtgaatg tcgtcgtgaa ccatcttcat ttccgcccaa tcttcgaacg gcgtatacaa      5940
     tgcattatcg tatacgtttg aaatcgagag ttcgtttcgc ccatccgcat tcacggcgtc      6000
     gtcgtaagat cgcagctcgt cgtccatgaa gcgcgtcaac acgctccaag gccaaacatc      6060
     tcgcgtctgc acacgcgtcg tgttcactgg ctctttcccg aaacttctcg ccgcgacttc      6120
     gatcgaaaat tcgtacgacg atagcgcgcg tgctgacggc ttccgtagca tggtcacgac      6180
     gcgcggttgt tccgtaaacc gttcaatcaa gctgtagtca tcgtgcgtcg ctaaaaactc      6240
     gcacgttggc tcgcggggat cgattctgag tcctgtgtac tgatttccgc agagttcgtg      6300
     atccttaaaa gacggtttca agaagcacca atgaaagctc cgtcccgccg tcctcggaat      6360
     gtgaagaaag tataaaaatc gtcgttgcgc gtcgtcgtcg cgagctcgca ctctgcgctc      6420
     gtgcgcaccc ctctgctcat cgatccatga cgtagcgagc ttgtcgcact catgcatttt      6480
     gcgtccgcgc atcttacgag gtgtgaacga aggcttcgcc ccgacctcga gactggcgtc      6540
     gtcgagacgc cgccagcgcc gcctcgagaa tatcaccagc aagatgcacg cgacgatcgt      6600
     gcgcgcgagc gtgagccatc tcgatcctcg atcgccgcga gacagtgtcg tcttcgccct      6660
     tcgatcgctc cgtcgaaaac gatgcgcgtc gcccgcgggg tgtcgacgtt gaagaggaaa      6720
     cattcgcgag gtggaaccga accgaagtca accggtcgct tcgacgcgat cgatcgatcg      6780
     aacgacggcc gtcgcgcgat cgcagtttgt tcggcgcgtc gttatcgtcg cgttcgccgt      6840
     cgatcgagcg tcgcgttcac gaccgctatc gagtatttcg ctctcgtcgt catcggcatc      6900
     gcgccatctc gcgcgcgcat ctgacgccgc ggtcacaccg ccgctcaccg ccgcgcgcgg      6960
     cgacgtcatc gccgtgcgag agtatggacg gcgaaagcgg cgtgtcgacg cgccaggaag      7020
     acgtccgcgg cgcggcgtcg actcgaaacg gaggggatcg cgcgagcatg gctggtgcgc      7080
     actcggccga cgtggtcgcg cgcgcgttgg cgctcgcggc tgaagcgcgc ggtgatggcg      7140
     agcgaaaacg aacgaacgcg ttgttggaag gcgcgctgaa gcagtacgtg agcgaactgg      7200
     acgagtttag agcggtgtgc gaacgactga aggaacgcga gacggctggc ggcggcgcgg      7260
     cgacgacgaa ttgaattcga agacacgtcg cgcgtcgcga gcgtggctct acagcggcga      7320
     taccgtgtaa taacaataaa gttagacgac gcccgcgtgc tccgttcgcg ccgtcgccgt      7380
     ccctggcgat ggcgaactcg gcacggatcg acgaactgct atctgtcggc cgaaatatgg      7440
     cttacaaatt ggcgacatcg cgcatgatgt catctaaaga tttttttagc gagcgacgcg      7500
     cgtcgagaca ttcagcgacg cgagacgctt ctgcgcgcgc ggcggcttcc cacggagcgc      7560
     aaatcgcagc gatgctttga gtcacttgac ccacttcctt tgtgcactcg gtctccatcg      7620
     acccctccag ctcgttcagg aacgtttcag cggtgcggcg aattttcgcc ttggtctcgc      7680
     ctcgcttgag cggaagtgac aagacggata tgtatgcgcc agcgagcgcg agcgcgtaca      7740
     ccaacacgtc ttccgagaaa gagttcatgt acccggtggc gaagaacgcg acaacgaaag      7800
     ccgctccagc agagccaatc gttgaattca ccgcacctcg aatcgattcg tcgagcattc      7860
     tcgccgcaga atcgtgatcg aaactcgtca ccacgtccat gcttgccttg ctagatgcgg      7920
     cgatattttc gccggcgtcg tcagcgtccc attgcgcgga gagacgggcg agggaagtgt      7980
     cgaacccgcg cgcctcgacg gcatcagcgt acgctttgag ttgcgtctca ttgtttcgtt      8040
     tcaaccacgc cgaaaactct cgaactgagg cgctgagctt ttcctcggaa tcgcccaaca      8100
     cggtggactt gtatcgcgac tcgaccgagc tcgggcccga acctaagatg tacgtgctga      8160
     acagagatgc ggcgttggac aatcgaagag actcgtctac gatcttctct gcgcgctttg      8220
     ccgccgcttg cacgacctcg cgcgcggccg ctcgctgcgc cgccgcgtcg gtaatcattt      8280
     cttgtcggta gctctccatt tgtgacgtga cccccgtcgc catcgcgact tcagactttg      8340
     cttcctcgtc ttctccttct agaatttgtt cagcggcatt gagcaagagc tcgctcacgt      8400
     tgagtggcgt cgagagttta agccgcagtg cttccccagc acgctcgccc gatcccccca      8460
     agaatgacat aacgtaatct tcaaactttc cgaagccgct ttcgacgaac gcgcgcgagt      8520
     tggcgtagtt tgacgaatcc gccttcttcg ccttgagagc gtttctcgag ctcacgggaa      8580
     gcaccgcggg atcgctcaca ctgagcaacc gcgtcgcgtt ctctttgaca aacgccacca      8640
     cttcgtccac gtctccaaga tcggagagta aatccgtctt gttcaccacg aagacgacct      8700
     ttttccccca cttgcgaata tacgtcaaaa acttgacctc gctctctgtc atgggtcgat      8760
     cggcggacaa gacgaagagc actaaatcgg cgcgcggcac aaattcttcc gtcaagcgct      8820
     gctggcgttg cagaatcaca ttcgtgccgg gcgtgtccac gattctcatc tgctgtaaga      8880
     gctcggcggg aatgccgacg ttgaagaagc cgtcttcggt ttgctctcgc gactttttcg      8940
     aagagtatcg caacaccgcg atttcgtttg tcgtcggaag aatgccttcc gcgacgaatt      9000
     tgtcgccgag catagcgttg atgacagaag acttacccgc gttgaattcg ccgcaaatga      9060
     cgacgagaaa caagtcttcc aaacctttgc gcgcttcggc gagcaacttg atctcgtcca      9120
     aatccgtgca gttttcgcgc aaaaatttca agatttcctc caccaattgt cgttcgcgtt      9180
     cgatcatttc ttcgccgtcc gcactaacga gactgaactt tttcggcgtg acttgcggcg      9240
     ctgacccgtt cgcgcccttc gaatcgccca acgcctcgta actttgttcc aacgcgttcg      9300
     ccaccgcgcg cacggcggac tgtagtaaag cctcatcacc gctcgctgga tctttagtga      9360
     gattgcgtat cgtgacccca ttcgcacctt ttgccgcgag atcttgcagt gtggacgaat      9420
     tctcgctcgc cagggcgccg agaccgtccg cggcgtccac gaaaatcggc acgctcaccg      9480
     actggcgaat cgcctccaac atcgcgacgt cgcgcacgag gagcaagtcg gcgccttctt      9540
     tgctcgcctt ctccgcttct tcggcgcttt cgctctcgtg cgccacgaca gctgtttcag      9600
     ggagcgcttt tctggccacg accgtcggca cgccgtcatc cgtgagcacg acgccgtcca      9660
     actcggcgct cgcggcgata tccgttctgt ccacaatcaa cacgcacgct cgtccacgca      9720
     cgagcgtctt gagcgtcgtc gcggcttcgt acaatttctt cccggaattt cctccgcccg      9780
     taccgtcgac gccgtactct cgcagcgcca cgcacgtcgc tcccgcgtgt aaaaccgcgt      9840
     cgacgacctc cgcgcctcgc gtcgacgtcg cctcgtccac gtccacgtac gccaagaatc      9900
     ccggaatccg cacctcggcc cgtttcgtct gcgcgaacag atcgcgctgt tgcttatcac      9960
     ccgtcgccgt cgcgttcccg ctcaggcggt ccaagaacgc cctcggcgcc gtcgacgatc     10020
     gcgcgcgcgt cgatggatga taaagatgcg cgcgtcgtgg acgacgtcgc gtctgcgtcg     10080
     cgtgcgcgcg cgcgcgcgcg tcgatcgaag gcaccgcgcg cgtcatcacg gatcgcatcg     10140
     ttcttcgtcc tcgtccactc gacgaccgcg ccgtcgtcgt cgtcgtcgtc gtcgtcgtcg     10200
     tcgtcgggga cgaccgaagc gccatcgccg tcgccccggc catcgcgcgc gcggccgcgg     10260
     tctggcgacg gcgcgacgcg ggcgaggccg tgtcgacgtg ataaatactc agatggcact     10320
     ctgagatacc acgatgcggc gtgaaatcgt agctctagac cctaatccgc cccgcgcgcg     10380
     acgcccgaat tcgtccaagt tcgccccccg caggcgacgc ccgacgcgcc cgtctcggag     10440
     gctgacgtgg atgcggactc gcgacactcg acgacgacga cgacgacgac gacgatcgat     10500
     cgatcgcgcc tctccgacga cgacgcgagt ggagcgcgaa cgcgcgtgac ggtagcgcgg     10560
     aatgcgccgt ctggcgcgaa tcaagacgat cgaacgcgcg cgcgcgcgct cgcgcgattt     10620
     ggcgtttcgg gtgccgccgt ggacggttgg ccttctcgga acggcgtcgg cgttcgcgcg     10680
     cgacgcgacg acggcgacga cgacgacgac gacgaatgta tcggcgttgg tgaaggatga     10740
     atcgacgacg cgtgggtcgc cgtgcctgtg ccgcgacatc ttggcggcgg cggcaaagcg     10800
     atgcaaatcg acgcaacact ttgaggctaa tcacttctgc acgtacgggg cgcccgtcat     10860
     cggcgacgta ctgaacgcga cgtcggataa acacaaggcg tttgggaaat cgcactggat     10920
     cgatggcgac gcgcgcgtgt ccgaagccgt gcgtcagatg catctcaccg acctgtccgc     10980
     gctcgtcgtc atggatactc gcgcgctcga cgtggaccgt tcgggcacga ttactcaaga     11040
     ggaattggaa ctttccgcga gcaacaacgc catcatcggc atcttgaccg agcgcgatta     11100
     cctcaacgcg gtcgcgcgag gtttcatctc cgcgtcgacg aaagtgagcg aggtgatgac     11160
     atcttttcgc gacgcttcaa agaaaatcgc aaagctcgtg tcggtgtcgc ccgaagattc     11220
     tgttctggcg gcgatggaga gcatgacgaa caatcgcctg cgtcacatcc ccgtcatcgc     11280
     gtctaaaggc gtgaatccaa aagatcaatc gccgatcgaa ccgcgcgttc tgggcgtggt     11340
     cagcatcggc gaagttttga aagctttgct ggccgagtct cggtcggaga tttcccacct     11400
     cgagtcgtac attttgggcc tcgagtgagc gcgcacgacg acgaagacga agacgcatgt     11460
     ccaaaacacg taaaggtatg taagcaccat cgacgccaaa gagagcacgc tgtaagtttt     11520
     gtaagatacg gataaaaatt catcacaacg cgagcgacgt cgagacgtcg cgtgtttaat     11580
     ctttaatcaa catgatgacg gtgtggcacg cgatgctacg gttctccccc aaagaatcca     11640
     ccttttcgtg cgtcttcgcc ttgacgttca ccaccgcctc gtgcacgccc aaaaccttcg     11700
     ccacattggc tcgaatatta tccttgtgcg gcgaaatctt cggtcgctgc gcgatgagcg     11760
     tgcagtccaa gttgcctatg gagtaccctt ccagtttcat caaccgcacc gcttccttga     11820
     cgaacacgtc gctcgtttgc cctttccatt tcgggtcggt gtcggggaac agctgtccga     11880
     tatccggcaa tccgagcgca cccgtgatgg cgtccacgac gcagtgcatc aacacgtcgc     11940
     cgtcgctgtg cgccacgcac ccgcggtcgt gcggaatctc tatcccaccg atgatcagtt     12000
     tcagctccgg gaactccgcc gtggattcga gacgatgtaa atcgaacccg tgcccgacgc     12060
     ggaacggcag caccggcgcc gcgccgtcca ccgtcgcctc ggcgcgcgcg cgcatcgcgc     12120
     gtcgcgtccc gatcggtctc gacgccgacg tcgtcgtcgt cgtccccgcg cgcgccgacc     12180
     gcgccgcgcg cgtcgtcgtc gtcgtcgtca tcatcgccat cgtcgccatc gtcgtcgtag     12240
     gttcggcgcc gtcgcggtgc gccggcgcgt cggggtcggc gcggcgcggc gtcgtttatc     12300
     cgaacgcgtc gcgcgtcttc ggtttttttt tttcaacgcc agagtcgtat tcgccgcgat     12360
     cgacgcgcca cctttttcac gcgcgcgcgc atcatctcga ccctcggggc gcgggtgccg     12420
     cggatggcgc gccatccgca cgacgacgcg attcgttcgc gacgacgacg acgacgagcg     12480
     acgagcgacg agcgacgagc gaccgagaga atagatggcg atgcggtgcc tgaggtgcgc     12540
     gacgacgggc agtggacgaa tcgaatcgaa tcgaatcgaa tcgatcgccg cgcgtcgagt     12600
     cgatcgagcg atcgaaacga cgatgagacg accctcgcga gacgacgcga cggcgacggt     12660
     cgcgcgcgtg gacgcgcgac gggccgcgat cgatggatga agacgcggac gcgaggactg     12720
     acccggaaac cgccgcgttc gcgcgcgcag ctccaagacg acgacgccga cgacggcgtt     12780
     cgcggcgcga cgccgacaaa cgacggcgaa acgacaactc cgcgtgcgcg cgggtgaggg     12840
     cgagacggac ggtaacgtca agtttgccaa taataaaccc gagtttgaag ccgtgagcgc     12900
     cgcggctggg agcgggttgg tggcggtgca aatctccacg aagacgtgcg ggccgtgcaa     12960
     gatgatttac ccaaccttcg tcgggctttc gcaagagtta ccaaaggtga cgttcgtgaa     13020
     gatcatgggc gacactgatt tggagtcgcg ggctttgatg aaggagtggg gcgtgcgtgt     13080
     ggtgccgctg ttcctgctct tccgcaacgg cgagcgcgtg ggcgagtgga gcggcgcgaa     13140
     ggcggacatt ttgaaagaaa atgtccgcgc cgcgtgcaac gcggacgaaa agtaatcaat     13200
     cgtatgtagt atgacccctt tattacgagt agtacgttgt aatgatcgat tacacggtat     13260
     aattactatt aaatgacctc aacaaagaat ctacgcgcgc gtcggcaacc cgttcgaagt     13320
     catgtgcgcc ttgacttcgc tcaccaagac ctcttcgcga tgaaatatac cggctgcgag     13380
     cgcggccgaa cacttggtga cgttgaaaac gttggtgaag tgttcggggc atcccgcacc     13440
     ggacgaggcg atgacgggaa tgcccaccgc gtccgacacc aggtttacga gctcgtgatc     13500
     gaagccgttt ccttggccgt cctcgtcgat gcagttcaaa agaatctctc ccgcaccgag     13560
     agcctccatg gcgatggcga gctcatacgc accgatatcg cgaccttcgc gtccaccctt     13620
     cacggtgcac tggaaccaca catacttttc tccgttcggg cccgggcgag acgtttccac     13680
     gcacttgttc ttcgtcatcg atggatcggc gacgtattgc cggcgcgggt caatcgaaat     13740
     caccaccgct tgcacaccgt aacgctcgga gatttgttct acgctcgtct tgcccgtgtt     13800
     caccttgcca gatgcgtacc aatcttcggc gacgtacacg gcatcgcttc cgatcgacac     13860
     cttgtcggcg ccgctcgcaa agtacgcgct cgccacctcg agcgcggtgt acgacttgcc     13920
     gttgctatcg gtgaagtcac gaatgccccc accaaccgtg agcggcacga atacggtttc     13980
     actcgagcga cgaaggacct ctagcatggg tgcatccgtg agtggcaagt ctctgtagcc     14040
     cgtgatgtta aggaacgcga cttcgtccgc gccttgcttg aaatatttgc ccgctaattc     14100
     aaccggcttg cctaagtttc tcacgtcacc accttcatcc ttctcgcgta cgtcgtacga     14160
     gtcacccttc gtcactacca agtctccgct atcgttcgag cgtacgtcta ggcacgcgat     14220
     aacgcgcctc gctaaaccgt ttgtcacgct cggcgccgtg ccgaattgcc ccgtcggctt     14280
     ggcgtcctcc agaaagcgct gaaacacccc caaaccagtg gcgccagact tttccgggtg     14340
     aaactgacac gccatgacgt ttcccttctg cacgctcgcg atgaattctc cgccgtaatc     14400
     gcacgtcgcg agcacccaat ccttgtttgc ctccgtcggc gtcgccctgt acgagtgcac     14460
     aaagtacacg cgctcgctct ccatgccgtc catcaacccg ctcgactttt tcgtgttcgt     14520
     gaggttccac ccgatgtgag gcacaatcag cccctcaccg cgaaatttat cgacgctccc     14580
     cggaatcagt cccaagccct cgaccccccc gctctcttcg cttccgtcga ataaaagttg     14640
     caaaccgagg cacacgccca agaatggctt atccgctctc acgtactcgc gcaacggctc     14700
     gatcaacccg cgctcgcgca agatatccat cgcacttcca tacgccccca cgcccgggaa     14760
     gatcaacttc ttcgcttcgc tcaaatcttt cggcgtcttg acgtctcgca cctcaaaccc     14820
     gagcgccgtc accgcgtttc tcaccgatcg cacgttcccg gcgccgtaat cgagcaagta     14880
     caccggttct ttcgccgcat tcgtcgcgtg cgtcgcattc gcgcgtcctc gtccccgtcg     14940
     caccggcgat cgcgtcaccg cacgacgcgt caccgcgcat ccatcgccgc gcgcgcgcgc     15000
     cgcaagtcga agacctcgcg cgcgcgcggt gcgcgcgggc gacgccaccg gcgcggcgcg     15060
     catgacgacg gggctcttcg gacgtgaaag agcgcgaggt cttcgcgccg ccgtcgcgtc     15120
     ctcgcgcgcg ccgttcgagc gcgcgtcggt gcgggcgacg ggaaacgacg ggaaatgacg     15180
     ccaccgcgcg agggctacgg agtcgtgttt tcatgacacg cgcgagacta cgggcgtcgg     15240
     cgattcaggc gccgcctcgc tttgattgcg cggcgaggcg agcgtcgcgc tcgagctcgt     15300
     actcgcggta gtctgcctgc tgtaagaagt cctggtgctc gcggtacgtg cgaccgccgc     15360
     gctgatggtg ctgtaaatct tcctgaagct cgacgtccac gtccttgacg ccgcgccagt     15420
     cggctttggt cttgtccaac acgtttaact ttttaggctc catgagttcg gctaagacgg     15480
     cgtcgaggcc gcccttcgcg agcatttcga cgcgcttcga gcgcgccttg gcctctttgc     15540
     tcccctccac gatctcggtc tcgacctcca ccatcttacc cgcgaaattt ctcgtctcgg     15600
     tgaatctggc gttttgctcg gcgcgcaaac gcgtggcttc gctcgcgagc ttcagcgcct     15660
     ctttcgccgc ctcgcgcagg cgcaccgatc gctcgtccgt tttaaccttc cccacgcccc     15720
     cgctcgcttt cttccccgtc gtcgactttg cccgtttccc tcctcgtttc gtcgctcgcg     15780
     tctcctccgc ctcgtcgtcg ctcgcgctcg tcgtcgccct ccgcgtccac gggtccatcc     15840
     tcgcttcgcg tcttcgcgcg atctctgctt cgcacggcat caccgcgagc gccttgagca     15900
     ccgtcaccgc gtccctcgcg cgcgccgtcg tccccgtccc cgtccccgtc ccgcgcgcgc     15960
     cgtcgtcccc gtcgcgcgcg cccatcgctc gccaaagttt catcactcgc gcgttctcgc     16020
     tcgccggacg cagcgggcgc gcgtcgtacg tcgcgcacgg ctcctccccg ggccgcgcca     16080
     cgacctcgtt cgcgagcttg cgcgcgtaca tggcgcgcgt cggcgagtgc gagcgcgcgc     16140
     gaccgcactc gtccacgcat ggcgacgcgc gcgaagcgaa ggaaaccgac gagcgacgcg     16200
     cgcgcgctgc gcgcgggacg cgcgatggac gaacgctcgc cacgtcgcgc gcggcgagcc     16260
     gacgacgccg gcgacgatgg cgacggcgac ggcgccgacg acgcgcggga cgacgcgcgc     16320
     gcgcgcgcgc gggacgacgc ggcgacgcgc gcggcgacga cgcgagatgg cgcgcgcgtc     16380
     gggaacgccc tcgacgccgt gatcgaacga aacgatttgt tcgcgcaccc accgtcgatc     16440
     acgcgcgatt atcgcgtgga cgaggcgttg aagttgaggt actgcgcgcc gtacgacttt     16500
     gactttgtgt gcggcgtcaa ggcgcggtgg gcgggacgga ggctgtgcga tttattcgcg     16560
     agtgagtttc cgatgcgacc gaaagagtat tacgtgaaag cacacgcgat gggacggttg     16620
     tgcgtggagg cgaacgggtg cgcgcggacg aacggggagg agacgacgac gaagacgacg     16680
     aacgaggcgc gagaacacga agacgggccg atgctcgccg gaggaaaccg cgtgcgacac     16740
     ttcatacaca ggcatgaacc tcccgtgatg gcggatgaag tgcgcgtgtt gactgtcaat     16800
     gatgacgtcg tatcggtgtg gaaaccggcg acggtgcccg tacaccccac ggggcaatac     16860
     aggcgaaaca cggtgctcgc tttgctggcg gcgtcgcgta gggatttggg acggttattt     16920
     cccattcaca ggctcgataa gaacgtgtcg gggttactct tgcttgcacg ttcgtcagaa     16980
     gccgcgaatg agatgcgagt gaagatggag gcgcgagaga tgcggaagga gtacgtcgcg     17040
     cgcgtgcgag gagcgttcaa cgacggtgac gcgacgccgg tgtcaaacgt agagagttta     17100
     ggattcgata gcaaaggccg tgtggcgatt tggcgcggaa aaaaaggtgt caccgatctc     17160
     gacgagcgga ctttgaagtc attcaaggat gcgtctacga aatttacgtg tattaagacg     17220
     ctcgttgacg ggacttcgct cgtgcgatgc gaacccttca ccggacgctc gcatcaaata     17280
     cgagcgcact tagccatgct cgggtatcca atcgcaaatg atgtcgcgta tgggggtgca     17340
     ttggtcgaag ttgagcgcgc tcgagcgatt cagcacgcgt gcgacgtcac cgtgctgaac     17400
     gaagcgggcg aattagtcaa agacgagtcg ctcgccatcg attactccgc tccccgcaag     17460
     agccgggagc agagctccga tttgtgtcca cactgcccga gaatcgtgca cgctggagac     17520
     caggcaatcg acctagaggc gatatggtta cactgcgtgc gatatagcgg cgaagggtgg     17580
     gagtttgagt gtccgatgcc agactgggct ttgtagtatt attgtgcttt tagctaacat     17640
     ttgcgcgctg accacggctc gatgccgagc tgcttcaaca ccgagttcgg caacgcaaac     17700
     acaggatcaa taggttccac tacagcggga tgtcccatca agctcaaacc ggcgatgccg     17760
     aaaaaagtgt gatagacgtc tggctcgtcg tctggcctgt cggaaatccc tcccgaagtt     17820
     tcgtcttggc atcgcaaaat gaaacgtgcc aacgccccac gatcaatcca gtgagtctta     17880
     cccagtatgc tcaacgcact tagcacccac cacgagtaac aaacgtccgg gagcttctct     17940
     gggcgcccgt tcagcccacc aaccttcact tgtcgctccg cgagccacca gcccagcaaa     18000
     tcgccgtcga cgtagtctaa tctattccca atcgccagcg cccctacgca cgtgaacacc     18060
     tgaccggcgt gtgactcgcc tcccggcgta gcaccgaaac caccgtcgaa attcttacac     18120
     ttgttgatgt acgcgcacgc ggcttcgacg tccacctcgt gcagacggtc gagcaaacgc     18180
     aaagtgctca acgcgcaata cgtaaatctc gtgtccacct ccccccactc gtccccttga     18240
     aacgagccat ccgccaactg cagtcccttg acgtaattca ccaccgaatc gcgatcgatt     18300
     cgatccatcg cgtcgaacaa cgcgtaaatt tggaccgcgc tgagtgtgta caacacgtgc     18360
     ccgtcgtgcc cagcacctcc gctatacgcc cccgattcgc atcgacagct cgcgacgtaa     18420
     cttaaaatct cttcccgttt gtccgcatcc atcgttttgc gcagatttcc catcgtcgcc     18480
     aacgcacaga cgccccaata gatgcccgac aatcgcaagt gttcggtgaa ggcgtgttcg     18540
     agcgtgtcct cgctcgcgct cgcgttgacg atgaacgatg cgtgcgcgtc cacggcgagc     18600
     gattcgaagg cgatcgtcgt aacctcatcg gcgagggatg acatcgttcc gtaggcggaa     18660
     tttcgtgtgc gtcgccgaga tgtgtggatg caaagttaga ggacgcaaag agtgtgcgtt     18720
     ggaggttgca aagaaacaag ttacaaacgc ccttctcacg tcggactcca cgaacaatac     18780
     gtgccttcgc agacgtactc taacgcgcta tcgacgtagt tcaaatgata tggcaaggat     18840
     gccacggacc cgtcttgttg aagcggcggc gcctcacccg tgaggcttcg tcgctcaatt     18900
     tcgtcaaagt tgacgcgagg gaaattttgg atgactatgt aatcgctgct ttcatgcgtc     18960
     ggcacgactc tgggtacttg aatgccgaac gctatggcag tttcttcagg actccacaaa     19020
     ttaatacctc cggataagtt gtccatcttc tcggaacact ccgaccggaa cgtttgcgac     19080
     gggatgaatc gagacccgaa cgataaaacg ccgtgacact cccccgccgg gacgcggtgc     19140
     agcgctttct cagaatcgtc ggacatcaca gggggtggat cccaacaaat ccactgatgc     19200
     acagtataat attcaccggc ctgcaccggc tcttcgtacg cgaggtgaac cgccataagg     19260
     atcagcaggc gctcgccgct cgggctccac tgaatcacct cgatggtgta acgcaagacc     19320
     tcattcacca cagataacac gggaacttgg cgcgaaccgt tccaggaagc atagtttcgc     19380
     acgctaactt catcgtatga tttgttccat ctgttcgcac cgttcaagat gctcgtgaaa     19440
     tcgatcacct gcatcatcgg acccagagtg ggaggaccca tccagtcgcc ctcggcgtcg     19500
     agattaaagt ctacacagcg cacgaagagg ccgtctacgg tcgaccaaac gacttggcga     19560
     cctcccgccc ttccagcata aagaaaccga gcgactatgt tgggctccgc gtacgctggt     19620
     gcgggcgaga tttcagttat cacgcactca ctaatatttt gaaacagttc gtcgtcgtcc     19680
     ccgctgatga agggctttat ctttcgttcc ttgatcgctt tttccgacgg caccggaacc     19740
     atgacgagga aggcgtagta cgcagtatca tgatcatcat cataacgctc cgggatagac     19800
     gacggtaaaa gccaaaaccc acgcccatta acgtcgcctc gcttggaagg aacccattcg     19860
     atgcgctttg ccgtttcgtc agtgtacagt cgcgcgagcg gttgtttggc gtgttccttc     19920
     accaagatat ccgtcaactt acgaaagttg gggatgtttg accaccacgt gcccgccttg     19980
     agacaactcc aatcactgcg atcaatacta tttgcagagt cttttatacg tttaagcgcg     20040
     ccatgctccg aatcttcatc gcgttttgcc gaagtcgagg gtttttcgtt gccccgcgcg     20100
     cccaaagtag cagactttac gccggcgaga atgttacgac tgagctgttg ccaccaagtc     20160
     atcttgggcg ttgacaccac ttcttgacaa tcgcgtgtcg ctcgctcgtg aatgtcgtcc     20220
     tgaaaggcgg attcgagcgg ctcagacgct gtgtcgcacg ctgggtgcgc cgcgtttgag     20280
     tttgccgatg tgagagaatg attgagagat ctcggaacat cgaccgcatc cgggggcatt     20340
     tcgtattcgc gctcaaaacc atctgatgcg tacagactgt cgtcgtctga cgaaacctcg     20400
     tcaaacgctc gagttcccgg ccaacgatca gacagcggga tcgcgccccc gcgtattcct     20460
     tgtttcctca gcaacatgat ttctcgttga tcgccgaaca tcagcaagga attgttatcg     20520
     atgggagaga tggcgaatcg gatgctatcc gtaccgctcg caaccctcgt gacgtgctct     20580
     gacggtggcg gcacgggcga agtgccactc ttgccgttac tgggaccgta caaggacgta     20640
     atgctgattg cacaatcgag cgtatatagc gacgactcca tgcggtcttt gtgcaagata     20700
     ttcaacatcg tcccacaagg cgcaaatgcc atgtgtgcgc actgtaaccc atgcggtaac     20760
     gctatgatat tattcatggg cggagcttcg tatggatgtc gcccgtgtcg cggcgtcgac     20820
     acctctgcat ttgtgtttgt aagcgcgtcg ccccgggcaa acttcagttg ccctgtgagt     20880
     actgccttcg gcgcagacag tataatcttg ctatgacacg ttttggactc cgcgccgttc     20940
     acgaggaaag cacacgccag taattccgac ctcggcgacc acaggagcgt atgcggaaca     21000
     aacgagttca tcccgctgtc gtatacgttg taaatgagtc cccccttcgg tcgtggatcg     21060
     cacgtgaaca attgttcttg atttatcacg gccagtctac cgaggtgacc aatcttcgac     21120
     cgcaattcgc tcgagctcgg tccggaagcg tccgcgctca acgcgcgcgt ggcgtcgccc     21180
     cgcgccgcca tctcggcgta cgccttcgtg ttcatcatcg cgcacccttt cagcgtgtga     21240
     agacgccaca tgaacaactc cttgtagctg aacgcacgaa acttcccact gccgttttgc     21300
     atcaaatcct ctcgcatcag cgcgcgcggt tcgagtttaa tcaacaactc gagccacagt     21360
     tcgtcgtttt ccctccccgt cgcttcaaaa tccttacacg cgcacgtcgc catcgccagc     21420
     gagtaaccat caagttcttt cattatcttc accaccagct ccgtcggcag cgtcgcaaat     21480
     cctccgaacg tcgtccgcgc gtcccgcctt cccgcgtcgt cgcgtttgcg tcgcgcgcgc     21540
     ttcttccctc tcgactgcgt ctccgcgtcg tcgccctcgc gctccgcacc gcgcgttcgc     21600
     gcgtcgcgcg cgagcgtcat tgttctcgcg cgcgccgcct cctcctcctc gtcgtcgccg     21660
     tcgccgtcgc gcgcttcgtc gcgcgcgtcg acgtcgttca tcttcccgcg ccgtcgcgtc     21720
     gtcgtcgtcg cgcgcgcgtc gcgcgtcgct cgcgggcgcg acggcgatga aatcgtcgac     21780
     gccgtcttcg tcgcgcgcgc gtcggcgcgt cggcgcgtcg gcgcgtcggc gcgcgtcgcg     21840
     ttcttcggat gaaagggccg gagacggcgc cggagcggtg ccgcggtcgg tcggtcggtc     21900
     ggaccgcgaa cgccggcgcg cgacgaccgc tttacgtttc gcttcgtttg gttgcgtcga     21960
     atcacacgcc tcgcttggcg agtctagggg tcaggtctaa ggtgcgaccg cggtcgggcg     22020
     cggcgccgat ctcgcgacgg acggcgtcga cgagcgcgcg cgcgggtttg gtcgaacgca     22080
     aatgcggctt gccggcggcg gcggcggcgg cgaggacgcg gatgtactcg ttgacgatgg     22140
     cgtcgatgcg atcgggagaa tgactgggta agatggagtg acggaagatg tgcgtcagag     22200
     cggtggtcaa ggcgtcggat tgccgggcgt ggacgacggc gaggatggcg aaggattcgt     22260
     tgagcgcgcc gacggagacg gcgtcggaga ggtctaaatc accgcgtata ggcggtaaga     22320
     tgcagcactc cacgcacacg cgttcgacaa cgaatcgcgt aaagcctggt acgcgttcat     22380
     ctctcggtcc tttggcaggc gctgacgacg tcggcgcacc ttcgagcgaa ggtggttcgt     22440
     cgggcgatgt gtccaacgtc cattcttcaa cgaagctctt gagcgcggtc agggcgactt     22500
     tgcgcgcgct caccatgccg tgcgactgcg cagcttggac aagatgcgac aacagctgct     22560
     ctctgagcgg cgcggtacgc ttggtgttgg gatatcccgt gaatgtgggc gcaatgagcg     22620
     cgttggcgcc gagggccgcc gtcgtagtaa gccacatacg ttcgagctcg tcggcttcgc     22680
     gcacaacttc cgtgttcgtg gcaatactcc cccccacgga ctcaaccgat gcctgtgcgt     22740
     acgcgctgga gatcgtgttg aagatttgag cggcaagacc tggtaatact tcaacaacaa     22800
     atggcgcgag ctcggcggcg tacgtcgacg cgagttgatt gaaaagcacc aacgtctcgc     22860
     gaagctccac ggcgtcggca tcgcgacgga gcttatggac cgtcggagcc aagtacggtg     22920
     tcacagtcgg tccgagcaaa tcaatcattc tgtgcaagaa accagtggca cgattgcgca     22980
     cgctcgcgtc tcgcggccac acgtcgagac atcgaagcga catctccaaa cacgatctaa     23040
     acacttctcc agtgcgaggt ctactcgtca aacatgttcg ctgcgaaaat cctttggata     23100
     tattcccgaa cgccacgatg gcgcgcgttg ccaatgcgat gcgaattggc gcgtcctcgc     23160
     ccgactgtcc tcccgccgcg acttcctcga tttgacgaca aagcccagcg gcgatttgcg     23220
     ataaatacct atactgttcc tcttctttca cctcatccgc gcctagcatc gtgccgaagg     23280
     cttcgaacag gtacaaccga tcgtcgtttc cgctctcagc catcgctcga gactgaatac     23340
     cagccgcgct cacagataca aacgcagcgt tctgcgtcgc cggttccggc aacgatctcg     23400
     cgaattccgt gagataggcc gggagtacgc acatgatgtt ttccacctta tccgaaagct     23460
     tgcagcgaag cggtcgggac agacgcgaaa tcaagtaaca tgcacgcgac cgcacggcga     23520
     gatcgacgtg acctatacct cgctcgtcta agaacgcagt caaggcggcg actagagcgg     23580
     cgtcatcgcg ctccaaaacg gcgtgatatc tgacgcaaat ctccaaaaac gtcggcgcta     23640
     cgaggcgatg gtacgccgcg cgaccaacac tcgtgcccca ttcgcgtata agcgatacca     23700
     ctagcgctcc gaggggggtg tctgtgacct caccggtgcc gttcgtcgcc ttggctcgat     23760
     ccgcgatgga catgggtttc accgcggcgt cgtcggcgcc ttctcccagg gtgaacagcg     23820
     ccgaaatcgc gacctcgacg ttttgccagc aaagctggtt tccttcgcca ctacccacga     23880
     cggcgctcat caagacttga cgaacgactt cgcgcgccaa gtgtggtgcg agccgcgcta     23940
     tgttcttcag ctgcacgttt agttcagcgc gaagactgaa gacgtccgct tcaaattctt     24000
     gcgtgagggc gttggagccg tcgttccaat ccaagccgtc tatgtgttct gtagggaacg     24060
     ccccacgcgc tatgagcgcc tgacacgccg acgtaagcgc cggctgcgcc gcattcaaca     24120
     acgccggctg tgatttcatg tacccaatgt acgccgtgag gaatggtagc gccacgagca     24180
     cggcgcgctc gtgcttaaaa ctgatgctcg acaaaaccaa cggagtcacc tgatgcaagg     24240
     acgaactgac ctcagcggac agttcaacac cgagagccgt tatattctcg actttgttgg     24300
     cgttcaaaag ctccgcggcg accgcggcgg cgagattggt cacctgagtt acgaattctt     24360
     cgtcgaaatc atcctgggta gccgcgcaaa tcacctgcaa ccgagcgcac acttctacga     24420
     tcttcgtgct gatgatcagg cgcacttttg cactcgtttc catgcctttc gttatgacgg     24480
     cgtgcaaata ccctaccgcc gcggcgcgca aactttcatc cgccgcgccg ctcaaatcgt     24540
     cgagcatcaa acactccttg gcgcccttca cgtactcttc gctcgcgaca agaccgacgt     24600
     ccacccactc gacgtatcgc cgcgcgacag accatacccg cgtcgccacg cgtggatcga     24660
     cgcgcgcata atgttccaaa cactgcctcc aagcatcgaa aactaagcgc aagctcccat     24720
     ccgctcgcat cgcttccttg atgcgcatcg aacgcgcgaa gtcctccttc cctgctcttc     24780
     ccgcgtccac ggtcgcgatc agctcctcgt cgatcgcctc gagcacacgc gtgaacatat     24840
     ccacgccttg cgtccctcgg ctcaatagat tcgccaaatc cgcgaagaac gagggccatc     24900
     gttctgggta ctccagcgcc acggcgtacg cgcacgcctg cgcgagctta tttttcacga     24960
     acgccggcgt cgacgtcgac gaggccgccg tcgccgccga actccgtcga tcatctccac     25020
     cgtctcctcc cgtcgcgctc tcgcccgtcg cttcgctcac gcacgccccg agcgctcgtc     25080
     gcagcgtctc ggcgtcttcg tccgacatcg tcgtcccgcc tcctctcgcc tccttcgcca     25140
     gcgcctccgt cagcgtctgc aggcaccaaa acttcgtctc gctcgacgtc gtgcgcgagt     25200
     acgcgcgcag gcacaccgcc cacgcccgcg cgtcgcgttt cagcgcgtcc agcgcgcgcg     25260
     acgcgtccgc cgccttcgcc gtcgcgcgcg cgtcgttcgt ccgcgcgaac gcgtcgcgca     25320
     cgaccgcatc gagcgcatcg acgtcgtcca gcgtcgtcat ccgctcgatc gcgcgcgtcg     25380
     cgcgcggcgc gcgccgtcgt cccgtcgcgc gtcgtaaccg acgcgcgtcg cggcggggca     25440
     ctgctccaca cacggaccgt cgatcgacca tcagacgcac gtcacacacg gataccaccc     25500
     aaaacgacac cgcactgttc gcccacacga gtcgatcgcg cgggttcgga cgcgcggata     25560
     acgcgacgcc gcggcgacgg cgcttcgcga cgcgaggcgc gcgcgcggtg cgtgcgcgcg     25620
     cgacgcgacg cgcgcgacga cgcgatcgac tcgacgcgcg cgcgactcga tatcacgcga     25680
     tcgacgcgaa aatcgcgacg atcgcgacga tcgcgcgcga acgcgcgacg gattcgacgc     25740
     aagatgaacg ccgcgcggcc ggatgcgtcg tacccccgac gacgacgaac ggggcgacgg     25800
     cgcgacggcc gatggcgcga cggccgatgg cggcgacgac gcgacgatcg atgcgagact     25860
     gaccgatgac gacggcgacg cgacgaaccg caggaaaacc accgacgcga acctcgggaa     25920
     gcggcgtaga tctcgcgcga aatgtccgtc gacgcggcga gcgcgagcgc gggcgcgggc     25980
     gtcttcggcg ccgtcggtcg ggtgaaggag tcggcgcaac acgtctgggc gcaacagaaa     26040
     ccgatgagtg aaatattgga tgcgtcggcg tacgcgcgtc cggtgagttt cggcgacgcg     26100
     acgtcgagga tgcagaaaaa cttaaactac ttcagaatca actacttggt cttcgcgagc     26160
     gccgtgctct cgctctttgt gttgtttcat ccgagctcgt tggcgatttt tggctccgtc     26220
     gccgcggcgt gggtgtacgt gttttccgtt cgcagcgaac cgcttaagat tggagataga     26280
     gagttgagtc atcgcgagac gttgatggga atgtccgcgc tgagcgcgtt cgtaatcttc     26340
     atgctcacga gcgcgggcac ggttttgttt agcggcctcg gcgtggcgtt gctcggcgtc     26400
     ggcgcgcacg ccgcggcgcg cgttccggac gatttgttcg tcgaggacgc gaacgacaat     26460
     aaaggattct tctcgttctt agagcctcct tcgcgtaacg gtcaggtttc gtcgggcacc     26520
     gtgtaattac ataaactctc aacgccccgc ctcgagcccg cggtcgtcca cgcgcgaatc     26580
     gacgcgcggc ggatcgatcc ctcgttcggt cggtcggtcg cgtcattgac cgtcgcgccg     26640
     cgcgcgagtc gctcgcgagt cggaaccgtc gacgatcgcc gcgcgccgac gcgttcgtcg     26700
     ccgtcatgca cgccctcgcg ccgcgcgccg acgcgaggcc gtcgtcgtcg ggacgtcgcc     26760
     atcgtcgaca ccgcgcgcga aatcaaaatc agcggaccgc gacgacgtgc gcgtcgacga     26820
     cgagcgcgcg agtgacgcgc gcggtgaaag cgcgatcgcg cgcgtcgatc gcgcgaacgt     26880
     gcgaaacgcg cgcggtcgga tcgccgaacg acgaggcgct gacgtgggac gagattgaaa     26940
     acatcgtcaa tcgcgacgtg gtgcgaagcg tcatgacgtc gcgagtgctg acggtgcgac     27000
     cggatgagag cgtgtttgag gcgatgaaat tgttagtcga taatcgaatc agcgccgtgc     27060
     cggtggtgaa cgcgagtggt gaggttttgg gcgtggtgag cgagtacgac ctcatggcgc     27120
     gcgtggggaa gaaggagacg acgaagagcg tggcggatga cgggatgttt ccgcgcgttg     27180
     gacgatgcga tgagtttaat gggaacgtga aagaaatgtg gagtcagttt cacaacttgc     27240
     aagagcgcat gtataaagcc agcgggtcga aggtatcgac ggcgatgcac gaggcgacga     27300
     cgtgcacgcc ggacatgccc ctcgtggagg cgacggaatt gatgctcaac ggtaatctcg     27360
     cgcgcatgcc cgtcgtggac gatcgcggcg cgttagtcgg gattttatct cgcggcgaca     27420
     tcatgcgcag gacttttcaa gcgtttctgt tggcgcaaca aacgtcggac aaggagtcgt     27480
     tcgccaagga ggtgatgcgt ctcgatgcga gcgacccgaa aatcgtctcc gagatcaacg     27540
     actccccggg cgtcgtggaa ttctgcgagg cgcagccgga cgatgatgag tgtcgcatct     27600
     acgaagatta agtcgtactt ttgtaaatca ccgttatcca cgcgattctt ccggctttgg     27660
     ctttggcttt tgctgcctgg ctttggctgc ggcgcgccgc ggcgccgtcg accgcacaac     27720
     tcgacgatcg gcgacgctcg gcgatcgcga tctcgacgcg agcgtccgac gcgaagcgac     27780
     atgccccgcg ccgagtctaa ggctggcggt ggcgctaaag cgcgtcgcgc ggcgaaacgc     27840
     acgaataaat tcaatccgag cgccgccgcc gccgcgcccg cgctcgtgaa cgtcggcgac     27900
     gcgtcgcagt acgacgatga gcgcgcgatc gagctcgagc ggaggaagaa atcaaacgtt     27960
     aagcaaggga agaagcttgg caagcgaaag aagggagcga cgagcgacaa ggagactggt     28020
     tcgagcgagg acgcggcgcc gaagaagaag cgaagcgacg ccgcggcaaa cgcggagaag     28080
     gtggatttta gtaaattgag tcgcaaagaa gccaaggcga agagcgatga gatgaaggcg     28140
     ctgagaaaac caaactttgc gctggtgcag gagttggcgc agatttggga acggatgcga     28200
     ggcaaaaagg tgtccaagac ggatcgaagc gcgatgtgcg acgaaattta caaaaagtgc     28260
     gtggggaagg ttcccgagtt ggcaaacaat cacaaaggtt cgcgcgtggt gcaggcggtg     28320
     ttgaaatacg gcactaccga gcagtgcgct aagatcatga gcgaagtgac gccgcagatg     28380
     gcgttgctgt caaagtcgct gtacgggaat ttcctggttc gcaaactcat agacgccgcg     28440
     gacaagaagg agataccggc gctggttggg aacttgcgcg ggcaaatcgc gcgattggcg     28500
     cgacatcccg tggggtcaca aatcgttgag gctttgtttc acgcggcttc ggcgaaagaa     28560
     aagaaggcga tgacttttga gttttacggt ccagaattcg tgcacttcgg cgcagcggac     28620
     gacgtcaagt cgcttcgcga agctttgctc ctcaagcccg tggcgcagcg ccaaggcatg     28680
     cttcgtcaca tcaacgtgac gatgattcca gtgttggaaa agggcttggt atcttcatca     28740
     gtgatccatc gggtattggc ggagtatctc agcgtcggcg gtccgagcac aaaagccgag     28800
     gcggcgggat cgatagccgc cgccggcttg cttcgcatga tgcacacgaa ggacggcgcg     28860
     cacgcggtga atatgatact tgcacactct ggcgccaagc agcgcaaggg ggtgatcaag     28920
     gcgttgaaag gtcaagtttc gagggtatcg caggatgatt acgcccacgt cgtcatcgcc     28980
     tcgctcttcg attgcgtgga cgacacgcag ttgttgggca agggcgtcgt gagtgagctc     29040
     aaggcagaga gtttggcaga agtggcgtcg cacaaaaacg ctcggcgtgt gctgttgcac     29100
     atcctcaatc ctcgatccac aagatacttc ccatcgcacc tgctcgagtg catgccggat     29160
     cctcaaaaag ttcgcgagga cgccgaagaa accgttgtgg cgatgaagcg cggcggtcaa     29220
     gcccaaaaag atgcgaataa agctgtgggc aaagaccttt cagatgatga agacgatgat     29280
     gacgatatgg gtaccgtaga tgatgagttc ggcggcgaag acgaagaaga agcgccagag     29340
     ggcgacgacg acgacgacga cgacgacggt ttagaagagg cgccggcgga tggtcctgat     29400
     tttggcatcg ccaagaaacc tgcgagcacg cgccgcgccg aactgtttca tcaaggattg     29460
     ggagactccc tcgttgcagc atgcagcgtg aacgcggcgt cgatgttgcg aagcaacctc     29520
     gcgtccgacg tgttgttcga agtcgctgcg ggcgggtgtg acgacatctt ttacaaaact     29580
     gtcggcgaca aaaagatgac cgacctattt gaagccattt cggaagcggt cgcgacatcc     29640
     atgacatccg aacaaatcga cgcggaattg ggggaaaagc tcgagccgtt gcacgcaaac     29700
     tttttctcca cgcgaacgct tcgtcgcatg gctttagaag tcaagcacgc ccagttcgtt     29760
     cccattttct ggaaaagtgc gctgaaggcg aacttgaaaa cctggatcga cggccacggc     29820
     gctaaagtcg tcgctgccgt cgttcgcacg aaaacggatg caaaaacgcg caaagaaatc     29880
     cacgcagccg tgggaaaact ggtcgacagc ggcgacgccg cggcgtggtc ggagggattt     29940
     ttccgcgtca aggatggaga caagccacga aattcagctg ggaaagacga gcaaccgacg     30000
     tcaaagaagg cgaagaaggc gaagaaggcg tcaaagtaga ctttgcgatt gaaatatgat     30060
     ctaagaagta cattcattaa acgcactaca aacgcactcc cgccatgtaa tatttttgta     30120
     acaacagttc ggacgctccg atgtaccgcg cagctcaatc gaacccgaca agcatgggcg     30180
     tgcatttttc gtacaaagcg cgcggcaatt tcgccttgag cgcggcgcgc acctcctccg     30240
     ccttgtaccg cgcgctgaaa tgaatcaata aaatagcttc gttctggaac ttatccgcgc     30300
     gtgcgacgat atcgtcgatg tgcgtgtgcc cgaatcgctc cgcgtcgtgc ttgctcaccg     30360
     cgtcgtcgat gaacgtgcac tccatgatga gaagtttcgc ccggagcgcg tccgcgttcg     30420
     cggggtcgtc gatccagtcc ccggtcgtgt ctccagtgaa cgccacctct gggacttcga     30480
     ctttatccgt cacttgttcg ccgtcgtcgc gcaaccgctt aatttccggt ccgctcaacc     30540
     ccgcgtacgc gggcttcaac ttttgcttcg tgccgtacac gacgtaccct tgactcggca     30600
     ccggatgcct cgttctaaaa gctgcgattt caaacaactt attcatcgcg taccgctccc     30660
     ccgggtcgat cccgatcgcg cgatgattca actcgctatc gtccaacgct cgcagcgatt     30720
     ctataaacgt cccgaacgcc tctctccgcg cgctcggcag cagcaccgtc ggcggcgtca     30780
     ggctcaacaa cccgcgcgtc gcgatgtaca tcccacaccc tccgacgtga tccatgtgcg     30840
     tgtgactcag gcacatcacg tccgcgtaca cgcaccgctg cgggcatcgc cccgaatcga     30900
     acgccacccc cagcgccggc agcaccaccg acgtctcgcg tccgcccacg gagacgccct     30960
     cgatcttata ccccgccagc tcgtgcaccg cgtgtcgatc gcgattcttc gtcctcttct     31020
     gcgcggcgtc gtcgccgtcg ccgtcgcctt cgccgtcgcc ttcgcgtccc gccggtcggt     31080
     cgcgcgccgt cgccatcgcg cgcgtcgtcg tcgtccgtcg cgtcgcgtcg cgtcgcgccg     31140
     tcgccgtcgc cgtcgccgtc gccgtcgacg tcgacgtcgc gctcgcgcag gtcgcgcgcg     31200
     tcgcgacgcg catgcgacgc gccgcgctcc gcggtcgacc gcgcgcgcga cggcgacgtc     31260
     gaccgcggtc ggtcgccaaa ccccgagcgg atgattgacg acgacggcag agcgcgacga     31320
     tcgatcgcgc gtcgagggcg acgcgaagcg cgcgcgaggc aaaacgcgcg aggcgacgcg     31380
     cggcagacga aggcgtcgcg cgaatcgatt cgacgaagaa tcgagtcttc gcgcgatttg     31440
     attttgattt gattttgatt tgattgattc gacgcgacgc gacgccgggg atggaacgag     31500
     gcgcgcgaac gcgcgcgaat gatgcgcgat ggacgcgagg gacgatcggg gcgagaggtg     31560
     cgcgcgaacg gcgcgtcgtc gcggtgagag tgacgacgcg gagggtagga ggcgacgcga     31620
     gcgtcggcgc gggaacgtcg aggacgcgaa cgtcggtggg gaaaacgcgc gccgtgaacg     31680
     gagagcgcga tggtgaaggc ggcgcgaacg atgagggaga cgcggtgagg gagtacggga     31740
     cgtttggttc gagcgcgtcg ttcgctcgag acgcggcgcc gggggaggcg gcggcgagcg     31800
     tggcggtgta cgtcgcgcgc gcggtcgcgc tcgtcgtcgt ctccgatatc gcggcgtgga     31860
     cggtgacgct gtatggaggg gggataccgg ccgcgatgcg ctcgctggtg atttttggcg     31920
     gcatgtccgt ggtgtactac ggcgcgtacg tcgcgcgatg gaatcggtcg atgtttgatt     31980
     tggcgacgcg cttggtcgcc gcggcggcga ttggttcgag ctcggtgatc tttggtaccg     32040
     ctttggcgct gaaagtgatt ccgaggccga tgatgcaagt gttggccatc ttgctcgcgt     32100
     cgacggtggc gccgctgttg ggcgtatacg tcgaagagtt gcgtttgcac cgtacgtcga     32160
     cgaggcgtac gagactgatg atattgtcgg actgctcgct ttacggttcg tgggacgccg     32220
     tcgccggcac tgtggcgtgg gcatgcgcct tcaaccagtc cgctgacgcc ttcggccccg     32280
     cgctagcgca gagttcattt gtcgcgttta tcgtcgccgc cgcgtgtcgt tggatgcgag     32340
     ccatgtacgt attgtacgtt atcgatcact ggatcattca gacggtcgcc gcgatgtcgc     32400
     aagagttcac agagacggtg tcgcgagcga ccgttgtcgt tatggaagaa gtttcgcgag     32460
     cgccgatcgt cgttaaggaa acagtttcgc gagtttctgt cgcgattgcg gaaacggtga     32520
     cccaaacgcc cgacgtggtt tcgcacaatg acgaatctcc gcaaccagtc gcagagccga     32580
     agatgcacga acgctcggac aataacgaag ccgccgtcgc gagcgtaaaa atgcgggttg     32640
     cgagagaacc tcagccagtt gtcatggagt cggcgccttc atccgacgcc gcgcctgtag     32700
     caggcgaaag cgtgagtgtc actcagcagc ccgatgaacg gcgtattgag tacgcgcctc     32760
     cgtataccgc ggtaattcgt gagcaggatc ctcgtccaga accgccgcgt gtcgtatacg     32820
     cgcccgcgtt tgtcgtggtg gaagaggcat cgacgtcgtc ttctacggaa tccgacgtca     32880
     ctcaaccgct cgagtcaaag cgtcgccgtc gacagcggaa gcgacagtat cgccgccgtg     32940
     agtcgctggc gaagaatact atagacatga gcgagattgt gtcgaaagaa gttaacatag     33000
     cgctgaacat gggcgtttcg attgaggcgg agcttcagcg catgttggat cgacgtcaat     33060
     cgacgctgaa cgacatgaaa aaccagcaag cgaatccaat ttctatcgcg caagtggaag     33120
     cggatattgc cgcgctgcgt gctgagctga gacgagccac gacatcacgc gaacaatttc     33180
     aacgagctca aacgtcgtat gagagcgatc tagagatgtg gatggaatcg atacgcgcgg     33240
     cggcggcggt ctcgcgattg gactacgcaa tcgattcact aaaaaacgca tcggtcgccg     33300
     acgacccgca ggtcaaggaa ctcattgatc aaagggctgt ttgggggttg cgtttggtca     33360
     gctctcaaat atttacgatt gttgaattgc aggattcact tgactctggg gaagcacgtt     33420
     cttccgcgcg catagcagaa ttacgaggag ctatagaaag tttggagctc aaattgactc     33480
     gtttgcaaga agaaaagacg cagagcgtcg ataaccgtat tcttttggag gatcgtctgc     33540
     agaaattgaa tcttgaaatc gattctgttc gggaaagaga gcgcgttgcg caagaagact     33600
     ggcaaagaga gcgcctgcgc ctggaagttg agctcgaagc ttcagtcaag gaacttcaaa     33660
     ctgccacgag aaccgtcgac gacgctctca aggcgaagtt agaactcctt gctaagctgc     33720
     agaccgctca agatcagagc gacactgatg cagaggcgat tcggcgtctc gaacatgaaa     33780
     ctgaaactct gcaaacgaag ctcaagtccc tcaccgagca gctatctgtc gcaaatgcta     33840
     gtgttgaaca aatcaattcg cgtcgatttg acttagaatc gcaactgcga gcaaaggcaa     33900
     ctgagttaga cttggcaaac gccaatcgtg ccgatacttc attagttgaa gagctgaggc     33960
     gtcaagtgaa gaatctatct acggagatct gttggctcag agatcaaaaa tcgagagaag     34020
     gaagcgaagc agaagcagta cttcaaaagc aactcgcaga ggctcgtacg caactcgaaa     34080
     tccagcgaaa tgaattagaa atcgaagcca aggctgaaat ttccgaattg aagcgatcca     34140
     tggatgttat ccgcgaggag atggaacgtc taacgtcgga gatgtcagag aagactgaaa     34200
     agagtttaga gtatcaacga atagttcaag agcgtcaaaa agagattgaa agtcttacga     34260
     aaaacaaaga gttggccgct cgcgcaatcg atgagtcaaa gaaaaacttg gctcaggctc     34320
     aggaagcgct ggagacgaag caaaaagcac tagatgaccg tgtttctcag gttgcaagct     34380
     tatctttgga tcttgcagcg agtgaggaga aaacgctcac tcttgagcgc gaactctcag     34440
     catcatgtca acgctcacaa gagctcgaag aactcatctc cagtcttcgc tcgtactcag     34500
     aatcacgcga tgccttgctt gctgacatag atttacttct cggcaacgaa aacgacgagc     34560
     gcgaagcgat gttacgaggc agtaagaacg catctgacct cgttgagcgc atacagaaac     34620
     gtcttcgaag agaagttgtc ctcgagaaga agcttgacca agctcagctg ctcgaacagg     34680
     taggtctcac agtcgaagaa ttgaaaacac gtgaagccgc atcactttgg tggaaggatc     34740
     tagttcaaat tggttctaag gctctggaaa cgattcagag caccgcagtg gatctatcta     34800
     aggggacagt cacggcttca ttgttagagc gatcgatcag tctacgagcg aaagagctgc     34860
     agaatatcac cagcgaaccg caataccaga gattgcaaaa aagcttcaat gatctgaagc     34920
     gtctttccga agccgcagag cgaaagttgc aagaaaaaga gcgaaagata aaatcattga     34980
     aggccgatag caaagagtca gctgcggaat tgaaggcgct tacctcagaa ttggcctccg     35040
     tgaaagaaga tcttaaatac atcagagata ttgcaaaaga agagcgtgat gaacagattc     35100
     agcgcataga atctctcatg ttagaggttg attcattcga aaacgccaaa tttgatggtg     35160
     aagaggcagt acgctttaga aacgaagcag cgaagcttcg agggatgaaa attcggttgg     35220
     aagctgagct caagttgagt caagatctcg cagagacagc gagcagcgaa ctggctcgag     35280
     ctcgcgaaga gcacgatgtc gtcatcacgc agttgagtga agaaatagca gctcttgaac     35340
     tcgacatcac agttaaatct gaagcgatcg aaaagttgga gtcaaagacg aataatattg     35400
     aggtcaagtt gggctccgat cttgagagcg cgttagcaaa actgaacacc acgctcgaag     35460
     aactcgataa aaagtccacg gattttgcat ctcttgaaag cgcatcggtt gaacaaaagc     35520
     gaaactttga gaagcacgtg gacgagcttg aaaagcgcct gggtgcttcc gaggctgaag     35580
     tgcaaagatt gatacaagat agagatctgg ctattgaggc caaagacaac gaaatggttt     35640
     cgaaaattct ttcgcagtcc gctatcgtgt ccgatctcga gtctgagcgc gacgcgctgc     35700
     gttcgcagct cgccgacctt tcgtccgctc gcgactctga gctggcgtct gtgcgcgcgg     35760
     atcttgagtc ccagcttcgc gagcgcgagg aggacatcga gcgcgtgcgt tctgagctcg     35820
     acgagtccaa ggcggcactt gagtctgagc gcgacgcgct gcagtcggag ctcgagcgcg     35880
     tgctttctca ggtgcccgag gttgacgcgt cgcagtccgc tatcgtgtcc gatctcgagt     35940
     ctgagcgcga cgcgctgcgt tcgcagctcg ccgacctttc gtccgctcgc gactctgagt     36000
     tggcgtctgt gcgcgcggat cttgagtccc agcttcgcga gcgcgaggag gacatcgagc     36060
     gcgtgcgttc tgagctcgac gagtccaagg cggcacttga gtctgagcgc gacgcgctgc     36120
     agtcggagct cgagcgcgtg ctttctcagg tgcccgaggt tgacgcgtcg cagtccgctg     36180
     ccgtgtccga tctcgagtct gagcgcgacg cgctgcgttc gcagctcgcc gacctttcgt     36240
     ccgctcgcga ctctgagttg gcgtctgtgc gcgcggatct tgagtcccag cttcgcgagc     36300
     gcgaggagga catcgagcgc gtgcgttctg agctcgacga gtccaaggcg gcacttgagt     36360
     ctgagcgcga cgcgctgcag tcggagctcg agcgcgtgct ttctcaggtg cccgaggttg     36420
     acgcgtcgca gtccgctatc gtgtccgatc tcgagtctga gcgcgacgcg ctgcgttcgc     36480
     agctcgccga cctttcgtcc gctcgcgact ctgagttggc gtctgtgcgc gcggatcttg     36540
     agtcccagct tcgcgagcgc gaggaggaca tcgagcgcgt gcgttctgag ctcgacgagt     36600
     ccaaggcggc acttgagtct gagcgcgacg cgctgcagtc ggagctcgag cgcgtgcttt     36660
     ctcaggtgcc cgaggttgac gcgtcgcagt ccgctgccgt gtccgatctc gagtctgagc     36720
     gcgacgcgct gcgttcgcag ctcgccgacc tttcgtccgc tcgcgactct gagttggcgt     36780
     ctgtgcgcgc ggatcttgag tcccagcttc gcgagcgcga ggaggacatc gagcgcgtgc     36840
     gttctgagct cgacgagtcc aaggcggcac ttgagtctga gcgcgacgcg ctgcagtcgg     36900
     agctcgagcg cgtgctttct caggtgcccg aggttgacgc gtcgcagtcc gctatcgtgt     36960
     ccgatctcga gtctgagcgc gacgcgctgc gttcgcagct cgccgacctt tcgtccgctc     37020
     gcgactctga gttggcgtct gtgcgcgcgg atcttgagtc ccagcttcgc gagcgcgagg     37080
     aggacatcga gcgcgtgcgt tctgagctcg acgagtccaa ggcggcactt gagtctgagc     37140
     gcgacgcgct gcagtcggag ctcgagcgcg tgctttctca ggtgcccgag gttgacgcgt     37200
     cgcagtccgc tgccgtgtcc gatctcgagt ctgagcgcga cgcgctgcgt tcgcagctcg     37260
     ccgacctttc gtccgctcgc gactctgagt tggcgtctgt gcgcgcggat cttgagtccc     37320
     agcttcgcga gcgcgaggag gacatcgagc gcgtgcgttc tgagctcgac gagtccaagg     37380
     cggcacttga gtctgagcgc gacgcgctgc agtcggagct cgagcgcgtg ctttctcagg     37440
     tgcccgaggt tgacgcgtcg cagtccgctg ccgtgtccga tctcgagtct gagcgcgacg     37500
     cgctgcgttc gcagctcgcc gacctttcgt ccgctcgcga ctctgagttg gcgtctgtgc     37560
     gcgcggatct tgagtcccag cttcgcgagc gcgaggagga catcgagcgc gtgcgttctg     37620
     agctcgacga gtccaaggcg gcacttgagt ctgagcgcga cgcgctgcag tcggagctcg     37680
     agcgcgtgct ttctcaggtg cccgaggttg acgcgtcgca gtccgctgcc gtgtccgatc     37740
     tcgagtctga gcgcgacgcg ctgcgttcgc agctcgccga cctttcgtcc gctcgcgact     37800
     ctgagttggc gtctgtgcgc gcggatcttg agtcccagct tcgcgagcgc gaggaggaca     37860
     tcgagcgcgt gcgttctgag ctcgacgagt ccaaggcggc acttgagtct gagcgcgacg     37920
     cgctgcagtc ggagctcgag cgcgtgcttt ctcaggtgcc cgaggttgac gcgtcgcagt     37980
     ccgctgccat gtccgatctc gagtctgagc gcgacgcgct gcgttcgcag ctctctgagc     38040
     ttcgtcaaat gtcctccgaa tccatcgcag gactccagca gcaattagtc gcattttcgg     38100
     cggaggcgga ctctgcggct tccttgagaa aaacagttaa agagttgaag gcaactatca     38160
     gacagcgcga aaatttgctt tctgaaacgg tgttcgatcc gatgttgaat gatgacttgg     38220
     accgtatgaa cgatgagctt gcatcgaaga gtgcggaact agattctgca cggacgaagt     38280
     tgcagtcgac tcttaataag ttaaaagaac gcgaggagca ggctgaatct tcgcaagctg     38340
     ttgcaagtgc tgtcatagat gagatccgcg ccgagctttt gaatgcaaac gaaaagttgg     38400
     ctgctcgtga gtcatacgcc aacgctgttg agttggcgct gcggtcagaa ctcacagaaa     38460
     gagagaaaga aattgcgctt ttgcgtgtca aggtagctaa aattctcgat gacagcacga     38520
     acaagcagac aagtctcacc actgcgctcg attctgcgca gtctgagatt gagcgcctca     38580
     ctcgcgagct cgaggatgtt gagcagagca agcaagtggc catgaaggag tcatttgagc     38640
     gcaacgaatc gcagattgcg tctctgaacg ccgcgcaccg cgagttggat cagcgcctgc     38700
     gagacgagct cgacgcggcg ctcaaagcga aggcaagtct tgagaaggag ctcagcgacc     38760
     gcgcggaatc caccgctgct accgaaacag cgaagcgcaa cgccgaagca ctgagcgaaa     38820
     gcttgcaatc gcagcttgat gcactgtcca cgcagcgtgc tgagctcgag cagcggctgg     38880
     tcaagcgcga ggaggagctc gtcgctgagc ttgacgcagc caagcatgaa gccacagcgc     38940
     aggccgcacg ttttgcacaa cttggcgagg cggcctcaga tcacgcacac gacgaggttg     39000
     ataaacttaa gtccgaagtg gaacgactcg agtttgagct cggcgctgtg aaaaacgagc     39060
     tgacaagcgc gacgtcgact gcgaaagcgg acattgcgag gcttacggat gaacttgcaa     39120
     gcgccagcgc cgcgcgagac gccgtggctg aaaccgctca tccagaagaa gacgggtcat     39180
     cggagtccgc atcggcgttc gaagccatga gacgcgacat gactcgtctc gagtcggagc     39240
     ttgccgccgc tctcgcggag cttgcggagc tcgaatcgcc tcgcgagtca gagtcctcag     39300
     atactgaagc tattcgcgag ttcaccactg cgctcgattc tgcgcagtct gagattgagc     39360
     gcctcactcg cgagctcgag gatgttgagc agagcaagca agtggccatg aaggagtcat     39420
     ttgagcgcaa cgaatcgcag attgcgtctc tgaacgccgc gcaccgcgag ttggatcagc     39480
     gcctgcgaga cgagctcgac gcggcgctca aagcgaaggc aagtcttgag gagcgcagcg     39540
     accgcgcgga atccaccgct gctaccgaaa cagcgaagcg caacgccgaa gcactgagcg     39600
     aaagcttgca atcgcagctt gatgcactgt ccacgcagcg tgctgagctc gagcagcggc     39660
     tagtcaagcg cgaggaggag ctcgtcgctg agcttgacgc agccaagcat gaagccacag     39720
     cgcaggccgc acgttttgca caacttggcg aggcggcctc agatcacgca cacgacgagg     39780
     ttgataaact taagtccgaa gtggaacgac tcgagtttga gctcggcgct gtgaaaaacg     39840
     agctgacaag cgcgacgtcg actgcgaaag cggacattgc gaggcttacg gatgaacttg     39900
     caagcgccag cgccgcgcga gacgccgtgg ctgaaaccgc tcatccagaa gaagacgggt     39960
     catcggagtc cgcatcggcg ttcgaagcca tgagacgcga catgactcgt ctcgagtcgg     40020
     agcttgccgc cgctctcgcg gagcttgcgg agctcgaatc gcctcgcgag tcagagtcct     40080
     cagatactga agctattcgc gagttcacca ctgcgctcga ttctgcgcag tctgagattg     40140
     agcgcctcac tcgcgagctc gaggatgttg agcagagcaa gcaagtggcc atgaaggagt     40200
     catttgagcg caacgaatcg cagattgcgt ctctgaacgc cgcgcaccgc gagttggatc     40260
     agcgcctgcg agacgagctc gacgcggcgc tcaaagcgaa ggcaagtctt gagaaggagc     40320
     gcagcgaccg cgcggaatcc accgctgcta ccgaaacagc gaagcgcaac gccgaagcac     40380
     tgagcgaaag cttgcaatcg cagcttgatg cactgtccac gcagcgtgct gagctcgagc     40440
     agcggctagt caagcgcgag gaggagctcg tcgctgagct tgacgcagcc aagcatgaag     40500
     ccacagcgca ggccgcacgt tttgcacaac ttggcgaggc ggcctcagat cacgcacacg     40560
     acgaggttga taaacttaag tccgaagtgg aacgactcga gtttgagctc ggcgctgtga     40620
     aaaacgagct gacaagcgcg acgtcgactg cgaaagcgga cattgcgagg cttacggatg     40680
     aacttgcaag cgccagcgcc gcgcgagacg ccgtggctga aaccgctcat ccagaagaag     40740
     acgggtcatc ggagtctgca tcggcgttcg aagccatgag acgcgacatg actcgtctcg     40800
     agtcggagct tgccgccgct ctcgcggagc ttgcggagct cgaatcgcct cgcgagtcag     40860
     agtcctcaga tactgaagct attcgcgagt tcaccactgc gctcgattct gcgcagtctg     40920
     agattgagcg cctcactcgc gagctcgagg atgttgagca gagcaagcaa gtggccatga     40980
     aggagtcatt tgagcgcaac gaatcgcaga ttgcgtctct gaacgccgcg caccgcgagt     41040
     tggatcagcg cctgcgagac gagctcgacg cggcgctcaa agcgaaggca agtcttgaga     41100
     aggagctcag cgaccgcgcg gaatccaccg ctgctaccga aatagcgaag cgcaacgccg     41160
     aagcactgag cgaaagcttg caatcgcagc ttgatgcttc tcgcgctgaa gaggcgaagc     41220
     tccgtgatga gctcaatcat tttcaggagc ttgcacgaga ggagatttca gcactccata     41280
     atgaaattac cgaaataaaa ttcacgtcgc aagaaagtca agcgtcgctt ggagaatcac     41340
     cgtggccgag tatcacaatt tccacccttg cgggtcttaa cgagatgatg tctcggggat     41400
     ctgaattcgg gagtgaaggc ttagattggc ttgagcacgc cgcacacgaa gtacaagcgc     41460
     ttgaaaagtc cgtgttggat gcgacggctg agctcgagtt acgagagaat gaatatgaac     41520
     aaactattgc acagttgcaa gatagtgttc gtgacgcgga aactgacctc aactcgcaga     41580
     agagtctggc tagcgcagct ttgagcgacg tcgagcatct gaatgataaa ttggccgaac     41640
     gcgatgagga gctggcatca ctccggctcg aactcgcgaa cttggtttca gatgacgtca     41700
     cacgcgagct tgaattaacg atcagtaatt tgaggataca gctgaccgca aaagataacg     41760
     agttgaatgg agctgtcgcg tcgttgaatg atttggaaaa cgacaagaga gctatagaag     41820
     aagcaatgtc cgaactacaa gctgcagctg acatgcaagc agctcgagtg caaacatcga     41880
     ttgagcaaat atcaagtttg aatgttgagc tggccaagcg ctctgcagct cttgatgcta     41940
     gttgggataa tctttctcac gctgaatcac gcgcacgttt tgccgagcaa gagcgagacg     42000
     acgttcgccg gctttttgag gagcgacttg ctgtgaaaga gcgagcacta cgcgagacac     42060
     aaggagatgt tgaacatctt cgtcagacgg tgcgtaatct tcaggataaa ttgaaagcac     42120
     atagatatgc acgttctgag accgaagctg gtcatccaga agaagacggg tcatcggagt     42180
     ctgcatcggc gttcgaagcc atgagacgcg acatgactcg tctcgagtcg gagcttgccg     42240
     ccgctctcgc ggagcttgcg gagctcgaat cgcctcgcga gtcagagtcc tcagatactg     42300
     aagctattcg cgagttcacc actgcgctcg attctgcgca gtctgagatt gagcgcctca     42360
     ctcgcgagct cgaggatgtt gagcagagca agcaagtggc catgaaggag tcatttgagc     42420
     gcaacgaatc gcagattgcg tctctgaacg ccgcgcaccg cgagttggat cagcgcctgc     42480
     gagacgagct cgacgcggcg ctcaaagcga aggcaagtct tgagaaggag ctcagcgacc     42540
     gcgcggaatc caccgctgct accgaaacag cgaagcgcaa cgccgaagca ctgagcgaaa     42600
     gcttgcaatc gcagcttgat ggaaaaactt gagtcattgc gccgtgagca cgaaacaaaa     42660
     ctgaacgaca tgcgtgagtc tgcaacacaa caacgcgcgg atcttgagtc ccagcttcgc     42720
     gagcgcgagg aggacatcga gcgcgtgcgt tctgagctcg acgagtccaa ggcggcactt     42780
     gagtctgagc gcgacgcgct gcagtcggag ctcgagcgcg tgctttctca ggtgtctgag     42840
     tctgagtctc tgcagtccgc tgccgtgtcc gatctcgagt ctgagcgcga cgcgctgcgt     42900
     tcgcagctcg ccgacctttc gtccgctcgc gactctgagt tggcgtctgt gcgcgcggat     42960
     cttgagtccc agcttcgcga gcgcgaggag gacatcgagc gcgtgcgttc tgagctcgac     43020
     gagtccaagg cggcacttga gtctgagcgc gacgcgctgc agtcggagct cgagcgcgtg     43080
     ctttctcagg tgtctgagtc tgagtctctg cagtccgctg ccgtgtccga tctcgagtct     43140
     gagcgcgacg cgctgcgttc gcagctcgcc gacctttcgt ccgctcgcga ctctgagttg     43200
     gcgtctgtgc gcgcggatct tgagtcccag cttcgcgagc gcgaggagga catcgagcgc     43260
     gtgcgttctg agctcgacga gtccaaggcg gcacttgagt ctgagcgcga cgcgctgcag     43320
     tcggagctcg agcgcgtgct ttctcaggtg tctgagtctg agtctctgca gtccgctgcc     43380
     gtgtccgatc tcgagtctga gcgcgacgcg ctgcgttcgc agctcgccga cctttcgtcc     43440
     gctcgcgact ctgagttggc gtctgtgcgc gcggatcttg agtcccagct tcgcgagcgc     43500
     gaggaggaca tcgagcgcgt gcgttctgag ctcgacgagt ccaaggcggc acttgagtct     43560
     gagcgcgacg cgctgcagtc ggagctcgag cgcgtgcttt ctcaggtgtc tgagtctgag     43620
     tctctgcagt ccgctgccgt gtccgatctc gagtctgagc gcgacgcgct gcgttcgcag     43680
     ctcgccgacc tttcgtccgc tcgcgactct gagttggcgt ctgtgcgcgc ggatcttgag     43740
     tcccagcttc gcgagcgcga ggacgacatc gagcgcgtgc gttctgagct cgacgagtcc     43800
     aaggcggcac ttgagtctga gcgcgacgcg ctgcagtcgg agctcgagcg cgtgctttct     43860
     caggtgcccg aggttgacgc gtcgcagtcc gctgccgtgt ccgatctcga gtctgagcgc     43920
     gacgcgctgc gttcgcagct cgccgacctt tcgtccgctc gcgactctga gttggcgtct     43980
     gtgcgcgcgg atcttgagtc ccagcttcgc gagcgcgagg aggacatcga gcgcgtgcgt     44040
     tctgagctcg acgagtccaa ggcggcactt gagtctgagc gcgacgcgct gcagtcggag     44100
     ctcgagcgcg tgctttctca ggtgcccgag gttgacgcgt cgcagtccgc tgccgtgtcc     44160
     gatctcgagt ctgagcgcga cgcgctgcgt tcgcagctcg ccgacctttc gtccgctcgc     44220
     gactctgagt tggcgtctgt gcgcgcggat cttgagtccc agcttcgcga gcgcgaggag     44280
     gacatcgagc gcgtgcgttc tgagctcgac gagtccaagg cggcacttga gtctgagcgc     44340
     gacgcgctgc agtcggagct cgagcgcgtg ctttctcagg tgcccgaggt tgacgcgtcg     44400
     cagtccgctg ccgtgtccga tctcgagtct gagcgcgacg cgctgcgttc gcagctcgcc     44460
     gacctttcgt ccgctcgcga ctctgagttg gcgtctgtgc gcgcggatct tgagtcccag     44520
     cttcgcgagc gcgaggagga catcgagcgc gtgcgttctg agctcgacga gtccaaggcg     44580
     gcacttgagt ctgagcgcga cgcgctgcag tcggagctcg agcgcgtgct ttctcaggtg     44640
     cccgaggttg acgcgtcgca gtccgctgcc gtgtccgatc tcgagtctga gcgcgacgcg     44700
     ctgcgttcgc agctcgccga cctttcgtcc gctcgcgact ctgagttggc gtctgtgcgc     44760
     gcggatcttg agtcccagct tcgcgagcgc gaggaggaca tcgagcgcgt gcgttctgag     44820
     ctcgacgagt ccaaggcggc acttgagtct gagcgcgacg cgctgcagtc ggagctcgag     44880
     cgcgtgctgg gagagttgag tcagtcgact tcggcgcttc ggcgcgttga ggaggatctc     44940
     aatgccgctt taagcgaccg cgatgagttc gaagaagaga gtgatcgttt gcgtcggcgt     45000
     ctaccacgac ttgaacgaga gcataacgag ttggaggatg caatgcgctt ggaaatggac     45060
     gaattggctt caaagcttgc agcgatgtca aaagcgcgcg atgatctcga gaaggacatg     45120
     attgagcaga gtgatggtct gtacaaggca cttggcagta gccgcgagga tctgcagcga     45180
     gaactaaacg agggcaagaa gttacttgct caacgtgagg ccgagctaaa gcgtttaact     45240
     gccgattttt cgttgaaaga gcacgcaatt gagtctgagc gagaagcact tgcgaccgaa     45300
     ttggatcgac tgatacacaa ggtgccagcc ttggagttga ctacggctga actagaggct     45360
     gaacgcgcgg agttgcgcga aaagcttgat gatttgatag caaatcgtga tcagctggcg     45420
     gccaatctgc gaaccgagaa cgattcgatg tcagcagaac tgtccatgac tcgagaagct     45480
     cttgatgaac aattcaatgc cgttacaaca cagctccttg aaaccgatga gatcatcgac     45540
     aagatgcgca aggataacga agctgcaaag gaagcagcag agaacgaccg cttagcgcta     45600
     caaggtgagc ttgagcgcgt ggtgtcggaa tcaaataagc tgcgggcagc tcaagccacg     45660
     gccgagtctc ttctacgcgc agagcgtgat gatctcgaag acaaggtcga aaaacttgag     45720
     tcattgcgcc gtgagcacga aacaaaactg aacgacatgc gtgagtctgc aacacaacaa     45780
     cgcgcggatc ttgagtccca gcttcgcgag cgcgaggagg acatcgagcg cgtgcgttct     45840
     gagctcgacg agtccaaggc ggcacttgag tctgagcgcg acgcgctgca gtcggagctc     45900
     gagcgcgtgc tttctcaggt gtctgagtct gagtctctgc agtccgctgc cgtgtccgat     45960
     ctcgagtctg agcgcgacgc gctgcgttcg cagctcgccg acctttcgtc cgctcgcgac     46020
     tctgagttgg cgtctgtgcg cgcggatctt gagtcccagc ttcgcgagcg cgaggaggac     46080
     atcgagcgcg tgcgttctga gctcgacgag tccaaggcgg cacttgagtc tgagcgcgac     46140
     gcgctgcagt cggagctcga gcgcgtgctt tctcaggtgc ccgaggttga cgcgtcgcag     46200
     tccgctgccg tgtccgatct cgagtctgag cgcgacgcgc tgcgttcgca gctcgccgac     46260
     ctttcgtccg ctcgcgactc tgagttggcg tctgtgcgcg cggatcttga gtcccagctt     46320
     cgcgagcgcg aggaggacat cgagcgcgtg cgttctgagc tcgacgagtc caaggcggca     46380
     cttgagtctg agcgcgacgc gctgcagtcg gagctcgagc gcgtgctggg agagttgagt     46440
     cagtcgactt cggcgcttcg gcgcgttgag gaggatctca atgccgcttt aagcgaccgc     46500
     gatgagttcg aagaagagag tgatcgtttg cgtcggcgtc taccacgact tgaacgagag     46560
     cataacgagt tggaggatgc aatgcgcttg gaaatggacg aattggcttc aaagcttgca     46620
     gcgatgtcaa aagcgcgcga tgatctcgag aaggacatga ttgagcagag tgatggtctg     46680
     tacaaggcac ttggcagtag ccgcgaggat ctgcagcgag aactaaacga gggcaagaag     46740
     ttacttgctc aacgtgaggc cgagctaaag cgtttaactg ccgatttttc gttgaaagag     46800
     cacgcacttg agtctgagcg agaagcactt gcgaccgaat tggatcgact gatacacaag     46860
     gtgccagcct tggagttgac tgcggctgaa ctagaggctg aacgcgcgga gttgcgcgaa     46920
     aagcttgatg atttgatagc aaatcgtgat cagctggcgg ccaatctgcg aaccgagaac     46980
     gattcgatgt cagcagaact gtccatgact cgagaagctc ttgatgaaca attcaatgcc     47040
     gttacaacac agctccttga aaccgatgag atcatcgaca agatgcgcaa ggataacgaa     47100
     gctgcaaagg aagcagcaga gaacgaccgc ttagcgctac aaggtgagct tgagcgcgtg     47160
     gtgtcggaat caaataagct gcgggcagct caagccacgg ccgagtctct tctacgcgca     47220
     gagcgtgatg atctcgaaga caaggtcgaa aaacttgagt cattgcgccg tgagcacgaa     47280
     acaaaactga acgacgtgcg tgagtctgca acacaacaac gcgcggatct tgagtcccag     47340
     cttcgcgagc gcgaggagga catcgagcgc gtgcgttctg agctcgacga gtccaaggcg     47400
     gcacttgagt ctgagcgcga cgcgctgcag tcggagctcg agcgcgtgct ttctcaggtg     47460
     tctgagtctg agtctctgca gtccgctgcc gtgtccgatc tcgagtctga gcgcgacgcg     47520
     ctgcgttcgc agctcgccga cctttcgtcc gctcgcgact ctgagttggc gtctgtgcgc     47580
     gcggatcttg agtcccagct tcgcgagcgc gaggaggaca tcgagcgcgt gcgttctgag     47640
     ctcgacgagt ccaaggcggc acttgagtct gagcgcgacg cgctgcagtc ggagctcgag     47700
     cgcgtgcttt ctcaggtgtc tgagtctgag tctctgcagt ccgctgccgt gtccgatctc     47760
     gagtctgagc gcgacgcgct gcgttcgcag ctcgccgacc tttcgtccgc tcgcgactct     47820
     gagttggcgt ctgtgcgcgc ggatcttgag tcccagcttc gcgagcgcga ggaggacatc     47880
     gagcgcgtgc gttctgagct cgacgagtcc aaggcggcac ttgagtctga gcgcgacgcg     47940
     ctgcagtcgg agctcgagcg cgtcatggac gacgttctga acgcagaagc gcttgcggag     48000
     caagctgagc ttatacgctc gcagatgcag gcggacatgg agcaacttgt tgaagcgcga     48060
     caaagtgttg agcagcgttt gcaggatgtg gacagtgctc ttcagatttc tttgaacaag     48120
     gttgccacgc ttgagattga gcaagaaaga ttgcgactcg aactctccgc ttccgagaaa     48180
     gccttagccg aaagtgaacg tgctaggtca gaatcagacg cagaaattct ggcgcttagc     48240
     gacgagctgt cggacgcttt gaatgcacgg ttacttattg agcaacgact tcgtgcgcgc     48300
     gacgaggaac tggagaccgc gcgcatcaaa caatctgaat taattacgga gaattcaaag     48360
     ctccgagctg aactcatgga tgccaaagca atggcagacg attacactcg gcagttgtct     48420
     tcagggctat tcggcgatga aaagcgtgtc gaggctggaa ttcaacgatt tgactctttc     48480
     gaggcgtcgg acactggtat atttgccaca gacgaagcag acgaagcttt cgtgaccgcc     48540
     tgcaatatgg tgcaacgaat tgaaatctta gttcgtcgac aaaagcaaac gggcgaagaa     48600
     ttaaagcgac tagatgacac tggcgcggct gaatcagacg atgcgcgctt attgcgctcc     48660
     gagctcgccg ctatgggttc tcaactcgac tcgtgcagag aaactctcgc tgcgtgctcg     48720
     cacggtctca gcgtgcttga atcgcgcatg gccgaagaat tcgcggcgat gggcaagtcg     48780
     ccaatgttcg cagaaggcat ggacactact cgcagtcgcg tacgcgatct agaaaagtca     48840
     ctcgcggcgg cgaatgccca gtccgacgtc accttcaaga atctgcaaat cgcgctcgac     48900
     gcatcgacga tggatgtcgg aagggatatt cctgtcgagt ttaaaatccc gtttcaatca     48960
     atcccaggac aacgtatttt agtcgttggt acttggtgcg attggatcac tcaaaacggc     49020
     ttgcagttga cgtggaccga ggggaacata tggaaaggca cgatgacact gcacacaggc     49080
     tcaaattacg agtacaagta cgtcgttgtg gaggaagtcc tcggcggagt gcctggggaa     49140
     gcaccgccgt actttccgcc ctggggcaca accgagccaa agattgagca gatgttcgac     49200
     ggacgggcgt acatgctcgt ctggcagcca ggaaacaaca aggcgatggc gctcgacaac     49260
     attcacacgg atggcgtcgc gcaaattaaa gtttcagacg actggatcgc caatcccaag     49320
     aaatcaccga tcacactctt cgccgcggat ggagaagtgc ttgagatcgt cggctcgacg     49380
     gcactgctcg gtgaaacggt cgatcgcgcc gatcacgccc tcgccgaggc tcgaaagcaa     49440
     gtccaaatga tggccgactt ggcgagcgcc gcgttggctg aagtcgatac ccagctcgcg     49500
     agacgaatcg ccacgcaact ggacgatatt cgtcacaaag gaactttgtc taccgacagc     49560
     gacggtaagc atcaccgtgg aacaaaggcg cttccctcga gcgttgaggc cggctcgcca     49620
     aggtctaatc ttaactggat gaatattgga ttcgggttgg aagcccaaga cgatggcgaa     49680
     gattcaacat cggcttcgac tgacgcggaa gacgccggcg atggcatcga ctacgcgtaa     49740
     ggaatgcatg cgatcacggc aaacgatcgc catagcgcgc accatagcat ttagatgtac     49800
     acgatgaatg tgtctagaaa tcaaatcgcg cccgattcgc cgacgtgaaa tttcttcgcc     49860
     cccaactccc tcgccgccac gcgctgttcc acggctcgcg cgtcactgac gggcggtacc     49920
     gcgcgcgcgt aatgtcgcat cgcgcgtcca atatcacgct cctcttcttc cgcgtcgtcc     49980
     cccaccccat aaaaacccac gagctctaac aaacgatccg gctgcttcgc caccgcgtct     50040
     ctcgcctccg ccgcgccgag cgtctcctcc aacccgcgca tcgcttcttc cagcgctcgc     50100
     ccatcgcaca gcagcagtcc cggtgcgagc gttatctgcc gccctgagat ccccgccacg     50160
     catcgtttca ccatcaacac gcgctttacg aattcgtcct cgcgcagcgc caacagcctc     50220
     ggctctcgcg ccgcggacgc cggcacgtcc aacccgtgcg agccgcaatt tccgtcgcca     50280
     tccaccggga acacgcgcaa cagcgcgcgc actttcgatt ccaatcgcgc tggatcgcga     50340
     tacagcgatt cgcgcgatga tttcgtgacg atttgtcggc agtgcgcggc gcccgtccaa     50400
     tttctccaaa acttttcaac cgcgcggtcg ttcgcgtcgg tgaacgcgca ctcgccgtcg     50460
     cccgcgctgc gcgcgcgcgc cgcgcgactc gccgcgcccg aagtcgacgt cgacggcccg     50520
     cgcgacggcg cgcgcgtgaa gtttgcgcgc atctgaatga cggcgtaacg tcttcgcgat     50580
     ggcgccggtc gcggtcgccg cgaacgttga aatcgcggcg ccgctcgcgg tggaagacac     50640
     ggccacgctt tgcgacctcg tgcgcggcgc gctgtgcttc tggcggtgcg agagggatta     50700
     tttcttcgcg gaagggtcga agtgcgcgag ggcgcgagac gcgtgcgcgg cggcgtgtcg     50760
     cctgccgccg gaatgggtca cgcgagcgct cggcacgacg cgagaacgag aaatcgcgaa     50820
     gcacacggac cctttggaac ggaaagaata tttggggacg ctcacggagg aggaggcgcg     50880
     gacgttgagg cggagacggg cggaggcggc gcgcttcgtg agacgaagag cgatggccgc     50940
     ggcgccggag agacagagca tgacgaagcg ggcgggggaa cgacggagac gggagcgagc     51000
     gtggacctcg tcaaagttga gaaaggatgg ggacgacgcg tcggtgagcg cgagcgatga     51060
     gttcgggaag gcggaggcgc tcgaggccga gctagcggag gcgaacgctc ggcggtatcg     51120
     ccgcgcctac gacggcgccg atgaatcggg gtattcgtcg cgatcgtcgt cgtattactc     51180
     ggacgaatcg tcgtattcgt cgtacaccgg gtcgtcgtat tcgtcgtaca ccgggtcgtc     51240
     gtattcgtcg tacgcctcgg acgcagacgc cgagcgggag cgtcggcgcg cgttggcgct     51300
     cgacgcaatg aagcccccga acgacgccac ggcgatgacc gtctcgcgca aggatgcgct     51360
     cggcaaacca ttaatcgtcg gcaagcactt ggcgttcgcc accgaaggtt tactccccga     51420
     aggcttgacg cgctgggagg cgtacatcgc cgaagccgaa cgcgccggcg agcttcgcga     51480
     cgccaaaatg cgtcgccgcg ccgagcgtcg cgatcgatcc ctccaccgcg agctcgatgc     51540
     tctgaaactc tacgccgaca gggtcaagct cagcgagcaa gacgtgcaaa tccgtcgtca     51600
     agcgttgatc gacgcgcacg acgcgcgcgt tcgcgaatcc gtcgagcgcg aagtcaaaat     51660
     agccgcccgc gcgcgtcgca agcgcaacgt cctgctcaat ctcgaccacg acgcgcgctc     51720
     tagattatta aagcgctggg ctctccgccc cagcgctcag aaatagcacc gattcagagt     51780
     cgtgccgcgc gtccggcgcg ctcgttcgcg cgccgtcgcc gcctcgccag tctcacaccg     51840
     cgccgcgccg cttcgcgtcg ccgccgccgc gcgcgcgtca tgtctcgcgc cggactcacg     51900
     cccgccgcgc gccgcgcgat ggaccgcgcg ctcgacggcg cgcccgacgc cgtcgagcgc     51960
     gtcgcgcaga aaccgcccgc gcccgcgacg cgccgccgcg cgcgcggtcg ctcgctcgcg     52020
     cgcgccgtcc cgctcgtcgc gttcctcgac gaccgaccgc gattgaaaca cttctcgctc     52080
     ggcttcctcg cgggcgcgtg cgcgatggcg gcgatcgcga tggaggaggt gaagaggatg     52140
     gtggcggcgc gcgacgacga gcggcggcgc gagcgagacg cgagacgacg cgcgaggatt     52200
     gagaaaaagg cggtgaataa attgaactcg gtgccgataa tcgtggagat gagcgatgaa     52260
     gaggcgggcg acgggatcgg gggggacgtc gggacgaggg acgaagagca caagatggcg     52320
     ctgctggtgc gagaggacgt ggcgatgggg gcggggaagt tggcggcgca ggcgggacac     52380
     gcggcggttg gcgcggcgat ggcgacgcgg gatcgatcgc cgatgctgat gggaagatgg     52440
     gagtgcgatg ggcaaaagaa ggtgacgctg ggggtgaaga atctgagggt gatgaatgaa     52500
     ctgttgggag aggcgaagac ggcgcggttg acgacgtttg tcgtggagga cgccggccgc     52560
     acggaggtgg aaccgggcac ggtgacggtc gccgccatcg gaccggcggc ggcgtccgac     52620
     attgataaaa tcacgggaca cctgcgtttg tactagcgtt tcgtcgatcg ttccgggact     52680
     agattatcat caatgagaaa ttcaattatt gttttacaaa tctttcgtcg tcggacggtc     52740
     ttgtaagtct cgatcaagaa aagacgtctt cccgatccat cggtgccgtt tcttccggtt     52800
     tctccgcctc gagcgcggcg aactcgagga agtgcgtcgg tctgtgtcgc tcgtggtaaa     52860
     attcgagcgg attcccgagc ttgagtgcgt acttcatgcc cgccgagtgc ttgacgcctt     52920
     ggaaagaata gttccacgac ccgccgtcgg gaaccatgta gtaacccaag aaacgatcgg     52980
     agagtaacat ttgaaccttt tcgaaatgtc cgggtccata tccttgcgga tttgtgctcg     53040
     tcatgtcctt gttcgcgcgg ccccattcgt accctgcggg cgtgatcttg tacgccgtca     53100
     acgagcacga acccggggtg aacgagcacg tcaagatgat gctcttttct ccatcccagg     53160
     acgaattttg ctcgagaatc ttggcgtgct gcgtgcaatc ctgcggttgc aattgagagc     53220
     tctcgttcgg ttgcgtgtga atccacccca acggctcgag atcgctcaag tagtcgtgct     53280
     ccgggagcgt cgacggtaaa ttcaccgagc tgtggttgcc ccactgaggc ggcatcacga     53340
     cgcaacggat ctccttcact tgagggttgt ccggcggcga aacgccgtac atgtaacccg     53400
     caatctgcgt acgcaaatcg gcgatagtga tgaacttttt caacacgttc ttgggcatga     53460
     tgtatgtgta tccagtctcc ttcaagtcgt cgctgttgac gtaaatgtgg ttcacgcgca     53520
     aatgtaaatt tgtcgcgctg atggctcgaa tacgccaatc ggtcttacta ccgaacgttg     53580
     attgttcgta cggactcgta gtggtgacga tgagctcgtc tccgtgcaca ttcgtagtct     53640
     tggtcgtgac ggcaatctgc tggttggcat cttgcccacg tttttcgatt tcggcaatct     53700
     cttgtcgctg cacagacggc ggcgtgattt cagcgccaag aatgatgtcg cgaacctcgc     53760
     tttgcgtcaa cgccgagacg ttgacgttgt tcttcgcaga ataatccgcc aagatcaagt     53820
     ctttcaaagc gatttcaacc ttgatccatt gctcatcggt gagatctggc cacacgtgat     53880
     gcggtagcgt cacgacactc ttgtcaggac gcaacatcat ctttgccttt tcgttgttga     53940
     cgtgcaacgc tcgtaaaatc aaaatcaaac gactaaaggc tgtgtaactc gaaattgtct     54000
     tcaaccaatc gtcgtagatg ttgaacaaca ccatttgcgg ctcagtggct ttcaagatga     54060
     gatcgccaaa cttttcgatc ttcatgcacg cttggaacgg cagttgcaac tcgcttccct     54120
     tgatgacgat gttcgggtaa tcgagcatgt gcgtctccaa cgggtcgagc ataccctttc     54180
     tcgtcacgat gatttgtttg ggttgctctt cgatcgggag agagcgaatc aaggccgcga     54240
     cttcttctgc tgtcttccac ttggccaact gcgcgagacg cttctgccca gcccacacgc     54300
     tcgtgtgaat gatcttcaaa aagagttgac cagtgcgcgg gttgaagatg aaaatagcac     54360
     cgttgattgg ttttgtcacc aagttaccct cgaacgtttt gtgaatcgtc acgcggtaca     54420
     cattcgtatc gtccacgaac caaattgttt ggttgctgaa caactcgccg tagttttgag     54480
     agttgagata cggttcggtg ggctcagagg agtacaactg caaaccctta cgaatgcgct     54540
     cgcgcaatac gtaaagcgcc gggttagctt tcatgatctt cgccatcgct tgttgcacca     54600
     aaggtttgca cccagggaac cagttaccgt aggctgagtg caagttgtac gccaagtcga     54660
     tgcctatcat caccccagtc ggcgacgggt aaatggacat gttgtccgtg gtgtaatcca     54720
     aaaactttgc gcgcgtgtaa cgctcaatgt catgagaatc aaagtcaccc cagcgaagct     54780
     gcacgtcgac ccagaacttg ttcgaactct tttgatcgaa agaatcgttt gtctcgccca     54840
     tgagcgacgg cttgcaaatc gaccacttgt acgcggcgaa gagcaaaatg tcggcgcaag     54900
     agctgttcat cttgtacgac tttctcgggt gaatcgtttc cttttgaacc gtttcaatct     54960
     ctagcgcgtc gagttcttgg tcgaaaacgt tgcacatatc catgacgacg gactcgtgga     55020
     tcttttgcca caagtgcgct cggaagattt gaatcaacga aatcttcagc gtaggaattt     55080
     taccgtgcat gaagatgcct gtcaagtcaa gttggacttg gaatccgacg tagacattag     55140
     cgcggttgat cgtaggcgac caccagagcg tgaatcgacg attcggaatt tggtttaagc     55200
     cactgcgctg cgcgttcgtc aatttcttgt actgcatcga ttgctcgaat ccacttgctt     55260
     tctcccagaa caaaccttcc caagtgggaa agtacgttcc cttgaagagc gtgtgctcga     55320
     ggataccctc gacgccaccg agcgcctgaa tgacgtcggt gcggtagttg ttcaagttcc     55380
     agagtttgcc gtcgtgtcgc tgatgcgtcc accagaacgg attttgtctg gtgagattgt     55440
     actctttgaa agtcaatcgc acgcgccaac ccttatcgta cgcgagcgtg tgtcgatcct     55500
     tttggaacaa ggtgttgatg cgcggaatac cgcgatccca cgagtcttcc aagtcctcca     55560
     atgtgagacg acgattctgc gcctgcgctt cttgacgctt caacgcgtac tcagcccaca     55620
     cgcgttggga atcgttaaat tcagcctccc aaggttggat gtagcggaac aggttcggaa     55680
     tgagttgatc ttcttcgtgc gtcattcccg agcggaagtg cgtgatgcca gagtcggtct     55740
     gcacgctgta ccgcaagtcg ctctggggga tgagaatgtg acccatcgag agcataccca     55800
     aaccaccgat ttctttcggt gcggcgaaca cgcacggcgg gaaacggctc ggcatcttcg     55860
     aattcaaacc aattttcacg cgagtctgaa tcttattctc acacttcacc aacaaatcaa     55920
     gcaactccga ggtgtgaatt gttgcctctc ggtagtacgt catcaagccg atgagtgccg     55980
     tgttccactt gttgacaatc ttggaaaacg tcgtcgcacc ggatgacatg agcacttgcc     56040
     ggatacggtt ttcgaatgac ttaagcgctt catcatcgac acgcaagaat gcctgcgccg     56100
     ttcgctcctt ggtttgctcg ttgtgcaagt tccagacgcc gtccttgttg gcaaagtact     56160
     cagtcgccat gcgaatcttt ggcaaaatac gcacttcaaa gccgctcatg gcaaagagca     56220
     agttggggtt gtcgcgagag tacacgctga cgaaaccatt atcccattcc aacgtcgtta     56280
     acgagcgcgg aagacggttt ttgatatccc agaatactgc gcgacccaag ttgacgtcgt     56340
     gcttcatcaa gcgcatgcgc gcatcgcgag gccagcactt cttgttgttg taaccaacca     56400
     tgttttcgtt gtttggatcg ggatgctcgg tgagataacg ctgaatcaag tcttttgact     56460
     catcagcggt gaatctgaac agaacgtgca ctcgatcgat gtaacgagag tacaaacgaa     56520
     tcgggtgtcg cgtctctgtc tccacgtctc gatatgaaat gaattcattc ggcatgttcg     56580
     ccggaccagc aatctctgag gcgcgagtta agccgagcag caacaaatct aaaactaaac     56640
     cgtagtactg cgtcatgaac gatgcgaatt gcaagccacg gatcataccg tagctgttcg     56700
     tgtgactcat gtccttgtat gaaatcacca cgttgttctt tgccgtgcaa taatcagcga     56760
     tgttgtgatc gacaatcaaa cgcatcaaac ggttgagcag ggtgaggtca accttttcaa     56820
     acattttctc gaagcgcgtt tgcaacatta ccacacattc gccctcgttc gtgtcccaaa     56880
     catccgtcaa gttgttgatg ccttggcacc acttgtacac caagagcggc gccggctcgg     56940
     tgtctgaagg cttgatccag ttggggaaca gttggcgttt gtccgcttcg taccagatgt     57000
     actgatcgag atacgcgtca gaaatctttt ccaaaggttc gatttcgtac accggtatca     57060
     agtgagagta caaatccatg aactcgatgt tcacctcctt gaacgcgcgt tgagttagca     57120
     agtgacgctt gattcggctg agcgcctcgt gcgggttgtc gaaggcttgc tcaattaagc     57180
     cgagctcttc acgctgattt tgattcaagc gagcgttcac tgagtagttc tctttcaaac     57240
     gctcgagcgc caagatgagc agcttgcgat cgtgcttgta cgacaacggc gggaaaggaa     57300
     tcggcgagaa tctgcgagat tcaagccagt gcaccgtggt ggtgtaaatg gcgactgctt     57360
     cttctggagt gacgtaagga ccgtctttca ggtagttgtg ctgtcgctct tgttccgctt     57420
     tcaagtataa acgcgtcaaa cggccgagat tcttgcggca caccgtcttg tccactgtcg     57480
     cgccgcggcg aatgcgctcg cggttgtagt gcgcgacgtt ggtccaccaa tcagctttgc     57540
     tcttgacgta tctcaagatc atgttttcta taggtgtcgg catgcccgga accttccacg     57600
     ggatgttcgc cttgaagcat ctccacgcct ctgaaagatg cgcgagaatc gtgcgagctt     57660
     tgttttgctt gacgccctct ggcatggaat ctaagatgtc gtgcatcacg gctgcgcgta     57720
     attcaagatc aaagtgcgac tcgatgcgtt gcttcgtcac agtcttggcg atgcccttgt     57780
     tgttacgacc ttcaaattga cgcgcgagca agttgccgag ccatcgttcg agtaaaggca     57840
     caatgccgcg caagaagaag agccacacgc gccacatggg ggcccagaag cccacgcccg     57900
     gccctttacc caccggaccc gtattgaaac gatagtaaat caggtgcttg agatccttgc     57960
     acattctaat ctgacgcatg agcttgtatt tgtatctgta catcccagtc aattgaccga     58020
     cgtgcgagaa cacgtattgc aatccatcgg cgagttgata cgcgtcgatg ttaccgagac     58080
     ggaactgcac gttggaatcc accacgagct tggtgagacg caagacttcg cggcagaggt     58140
     ggaacgcgtt cccaaatcga ctcttcttac gctcctttgt cgtcagcgtt ttcacgggct     58200
     tcaagttgaa gttgtagtcc aagtgcaagt agttcaagtt ctttcgatga atcaagagat     58260
     tgagcatgtt gtaaccttgc ctacacactt gcaaaccgac ttcgacccag tcgagctcgg     58320
     tgcactggaa gaatttcgtc ttcttcagcg cgacgaacaa gtttcggcgc ttcatcggct     58380
     tcggcgggcg cttatgcaat tggttcaaca cgaaaccttt caacagcttt tgatacgaca     58440
     cgcgaacctt gaccgggtag cccgacgggc agtgctcgtg aaaccagttg ttcaccaagg     58500
     gcacgtccat cgcgcgacgc gtcttcccgc tcctcaggtt gaacggtcga ggtgcataga     58560
     gaagtgcgat cccacccgca gtgttgtccg tgtaaagcgg ggtgtcttct aaaaacggct     58620
     cgataccatc cggcaactga aagtcgtcct cgccgtcgtc ttcttctcgc ggcgtcgtct     58680
     tctgcttgtt tgacctataa aacgcaatcg gatgaatcaa tgggtcgtag taatacgccg     58740
     gtaaatcggg atcttccgtc ttgatgaaca tcaccatggg cgtgtgatac accgcgagcg     58800
     acactttgcg cggccggttg ttgtacaagt acggaaacgc caccttgtac tcggtgcgca     58860
     gcgcgctgcg aatgatgagc ttgttgatgt cgttgaactc attccaatcc tcgtccgcgc     58920
     gatccatgtc tcgaaataac ggctcaaact ttggtccacc cgggatgcac atgcccaaag     58980
     ccttggcggt gaagaaagat ttgtgatcaa agaggtaaaa gtaattttta tccgtcaagt     59040
     cgctcaggag ctgcgacgac agtctgtgca ggttcgccat caccggtagc ggcaactgcc     59100
     acttgcggta actcggtccg ttgacgaatt tcgtccactt cagcgggtta tgatcgtaga     59160
     accactccgc caccgcgccg tcttcctctt cgtctaactc cagcgcgatc gcctccagcg     59220
     ggtccacgtc gagcaagttg tcggcgtaat ccaacggcgg ttcttcgtcg tcaaacggtg     59280
     gaaaccgcat gcgcttaaaa tgtttcctat ccctcttctc ccgtcgcatc atgatccaca     59340
     tcgtccccca ctgcgcgatg aacaccggct cgatcaccct cggcgtctcg ttcacaaacg     59400
     taatcgcccc cgtgatgtgg taaatcacct cgcagtgccg cacctgttcc cacggcatcg     59460
     gcatgttctc caacagttta tacaccgcgt gcggcacgaa tttcaacgct cccaagtaca     59520
     ccctcttatc gtgtcgaaac tttcggctcg acatgtcgcc gtgatccttg ataatcttcc     59580
     gcacgtgctc cggcggcatc tcctccttcg gcggttcctg gtacccaaac ttgcgccgcg     59640
     cgccgtaccg cttcgcgttc agcgctcgcc acttccgcgc cttctccatc acttcctccg     59700
     acacaccgac gtccatatca tcccgcgccg tcgtttcctc gtccatcgtc tccgcgtcgt     59760
     cgtcgcgtcg tcccgcgcgc gtcgtcgtcg tcgcgatcgt cccgccgccg ccctcgccgg     59820
     tcgtcgtctc gcgcgtcgcg tctcgcgcgc gtcgcgcgcg cgcgtccggt cgacggttcg     59880
     cgtctcacgc gcgtcgcgcg cgcgtcgctc gcgtcgcgtc gtcccgcgcg cgcgcgtcga     59940
     cgaccgcgcg tcgcggattg cggcgcggga cgggacggaa tgcgacgtgg cgcccgacaa     60000
     agtggtgcct cactgaatgc ccatacgaag catcgatgca ctcgtcgacg cgacgacgac     60060
     gacgcgcgag acgacatggg cgatctcgag ggacgaaaag aacgcgaacg acgcgcggga     60120
     cgtcgcgggc gggcgcgggg ggggtcggcg cgcgcggttc gggtcgtcgc ggcgtggagc     60180
     ctcgtcgcgg cggcgcgcgc ggcgacgacg acgacgacga cgacgacgac gacgacgacg     60240
     acgtgtcgag aatgcctggc ggagggcggc gaacgggtgg ggagagtttg gtgcgcgagc     60300
     acgcagacgt gcgagtcgtt ggagttcgcg ggagggtgcg acgcggcggc gcgagacgcg     60360
     agcgcgtgcg cgacgacgcg agaacgactg gcgcgcgccg cggcgctggg agtgccgaag     60420
     attcgggttt tatacgacgc gtacgggaga atgagacgaa ttttggacga tgcgctggcg     60480
     ttcatggcgc ggcgacgcga ggcgaggcgc gcgaagaggg acgagatgcg ttagggcgtc     60540
     ttcgcgtcgc gtcggaactc tcggcgacga cgtcgcgatt ccttgtacgc ggcggcgcaa     60600
     gtacagattg tgtgtatatt caaagtacgt gtacgggtga gtaactaaga tgcttaatgc     60660
     cgcgggccga tcgtgttcgc gtcaactgaa ggtgagctga cttcgagacg aattttatga     60720
     gagcgcgcgc gcgccaggtg gaatcgtcaa cgggtggccg gtcgcatcgc tcactttctt     60780
     tccggaacag tgcacggctt aatgccccaa atctccttcg cgtactggtc gatggtacga     60840
     tcggagttga acttaccgct gaacgcggtg gagatgatgg aggactcggt ccagcccatg     60900
     gaatcggcgt acgccacgtc gacgcgctct tgcgcttcga ggtaagacgc gaaatcctta     60960
     ccgacgagga agtagtcacc gcgaccgaag ccctcgttgc cttcgagaga gcccaacaac     61020
     tcctcgaact tgtcgccgaa gacgccagat cgaacgtatt ccaacgtttc cgtgaagcgc     61080
     gcatccggaa caaacttacc cgcggcgcgc tcggctctcg ccggttcgac ttcgggatcg     61140
     gtgataccga acaagaagaa gttgtcgtcg ccgacgcact cacgaatttc gacgttagca     61200
     ccatcgagag taccgatgat caagcaacca ttcatttgga acttcatgtt ggaagtacca     61260
     gacgcctcgg taccggcggt ggagatgtgc tgagacaact cggacgccgg gatcaaggtt     61320
     tcagccaaag aaacgttgta atccggaacg aagacgacct tgagcagatc accgatctcc     61380
     ggatcgttgt tcacgacgct accgacgttg ttgatgagac gaacgatgcg cttggcttgc     61440
     gtgtaggtcg cgtacgcctt gccgccaaag atgcacacgc gcggcacgca cttggcgcgc     61500
     tcctccggag tcatcgcctt catctgcttg tatcggtaaa taatgcctaa gatgttcaag     61560
     aactgacgct tgtactcgtg gatgcgcttg acttggatgt caaacatgga atcgatggga     61620
     acgtcgatgt ccgtaacctt cttgatgtag tccttgcaaa ttttcttgcg agccaacttc     61680
     gccgctttcc attcggcttg gagctccggg ttagtggcgt gttcggccag cttgcggagc     61740
     tcgtcggtat ccgtgaccca cttgtcgtta cccacccatt tggtgatcac cgcagagagt     61800
     tgcgggttgc agaacgccaa ccaacggcgc ggcgtgacgc cgttcgtctt gttttggaac     61860
     ttctccggga agagcttgta aaagtcgttg aaggtgaaat ccttgacgat ttcagagtga     61920
     atggcggcga cgccgttgat ggccatgcca gagatgcagc ataagttggc catgcgaacc     61980
     atcgcgggct tttcttcttc cgactccttc ttcttcttgt catccttctt cttgtcatcc     62040
     ttcttggccg ccttggccgc cttggccttg gccgcctttt cttccggaga cacgtagttt     62100
     tcgaggatgc tcatcacgcc gatggagcgc tcgagctcgg ccgccggcat gtcggcgtac     62160
     ttggctcgaa cagacgcgat gaattcttcg tcgatgcgct tgatgatttc catgtggcgc     62220
     gggaggagct cctcgaccaa atcgagcggc cacttttcga gcgcctccgg catgacggtg     62280
     tggttcgtgt acgccacggt cttcttcgtg acggcccacg cgtcgtccca gctcaagcct     62340
     tcgtcatcca tcaagatgcg catgagttcc ggcgcggcaa gcgtcgggtg cgtgtcgttc     62400
     atttgaatcg caaccttttc gtggagcttg ctccagtcag agttgccacg ctccttccag     62460
     cgcgccaaaa tgtcttgcac ggacgcggag cagagcatgt attgttggct caagcgcaac     62520
     gccttacctt cgcgcgtgcc atcacccggg taaagcacgg cgcacaacat ggatgccaag     62580
     ttcgtcggcc ccatggaggt ttcgtagtcg ctcgcgttga acgcggccaa atcgaattcc     62640
     acggcggacg gttgagcgtc ccacatgcga agagagatgc agttgcgcgt cttgtaaccc     62700
     ggaatcgggg aatcgtacgc gaccgcgcgc acttgcttgc ccggcgccca cttgccgttg     62760
     acaaccttac cgtagaaaga aatcgggtag ctcacttgcg ggcgagcgac ttcccacggg     62820
     ttgccgactt cgagccagtc atcagcgtac tcgagctgct ccccggtcgc cttgtcgaca     62880
     ccttgcttga acaaaccgta cttgtaacgc aaaccgtagc cccaagccgg aaggtcgagg     62940
     gtggcgatgg agtccaaaaa acacgacgcc aagcgaccca aaccgccgtt gccgagaccg     63000
     gcattgcgtt cgacgctcat gacgtcttcc aacgtgtaac cgagcgagcg aagcgcctca     63060
     gagtactcgc cggtgagacc catgttaccg atggcgttcg tcaacgcgcg cccttgcaag     63120
     tactccatgg aaaggtagta cgcctgcttc gggttctcct tgtggaagtg cgcgtacgtg     63180
     tcgttccatc gctccaccaa cccttcgcga acgctttgag cggtggcttg gtacatttcc     63240
     ggcacgccaa actcaatcgg aagcgcgctc gtggacttcg ccgcgtggta ctgcacgttc     63300
     tccttgaccg actcggacgt cttaccgacg tcggcggcga cggcgcgaat cgtcggcttg     63360
     ttcgccgaag ctattagagc gttcaaaatc aacagtctcg tcagtctcgc gttcgtcgcg     63420
     ttcgaaaccc aaacctccgc gtcggcggcc gccgccagat cgtcgatcgc ccgccgtcca     63480
     cgccgtcgcg tcgcgtccct cgagcgccga gcctcgccca acgccgtcgc gccgtcccgc     63540
     cgtcgcctcc gccgtcgcgt ccgtcgcgct cgcgtcgtcc tcgtcgctcg atcgtcaaaa     63600
     agatgtccgc ctcgaccgcc aggccatgcg gacggttgcc catcggacga tgacgacggc     63660
     gacgtcgcgt cgtcgcgcgg tcgcgcgcac cgttcgttcg cgcgcatcgc gcgttcgcgc     63720
     gtcgcgccgt cgctcccgcg ggcgctcgcg cgcgcatcgt caccacgcgc gtcgtgcgcg     63780
     cggacatggt cgatcggtcg gcgcgttctg cgggcgcgcg gcggcgtcgc gcgcaacgag     63840
     tggcgcgcgc tcgcgcgtcg ctcgatgggg ttcgacgtgt gcggaatacg acgtttgtga     63900
     aatgtttggt tttttatgcg caacgcgata tttttgaaac gcgacgccgc ggcggcggcg     63960
     gcggaggcga cgatcacttg accacggcct cgaaagcgtc gcccgcgatc gcgtcgtcgt     64020
     cggaggagac gttgatgact tcgtaacgcc agacgacggc gggaccgtag gcggcgaaga     64080
     cgtggcggca gtgatcgacg acggcggcgg cgtgcacgac gccaacgacg cggaggggct     64140
     ggagttcgac gatgttttcg cctgtgcggg cgtcgtagac gtagacgacg ccagaatccg     64200
     tgccgtcacc gcacgcgagg aacttgccgt cgctggagac gccgaatcgg cacgcgggac     64260
     cggtgtactt gtggtcgcga tacttttcgt tcggcagcgt ccaactggcg atggattcgt     64320
     ttcgcttcaa atcgcacgtc tcgattcgcc cgtctcgcgt tttggcgaac aacacgtcgt     64380
     cgacgatgcg cacgcattcc acggcgaaac gcggcttgaa cgtggccagc ggtaacgcct     64440
     tggacttttg cgagacggcg cccgagagat tccaccttcg cgcgacgccg tcggcgtgac     64500
     cggtgacggc gaacgcgccg ttcgcgtcgc acgccaccga acgcgcgttc gtaccgacgt     64560
     caaacgtccc tacgcactct ccctcgccgt cgggcccacc gaaaacgtcc caagccttta     64620
     aaaatccatc ctcgcccacg gagacgacga atccgtctcg cgcgcacgcg ccgtccgcgt     64680
     cgacgacgcg cgatcctgga tgcgcgttca atcgccccac cacgcgattt tccgccacgc     64740
     taatcacact tatccaccca tgttcatctc ccgcggtcac gatcgcgtcc ccgaactcgt     64800
     gccccccccc cctcgtcgtc gccgtctcgt tttccttctc gtcgtcctcg ccccgcgcga     64860
     agcacacgca cgtaatctcc ccccccgtct gatgcgccgt cgtctcgtgc gcgtactgcg     64920
     ccacgatcgc cgtgtgatcg ccgaagtgcg cgtcatcgta caccgtcacc gcgctcccgc     64980
     cgcacgtcgc gtacagattc gacgtcctcg cgcttccgcg cgcgaactcc acgcgcgtcg     65040
     tccgcgccgc gccgtggttt tcgcgaatca ccgtcttgag tcgcagcgcc cggagcgcgt     65100
     ctcgcttcgc ggcgtcgcgc gcggcctcgg tgaggtcgtc gccctcgagc gccgcgcgcc     65160
     gcttcttcag cgagtgcatc gcgggcgtcg cgcgtcgccg tgcgcggcgt cgcgacagct     65220
     cggcgatttg aatcgatcgg cggggcgaag acccggtcgg tgccgtcgag tcatgactcg     65280
     tgacgtatgc gtaaacagtg cggtgtatga aaagggaccg aatcgcgcgg cgcgccgcgc     65340
     cgttcgacgg ccgacgcgcc ggcgcgcgac tcggagacgc gcgcgcgaag ggccgtcgcg     65400
     cgtgaatccc gatcgcgcgc gggcgtcgtc gagacgcgac gccgggcgtc gcgagacgaa     65460
     cgcggcgacg ctcggaaaag gattcgcgaa ggcggcgatc ggcatgggcg acggcggcgg     65520
     cgacgacgac gacgcgcggg gacggaagcg cgcgcgaaag tcgcgatggg acacgacgga     65580
     gagcgatggt ggcgcggacg cggcgaacgc gagcgcgagg ttcgggacgg ggagcggggt     65640
     ggtgctgccg gacgcggcgg cgattcacgc gcacctggcg tccaagggcg tggtgacggc     65700
     gaacgcgttt cgagcgctgg agacggatga tccggagacg gcgcggaggt acgcgaaata     65760
     tcaagacgtg cagcaaaggc tgacgatgcg ggatttcgtg gatgaacggc cggagagcga     65820
     tcggagtccg tcgccgccgc cgaagtataa ccggttcggc gtcaaggtga acacgcgcga     65880
     ggcgcggatg aaggataagt tgtatcgcga gcgcgacgag ctcatcgagt ggttgatggc     65940
     gaacacgaaa cccgggcagt ttcaaccgcc gcacgattgg cggccgagga aaaaggagag     66000
     aaagttgtac gtgccagagg acgagtatcc ggggtataac tttatcgggc tgattttggg     66060
     gccgcgcggg aacacgcaaa agcgcatgga acgagagacg aacacgcgca tcatgttgcg     66120
     agggaaagga agcgttaaac cgggcgcgca tcgcgaccat aagacggatt ataaagagga     66180
     tgaacccctg cacgtggtga ttttaggcga gacgtgggaa ggcgtggacg ccgcggcgga     66240
     gatggtcgga cacatcttgc gtccgatcga cgaagaggca aacgtgcaca agcgcatgca     66300
     gcttcgagaa ttggcttcga tcaacggtac tttcgttgag acgttcgggg catgcagatt     66360
     ctgcggcgtg caagggcacg tgcaagcgaa ctgccccgag tacgaaaaag ccgtttccga     66420
     gggctatcgc gcgcccgtgg agctcgtgac gtgtaagata tgcggtaacg gcgggcaccc     66480
     gacgcgagat tgcccgctcg ccggaaatac cgaggccgtg ggcgcggcga agcaggaaat     66540
     gaatgaggag tactccgcat ttttgaatga aattggcgtg agcaaggacg accttcgcca     66600
     aggcggcggc gccgcgggcg ctccaccgat gcaacaccag ggcgttggcg caccgcaacg     66660
     tggaaactac aacgcgcgac cgggtgattg gacgtgtgaa ccgtgtggat actcaaacta     66720
     cgcatcgaga cagttttgca aacggtgcaa cgagacgcga ccaggcgtcg gcggaggcgg     66780
     agcgccgccg ctgcacgggg gcgggcatca cggtcaacaa aactacggcg gcgcgccgcc     66840
     gcaattcgga ggtgggtatc aacaacaagc accgccgccg cgccgcgcgc cgccgccccc     66900
     gcctccgatc ccggccggca tgcaggtgca aggtggatac gtggtgcccg cggatgtgcc     66960
     gcctccgcct ccggaggacg gctccgcggg catgcctccg cctccgccac ccgaggatgg     67020
     ctccgcgggc gtaccaccgc ccgcgatggt gatgcaagtg ccgccaccgc cggtgcaaaa     67080
     cgtcgcggcg gtaccggcac ctcgagcggt cgccgttccg cggccgcacg ccccgatcga     67140
     agaaccagag gagggcgaag tcggcgaggt gcctccgccg ccgccatgaa caacctttag     67200
     tttcgcctag ttaagtttgt cattggattg tttagcgtca tgcttgttac atcacccgtt     67260
     ctcacacgtc tatgagctac atctaaagtg cctaggccta tctatctatc ttatctccct     67320
     cgccgcatct cggcgtattc gtcttcgctc gcgcgaagca gcgttagcat tctcttcgcg     67380
     ttttcgccgc cgtcgttgtt gacgtgcggg aaaatgaact ttgggttcat gaagcgcaca     67440
     aactcgcgta actcgttcag gctcgagtgt tcggagtacg gcaaaccgta ttgaatcagc     67500
     ctcccgcgct gccttcgcga cgttgctctc gccgttttct tctgcgcgct aaacgtccaa     67560
     cccgtcggac gaaacgcgat aacggtgtcg aatcgacttt tataatactt caaaatggac     67620
     gccatcttca tgaaactcgt cgagcccatc ggaacgacgt gcaagtttgt tttcgagtcg     67680
     tcgtgcgtca tggcgcttct ctcctcggga tcgagcgcta tggcgtccat gacgcttcgc     67740
     ttcgcctttc cgatgtacac cttgcgattc aacacctttg cagcttctaa aaacactttc     67800
     tcttttccga tcgtgtacgt cccgaacaag aacaacttgc gcgtcgagag caagtcctcg     67860
     tgcaccacgg cgtcgcgaac ggctttcaac acgcgctctt gcgtcggaaa atcgtcgtgt     67920
     tcgagcgaac aatacgtcgt gtcgaggatc aatatcggcc tcggcgccga aggatcgctc     67980
     gtgatccgca aaagcgtcgg atcgttccgc atgccgtcgt gaaatctaaa atctcccgtg     68040
     tgcaacaccg gcgacgcgtc gcgccgatgc ggaaactcga aacaaatcat cgccgctccc     68100
     gggcaatgat tcgcgcgcaa gaacgtcacg tccacgccat ccacgcgcac gacgacgccg     68160
     aactcaacca cgcgcaaccg ttcgcgcggc accccgatct tcgttcgcac caactccgtc     68220
     gtcgtccgcg ttccgtacac gacgccgcga tcgaacgttc gcgtcaaccc gcggtgatga     68280
     tccgcgtgaa agtgcgtcag aaaccagtgt tcgcaccgcg cttcgctcga cgccgcgtac     68340
     tcgaacccat cgacgatgaa catcgttccc ggcggccgta tccacgccgg cggtttcgcc     68400
     ttcgccttcg ccttcgccgg cggtttcggt ttcggtttcg gtttcggttt cgccttcgtc     68460
     gtcgtcgtcg tcgtcgtcgt cgtcgtcgtc gtcgcgcccg tctcgcgcgc cgtccccgac     68520
     gcgaacaccg gcgcgacgcg cgtcgcctcg tctcgcgcct ccgatcgcgc ctcgcgcgcg     68580
     atccgaaccc gcgcgccgag cgtcttcccc caaccgatcg cgcccagcgt cgtcgtcgcg     68640
     tccttcgcgc gcagcgcgtc catcgtcgct cgcgcgtcgc gcagtcgccc tcgaacgagc     68700
     tcggtcgcgc cgcgcgcgcg cgcgaacgcg acgcaccgcg cgacgtcgtc gtccatcacg     68760
     gcgcgcgcgt cgacgcgatc atcgacgatt cggcgtcgcg gagtgccaca cgccgacgcg     68820
     ccgtttgaaa gcgcccgcgc gcgctcggcc cgccgcgcga cgcgaaaaaa cggtcgacga     68880
     accgacgcga tcgagcgcga gggcatgacg ccgcgccgcg acgacgcggc gtcgccgaag     68940
     cgcgcgaaac gcgcggtgga gtgggacgag gcgaacctgg cgaaaaactt tgccgagcgg     69000
     agcgcgacga tgaagatcga ggagatcgag acgccgtggc acagcccgcc gagggaactg     69060
     tttcatgacc tgcgcgcgga ggacgagggg gaggtggcgc ggcgggagcg ggcgcacgag     69120
     gaggtgatgc ggcgactcga ggcgttgatt cgagcggacg cgcgaggcga gacgtcgacg     69180
     ccgccgacga cgaaggatgc ggacgcgacg atgggggacg agggaagcga ggatgggacg     69240
     tcgagggtgg cgtttcacga tccggacgcg agggacgagg atttcgagga cgacgcggag     69300
     gaggtggtga agaagagact gttcgacgcg aagcgaaagg cgtttcagtg caagggacgg     69360
     gcgacggcga ggtttctcgc ggacgaggcg ggcgattgat cgcgcggggc gcgagcgttg     69420
     taatgatgaa aattttactg ctagtaattc ttaggcggag gcgcgcgcgg cgaggtcgac     69480
     gagatcggcg tcgtcgccgg cgctgacgac gacgcccgag ccgaagtcgg atttgacaac     69540
     cttgtcaacg acgtcgaata agtgcgcggt cgcgctgtcg gcttgactcg tgagtaatac     69600
     cgtacgctta gggagcgcgc ggaggaggga tgtgactcgc gcgatgccct cggcgtcgag     69660
     gtgctggaga acttcgtcga ggacgagggc gtcgcacgcg acgccgcatc gctccgaggc     69720
     gagatcggcg tacgccaaag cgagcgccaa agcggcgcgt cggcgttctc cgccagataa     69780
     ttgtcgaagc gaacgggcga tcaaactgcc gtcggggcga cgggcgtgga tcacgcgctc     69840
     gatgcgttcg gcggcgctcg cgctcgcggg cgccttggcc gatttgctct tcgtctttct     69900
     cgtcgccgtc tcgtccgcgt cgacgtcgct ctgcacgacg tcgttatcgt ccccggtgaa     69960
     cgccgctccc gcgggacgaa gctcgagcgt caaggcaccg ccggtgaggg cgtccatgta     70020
     ttgacccacg cgcgcgctca aatctccgag cgcgccttca aacagataac tctgaatgcc     70080
     cttcgtgcta aacgctgtgt ctgcggcttg agcgacgcca aggagctctt ttgcgccatt     70140
     caaggattcg attctcgcgc cgagagattc gctttcaccc gcgagttgcg cgtcgagctc     70200
     ttcgagcgcg ctcgtgtgtg gatttgaacg cgccgaacgc gagaactcat tcagctcttg     70260
     caagcgtcgt gccgcgtcac gcccggcgcg ttcgccatcc atgatggcgt cttctgcacc     70320
     tttgaccaac tgtcgaacga aatccgcgtc ggcgacgttc atttgttcgt cgcgaaggag     70380
     ctggatttgc ggagaggcgt tcgacaaaga cgcagacgac atcgatcctc gcgtcaagtc     70440
     gggatcgagg cccgcaagca cgttcgagga cgcgccggat atactgatcg tcgactcgct     70500
     catcgcaaat gcatcatcga ttgacattgt cagcgcttcg tggacgacgt cctcgggcgc     70560
     tgagtttaac aacatttccg ccctcgccac cgcattgccg atgaggctca acgacctctg     70620
     agaatgtcgc aactgatctg tcgcgtttgc ggaagctgtc gcggtggttt ccgcgcgcat     70680
     gcgttcggct ttgcgtgcaa gcgcggctgc ttcggtgaga ttgcgtctat catccattgc     70740
     cttgttcaga gccgccgtgg cgcgcttgag ttgctcgatg gcgttcccgt gctcaatcgc     70800
     cgtctttcgc gcttcatcct tcaattttat gagcgtttct ttgtgatgcg tcgggtcgat     70860
     ggcttgtaag caacgatcgc acgtaccgac accatctgga tgcgagtgtg tgcctccagc     70920
     gcccgcgaac ataccgactg cggcgtgact ttgacgtccg atggcgcccg cgctcgcctc     70980
     cttggattgc cactcgcgta cgacaccgtt aagtcgttcg atttcgcctt cgatgacgga     71040
     cgttttgtgc tcgaactcgg attctttcac ttcaaagcga cgtgccgcat catcagagtc     71100
     atttcgtgac gagtctagca cgcgttcggc gtgactcgac gtcacttcaa gtgcctcgct     71160
     cgcgcgactc aatcgttgga ggaaatgatt tgtcctcgct aaatacttcg tgaaggttgt     71220
     tgaaaccgcg ctcgagctcg tctcaagctc gctcacgcgg cgcctgtact cgaattccca     71280
     cttctcactc tccacgtgcg cttgatcgcg tcgaaggcgc gttcgagcga tgtactcttc     71340
     ccgcgccttg acttcggcgg cgatggcgtt gacgtttcct ctcgcctcgg taactcgctt     71400
     gcgagaaatg tccttcgcct tcgtccacgt gtccgcctcg acgagtttac ccagcgccgc     71460
     tttcaacgaa gcgtcgttcg cgtcgagcaa agctcctaca gtgtgctgac cgtgaaacgt     71520
     cgtgttcgcg atgacgtcgg cgccgagatc atcgttcaag ccttgctgcg tcagttttga     71580
     ctcagccatc gtcttttctt cgccatcaat ggcgtacttt aagctcacta atttcgttct     71640
     gttcacttta cgttccaccc aaaacggcgt gccaccgttc aagaaccctt ctaagcgaac     71700
     gcggccgaat ttcgacgaat cgttgacgac gtccgacttt gtgagcgact tgcccgatcc     71760
     cgcgccgtcg attcgcaaat cactctgtcc cgtaagcgcc cacatcgggg acatcactaa     71820
     cgtcgtcttc cccgcaccat tagaatccga acacgtgtcg gatttgttct ctcccacgac     71880
     cacgcacact cctctggcgc cgagcgggta acgcgtcgcc gactgaaacg ttccaaatcc     71940
     ctctacttcc accgtctcaa aagaaacgct cacacctttc gattgtcggc gcgtttcggg     72000
     cgcatcatca gacgcggcga cttcttgtaa aactttgcgc ccgaaagcgc tgacgctcgg     72060
     tgccatctcg ctggcgacgg cgtatgcatc gaacagtccc gcgggcccga gctcctccgc     72120
     ctttggtatg cgcgccgtga gatccttggt gacgtagcac acctctacga tgaacccctg     72180
     gtcccgagct ttctgcacca ctgacggtac ggcgtcggaa accgcatcca tggcttcgat     72240
     cggaagcgtc cagcggatga tgtctcccgg acgcgccgtc ggcggcgcgc tcgcatcgac     72300
     gccctcgacg gcgaaatgtt tcggcccgat gtccaaactc acgcgcgcat tcgcgccttc     72360
     gacccacgtc tgcgagtcaa gaacgatgaa ctctttcttt tgtccagctt cagaccgcga     72420
     gacttcgtat ggcgacccga cgtacgtaat gtttgtgttc ggaacgacgt gcggtttgtg     72480
     atagtgtccc gtgtacgtgt tcgcgccgcc gaagagcgcg gggtctaatc catctcgcgc     72540
     ttggaacgtc tcgttcatgc tagctccgac gacatcggcg tgacaaaata tcgcgttgaa     72600
     ctcgcctcgc gtgtcctcga tcgcgcgctt gagttcatcc gagtttcggc gatacggcaa     72660
     ccacaacgcg ccgccgtaaa gcgtcggccc gtcaaagacg acgatgttcg gattagcctt     72720
     cgccagcggc gtgagcgcgt gagataaccc tccggcggtg acttgatcgt ggttccccgg     72780
     aatcatgatc gtcggcgccg tccacttcgc gctcgacatc aacgccagcg cctcgttgag     72840
     cggttcgact ggaatcgctc cgcgcgcgtg ccaaaagtct cccaaaaata ccactcccgc     72900
     ctcgcgtttc agcgcctctg cgtgcacgcg ctcgagcacc cgtcgacacg tttccatggt     72960
     gcgtttactg acgtgcaagt cactgaacac gatccatcgc tcgacgctcg agtgcgccgg     73020
     cgacagctcg ctcgcgcgaa tcgtcgcgcc cccaccctcg ccgccgacgt ccgccaccgc     73080
     gcgcgcaggc gccgcccgca cgacgcgcgg atcgatcaca cgcccgcgtc cgcctcgcgc     73140
     gggcgtcgtc aacgcgcgcg cgcgcgccgc acgcgcgatg gcagttttcc cgccagaatg     73200
     attgttagcg atcgatgacg acagtttcct cgcgccctgc gtcgtcgtca tcgatgccgc     73260
     ccacgcgcgc gcgccgagcg tcacgaaacg cgtgtacgta tcactcgacg acgcggtcgt     73320
     ggacgcgagg cgcagcgcgt gcgtcacgcc gcgtcgcatt ctgatgttgt cttgactttt     73380
     aagcgtgcgg acgcgccatc ttgcgccgcg acgcggcgcg gcgcgcgtcg tcgcgaccgc     73440
     gcgcgctgcc atggcgtcga tgcgaccgct agaagcgcgc tcgccggacg tcgatcgcgc     73500
     gaacgcggcg ctggagcggg aaatcgcggc gctgcaaaga cagtccgcga cggcgacgac     73560
     gccgtcgtcg aaagcgacgc cgtcgaacga cgccgtcgtc gagcgatcgc gcgcgagggt     73620
     gcgcgcgctc gaacgcgagc tcgcgctggc gaacgaagag cgcgagcgcg agcgggagat     73680
     gtggatttcg aggtgcgaac ggcaggcgac ggagcttcga gcgctcgcgg cgagcgcgga     73740
     gtcgcgagcg cgaatcgcga gcgaggacgc cgaggcggcg atgctcgagc gagatgagat     73800
     tttgagagaa ttgaaagcgt tgcgcgcgga ggcggcgaga cgggcgatgc aggacgcgga     73860
     gattgagctg gaacgagcgg cgttcgcgaa cgcgaaacgt ttcgcggacg cgcgaacgat     73920
     gagacgcgcg ctcgttcggt ggatcgaagg gtgcgtgttc aacatcgcgg ctcggcatgt     73980
     gattcaaaag atggacgtga gacgaaagcg agatacgctg atggagtggc gcgatgcggc     74040
     ggcgtttgag cgacgcctcc gcgagacgcg tgcgcgcggc gaccttcgtc tcgccgcgcg     74100
     cgtgtttcga cattggagtt tgttcgtgga ggtcagtgga atgtgtgagc gctctcgtct     74160
     cgcgcgcgcg ctagcgcggt ggaaatcata cgacgcgacg gatgagggta cattagatga     74220
     cgtcgagata ccgtcgatgc gagaaaagta tctcgcgcta gtcaatcgcg tccggcggag     74280
     agaaatcatg cgcggcgcct tcaccgcgtg gatagtcgtg ttagcgaacg cgaagagcgc     74340
     gcgcgcactg gcgatggaaa ttctgcgcga tcgtgagcgc ggcgaggtgc ggtcgtcgct     74400
     cgcgaaatta aaggcgcgtc gcgtgggcgc gatagaatag ccgattagtc gcgacggaac     74460
     tgcttgtcgt ttatttaaca taagaattgt tgctctactg cgcagctttc acgtgcggca     74520
     cctcacgcgc gcgagaaacc gccggccgtt tcaatgagac gcttgggtct gttcaacgtg     74580
     cacttcgtgc cgcaggcgga gcacttgtgt tcaaacgtct ccgcgggcga ctcgccgcca     74640
     aagaattgct tgatcggcat ctcgcagcac gggcatgccc cgatcaagat ttcagcgttt     74700
     tgcaggttgg tgtagttgac taacttgtac gtcaagcccg cgcaaagcgt cgccgcgaac     74760
     ccgagcgaaa ggcccgaggg aacgtgcacg ccgaaaaagc cgagcaagat gctcggagac     74820
     aatccgagca acaacgggac cgtggcgagc gcggcgtaca tggtaaagac cccactcgtg     74880
     tcggagatga gttccgtgct cgtctgcgac aacgtgcacg tcgcaccctt catgcccacc     74940
     tcgattccta actttttcat ctccgctccc aagagttcaa actccgcctc gtcgaggagt     75000
     tccttcccct tggtgtagag caacagcgca gtcacgtccg tgcgcttgcc ttccgccttc     75060
     actcgtcgct tcaactcttc gtacttgtcg tcgtccacga ccgattcccc tcgcgagtaa     75120
     gaaatcgccg cttgcacgaa ttcaatctca taccttcgca gcgtcgggaa cccgctccct     75180
     tgccaattca actcctctct caatcgatcg taatcctcgt cgctcagcgt gaacttacca     75240
     ccgttatagt aattccacag cgcgtcgacg tacatgagct cgagatcggc cagcgagcac     75300
     gagctcgggt cgtcgatcga gcacgagacg ccgatgtcgg ggttcacgtt gctcccttcg     75360
     ctcttcatca cgatcttttg cgcccgcgca ccgccttcgc gtccgcctct gcgcatcacc     75420
     accgcgacgc gcgtttcacg catagtcgcg ccgcgtcgca agcgcgtttg acgcgctgaa     75480
     gcgcgcgtca gcgtcggcat cttgctcgac gtcgtcatca tggcgtcgga tctcgtcgcg     75540
     cgacttttcg tcgttcgcgt cgctcgcgcg cgtcgattcg cgcgtcggtt cgcggcgtcg     75600
     aggcgttcgg gcgcgtgcgc gttcgatcgc gcgcgtcgtg cgtgcgcgcg cgcgtcgcgt     75660
     cggcgtgtgc gggacagatc gcgacggccg gataaacaag cccccacgtg cccgtagggt     75720
     ttgggcgcgc gaaggcggac ggcgtgaagc gcgacgagcg cgtcgcgtta caactggaaa     75780
     ctaaacgtga ttgggagcga aacgctcgat ggaacgaatg cggatcatgc gacgacgacg     75840
     acgtcgcgcg agggcgggcg aacgggcgga gacgggggac gagcggcggc gaggaggtca     75900
     cgcgccgccg tcggcgggat cggccggcgg cggcgccggc ggcggcgcgc ccaggacgtt     75960
     tggaaacccc ggaacgcccg gaaatcccgg gaacacggga ggcatggcga tcgcggcgcc     76020
     gagcgcgggc atatgatccg cgtcgccgcc gtcgccgggc tctcgcggga ctatgtcgac     76080
     gagaaagtcg aaaatatctg tcttcgtgat cgccgccgcg acgtcgctgc gttgtaaagt     76140
     ccgccgctta ttctcctgcg cgtgcgccca cgcgcgagtg gtgagctcta gaacgaacat     76200
     ctcgcacgcc ttggcgaaga gcacgggcgc ctcgctcgaa atcatccgca cgtcctcgtc     76260
     gctcttcata atctttttaa tcctcgccag cggtaacaaa tgattcttaa aatcgttcgt     76320
     ctgttgaatc tcgatcatca tttccctcca gaactgtctc aacgccacct gttgcgccgc     76380
     gtacgcggga ttcgccgccg cctgtgccgc gttcatcgcc accgcgtgcg cgatttgcgc     76440
     ttgatgttgc cgcaactgcg cgccgtactg ctcttgaaac tgttccggcg tcagcaccgg     76500
     cgcccccggc ggcggtgcga acggcagcgc cacgccaggg attccatgat acgtcggcac     76560
     gttcgggtgt tcgttcgatc cgggcgcgcc gctcatctgc gtcgtcgttt cgcccgcgtt     76620
     cgcgtcgtcg tcagtctcgc gcctaaccgc cgcggtcgat catcatctcc gcgtccctca     76680
     cgcgcccgtc cgagcgccgc tcgcgccgcc gcttccctca ccgcgcgcgc gcgaaacctt     76740
     acgccttcgc ctttcgcgcg cgcgcgcctc gcgcgcgtcg aatcgcgcgt cgaatcgcgt     76800
     cactctccct cgcgcgcgac gattctcgtt cgaacgcgcg acgaccgcgt tcgtctcgtc     76860
     gcgcgtcgtc gcgcgtcgcg cgcgcgcgac cgcgcgacgc acctcgcgga ccgtcgctcg     76920
     cgcgcgtcgc tcgcgtgcgc gaggcgatcg ttcgcgcgcc cgcgacgcgc gtcgtcgagt     76980
     gcggcgcggc gcggtcgacc gagggcgacg acgcggcgcg cgcgtcgaga cgaacgcgct     77040
     cgcgacgcgc gcgatgcggt ggacgatttt attcgtcgcg atcgcggcgc gcgcgatcgg     77100
     cgcgggcgcg agcgcggacg gacggttcga ggcggcgctc gcgctcgcgc ggcggttggc     77160
     gcgaagcgtc ggcggcggcg acgacgagag gatcgcgccg gtgaacggac gcctgtacga     77220
     cgtgttcggc gtcgtcgcgg tgccgaagtg ctttccgaga tgcgcggcgg cggacgcgcc     77280
     gaggccggag gttcgagaga cgtgggcggc gacgcgcgac gatttgctcg cgtcggcgcc     77340
     gaacgaaatc gaggcggccg tcgaacgatt tttgtcgcgc ttcgagacgg cgaaggaacc     77400
     gacgggcgcg cacggggacg cgctgttggt gaacgacgag cgcgtgcgcg cgttttttgc     77460
     cgacgcggtg gacgttgaga gtgtctagag ggtgcgaatt aaatttctcc gtttcgcgcg     77520
     tccttgggcg cgcgcctcga gcgatttttt ctgccgccgg agcccgacgc gcgcgaggcg     77580
     tgccgctgaa cgcgcgggtg tccaccgccg gcgacgggag cgttcgcgac cgacgacaag     77640
     tcttcggtgg agccgaattc ggcgcctaga ctggatggta aatctcccaa gcgttccgcc     77700
     aggtgcgaga cgtccgccgc cgcgccgtac gtacccgtgg cgtttatgtc aaacggcgcg     77760
     ttcgcgggaa cggtgaccgg cgcttgatac ggatacgatg cggccgcgga cgccgacgcg     77820
     tcggaggcgg ccgacgcggc ttcttgcgtc cacgtcgccg acggcggcgc gctcgcgtag     77880
     ccgtagtatc cgctgtaacc ggcgggatac cccgccgcga acgtcgggaa caatcccgag     77940
     ccgtcggcga acgccattcc atacgccggc acggcgcctt cgaccgacgc gccgtagcct     78000
     ccgccgtact gtgagccgac ccagtcgttg tagtttgccg cgggcggcgg cgcgtttttc     78060
     atccgcgacg ccgccgtttt atccgaatca tttttcgacg atcgcagcac ccggcgctct     78120
     tcgcgctcgc gaacgcgacg cccaccgcgc tttttccgcg ccttatcttc gctctcggtc     78180
     tcgtccattc gctcgtccga ctccgcgtcc tcgaccggcg gcggcggttt cctgcgcaac     78240
     accatcggcg cggtggcgcc gcgcgattgc aaccaatcgc tccccggcgt gtcgaccacg     78300
     cgcgcgtcct tctcgctcac gctctcatcc ggggcgtttc tcgcggcgag caacgccgac     78360
     gatggcaaaa tcttcggcgg cgcgcgagga tcgaatttct cgcgtctcgc cgacgccgtc     78420
     ggcggcgccg ctttcgcccc cccgcgcgtc tcgcgcaccg tttcgccgcg cgatcgcgcc     78480
     ctttccgcca tcacgcgcgc gatttcatcc tcgtacgccg cgcgcgcttc cgcgctcgcg     78540
     tcgtcgtcgt cttcgtcttc gccgtcgtcc gcgcccgcgc cttcgtctcg ccgcggcgtc     78600
     atccccggaa tcgtcccatc gctcccgatc cctccctcgc gcggccgcgc gagcacgcgc     78660
     ggcgcgtacc cctctgctcc tttcctctgc cctcgccgcg ccgtccccgc cgcgcctccg     78720
     agccctcgtc cgcgttcgtc ctccgccggc gacggcccga cgtaccgctc gtcctcatcc     78780
     tcccgcgtcg tccccgcgcg tcgccgcgcg ctcgcgtcgc cgtccacgta ccgtcgcacc     78840
     gcgcccacga cctctcgcgc cacccctcgc gcgtcgtcgt cgtcgtcgtc tcgcgctcgc     78900
     gtcgtccgtc cccacgtcgc gcccgccgcg cgcagcgtct cccgttcgcc gtcgctctcc     78960
     cgcgcctcgc gcgcgtcgtc gccccacgtc cgcgcgctcg cgaacgtcgt cgtcgtcgtc     79020
     gtcgcgctcg cgccggtctc cttgcgcacg ctcggcagcg cgacgggcgc gaacacggcg     79080
     acgcgctgcc gatgatgatt cgtcgtcgtc gcgcgcgcgc ccgcgccgcg cgcgccgcgc     79140
     ccgcgcgcgc ccgcgacgcc ggcgccgcgc ccgcgcgcgc tcgttcgcgc gcgatcgtcg     79200
     cgctcgcgcg acatgacgcg acgaagcgcg cgacgacgac gcgacgacgc gatgtgccgc     79260
     acatcgcgat gcgcgacgac gacgacgacg acgcgtggag cgacgacgac gcgcatcgcg     79320
     cgacgctcga cgacggcgac gacgggtggg gacgcgcggg cgcgcgcgcg tcgacgcgcg     79380
     attcgtggga cgacgacgac gacgacgacg acgaagacga cgggacgacg acgacgacga     79440
     cgcgggacgc ggcgcggtgc tcgagcgagg acgacgacga cgacgacgac gacgaattga     79500
     tggacgacga tgcgttggcg cgaccggcgg tgttcgtgga ggcggagcga cgggcgagcg     79560
     cggaggcgga gcgacgcgcg cgcgaggcgc gcgctcgacg agaagaagca gaagcggaag     79620
     aagaagcaga agcagaagac gacgacgaga tagattcaga cgcgacggac gacgaggaag     79680
     cgttcgattg gcgcgcggtg cgcgcgaacg gggacgggaa cgacgggacg acggcgcgcg     79740
     aggtcgaggc ggacgcggag gcgagcgcgc ggcggtcggc gacgctcccg acgcgaaacc     79800
     tcgcgaagac gcagccgtgg cgcgcgcggt tgccgaattt cacgcccgtg cgcgagcttc     79860
     cgccgcagag ttttcacgac ggcgagctcg tgttcgtgga ttacgaggcc cagttcggcg     79920
     ggccgcggag cgcggcgtcg aaggcgttcg cgaggcgcga ggcgagggcg ttcggcggcg     79980
     tcggcgcgcg agaccgcgcg gcggcgtcga ccgcgccgac cgccgccgtc ccgcgctggt     80040
     tcacggacga gcgcggtcgc aaaaccttcg tcgacgcgcg cgggaaatcg ctcgtgggca     80100
     aagccgcgta cgcggcgtcg caaaggcttc gcgcgtgacg ccgcgagccg agcgttcgac     80160
     cgatcgacgc gcgccgtcgt cgcgcgagcg caaacctccg cgcgcgcgtt ctcgtctcgt     80220
     ctcgtctcgt ctcgtctctc attcattcat tcaatattca cacgcaaaag tattcctact     80280
     aaaaacccgc gcgtcgaccg cgccgcgctc gccccgcgcc ctaacgcgtc tcttcggtct     80340
     ctcggtcgcc cgacgacttc cggccctcac gcgtcgtcca cgcgctcgag cgtgttatac     80400
     ctcagcaatt tctcgatcag atcgacgtga cacatcacca ttcgtcgaca gcagtaccga     80460
     ttcagcccga gcgcgtccag cgcgtcgcgc tcgctgtagt ccgcctgcag caggtcgagg     80520
     tacgtgtccc acttgttccc gatcaccttc ccgcacgtga agcatcgcac gggaatgatc     80580
     atcgcgcgtc gtcgcggcgc gacggacggc gaccgcgcgc gcgacgacgc gtcgcgaagt     80640
     gcgatcgagc gcgaggcggc gcgaatcgtc gacgacgcga ttcgcccgcg cgtcgcctcg     80700
     ccgatgcggg acgagcgcgg gacgacgcgc gggaccgagc ccgcgcgcgt cgcgcgaccg     80760
     gcgacgcgct tgagcgcgcg cgcgcgaccg ctgacgaagg ttttgaggat cgaattgatc     80820
     aagaggctcg atcggtcgac gcgcgcggtc gacgacgcgt tcgcgcggta cgcgcgaaag     80880
     ctcgggcggt tgttcgacgc gccggcgaac gggaagtgag cggaccgcgg ctcgacgacg     80940
     tgcgatggag gcggacgacg cggcggcggc gcgacggcga ggcgacgacg acgaagccgc     81000
     gcggctgtac gcggcgcggc tgggagacgc gcgcgcgtcg tcgacgacgc acgtgcggta     81060
     cgcgctcgcg gcgaaggcgt gcggacgcgc ggcgagcgac gcggcggcgt tcgaggcgac     81120
     gcttcgtcag ggactcgagc gagcgatgcg cgaggcggcg gaggacggcg tcgaagacgt     81180
     cggccgggac gcgcgcgcgc gcgcgatcgg agggcagttg gcgctgagtc tgtgtcaacg     81240
     aggggcgaac gaagacgcga gcgatctgtt ggagtttttg gggtactcgc gaaggctttc     81300
     cgaggaggtg ttgaggtacg cggaggaggg cgcgcgcgag cgagcgccgg aggacgtcgc     81360
     gcgcgtctac gacgacgcgc tggacgcgcg cgcgctgcgg tttctcggcg acgcgttcgc     81420
     gagacgcggc gcgtcgacgt tttggatcga gcacgattac tacgcgccgg agactggatt     81480
     cttttcgtac gtgcacgacg tgccgtcgcg gagagagaat aagatggacg ccgtcgtgga     81540
     catggtcaaa gacgtcgcgt cgcgcgcgtt tccgggcgtg aaacgcgcga ggtacgccga     81600
     gtggtgggcg cactcgcgtc cgcacaccga cgggcaccaa ctccacttcg attcgcacga     81660
     cgaagggctg ggcgaggtga ggcatccgat ttgttccgcc gtcgtcttcg tcgacggatg     81720
     ttgcggcggg ccgacgctcg tgacgaatca aaaggacacg agcgccgagc tcgcgagccg     81780
     cgcgtggctc gtgtacccca aaaccgggag agtcgccgtt tttaacggcg actatcttca     81840
     cggcgtggtt ccgggacgcg tcgcggacga cgggttcgat cccgagttcg cgtcgcgccg     81900
     gcgaatcacg ctcatgattt cgttttggga agacacggac gtgcaccact cttggacgcc     81960
     cgcgggaagc gcgcgaccgt tccctccgcg agacgccccg ggcgtctcgt ggcgttcgcg     82020
     tttcgatttc gccgccgacg acgacttcgc cgccgaagcc gccgtcggcg tggaggtcct     82080
     ccccgtcgtc gtcgagcgcc cgtgggatcg cgtgcgccgc gacgacggcg acgacgacga     82140
     cgacgcgtcc gcgctccccg cctacgacga ctgttttcaa ggcttttgat tcgctcgcgt     82200
     tgtaacaaaa atcaaaccag cgcgcgagcc gccgctcgac gtcacatcgc cccgcgagcg     82260
     tcgacatgcc ggacgacgac ggcgacggcg acgacgacgg cgacgtgata atagtgcgct     82320
     cgaaatattt cgcctccacc gcgtcggcgt ccccgcgcga gcgcaccgac gcgaaaacag     82380
     tcgcgattac cggaacagac gatgactaca aactgtcgac gcgacacgcg acgctgctcg     82440
     acgccgtgga cgcggcgtcg gtcgcgttgg aatccttctt cgcgaccgca aaggtgaaga     82500
     acgcgcacga ggcgcacgag cgcgcggcgc acgaggtgtt gcggcatttc agagggacgc     82560
     tcgggacgct cgggacgccg cgagaagaga cgacggacgc tttcgatgat ccaccggaga     82620
     aacgaacgaa gacggaggac ggagaggcgg ggaaaaagaa aaaggacgaa gagatggacg     82680
     cggaggcgcg cgaggacgcg atcggacggg cgggagatgt gttgcaaaac atgttgcgag     82740
     agacgcatcg tttgcacgtc aacgcgagct gtcgggtgaa cacgcgagcg cccgaggtga     82800
     agcgcgcgcg ggataatttg acgcgcatac gacgagaggc gagggaattg tataagaaga     82860
     ttgatccgcg agggtacgag cgcgatcgcg aacgagtgcg gatgatggct gaggagacgc     82920
     aggcggcgct ggattttaaa attacgcgat tcgagacgcc gccgaaggat ttggccgagc     82980
     ttcgcgcgaa atgcccggta atgtccagca ccggatcacc gcatcacttg tgcgcacact     83040
     tgtgctatta ccgcgagtac gagcccgcgc ggcagatgta cgtgttgcga tgccgcgccg     83100
     ccgaggcaaa cggcaacgcc gcggcgctag acggttggcg cgccgagctc gcggtgcggc     83160
     ccgcggaaga tattcccgcc ttcaatcgct ctcgcgcaga cacgcgcggc acggcgtcgg     83220
     gagcttgctc gctcaaacac ttaccgtgga tggtggagtt cataggcccg ggcggcgagc     83280
     ggttcaagga tggcatggac gtgttgaact ttgtcgccgt cgagtgcgac aagctttcgt     83340
     ggccacgggc cagtcacggt ggtaacggcg ttcgtgaggc aagagtgagc gaagacgggt     83400
     tgaacgacca gaccgagctc ctacgcgcgg cgttgtggga cgaagacacc gacggtacgg     83460
     ccggaacgac gcccgtgcgt cgaagcttca cgcgcatcgc gcgatgcgtc gatgagacgc     83520
     gcacgccgtt gcgtctcgct cccgatccgc tcgcgaacga aaacgacgag aacgatgacg     83580
     gcgagaaaat aaatgagtcc gtcgttcttg cggcggcaaa cgcgttcgac gacgaaacgc     83640
     cggggcaaac gccgacgaaa acgccgctca aagaccaaca aggcggcgac gccgccgcgt     83700
     cgccgcccgg aagcggcccc gaacccgtcc gtcattggtg ggcgccgcca ttatcgccat     83760
     tcggtttact agaagaaatt ctctggcagg acgagtggaa acttctcgtg tcgtgcatga     83820
     tgctcaactg tacgacgcgt ttgcaagtcg atcgcgtgct ttggcgtctc ttcctcctgg     83880
     cgcccacggc ggcggccgcc gtcgagctcg gcgacacgca cgaaggactc gaagccctcg     83940
     agcgcatcat cgccccgctc ggattacacc gcaaacgcac gaatgcgttc gtcaagctct     84000
     cgcgagacgt cgaggcacag cgcgcaaagt acggaggtcg cattaaaaac gtctccgcgt     84060
     gtcacggcgt cggcgtctac gccgccgacg cccacgccct cttcgtcgac ggcgtcctcg     84120
     ccggtccacc gcgcgaccac gcgctgcgtt ggtatcacgc ctgggcgcac gaacgtcgcg     84180
     agaacgcggc gaaaagcgcc ccaaagcgca cttagcaccg ttagtcgata gaaatgtaga     84240
     acgcgcgccg cgcgccgaat gtcggcgcga gcgacgaagc cgaaccactc aacgcgtccc     84300
     aataatccac ctcacacgac gactcgcgcg cgccgcgccc gccgcgcgac gcgccgagcg     84360
     ctcgacgcga agcgaacgca ccgcgcgatc gacagcggta gctctctctc ccgcgcgcga     84420
     ccgcgtcgac gttccgcggc gcgtgaaagt cgcgccaaaa atagttgcgc gcgacacaga     84480
     agacgcgctc gcggcgcgcg ccgacgcgcg ctcggctcga gatcgcgaac agacgctcgt     84540
     gatggacgcc tcgacgcggg cgtacgcgcc gggagacgac gcgatcgcgg cggcgagcgc     84600
     gctgagcgaa cggtttcagt tggactcgag gacgagcggc gggcggggag gattcttctc     84660
     gcgcgtcgcg tcgaacgtga aacgatcgcc gggagggacg tcgagtgggg cgtcgagtcc     84720
     cgcgagctcg cccgcgggtg gatcagggcg agggatgacg atggcggacg cgctatcggt     84780
     ggacggcgcg ctgacgacgt cgctgttacg tttgacgtcg gatcaaacga ataaaagcgt     84840
     caagctgcac gcgctgctcg tggtgctcgt gagcgatacg gatgatgtga ctggggagac     84900
     gttcgcagcg ggggtgcaaa agattgcgaa ggaggtgatc aaacgagagg agttggcgga     84960
     cgagatgtac ttgcagatta ttcgggcgac gcgctcggct gcttcggatc gcgggcgtcg     85020
     aaaggcgtgg gaactcgtgc gcgtgatcgc ggcattgttt gcgccgtcgc gtgatttcat     85080
     tggcttcgtg tcagagtaca taaacgaagt cgccgcgcgt ggttcgagtg acattcagcc     85140
     cctcgcgcgg agcgccttgc aaacgatgaa gcgaacgagc aagagcgcaa tgcgccgtca     85200
     cgaaccaacg gctgaggaaa tcatcgcgtt tgcgcgtggt gaaaagctca gagtggtgat     85260
     aactttcctc gacggcacgt tcgaagattt accgtacgac atgtcgacca cggcgaagga     85320
     agctgtcgtt gcgctcgcca cgtcgatcaa tctgcaaaac tacagcacat tttcgttgtt     85380
     cacggtgcgc aagttcttcg gtaaagtcgc cccgctcatc aaggaaggat tactttcgga     85440
     agaacaccat gaactaggcg atgtctcgtt tctcagcgac gccctcggcg atattcgggc     85500
     gatgaaaacg gagtcgacgc cgagcaaggc gacgtcgatg caaactggat tgttgttcaa     85560
     aaagcgtatg ttcagagatg cagatgaaac catcgacgag acgaccttcg tgcttttgtc     85620
     gtacgtacag gcgaagcacg attttatgat gggtaattac ccaatctcgc gtgacgacgc     85680
     ggcgttgctc gcggcattgc aagtgcaggc ggaggagggc ccgagactcg gtgaagatca     85740
     agccgcgctt ggccttgtgt tggcgaagta tctgccgcgc acaatgtgta atacgcgccc     85800
     cacaaaggag tggaccgaac acatcgctgg gcaacacgcc tcgatacgcg ggttgagtgg     85860
     cgacgaagcg cgtcaggcgt tgttgcgcat gattcgatcg cttccatacg gcaactccgc     85920
     gtttttccgc gccaaacgcg tcgacgatcc aatcggtttg cttcctggca agctcatgat     85980
     tggagtcaat aagcgaggcg tgcacttttt ccgcgagacg ccgatggagt acttatacac     86040
     tgcagattta cgggacatca tgcagtttgg ttcggcaccg cacgccatct tttttaagat     86100
     gcgcgtctcg ggtgcgctcc acgtctttca attcgaaacg agcgacgggg agaatatttg     86160
     catggcgctt caaacgcaca tcaacgatgt gatgatgaag aaaatggcgg ataagaaggc     86220
     ggcgatgatg gcggtggaag cggtgacgcc gagcaaaaaa cccgtgagtt cgtcgtctga     86280
     cgcagagctc gcaaacgctt caaacaaagc ctttgcgaac cagacgaaac gcggcgacat     86340
     agatgcctcc gacgcgcaga aagaaatcaa aacgctgaat gaaaagttgg ccaatatgag     86400
     gaacgagcgt gcggaattgc gcgcgcaact ggaccaagca aacgaggcgt ttcacgaagc     86460
     gaacgatcga ttggaaagcg aaagagcgag taaagccgac atcgtggata ccattcagat     86520
     gctcgagcga cagctcaagg agtcgaaaga agcagcaatc gcgagcgaca acgcgacgac     86580
     agacaagctc gacgacttga ccgcgattca gttgcaagag ctacgagacg agttggtgat     86640
     tgaaacagaa cgcgcgagat cgacagaggc acagacgcac gagttgcagc agcaagtggt     86700
     ggttttggag caaaaactca aacgcgcgga agcggcgcac gcggaagagt tgaaagaaac     86760
     ggcggagcaa aatggtgccg acattagcga atggcaaaac aaattgcacg aagcggactc     86820
     aagagctggc gagcttgagg cggaaattag ggcgcttcgg cttgagtacg aagagcaaaa     86880
     ggcgatggtg acgaaggaga tgctcgacga gctcgagcaa ttgcgcgaga tgaaaaacac     86940
     gtttgaggga cagcaagcaa cagctcgcga actcatggcg ggccagacgc aaaagatcaa     87000
     agagttggaa gaaaagtaca cttccgaggt gacgctgcgt cgacgctact tcaacatgct     87060
     ggaggatctg aagggtaaga ttcgagtcta cgccagaacg cgtccgctga cggaaatcga     87120
     aacgagtcaa aatcaacaag ctatactcgc gactccggat gagttcacgt gttcgcatcc     87180
     ttggcgagga gaaaagaagg atcgctcgta cgaatttgat gaagtttttc cggcaaactc     87240
     gacgcaagaa caagtcttcg aagacaccaa gtatctcgtt caaagcgcca tggacggata     87300
     taacgtgtgt attttcgcat acggacaaac ggggagtggg aaaacgttca cgatttacgg     87360
     cgacgatgcg aacccgggat tgacgccgcg cgctatcgcc gaagtgatgc ggtgcgtgca     87420
     tcgcgactca aacaagtcct cggtgaagat ggagtgttac atgctcgaat tgtacaggga     87480
     cgatttgatt gatttactcc tgccggtcgg aacgtctgat gcgcctcgcc tggacatcaa     87540
     aaaggacaag aaagggtggg taacggtgcc taacgctact atcgtgccgg tgacgtctga     87600
     agatgagatc atcgaggtca ttcacacggg tttgaaggtt cgcaaaaccg ccgggacgaa     87660
     gatgaatgtc gaatcgagtc gatcgcactt gatcttctcg ctcgtcatgg agacgacaga     87720
     tttgcaaact ggggctttga cgaaaggaaa actatctttc gtggatttag ccggaagtga     87780
     gcgcgtgaaa aagtcgggtg cggaaggcga tacgctcaag gaggcgcaag caatcaacaa     87840
     atcgctttcc gcgctcggcg acgtcatttc cgccttggcg tccgaacaac agcacattcc     87900
     gtacagaaat cacaagctga cgatgctcat gagcgattcc ctgggtggta acgcaaagac     87960
     gctgatgttt gtgaacgtct ccccgacgga cggtaacgtt gaagaaacac aaaactcctt     88020
     gacgtacgcc acacgtgttc gcaccattaa gaacgacaac ggtaagagcg tggagagtaa     88080
     ggaagtacaa catctgaagc agcaagtcgc gcattggcgt caaaaagcgg gcgaggtaga     88140
     agaatcgcac gttgacattg aagatgagcg cgtgggcttg gaccagttga gcctcaacca     88200
     gtgatcgtct ttgtgtttta tagcccgttc cttggggagc gttgcaatct aatcaaacgt     88260
     gagcacgcgc gtattatagc ttctacagtg cgcgcacgcg tggtatacaa aatgaaactt     88320
     tgcatccgaa tccttcgcac agtcgttgca cgacaccttt tgcgtctttc cccgcagcgc     88380
     ctctggaacg ctgtcgtcgc tctcatccgc taggatggcg tcgagcattc taaagtacat     88440
     ggaaaagtcg ccgagcgatt tccgacacaa aggacacgtg tagtagtgcc gcgtatacgt     88500
     ggtaaagcac gtggcgtgca tgatatgccc gcacggaagc tccttaaccg gtgtctccga     88560
     ctcggcaaga aattctttgc acactggaca ttcgctatcc atgcctcgtt ctgagcactc     88620
     atgcttgccg tgctgtaagc tcacgcacgc gttacacttc atgcaatgga agaagtcaac     88680
     gcccagacct ttaccgcgtc gacagacgtt gcaaaacggg caatgataga tggcttcgct     88740
     cgagtcgtca aacaagttgc acacgttgca gtgatacttt gccatcgacg tcgagcaccc     88800
     cacgcatacc tcgttcacgg gttgacgctt cttgcactcg ttacacacca tttctttcac     88860
     cgcgtagcga ttcacggtgt gatcactcgc gtcgtcgtga caaaatctgc acgtgaaagc     88920
     ttggtcgcag cacggcgcga cgattttgca ccgacgcttg taatgcttgc aaccgtcttt     88980
     gccgttctcc tcgtcttcgt cgacgggctg gcacagaatc gcaggcgcac ccgatttttg     89040
     tgcgctaccc acgcttgaca gctccgtcgt cttatctttt tgcgcttgca attgatttcc     89100
     cacgatccat cgcgacgcga gcaagttttg aatcaagtat gccttcttcg tcggcgcgag     89160
     cgtgtcgtcg cgattcaccg tgcgcacggc gtcttcgagc tggatctgat tcatgcgaaa     89220
     aatatcttcc caaccgggct tgaatgtttc cttatccaca tcgccagatc gacggctgag     89280
     gtacgcgtgt acctgtcgca tgccgtcttg ggacgaaacc gcggcggtat cggcggcgtt     89340
     cgtcttcgtc gtcgtcgcgg acgcgtcgtc gtcgtccatc gccgtagact tcacccaatc     89400
     gtctccgatc gtctgtaagt cttccacctt tccgctgtac cacgtgttca tccactgcgc     89460
     gaacctcgtg ttttgcgtgg cgtgtcgcat cgatgaaatc atcccctcgc gctcgtcttc     89520
     gttgagcgcg tttcgcaccc aaatcaacat cgaccgtaaa acttccgccc ccgtgcgtcc     89580
     gatgatttgt ccgacaatct tttcttgctc ttcaaaacta aagtgtttct cgaacaaagg     89640
     ccaaagctca gcttcttctt tcgcgacgtg cgtctccatg gacacgcgca tcgccacgca     89700
     cgcctgctga atatcgttga ctaaaccttc gcgaaacccg gaatgcgcct tcttgttgtt     89760
     accacccttt tccttccctt gaccttctcc cgccgtggag acggacgaac gcatctccgc     89820
     gatgagctcg acgacgtatt tcatcagctc cgcctcttgc ttgtgatcga gcgtgtaaga     89880
     gtgcgacacg ttgtgcaacg cgctcttcgc ctcgagcgcg ggaaatacga tgtcgtcttc     89940
     cgacatcgag tgcgcctcgt acacgcctcg caagaagacg aaccgaccgt caatcatgcg     90000
     caccaagcgt gcgtcctctt cgtccgttcc cgtgctcgaa atggccaaga tatcgtgctc     90060
     caaccgacga agctcgtggc gcagcgcgtt gtgaaactga aaaatgtgat cgatgggtaa     90120
     cttttgttgc gtcgtcgtcg tcgacgtccc cgcgcctccg ttcgcagctt gtcgtcgtcg     90180
     cttccgcgcg ggctccgaat cgtttcgtcg cgcgtttgac gtcgtcgcga gttcgccgtc     90240
     atcgtcgtcg tcgtcgccgc cgcccgcgcc gtcgacgaag agcgctcgca aaatcggcgt     90300
     cgattccgcg cgtttccgat gcgcccccct cagcgaccga cgcagcgcga tcgcggcttc     90360
     agaatccacc gcgctcgccg ccatcgcgcg ttcgaggtca tcgttcacgc tcgcatcgct     90420
     gcacgtcgcc gcccaggcga gcatatcgca cgcctcctcc gccgacagcg cgcccacgaa     90480
     tcgccacacc aactcccgct gttcgtccgc gccgacccgc gcctccaaca tcggcagcac     90540
     gtgttcgctc tccttcgcca ggtgcgcctt cagcgtcgtc cgcgtcgcgt gcacgatcct     90600
     cgccgccttc gccgccgccc cagattcccc gtctcccgcc gccagcgtct ccaggcatcc     90660
     cgtcacctcc tcgaacaacc actcctccgc ctcgtgctcg aattcgtacg cgtacgccac     90720
     gttctcgatc ctcgacgcga cgaacggaaa cagcacctcg tcctccgcgc gcgtgtgcgc     90780
     cgcgtaccgc ttcgcgaacg cgcgccacgt cccgcacagc gccatcgcgt cgccgtcctc     90840
     cgcgcgcgcg ctcgcgccgc cgccctccgc cgcgtcgtcg cgtcgccgcg ccaacctcgc     90900
     gcacgcgttc gcgatcgcgt cgatcgatcc ctcgaacgcg cgtcgaaaca cggtgtgaaa     90960
     cttggacgcc gcccccgtcg ccggcgcgac gtcgtccgtc gcgcgcgcgc gcgcgcgcgt     91020
     cgtcggcacc cttcgatcgc gcggtttcgt catcgattcg attcgtttcg tttcggcttt     91080
     ttcgcgagtc ccgcgcgcga tcgagcgctg ggcgcgatga acgcgatgga cgcgtcgtcg     91140
     tcgagcgcgc gccggacgcg atggacgcgc gcgccgatcg gcgtcgcgct ctgacaccgc     91200
     gaccgcgtcg atgagtgaat gatttcgcgt cacgatttcg cgccgccgac gacacaccgc     91260
     gccgcgtcgc gcgccgcgcc gtcgctcgca tgtccgcgac gcgttcggtc gtcgcgtccg     91320
     cgacgccgcg ccgtcgcgcg tcgcgtcctc gagcgacgaa tcgtcgtcga cggcttcgcg     91380
     cgcgcgcttc atccatcgcg acgcgcgacg acgacgacga cgacgacgcg cgatcgagga     91440
     cgcgacgccg acgacgaggc gacggcgccg gacaccagag cgaccgcgag gcgtccgcgc     91500
     gtcccgaccg cgcggacgcg tcggcgcgat ggcgaaggct cgagcgggac gcgacgacga     91560
     cgctcgggac gcgcgacgcg ctgagcaaaa ggacgctggg cgcggacgac ggagggtacg     91620
     agtggctcag acgcgcgtgc gatgacgtgg cggaggacgt cgtgcgaggg gtgatcgaag     91680
     gcggcggcga atggtcgagg gaggacggga tggtggggtt cgatttgacg gcggcgacga     91740
     cggcggcggc gaggcgcggc ggcgaggcgc cgaacgcgac gtgcggcgcg gcgatagcgc     91800
     atcgagcgac gacgaatccg atgtttttgc gagcggcgtt cgagcggttg gtgagagatg     91860
     ggttcgacgg ggacgaggcg cgggcgaagg agagcgcggc gtgggggtgg attcgagggg     91920
     cgattgcgaa gcggtcgagc ggcggcgatc gcgcggacgc ggcgcgggcg aagaggatgg     91980
     cgaagacgga ggacgatggg accgcggacg tcgccgagcg cgcgcgggag gcgacgcgtg     92040
     tgcgtgtgtc gacgttcgtc gagcgcggac gggagttgtt ggcgatagag cgcgcgaggg     92100
     agatggagat ggcggcggag acggcggtgg atcgcgaaga cgtcgaagac gtcgacgacg     92160
     aatcgtctgg attcgtttcc gaagagtcga gcgagttcgg cgccgcggtt tctggtttgc     92220
     gcttagtcgg cgctacgcgc gggtcggacg gcaaagcgct ggtggtgttg cgcgccgcgg     92280
     acggcgaggc catcgcggtg aactcgctca ccgtgggcga tcgagtgacg atttcggcgt     92340
     acggcgacga attcgcgagc gcggacgagt ccgcggatgg gagcgcggcg acgttttcga     92400
     gcgaggccac ggttcggttt atgggtgacg ctctgaatgc gacggcgaaa gggcgttacg     92460
     gagacgcgtc gtcgatttca ttagagtacg ccgacgacga gcaggcgctc gtgcgcgcgc     92520
     tctcgggtct cgagatttgt ctctcgcggg cgccggacga gacgacgtac gaacgtcagg     92580
     cacgcgccct ggacattctc gaatctattc cagcggtgaa acgttcaaaa ccggcgtgtc     92640
     tgcgcgtcgt gaagacgatt ttcagtgaag accggccagc gatgtggcgc gacgcgcgcg     92700
     atttttacgg aggcgacggc gccggtttcg ccgccgtgcc gacgaagtcg ctcaaacgcg     92760
     tcgacgctca atcgctcgcg acgaagacgt cgttcgacga atctcaggtt ctcgcgctgc     92820
     gcgcggcggc ttcgacaaac taccccgtgg tgtgcattca aggcccaccg gggactggta     92880
     aaacgagcgt ggtggtggaa atcatcgccc aagccgcggc gaggggcgag cgcgtactcg     92940
     cgtgcgcgcc gagcaattta gcggtggata acctggtcga gcgcctggac ggcgtcaccg     93000
     acgttcgagc ggtacgtttc ggcgcacccg aacgcatcag cgccgccgcg ctctcgtgct     93060
     cgctcgacgc caaagtttcc gaggcgaccg agttgttttt ccaaacgcaa cgcgtggaat     93120
     cgagcgagac gtctacgaaa cttcgcgcgt tgatggaccg ctatcaaaag gcgaccaacg     93180
     tgccgaaaaa gcaaagggaa aagcttcaga gcgaaataga ggcgctgaaa aagaagctca     93240
     aaaccacggt gagcgctggt acgaagcatc gtaaggcgtc gcaggcaaag attttgcgag     93300
     aagccaacgt ggtgttggcg acgaacgcgg gcgcgggaat ggacacggtg caacagctgc     93360
     cgccctttga tctcgtcgtc gtagacgagg cggcgcaagc gagcgaacct ttgagttgga     93420
     ttccactcgt gcgcggcaga cgcgctgttt tgatcggtga tccgtgccag ttggcgcccg     93480
     tcgtgcgctc gctcgaagcc gtcgaggcgg gattggctcg ctcgctcatg tcgagattga     93540
     tgcccgcacc agaaaattta gacgacgaag acgacggatg gaacgcgcgt gcatatgcct     93600
     catcgggcgt gctcaccctg acgctctcga cgcagtaccg ctcacacgaa accattagct     93660
     cgtggtcgag tcgtgaggcg tacgggggac gcctgcgcgc cgccgaaagc gttcgcggcg     93720
     ccttgcttcg cgacttgccc ggagtgcaag atacgcaaat cacgcgcata cccatgctca     93780
     tgattactgc tcgttcgcct tacgggcgca ttccagcaga gtgtaacgaa cgtcgcgttg     93840
     gtggctccta catcaacgaa ggcgaggcga cgacggcggc ggcgcacgta ctgatgatgc     93900
     tcaaggcggg cgtgcgcgcg tcagacattg cggtgatttc tccctacgcc gcccaagttc     93960
     gcttgcttcg aagcgttctc gcggtcgcgc tcgaggacgt tgaaggcgct gatgctgtgg     94020
     agatttcctc gatcgattcg tttcaagggc gcgaggcgga gtgcgtcatc atcagcacgg     94080
     tgcgctcgaa tgctcgccgc ggcgtcggtt tcttgtccga taaccgacgc atgaacgtag     94140
     cggtgacgcg cggaaaacga cacgtgacaa tcataggaga cgacaagaca atcatgggag     94200
     atgcgttttt gcgacgactc gtcgagcaca tcgaagccac cgccgccgcc gtaattcctc     94260
     gcgtcgatct attcgcgccg gttgccgcga cgtagcaccg caatattatt agcatgacta     94320
     gctcacacga tgcacgcaac ttagtgaaag attcactcat cgtagctcat tacatggtgc     94380
     gctaatcgtg aatcgctctt aaaactttcg cgagaattcc tgctcggcga ttttcgctcg     94440
     cgcgatgacg tcgcccgtga cgcgcgaaat ggccacgcgc gcttcgcgtt gcgtcgtcac     94500
     caacttttcg cgtaaatcct cgttttcgcg ccgcaactct cgaagtgcct tgcgcatggc     94560
     ttccatgtca cttccatgga tcgcagcgtc gacatccaca ctcgacgcgc tcagcggcga     94620
     gtcaaacttg agctgcgtgc cgcccatgcg cggcgagttg gaatcaatcg ccgccaaatt     94680
     tgccatcttt gaaggcgctg gggacatgga cagacgcctg atcgcctgct gcacctttaa     94740
     aatcgaattc gtcacgctct cagccgtgtc ttcgctcttc gtgggctcgg gagatttctc     94800
     tggcgcgcgc ttcgttccag gaggcggcat gacgtcccca gattttcgct tagccttgct     94860
     ctttgccgcc acgaccgcgg gcggcgccgg tgccggcgcc gcggccgcca taccggggag     94920
     gttggcaaac aagtatccac cgccaccgcc gccgaatccg ttcaacgcag cgccggacat     94980
     cgtggcgagc gacgcttgct gcttcgccgc ctcgtcgagc ttggccttgt tcgccgccgc     95040
     cgccgcgtcg ttggcacctt ggtgtaatcg ctgcatgtgc ggcggtcgtt gattcggtcg     95100
     cgcgggcgac ggtgacgcca tctgcgccat caatcgcgcg tagtatcctt tcccttgcca     95160
     cgactcttgc agttgctcgc gcaagctctt ggcgtgcagc gatttcgccg gcgacggcgc     95220
     gtagtcgggc aacatttcat ccgccgcctt catgagttcc gccacgcgac tgtgcacgtc     95280
     gctcaccgtg tcttcgaccg catgtccgtt cgccttacgc tcggcgagct cttcttcgta     95340
     ccgagccttg gcgtacgcct cgaggtacgc ctggcgttgc ctgggattcc cgacaaacgc     95400
     cggcgacggc ggcacttcat ccgccgccac ggattcccag ctctgaaact ccccgaaccg     95460
     cgtcacgcct ttgtgcgtcc tccgggatga tctacgcttg ttattatttc ctccatccac     95520
     cccctcctcg ctcgaattcg tcatgtgcga gctcgtgcta tcgttaaacg acgcgtccgc     95580
     gcgatttccc ggcggcgtgc gtccgctcga cgaagacccc gcgctcagct ttctccccac     95640
     catcgacgcc ggcgtcggct ccaatccggg cggtgagttc gacgcccccg aaaatgacgc     95700
     attcttgctc acatccggta tcgagctaaa cgacagatcc gccgcgtctc ccgacgcgcg     95760
     tccgctcgac cgccgtctcg gcgcgtcgtc ccccttttgc gtcacgtccg agttccgttt     95820
     cgcgttcccg cgcgtcgcgc gcccgctcga cgtcgacgat tttccctgcg cgcgcgcgcg     95880
     tcagtcaccg cgtcgcgcgc gcgcgtcgag gttcgaaaac gttcgtcgcg ggggaacgtc     95940
     atcgcgatgc gtcgtcgcgc gcgcatcgtc gcgcgcgcgc gatccagccg tccgcgcgcg     96000
     ccggcgcgcc gcgccgcgat cgcgcgcgca cgttcgcgtc gatcgcgacg caccttattc     96060
     gtcgcgtcgt tgagcgcggg catgacgcgt cgtgttttgg cgatttcgtg gaagtgacgt     96120
     tttgcttccc cgttgttccc ccgcgcgcga ggcgcgagac gtcgagacgt cgagacgtct     96180
     cgccgagcga tgcgcgcggg cgcgagcggc gacgcgcggg cgatgcgatg gattacaaca     96240
     gtgatgtaca cgtacggcga tgtacagtcg atgcgcggta ttgatgcgcg atacaggttc     96300
     gaatcagtcg gcggtcggcc cttcccaaaa gccgtcgacc atccactcgc tcgcgtcgtc     96360
     ggcgaagaaa tcatcccgct cgcgatccgc cgcctcgcgc tcgtcccaca ttcgctcgta     96420
     atcttccaag cgggtgtcgt cctcggacgc gctgtcgagg agcatgtttt gaatgctgat     96480
     gggcaagctc tcgacgtagt cgtacgagtg gatgcgatat ataagttctg ggaattcgtc     96540
     gacgacggcg cgcgcgtcgc aattcggttc caaactcgcc agttttgcca ccgcgcgctc     96600
     aatgtgggcg tgaatgtcat ccaccagtaa taattgcgga tgacgctcga tcaatccggt     96660
     gacatcgcga cacatatcgc tcgagcacaa aacgtcttgc aactcgagca cgcgtttact     96720
     cgcggcgacg aattcaattt tcaaaacccc tgggtcgcgt tcgaacaccg cgcacacgtc     96780
     gatgtccggc agaagtcttc gcaggcgatc gcccgcgatc gcgatctgcg ctggatcgcg     96840
     catttcacgg tgcgtttcgc cgacgtcgac gagcgcgcgc acgacgcgat ctctcgcgcc     96900
     cgcgtactcg cgccaaaacg tcaccagttc caccgcccac ggttcggtgt agccgaggtt     96960
     gtccacgtcg accgccgcat cgagcgcgtt ttgagccttg gcttcgtcgc ggcgacgcgc     97020
     ggacgcgcgg cacgcgctgg gacgacggac cgagcgcgcc gagtgcctcg gctgcgcgtt     97080
     caaaagcgcg ccggaagacg cgcgcgcgcg gcgcgctgag tgaatcgaag cgggcgcggg     97140
     ggtgcggacg cgcgcgcgca cgccagcggc gatgacgcga ggcatggcgc cgacgctcgc     97200
     gcggtcaccg cgcgcggcgg tgtgacgagg cgcgtcgcgg cgcgcgcggg acgcggcggt     97260
     tcgcggcggt tggcggtcgt tcgtattatt ctattctcaa tctcgaacgg tgggcgttcg     97320
     cgcgctatgg ttcgacgtcg atgtaatcgc gggtcgtcga cgccgttcac ttgtgtttga     97380
     gtttggagac gaaatcgtcg acgctgaatt cttcggcgta ttgcgcctcg tcccacattt     97440
     cttcgagtcc gttgacgatg ttggagagac cgccagaagc ggcgcccgcg gcggcggcgg     97500
     ccgcgccctt ggcgacgggt gcaccgtctt tgccgagttt gacacccttc tccgcggtga     97560
     agagctcgag catttgaccg gtgtccatgg cgctcatgga cgcgttgtcg gcgttcacca     97620
     cggcgttggc gacgtcgagc ttgaagcgct gcagagacat gattttctct tcgagcgtgc     97680
     cgcgagtgag gatgcggtag acgttcacgg tcttgcgttg accgagtcgg tgtgcgcgat     97740
     ccatggcttg caaatccttc tgcgggttcc agtcgtgctc gaggaagacg acggtgtcgg     97800
     cggatgtcaa gtttaatccc aaaccgccga cgtgcgtcgt gagcaagagc acgtcgattg     97860
     acgggtctgc gttaaacttg cgcacaacat cgaatcgctg cgatggtgga atactcccat     97920
     cgagtcgtaa ccagcttacg tcgcgcattt gcgtcgtgaa aagttcgttt tctaccaagt     97980
     cgagcaagct cttgagctgg gaaaacacca agacgcgatg accggcgccc gacgccggat     98040
     tcggcttccc ctcgtccccg ttggactttt cttcttctaa gtctactcca atgccacaat     98100
     caatcaatat ttgcttcaac gcatcgaatt tcggcgagcg catctcagga ttgaactttt     98160
     tgctcgcgcc gtcagacacg acgagtttcg gatgcgagca cagcttgcgc aagtattgca     98220
     gcgtcgtgaa gacgtgttgc gccgcgcctt cggcgcctcc accgccttca atcgcgctca     98280
     cggcttgatc ctttgcttcg cttgattcga acgcatcgta catcttgcgc tgcgcgtccg     98340
     tgagttcgac gtagacgtct tgaataatct tgggcggcaa atccttgagc acttcgtcct     98400
     ttgtgcggcg catgacgaag ggcatgactt gcttgtgcag tgcacccgtg gcgagcgcgc     98460
     cttgctcgct cagtccaccg cctttcttcg cagccgccga tctcgccgcg gcgatgccgt     98520
     aagtcttctt gaactcgcgc tcggtgccta aaaatccagg catgagaaag tcgaacaaac     98580
     tccaaagttc cacgacgtcg ttttgaatcg gcgtgccgga gagcaacaat cggtgctccg     98640
     cgcgcacgct cttcaccgct tgcgtcacgc gactttttgg gttgcggatg gcgtgacctt     98700
     cgtccaagac gcagtaacac cagtcgaatt tgtccaacga atcgaaatcg gcgcgaacag     98760
     attcatacga catgatgacg acgtcgtact tgccaaagtc cttctgtaac gcgcgacggt     98820
     cgggtggact gccgtggtac tcaagcgggc gcaacacatc cggttcgacg taaagcccga     98880
     tctcgtacgc ccagtgactg acgagggtgc tcgggcagat caccaagtgc gggagtgttt     98940
     tcaatccagc ttccttgcgc tccaccgtcg tcgcggcgag aatgcacgtc gattgaagcg     99000
     tctttccaag acccatgtcg tccgcgagcg caccgtgcaa cttgaagcga cgcaagaacg     99060
     cgagccaatt cacaccatct tgctgatacg ggcgcagcgt gcgcgcacac ttgaacggga     99120
     gtttgaagtc ttcaatcttg ctgttgtcca agagcgcctc gaggaattcg ccatccttct     99180
     ttgagcgttc tttttgcttg gtcgtcagat cgttcggcgg ttctttaccg acagcgagcg     99240
     gaagcaacgg taccagcttt gcgaacgcac gggtggcgtt tccacgaatt ttcagatccg     99300
     gatcactcat tcgacccatc agaggaacga gaagtaagac gcaatacggc gcgagcacgg     99360
     cgccgagtgt gtcgacaagt tcgctcgcga ggccgacggc accagcacgc ttcgccgtct     99420
     gcgaggccgc ctctccttct tctaacttcg gcacgatgaa gtctaacaac gacgaaatga     99480
     ttcgctcggg atgcttcgaa gcgatgctcg ctatggtctt tgccgcagtt ttccgcaccg     99540
     cgacgtcggt gtacaacgct gcggcgaacg ccgtcttggt cgtttcgata actttctcct     99600
     ccaaagcttc gtgcaccacg gggcctaaaa tcttgaacaa ctgcaacgca tcgacgagtg     99660
     actgcagcgt tgcggtggga gcattttcag gcggggcttg cgtgatcggc ttcatcatga     99720
     gcgcgtccaa cgcgccaagt tggttgaaaa cgtccgctcc gaagagcgaa gccgccgaac     99780
     gaatcaccgc ctcgccaccg cgtctcgcga ttgtcgcgtc actgataact tcttcatcga     99840
     cgatgcccgc gacggacttc ttcttcttcc catcatcttc ctcttcttct acttcttccg     99900
     tcaatccagc tttgggcgtc tcggcttcgt cgccgcaaat catcgacgtg atgttcttga     99960
     gaagcttatc gttaggcgac ggcgagcgcg aagtgcacag cttcatcata gccgccaccg    100020
     aagccgcggc atgtgcttgc aaatctgcat cgcgttcgcg acgcacagac gacatcaacg    100080
     gttgaatgaa tggattcagt ttcggaggca acgcgccgaa accgacagcg gcacccgcgg    100140
     cggcggcgag cacggcgccg tgaagcttcg cttcggtatc tcgcaaacgt tgcgcggatg    100200
     catgaagaga acctcgcgcc gtttccacgg cagctatctc ggactgcgat ggaaagagtc    100260
     gatcgtggtt ggtcagtctc gtacgagttc ggtggcgcaa tgggggatgt tcgaggactt    100320
     atacttctct tcgggcaatg ctagctctga ggaaacctgt gagcctcgtt tttatgtagg    100380
     agctggacac gacgcaagcg ttcgtccgat gcccgtgata ctaaacccat gtggtgaaac    100440
     cgcatgaaat accacgcgca gagtgcgcgc ggcgccgatc gtacgtgtag acgtcgccgc    100500
     cgccgcgcgc gaactccgaa gcgagaaaaa atcgaacacg tgaaacgtac ctgtggcaca    100560
     gccgccgaga gcgtcgcagc cgaatccgca ccaaaaccat ctgcctcggg actaggaact    100620
     tcacccgtga cgacgacgcc attcgtcgcc gccacacgca aaaatgccat cgattcgctt    100680
     ttcacgtact tgaccatttg cgccacctcg ccgtacggtg tcggcgacgg tgcgctggga    100740
     tatgccggat tcgtatttgc taaaattgcc cccagttgcg caccaggcgc ttgcaacgtc    100800
     ggacgttgcg gaccaggcgg aaccactcga agccaagagg tgagcaagtg cgcgccggcg    100860
     agacgcgcgg tggcgagctc gcccgtgagc atgcccacga tgtgctgctc catacgagcg    100920
     accgaactcg agcgttcgtg cgcgccgaac gccgcggcta gacgcgcgag gcactcgagt    100980
     ccacgcatac gaccagcggt ggtggccggc caatctttcg cgacggcgcg aatctcaccc    101040
     ttaacgctcg gcggcgtgga gacgaaaatt aatttgccct cgccacgagc gttcgccacc    101100
     gttgtcgcga gttcgcacca cttcgcgccg tgtaccgtga acgtagcctc gatgatggcg    101160
     atcgggaccg tgcgcaaaag cgccacccac gcctcgctcg ccgcatcggc gctcgccgcg    101220
     tcgacgtcga gcagcgcgcc ttgaaatgcg tgacgcatcg ccggcgcgca cgcctcttgc    101280
     acccacaact gcgtcgacgc gttcggctcg acggctaaca gtcgagcaag cgtctgccac    101340
     acggccagtc gtacggctgg gatcgggtgc gcggcgaacg gccaaagacg tgggacgact    101400
     tcagcgagcg cggcggtgga ctttgcgcgc gtcgattcca acgcgtacag ttcggcgatg    101460
     agcttcatca ccggtaccgc actcggtgac aagtcgtcga gctcgttgag gagcccccac    101520
     aacgacgaaa gtaattcgtt gaattgcgga tgactcggca agtgctcgac ggcaggtaat    101580
     aaggattccg ccgcggcgcc tcgcacgtcg tcgtcggcgt ccacgagcgc cttggtcgcc    101640
     gcgggtagcg ctgcgggcaa aagctcgact gccaactctg actttgcggc gagaatatac    101700
     ttcaacccga gcaacgcgga gtgccgcact tcccactcgg ggcgcgacag tagtgtgagc    101760
     gtgcacgaca ccacggcgtc gacggcttgc ggcgacaacg gcaaaagcgc cgcgccgagc    101820
     gcctgcgcgg acgtctcacg gacgggcgcc accgcgccgt cgcccgcgaa atcaccgaaa    101880
     cggtcaagcg ctagtatgca cagtaagcgc acgcacatgt cctcgagcca agcggcgttg    101940
     gactcgcgag cgatctccac cgttcccggt tctggtttca ctccgggcgg cggcgcccaa    102000
     atagccgcgc tcgccgcctg atgacgtagc acctcacgca acgccgcggc ggcgccgtga    102060
     cgctcttccc acccctccga aaacatcatg tacgccaacg tctcgcaggt gcgcgcgagc    102120
     ggccatccgc ccgcggcgac ttccgcctgt tcctcgtcgt cctcctccgc ttccgccttc    102180
     tcctgttcca aacgcgccgc ttcctcgtcc tgcttcgacc gcttcgcgtc cagcggattc    102240
     gcgccttcgc gcaacatccg tttcgcctta cgcttcaact tgttcagctc tcgcgcgctc    102300
     aaatgactgt aatcgacgtc gccggtcaac ccgtccaccg cctccgccgc gctatcgcca    102360
     accgcaacct tctcctgcac ggtcaccttc ccatcgtcca gcaaatcctc atccttcacc    102420
     aaatcactca tcttcatgtt ctcgtccatc atcgctcccg cctcggggcc gagctccatg    102480
     cctaaccttc gcttcaacga cgccttggct tgcgccaacc gttccgcctt cgtccccggt    102540
     ccgttttcca gccgccaccc gatcccgctc gaactcaaca gtatccccgc cttttccagc    102600
     acgcgctcga cgtcgaactt cgcgaacgtg agatcgagcg cgtccgagcc cgcgttcgcg    102660
     tcccgtcccg tcttcgcctc gctcgcgtcc cgtcccgcgt ctcgttccgc cccatcgctc    102720
     tccatcgcga tcagcgcgtc cacgctcggg tgtcgcaacc gcgacgcgat ttcactcatc    102780
     gtcgcgctcg ccgcgacgcg ggtctcccat tttttgctcc gcaggtgcgc gcgaacgcga    102840
     cggaggagat tgggcaactg cgtcgagtgc gacgcggcga gttcgccaat ctgacgcgcg    102900
     gcctcgcgcc tcgcggcggc ggtggagccg gtgtcgagga gtttgatcag gcggtccagg    102960
     cgcgagccgc cggattccgc catggcgcgc ggtgacggcg gcgcgatctg acgcgagaat    103020
     gcgtcgacgc cgcgaggagg cgtcgacttc ggcgcgacgc gtcagcgaat cgaatgcgtc    103080
     gggttcgtta cagttcgagt cgaagatttg agattgaagc gctaatccac gtcgttcgcc    103140
     gcgccgccgg gcgcggcgcc ggcgcccggg aagccgcccg ggaagccgcc cgggaagccg    103200
     ccgggcgcgc cgcccggcat cgcgccgccc atcgaagcca tcaatttttg caacaccggt    103260
     ccgacttcgg ggtcgctcat gtactgcatc gccgccatcg ggttcttcat catcgtttga    103320
     agcgcttgca tgaccttggg gttctgcatc gcggcgatga gatcggggtc gctcatcagc    103380
     ttttgcgcca tctcgggcga aacgccgggc ggcaagtcgc cggcgccgcc cgggaatccg    103440
     gcgcccggtt ggccgaaccc aggcccgccg gcgtctttcg ccgcggcttc tttgcgcgcc    103500
     gcctccgcgg cggctcggcg tttttcgagc tcttctcttt ccttggcctc cttcgcggcg    103560
     cgcgccttgc cctcgcgcac gtgaagctcg tgcacgacgc tcaagacttt tttatgcatc    103620
     tccccgtacg tctcgtcgaa gtcctgagac aatcccgcgc tcagatccgc gttggcctcg    103680
     ttccagtgtc ccaagtacct gtgcgccgcg cctcgaacct tcaacgcctt ggccgaatcc    103740
     ggattcaact tcaacgccgc cgtcccgtct cgaatcgccg acagcggctt tcgcaacttg    103800
     atgaaacatt ccgcccgttt cgcgtacgtc agcgccgacg gcgcgatcat cagcgcctcc    103860
     gtgtacctct cgatcgcctc ctcccacgcc tcgcgcgcga acgcctcgct cgccagtcgc    103920
     ttcgcctcgc tcgccttcgc ctcctccgcc tccccgagcg tctccggcgc cgtctccgcc    103980
     cccatcgcga tcgcgctcag atcatcgctc tcggccgcca tcgcctcgtc gtcctcgatc    104040
     tcgatcgcgt ccgtccccgt ccccgtcgtc gtcgtcgtcc gcggcgccgg aatcgtcgcc    104100
     cccaaatcct cctcgagcca tcgtcggaag aattcgagcg ccggcgcgtc caggatcgcg    104160
     ctgtcttcct tcgccgcgcg cacgaggtgt cgcagcgcct ccagcgtcgc cgtcgtcggc    104220
     gcgcgttcgc gcgtcatcgc gcccggtcgt cgcgtcgtcg agtgccgccg atgaatgaat    104280
     cttcgcgaac gacgattcga tcgacgcgcc cgtaagtttg ccgacatcac ccatcgcggc    104340
     cgcgcggcgt cgcgcgcgcg ccgacgggaa tcgctcgacg tcgagcaact ctcgaattcg    104400
     cgattttttt taactcgcgc gcgatcgcgt cgaatcttcg tcgcgaccgg tcgccgcgtc    104460
     gtcgcccccc ccgaggtggt tacgccgcgc gtccttcgcg cgcggcactc ggcgacgcgt    104520
     cgtcgacggc gcgcgtcgcg cgcgacgtcg cgacctcgcg gatgcgtcgc gcgacgctcg    104580
     atcgcgcgcg tcgcgcgctc gcgtcgcgcg cgccgatgga aacggcgctc gaggatgcga    104640
     aatcgatgat cgagtacgcg cgcgcgcgat ggcgcgtcgg cgcgcgaggc gacgcgcggg    104700
     gggtgctgga acacgcgagc gtggcgctga ggcgacgagg cgaggaaccg gcgacgtcga    104760
     gcgcgatcgc gcgcgcgcgc acggcgtggg cgcacctggc gcgggagcga ggcgagcgcg    104820
     ggacggcgcg agacgcggcg cgagacgcgc gagacgcggc gcgcgagagc ggagcgccgg    104880
     aggacggcgc ttcggcggac gcgatgtgga cgctcctgga ggcgcgggag gaagcgaagg    104940
     aggcgacgtg ggcggacgtg gtcgagggcg cgcggcgcgg cgcgggaggg ggagcgggag    105000
     ggcggtgcgc ggcggcgggc gcggagacgc tggcggcgct gacgcgaaga cgcgcgaggg    105060
     acgcgttgga ggcggcggag acgtgcgaga tcgcgctcag ggggatgtcg tcggaggagt    105120
     tgcgagaggc gaaggacgca ccgcacgggt gggcgatcgc gagcgcgatg aaggcgctgg    105180
     gacacgtcga gaggttgacg ccgagcgggt cgagcgaacg cgcgttggaa ctgtacgaac    105240
     gcgccgccga gtacgccaag gacgtggcgc tgagcgagca cccgggggcg atggcgtcga    105300
     ggatgatcgc tgaggatttg caagcggatt gcgcgttggc gcgcgcgcag gcgtacgcgg    105360
     cgctcgggga cgtggagaac gccgagacgt tcgccgcgcg agcggtgagc gccgcggagg    105420
     cgttgggcga cgaaaagcat ccgcgcgtcg gagcggcgat cgcggtgagc ggggacgtgt    105480
     acgtggccaa agcgctcaga tcgatgtcga acgatgagaa gacgtctttg ggcgacggcg    105540
     cgggcgtgat gtttgccgag gggttgtaca agagcgccat aaaattgatg cattacccgc    105600
     acgtcgtcga ggatgggaaa atcgtcctcg attacgaggc gaggcacttg tgcgcgctgt    105660
     tgcacgcgcg ctactcgagc attttgcgcg cgtctggcgg tcagcgcgag cgtgaagcca    105720
     acgcgtggct cgaaagcgca aagattttgt ggccagatga gcgcggcgac gatgaaggcg    105780
     tcgacggcgt cgacatcgtg accaaggcgg cgacgaagct cggcgtgaag cacggaccgt    105840
     cggtgttgat cgatttacag caaatggcgc ctctcaccat gggcgcgtga gcgttggtgc    105900
     gtgcgccgtg tacttttact ccttcctacg ctacggtttc gcgcacgcct ttagtttaga    105960
     cgattcgtta gacgaagaaa catcacgttt ttcgctcact cgccgcctcc tccgtctcga    106020
     cgtgcaacga gtgatgtcgc cgctctgcct tcgtgaaccc gagctcgcga tagttcacgc    106080
     gcgcttccgc actcgtcgta cccaccggcg agtttgcggt tttcgacgaa ggaccgctga    106140
     ggatggcggt tagatcgcct ccagcctccg ccgcgcgcat cgcggcttcg agtttggctt    106200
     cgaaatcgag cgcactcgtc gacggcgtcg gtttcgccgc gggttcgtac ttttccggtg    106260
     acttgacttc taatttcggc ttgaactcgc gcttcggcac cgcgcgatcg agcggttgct    106320
     tctcgatcgg cgtcgacgcg ccgcgcgttt ccttgagcgc ggcggataac atgcgctcaa    106380
     acgcatcgtc ctcggcggcg ctcgccggcg gcgacgcctc caccgcggga ctgttcacgg    106440
     gactgttcac gaactccaca ggcgcgtcga cgtccatcgc gacgtcgtct cgtgcgctca    106500
     aatcgtcctc aaccttcgcc tcgccgtcgc cttccgaatt cgcctccgcg tcgtcgtcgc    106560
     ctccgctcgc ctttggcggc gaattcgcca aaccgccctt ggccgcgagc atccgcccga    106620
     cgtccactcc cgccgcctcc gccgccatcg cgcgccgcag ctgcgcctcg aataacgcgt    106680
     ttctatcctc ttcgtaaatc acgccgtcga tcgccccacc gtcgtcgtcg tcgtcgtcgt    106740
     tcgcccgcgt cgccgtcacc gtcggcaccg tcgtccgcgc gcgtcccgcg tcctgactct    106800
     tcaccaccgc cgccgccttc accggcgctc tcgcgacgcg cgcgtcgtcg tccttcgcgc    106860
     gtcgaccgcg cgtcggcgcg aacaccgccg ccgtcgggct cgcgtcgaac ggaaacgttt    106920
     cgtcttccac cgggggaacg acttttcccg tcgcgctcga cgccgcgcgg agccacgacg    106980
     cacgcgagac gcatatcggc gagacgttgg acaggtcgaa cagcgcgaga agtctgctcg    107040
     cgtcggcggc gcgcgcgggc gtcgaggcgt cggtcgttcg ctcgcgcgcc atggcgagcg    107100
     cgagcggcga agtgtcgctc gcgagcggga cgcgaagcgt ctcggcgcgc gggactaatg    107160
     ggcggggtag caatacaaag aggcgaatcg agcctcgcta aaacacacaa atacgcaaac    107220
     gcaacgcggt gacggtcgac gcgtcgatcg atcggcgcgt cgatcagtcg tccttggagt    107280
     acagacgctc gagcgacgcg ttgatgaaat accgctcagc cttttgcacg tccaatcgac    107340
     tgccgtcctt gcgatatcgc ccgcgcacga gattatacat cgtcgtcacg cgattgacga    107400
     tgaaccatcc gttggcgctc tcgtcgccgt ccgcgttcgt gggcacttcg atcgtctcgc    107460
     cgcacgcgat gttcttcggc agcttgtgca gtcctaaatc caccggaggg ggggtggcga    107520
     cgcgcacgtt gtacggcacg agctttgggc tcgattcgcg cgcgccctga gatttgacgt    107580
     cgtcgttggc gtcgcgttcc gcgccgtcat cgctcgatgc gcgcgctccg acggcgatct    107640
     ttgcgcgatg acgtggaggg aggtgtcgat ttttgagtct ttcggcgacg ctcgcgcgcg    107700
     atgcgggcgc ggatggcgcg cgcgcgcatc gcgatgcgat tgacatggtg ttcgcgcgtc    107760
     gagtgcgcgc gcgtggcggg gtgcgctcgg tcaccgcgcg ctgcgatgtg acgcggcgtt    107820
     tcggagggcg cgttcgacgg gctatcctcg cgaagcgaat agaatttcta tgaaagtaca    107880
     cgcgtcagga cgcgacgacg ctagactaat cggtaaactg cgttttagcc gcgacgtcga    107940
     gctcggctaa cgcgcgaagg gcggaaccga gggtcatgcc gttcgaagcg gcgcgggatt    108000
     tgtcgtcgcc gccgacggat ttatcgagct cggcgctctg gttcacgatg gaatccgtag    108060
     aatcttccaa cgcggcgtca aggggcagcg gtccgtcgag acttcgtcga cggagcgtgc    108120
     acgggttttc gagcaagctc agcaggtccg caggggtgtg ttcgacgtac gtcgccgtcg    108180
     ccgtcgcgtc ggcgtcgtcg atggcaaacg ggaactcgtc ttggttgtcg atggactcgt    108240
     ccgcggcgtg cggcgtcaaa ggcgaccctg gtgcggcgtc atcgctcgcg ccgctcatgc    108300
     gtcgcgcgaa gttggagacg ccaccgggcg agtgcgggta tacgccgatg acgtcgcgaa    108360
     tcgacgtgcc gaggcttgag ctcggcgacc aagaggaacg tggaacgctc cgagggtgcg    108420
     caaacgccgc gcctcccggg ctcggaattg gagattcagg acacacgaaa ccaccccaag    108480
     gcgaaggcga accgtgcggc gcggggcccg agcggccgtc tttcggcgct cggactcgcg    108540
     gcgagcacgc gatgggcgcc gccgtcgtgg gcgagaaacc gatcgtcgtc atcggcgaag    108600
     ccggcgctgg cggtggcggt ggttgcgcca ccgcgatcga ggggctcggc gccccgatgt    108660
     cgttcgctcc tggcggtttg gcgacgaaat cgtctttgtc gatggatgtg ccgacgtcga    108720
     ttttcaaaca cgacgccatc gtcgagcgtc tcggcggcgg acgcggaggt tccaccaacg    108780
     gcgactcgat cgcgctttgc agcgcatgtt tcgcgccgac aggcgcggcg ttgaatccgt    108840
     atatcggtgc cggcccgtta ttcggcgcag aactcggagc gttgtcgaat cgttgataat    108900
     tcgggctcgt gtaatccgcc aacggcacga cggatgggct cacgggaggt ttcgcttgtt    108960
     gctgaagcga ccccgacgat aacgacgccg tcattccacc gcgaatcggt ggccgcgcgt    109020
     tcggcgacgg cgatggcgag gcttcgtcga agagtatccc gcgcgacatc ggactcgaat    109080
     cctcctcgcg acgcgcgcgt tgaagcgact cgggtgcgtc tgatttccca gtcggcgatg    109140
     gcgagagcga catttcgccg cccgcgagcg cgacgacgtc gggaccgacg ctcgcgtcca    109200
     ggcgttcgca cggcgtcggc gccgtttcga cgacggcgac gcactcgtcc tccaacgcgc    109260
     tcatcgctac ttggtctaaa aagtacacgc acgcgctcag tttcccgatg gacgtcggca    109320
     cgtccgtgaa cgcgtacgtg cggtacccct ccgctttccc cgggtgcgcg ctcgcgatcg    109380
     tccctccgcg atcgacgttc ttgatctcaa aactaaaccc gcctcctccg ccgccgtctc    109440
     gcgcgcctcg tcgacgcatc gctcgcaagc gcgcgccgtg cgcgggaagc gtccgcaaca    109500
     tcgccaccac cgtgcgcacc atgatcaccg ctcgcttata caccaccgcc gtgtccaaat    109560
     ccttgttaaa atgattgttc ccaccgactc gttctccatc cgcgcccgcg tgaaacgccc    109620
     atcgctcgac gagcgcgcgt tcgccgctcg tcgacgcgtc ccccccccgt tcgaaataca    109680
     catccaccgt caccgcgccc tcgacgaacg cgtccacaga atcgccctcc agttctttca    109740
     ccgcgcgcgt cccgccgtcg cgcgccgctt cgtcgcgttc catcgccctc gtcgtctcgc    109800
     gtcgtctcgc gcacgcgcag ttgaaccacc tgttcgcctt catcccccca tccctcgcgt    109860
     cgcgcggcgt cgccgcgcgc gcgcgcgcgt ccagcacgac gtccgcgcac ttcatcaccc    109920
     actcgcgcgc gatctgtcgc gtgcgatcgc ccatgacggt cgcgcggcgc gtcgtcgccg    109980
     cgcgcgcgaa tctcgagctg tcgcgatgtg agcgcgcgcc gcgccttcac gctcgcgcgc    110040
     gcgcgcgtcg cgcgccgcgc gcggcgcgcg cgcgatcgtc gtcggtcggt gtcgcggtcg    110100
     cgcgcgtcgt tcgccgcgcg ctcgcgcgtg cggcgcgccg tccgtcgtcg cgcgattcaa    110160
     acgcgccgtg tttcagcgct tcaatacgga cgcggttcat tatatatagt atgacactgt    110220
     atgcacacac gcgaccgacc gcacgcgcgc gagggtcgcg ccgcgcgcgc gattccgcgc    110280
     cgcagcgcgc gcgccgacgc gcgggggctc gacatcggcg ccgaaacgcg tcgcggttcc    110340
     gacgctcgcc tcgatgtccg tgcgcgcggc gccgcgacgc gccgcgacgc gcgcgacgac    110400
     gcgaaagatg cgcgcgggga cgcgcgcgcg acgtcacgcg atgcgatcgc gcgaacgggc    110460
     gacgcgcgag aagcgctgga cgcggacgcg cgcgacgatg gacgacgcgg acgcgtcgcg    110520
     cgcgaaagag gacgaggacg tgtggccgga cgcggatttc gcgacgggcg agggcgacgc    110580
     gaggacgtcg ggcgagggcg cgagcgcgag cgagacgttc aagacgtcgc tcacggatga    110640
     tccggcgttc gcgatggcgc tgcgcgcgga ggaagacgag agcgtggaga tggtgccgct    110700
     ggcgagcgcg gcggtgacga cggtgaagga gaaacggacg ttcgtggagg cgccgccgga    110760
     ggacgtgcag cgggaacagg ttcggagttt tctgtacccg ggagaggatg agctcccgga    110820
     cgacgtgtcg atgacgatat gggaacactt ggaggagctt cgagagcgcg cgctgatctc    110880
     cgccgcggcg gtgggggcgt tgattttggt gtgtttctgc ttcgcgaagg atttgacgat    110940
     tttcttggag gaacccgtca agtcgcaggg cgtgcggttt ttacagctcg gtcccgggga    111000
     gtacttcttc accacggtca aggtggcggg gtacactgga ttgctcgcgg gcgcgcccgt    111060
     ggtgctttac gaggcgatcg cgtacgtgtt gccggggttg acgctgaacg aacgcaagac    111120
     gctcggcccc atcgtaatcg ggtcctcggt gctgttttac ggcggcatcg cgttcgccta    111180
     ctacgtgctc gtccccgcgg ctttgaagtt cttcgtcggc tacgccgacg gcgccgtgga    111240
     gtcgctgtgg tcgatcgacc agtactttga gttcgtcctc gtgttgctct tctccacggg    111300
     tttgtccttc caagtccccg tgattcagct cttgctcgga caatccggga tcgtgtcttc    111360
     caagcaaatg ctcagcgttt ggaagtacgt cgtcgtcggt tccgtcgtcg ccgccgcggt    111420
     gttgacgccg tcgacggatc cgttcacgca aatgctcctc gcggtgccgc tgatgagcct    111480
     gtacctcggc ggcgccgcgc tcgtcggcgt cttcgaaaaa gaccgcgagg gcgagaccgc    111540
     gtaagcatag cacgcacaac atttagcgca ccattcatca acgctccaaa gcatcgcttc    111600
     gcttcaacaa cgaacgataa taatacaaca aacgagctac gtcgactaag cggacgcgtc    111660
     caaagaacga gctgcgtcga ctaagcggac gcgtccatgc gttcgacgac gctgtccgtc    111720
     gccgcggcgt ctctccgacg tttacacatc gccaacatcg cgtgcacgtt cgtcgtcatc    111780
     gccgccctcg ccgccttttc cgtcatcccg aaaaatgtcg ccaagttcac cacgtcgtac    111840
     atcgatcgca actcgatcgc gcgctccgcg ccgctcgaca agatgaacag ttcgcgtccg    111900
     ccgcgcgtcg cccgcgcgag cgcgctcgcg ttcgcgaaga accacatcct cgagttcgaa    111960
     tccctcagcg cctccccgta gcacagctca aacgatatcc gattccccgt cgccgccctc    112020
     accgcgctcg ccgtaaactt gtacctcaac cgccgccccg cgccgacgct caccacgtcc    112080
     gcgtgtttat tcgcgcacgc gctcgcgaac gcccgctcgc tcgtcggttc cagcgccagc    112140
     acgtcaaact tctccagatc ctctcccagc gcgagcatcg cgcgccgcag ctctcccggc    112200
     tccccgaacg cgatcgtgca ccgcgccagc gtccccgcgc cgtcccgtcc ctcgctttcc    112260
     ctcaccgcgc gcgtccgcgc ctcgagcgcc gcgcgcgccg tcgcgcgctg tcgctttgcg    112320
     tcgtcgctcc cgtccacgcg cgcgtcgatc gcgcacgtcc ggtaccctgc gcgcgtcgtc    112380
     gctcgcgtca gtcgcttttt cgcccatcca tccgcgcctc cccatcgcgc gttcgcgtcg    112440
     cgtgcgcgac gcaccgagcg cgcgcgcgcg gtcgagcgcg cgcgccgtcg tcgccgcgat    112500
     cgtcgccgcg tctcccgccg gcgcgcgcac ccgcgcgtcg cacggcgcgc gcatgcgcgc    112560
     gtcgcgcgat gccgagggca cgcgtcgcgc cgccgccgcc gcacacgacg acgcgcgcga    112620
     ctcgacatgc cgctcgcgct cgcgcgcggc gcgcccgcgc tcggcgcgac gcgcgtcgcg    112680
     ctcgagcgac gcgaacgcgc gcgacgcggc ggcgcgacgc gacgcgacgc gacgccgcgc    112740
     gcgatggggg cgatgggcgc gacgcgcgcg ggcgatcgcg cgatgacgcg ctcgagcgcg    112800
     acgcgcgggt cgggcgacga ttacgacctc gacgcgggca tcgcgggcgc gacgccgggc    112860
     gatggatgga cgccgacgtc gtacgacgga cgcgggagca cgggggacgt gtaccaaggg    112920
     ccggcgcggc tggcggaggg attgcgaaga cacaccgtgc tggtgtacgt cgcggacgag    112980
     accgggatga tcaatcgcgt cgcgggggtg ttcgcgcgac gagggtacaa catcgaatcg    113040
     ctcgcggtgg ggctgaacat cgacaaggcg atttttacga tctcggtgat ttgcagcgac    113100
     ggcgacgtgg ggaagctgat caagcaggtg aataaattgg ccaaggtgcg aaaggtggag    113160
     aacgtcacgg ataaggagtg cgtggaacga gggttgatgc tgctgaaggt gaagtgcgag    113220
     cccgaacagc ggtcgcaggt gctggagatt aatcggattt tccgagcgag cgtggtggac    113280
     gtggcggagc ggtcgctgac gatgtcggtg gtgggggatc ccgggaagaa tcgagcgttt    113340
     cagagcgcgc tgatgaagtt cggggtgatt caagtcgcgc gaacggggaa gttggcgctg    113400
     aagagagagc ccgtgtacag cgaggctcgg tctcgtcgag tgaaactcat ggaggcgatg    113460
     cgaaaggcga aggacgcggt gagcggatta aacatcaagg agaagagcgc caagtacgag    113520
     agcatcttgg cgtcacgaat cgttcgcgcg gtcgcgggga tggaacacga cgatgacggc    113580
     gacttgcacg tcggcgacgt gtacacgtcg ctcgagaacg acgaaatcgg agtgtgggac    113640
     gtccccgtgc tcagctcttc cttctcggga ctggggcacg gtagcgacaa agtcgacatc    113700
     gacaagatgg acgaaaacgc caagtacacg ccgcacacta tctctatttt ggtcgataac    113760
     cgcccgggcg tgttggattc catcaccggc gtgttcgctc gtcgcgggta caacattcag    113820
     tccctcggcg tcggcccgga aagaactttc gacatctctc gcatttccac cgtcgttccg    113880
     ggcagtaccg aagacatcgc gatgctgctc aagcaaatct taaaggtgcc ttacgtcatc    113940
     tccgccgaag atatcacgat gacgccgttc acggagcgcg aactcatgct catcaaggtc    114000
     gtcagctctc gcgcgcaacg agcagaaatt atcgatttgt gcggcatgtt ccgagccaag    114060
     gtgtgcgaca tctccgaaga caccgtcacc atcgaagtca gcgggcgcca gcgtaagatt    114120
     aacgccattc aagcgcttct cgagccgtac gggattctgg aagttgcgcg cagcggtcgc    114180
     gtcgcgctcc cgcgcgattc gggcgtcgat tccaagctca tgatggcgat cgagtccgaa    114240
     agcgatctcg acaagtggta acgcgaaatt tatcaatcga atacaacaac acagatccta    114300
     cgcctcgccg agcgccccag gaaacaggcg taaaaagtta tcgcctctaa tattcgcgag    114360
     gagcgcggga tcgtcgtcgc ctatttgccg ctcgagcact cgaaccgcgt cggcgtagcc    114420
     tccctcctcg gcggtgacga aagggtagtc cgacccccag atcaatcgat gtggaccgaa    114480
     caccttgacg agctcgcgca attgcgtcgc ggtcgagtcg cctccgtcgc tcgtttctat    114540
     gcgcacgcgg aaatgcgccg aaaccttcac gctcacttgt gggaagtctc gcccgagcgc    114600
     ctgtaacaac tcaaagttcg gatcatccac gcccttggtg aatccgaagt gatcgatcag    114660
     caccggcacc gtcggttccg ctttgagaag agcgcgaatt tcgtccacgt gcaaatcaag    114720
     tccgttgaag cacatgaaac ccaccaccgc gggcggcgtt cgcgccgcgc acgcgcgcat    114780
     catttttctc cctatttcgc catccatacc cttgccattc ggccatagcc ctggattgaa    114840
     tcggacgccg cgaaaacgtc ccgcgaggag cttctccaac gcctcgacgc cggcgtctcc    114900
     cgcgctcggg ttcgccagac acatccccac gaagcgattg gcgtgcgtct ccaacgcacg    114960
     ctctacgtac gtgtgatcga accctaggtt tatcggttgc acgatcatcg ccgcgcgcac    115020
     gccgttggcg tccatcgcgg cgatgagctc attcgccgcc ccgggaactg gaggcgcttt    115080
     gccgtcttcg tacgcgaaat cctccgcgct cggccacacg tgcacgtgcg cgtcgattat    115140
     ggacgcgcgc atcgcgatgc gccggctcga aacgcgcgtt gagacggtga cgctcggtcg    115200
     aactcgcctc gccgcggccg cgagcatggt tatgcggctg cgcagctgcg gcgtcgagag    115260
     gaacgcactt ctcacgagag cggtgaaaca gttttaagcc tcttcgatga gcgctaacac    115320
     ttccagcgcg gtgcctcgac acagcgtcac gcccgcgccg ccgtgaccgt aggcgtggat    115380
     gagcgtcgcg tccgccgggt ctcgttcgca tcgaactacg gttcgcgagg ggcgcagacc    115440
     gacgtttgtg ccgatgactt tcgtttcatc gagctcaggc cacagccgtt tacacttcgc    115500
     gatgatatct cgctcatctg cgtcgtctgg ctcgagtgaa tcgttgtcga cttgcgccgt    115560
     tccgccgaga accgtgcagt cggctcgcgg gatcaaatac gcgagagcgt tgggatcgtc    115620
     gtcgaataat ccgtagccgc aatcttgctt caggtacacg acttgtcctc gcaccggctt    115680
     gacgagatcg tcgttcacca ggcgcctcgc gccgagaccc gtgcaattga ccacgaacgc    115740
     tcgctcgcta ttcgacgcga acgctctcgc ctcccgcacg tctgcgagcg tccgcgtctc    115800
     aaatttcacc cccagcgctt cgcatcgcgt cctgagccaa ggcaagaatt taggcatcgc    115860
     gatcacgggc acgtcgaact cgtatccacc cgcgtatttc tcgtcgtgct ctccccgttc    115920
     gagcgcgcgg tagtgctcca ccgcgttcgc ccatcccgcc gccggcgccg gcgcctttaa    115980
     aaattctcga catcgtcgca tctccacccc gcacgccccg tcctcgcgcg cgagctcgcg    116040
     ataccactcg tacgatttaa tcgcccacgc gtcgctcagc gccgcgggtt ccgtgcgcac    116100
     gatgaacggg aaccaaaacg ccgccgcgac gctcgacgtc gtccgctcga acgacgccgc    116160
     gacgacgcgc acgtccatcc cgcgctccgc cagcgtcagc gcgaccgtca gtccgatgac    116220
     gccgccgccg acgacgaccg cggacgcgtc gccgtccgtc gcgtcggccc tcgcgccggc    116280
     gcgcgcgcgc gcgcgacgcg cgacggttct ggtcgcgccg cgcctcgcga cgtccgccgt    116340
     cgcgcgccgc ggcgcgcgcg cgtcgcggcg cgacgacgcg cgaggcgcgc cgcgcgcgcg    116400
     catgtcgctc gacgcgcgcc gcgcgacgcg cgacgcgcgc gacgccgcgc ggtgatttgt    116460
     acggcgtcga tccaacggcc gacggcggtc gacgacgccg cacacgacga cgcgacgcac    116520
     ggtcgagccg aggcgacgcg cgcgcgaagg acgcgccgag gacgcgcccg tcgcgcgcga    116580
     acgccgcgaa tcgacgcgcg cgcgagggag atcgacgacg cgagggcgtt gaatttgaag    116640
     gattggattc gtcgagatga attctgaatt cacgccggaa aacacgcgct cgaacgcgct    116700
     gttcgcgtcg gacgcggcgc tggacgcggt gtcgacgccg ggcggcgacg cgccgcgcga    116760
     tgggttcgaa ttcgaggcgc tgaaagaccc gaggatcgat tggggggcga tcgcgcggtg    116820
     cgactcgaga gacgcgcggc gacgacgcga tatcgacgcg ctggagagcg tgctcgaggc    116880
     gtgcgtgcga gcggacgtgg acagcgtgac gaatcaagac atgtgcgaac cgaaacgggg    116940
     gcgggagctg acgaaattgc tgcagatgtt ggtggaatat ttgttgcacg tgcaggaggc    117000
     gctgagcgag ggcaaggcga aggcggagcg agacgcggag gggtggaagg atcgggcgag    117060
     gacggagcga gatgaggcga gaaaatccgc gagggagtta aggctggcga tggaggcgca    117120
     cgaggcggag ttgatcgcgg ttgcggcgga atacgcgaag aagaggaata atccggataa    117180
     cgccgagctc gaggacgcgc gcaggcgagg ggagtcgatg gcggctgaac gcgcggcgaa    117240
     agacttggaa aagcgattgc gcgaacaaag agagcttttc gatagtgccg tcgatcgcat    117300
     gcgcgcggcg cacgcggagg cgcaggcgga ggccgcgcgc gagttgtcgg ctcgaaaggc    117360
     ggagctcgcg tcggcgcgcg cgcagtacgt ggcgtcatcg acggagtcca cgaaggaggc    117420
     gaataggatg gtcgctgacg cacaagcgct cattcgtgag gcacgcgaga aggcggagtt    117480
     ggaaaagtcc aacgtcgcgc gcgtgcgctc cgagctcaac gctgcggtgg aggcgactca    117540
     aaggcacaag cgttcgttgg tcgacgtcaa gtcggagctc acgcgactca aggaagattt    117600
     caaattcgaa cacgagtcga acgccgagtt acgaaaagca ctagagcgcc gcgacgaaga    117660
     gcgcaagttg atgcgcgaac aaattgagcg tctccacggc aagcagaaat cgtcgatgac    117720
     ggaggaaatg gccgagttga cgaacatgcg agaactggca aagaacaact acgccgaaat    117780
     cgaacgcctg aagcgcgaaa acgaagtgct tcgcgaggat aagaatgcac aatccacttg    117840
     ggtcgcggag gaaaagaagc gttgggtgtc ggcgaatgag caaatcttac aagccgagtt    117900
     gacagagaag gacaacgcca tcgctcagtt gcgcgaagag atttcgcaat tgagaaacga    117960
     catcgccacg gagcgttcgc gcaagatgat cacgattaaa ccaatcatcg cagagtacga    118020
     ggctcgagcg caagctgcgc cgcccgtggc ccccaaaccc gcggtgaagg cagcgaaagc    118080
     gcgcaagacg ctcgagcccc cgccgagcga cgtccaagac atggatgggg cgctccacgc    118140
     cgccatgctt gatctcgacg tcgacttgga cgcggtcgcc gaggctggtt tggacgacgc    118200
     cacgttccag gaagctatgg cgaagttcga agcggttcaa atgcaagacg taccgaagga    118260
     gttgcgcgca aagtatgcgt tgtcgcgcgc taagattcaa aaggaactcg acggcgtcgc    118320
     ggttcgttga aatatgtatt aaagtctcat atcaatctcg tctaaagctc gcaaaattca    118380
     cccgtctcct cggcaatcga ctgctccgtg cgacggacga tttcaatcaa atcttctccg    118440
     ccgatcgcgc cgtaacggag gcagtgcgtc tcgaccatga cgttcgtcgc gtcgacgact    118500
     tcgcgcgaat ccttaccgaa cgttcgccgc gcgttgttcg ccaacattgt gctctgtttg    118560
     cacgccgcga atccaccggc atccaccgcg ctcaaatcct ctatgatcgt cttaacgagc    118620
     gcgtgcttca tctcgcccgc tcctgtgacc gaaagcgcga gcgaaagaga ttcgtacatc    118680
     gagtagcacg acatgcgcgc catggcgagc tgcgcgcgac tgagattgag cgccgcgagg    118740
     cgactctcgt accaccctcg aagctcgatc aacgggttca cgttcggcac cgtcttgccc    118800
     ttcgttttct tcatctccgc caactcttcc ttgaaatcct tgagcacggg cttgagcttg    118860
     cgcttgagct cgttgaccgc gcacgtaatc ggcccggcgc cctcatcgtt ttcttccgcc    118920
     tcgtcggctt tcttttcctc gctcacgtcg cccgtggatt cgaaagcgca tcgcgcgcag    118980
     ttgcacatgt acccgcgtcg actggcgaac gcgtcgcggt ctttcttcgg catgagcgtg    119040
     tcgtagtact tcatcgtaat ctccgccccc gccgggagat tttgcgaggc gaagacgagc    119100
     atgatttgcc cgacgttgat gcgatggcaa ttcggcgcgc acgagtggtt gatgaagctc    119160
     ggcagcggcc agacgccgca cagacggcgc ccagagatgg cgcagttggc gacgactttc    119220
     gggatgaacg ccagttcttc cgggctctcg ggcgcgggtg cgttttcctt attcgccgcg    119280
     ctgatgtgct tgcgaaacac gctcatctcc ggcgcgtctt tttgttcatc ctcgctcgac    119340
     gccggcagag ccttgagaat cgcccaatcg gccgggtgcg cgcgcgcagc ctcgtaaaga    119400
     ccgcggacga ggttttgttc caccgtcttg ccgaacgacg ccgagctcag cgggctctgc    119460
     accatgagca aatctcccgc cgcgacggcg ctcgtcgtca ccaagccgcg acgaccgtcg    119520
     gagagcttgg acactcgaac cacaccgatg taatccgcac aacggcggaa actcgcaccc    119580
     atgcggttca aatacaacgc tccgagatcg tacgcccccg tgaacgcttg cgccgtgagc    119640
     atatcgcatt cgagcttgac tttttccagc gtcgcccgaa ccgccgcgtc ctccggcgcg    119700
     tcggcgagac gcgatccctc atctgccgtc ttcgccgcat ccacgtatcg cgccatcccg    119760
     ttcaacgcca tgctcttctt ataaatcgcc ttcagttcca tcgccttatc ccccttcgag    119820
     cactccaacg ccttcgtcgc gcactccaac gccttctcga acactcgcgc tcgcaagtag    119880
     cactccgcct tgttcgcgta cgcgctcgcg tccgacccat tcaacttcag cgccgcgtca    119940
     tacgccgcga tcgcgccgag ataatccccc ttcgcaaact tttcgtttcc ttccactcga    120000
     atcgcgtccg cttcgtccac tttctgcgcc ttcttcgact tcggcagcgc cgcgcccatg    120060
     ccgcccagtc cgaacggcat cgctctcgcg cgcgcgcgtc gacgccctcg cctcgagtct    120120
     cgctcgcgtc tgcgtcgcgc gttcgatcgc gcgtcagtca tcgcgccgct tcgtcgcgcg    120180
     caccgttcgc cgttccgcgt cgcgtcgccg tcgccgtcgc cgtcgcgcgc gatatctcgc    120240
     gcgctgtatt cgttatccac aacgtcgcgc gcgttcgagc ctcgcgcgtc gcgcgtcgcg    120300
     cgcctcgcgc gtcgctcgcg cgcgcacccg ctcgatgatt cgctcgcgct cgcgctcgac    120360
     ctcgcgttcg cgctcgtcgc gcgccgcgcg tcgtcgtcgt gtgccgtcgc gcgcgtcgtc    120420
     gactgtcgcg aaagatcgtc tcgattcgta tgggtaaaca gtgagacacc cagcacacgt    120480
     ccgcacatgt ccgcgcccgt cgacgtcgcg cgcgccgccg ccgcgcgcgt tcgcgcggac    120540
     gcgtccagca cctcgcgcgc gggctccggc gtcgtcgtgc gccaccgcgg cgtcgcgtgc    120600
     gtgctcaccg ccgcgcacgt cgcgtcgttc gcgggcgcga agaatgcgct tcgcgtcgag    120660
     ctcgcgagcg gcgccgcgcg gcgcgggcgc gtcgtcggcg tgcacgacgc gctcgacctc    120720
     gccgtcgtgt acctcgacgg cgacctcgac ggcgcggcga cgatggagcc gggcgaggcg    120780
     cgcgtcggcg acgaggcgcg cgcgctgggg acggcgcagc ggtacgcggc ggcgacggcg    120840
     gcgtgcgcgg acgcgatccg aggacgacgc gagaccggac gcgtgttgaa gatacaccgc    120900
     gatgaccgcg gtgacgacac gcacgcgatg cacgacgcgc gcgtgctggc gggacagtcg    120960
     ggcggggcgc tcgtgcgcga gacggatggg aaactgttgg gcgtgcacag tttcggcgac    121020
     gcgttttggg gcgggagcag ggacgtgtgc gtgctggtga acgcggcgac gctggacgcg    121080
     atcgagatcg cgcgcgatgg cgtcgatccc gaggtgtacg cgacggcgcg ggtgaacgcg    121140
     atgatttttc gttcgagcga cgaggcgctg aagcgcatgg cgcccgagtt gtcggcgaag    121200
     cagcgcgcgt cgtggatctt ttgatcggtc gcgtcgatcg gtgatgtaat actagtgatt    121260
     gttgtttgtt gattgcgcta aacgatgcgg cgaggtgccg cgctaggagg tcacgcgtct    121320
     tcgtctcgcg cgccgtacgc gggacgcacg gcgtaatttt ctagatacgc gacgtcggcc    121380
     aaatataacc cgtgcgcggg cgccatttgc ggcgcgcgcg cgacgtcttt cgcttcgaga    121440
     agctcctgaa cgtctttcac ggtgaggtcg ttcgcgccga cggctttgag cgcgccggcg    121500
     aggagacgga cttgatggta aagaaaactg ggcgcggcga cggcgatgga aatcttttgc    121560
     ttcgtaccgc gcgcctccgc ggcgggccac tccgtgagct cttccttgac gtcgatggac    121620
     gtcagcgtgc gcacgggcga gctcgcttga cacccgttcg cgcgaaaaga actgaaatcg    121680
     tgcgtgcccg tcagcgccgc cgccgcgtct cgcatcgcgt ccacgtttaa acgcccgtcg    121740
     cacgtctgat atcgacgcac cgacttcacc ttatccccgc gctcgctatt attcaccgcg    121800
     cgcacgtacc acgcgcgctc ggcgtcgaac aagctccccc cgtcgtcgcg ttcgccgacc    121860
     aatatatcgt atctataccg cctcgccacc gcgtcgtgcc gcgcgtgaaa ttttggattc    121920
     atctcatcca ccctgacgca ctccgtcacc cgcaccgccg cgccgagctt tctcaagtga    121980
     taattcaccc ctcttcgcac gctcgcgccg tcgtgcggtt cgaccgtcgt cccatccttc    122040
     gtcgttctcg cgaagtcgaa gtgcgccgag tttcgcagcg cgtgcacgcc gacgtccgtc    122100
     ctcgagctac cgacgcactc gatcgctccg cgcgcgcccg tgaaagccgt gagcgcttca    122160
     tccagcgcgc cttgcaccgt cgccgcgacg ccgcactgcc tctggaagcc gcggaagcgc    122220
     gcgccgtcgt actccaaaaa ggcgaggtag cgcgggacag cggcggcgat tcgcttcgac    122280
     gccaccatct ccgcgctctg cgcgctcacg ggacgcttgc gagacgcgtc ggggtcgttc    122340
     gagcggctcg ggcgtcgacg agcgacggtt gcgctctcgg gcatcgaggt gtgaagcgcg    122400
     agtcgacgcg cgggacaaat gcgggacgcg acggacgagg gactttgaca tctgtgtatc    122460
     gtgaatgtca tcgaaaacgc gatgtttcgc gcgtgtttac tattcgtacg cgctgtcgga    122520
     tgcaccgcac acggcgacgc ggacgacggc ggaatgttcg ccgttactta tggcgtcgaa    122580
     ttcgtcgcaa atgcgacggc gttcgtcttc gctcaatctc gaacgcaaac ccacggagag    122640
     catgtctagc tccggagcgt ctggcgtgaa agggaacgtg ttgaataagt caacgagctt    122700
     gttgagctcg agcatggtgg cgacgctgtc gttacttcga agtcccgctc cggcttgaac    122760
     gacggcgccg cgcacgcgaa cggcgacgtc cgccatgacg atggagacgc acttgtgcgc    122820
     atctaggctc agatcatccg aaagaccgac taaaaatggt ccaacaggag tgttaaatgc    122880
     gctcgtcgcg cccgcttggc cgcgcatggc gtccgtgacg gcgaaatcag cggcggctcg    122940
     aaagatggcg actcgcgcgc tctccggtcc gaccgacttt accgcgcacc ctcgctcgcc    123000
     cgccgccgcg cacgcggcgc gaaaatcggc gatatcatcc gcactgaatc ccgcgccgct    123060
     gactcgcttc gccgcgagcg ttgctccttg cgctttcgcg acttgaatca gcgcctcctt    123120
     gcgtcccggc ggcacgtact gcggcgacgg cggcgtccac cacgccggca acgccttcgc    123180
     cgcgccgctc gttttcttct cgtttccccg cgccttcgtc gcggatcccg gctttacgtt    123240
     cgcgtcttcg ggaacgtcgt ccaaagcccc ctctaaacgt ttgcgttcgt cccgaaaccg    123300
     atccgccgtc gccggcaccc aaacctgccg cccgccgaga ctgcggtcgc cgacccaccg    123360
     ccccggtccc gtcgcccccg gcggcggcgc ccgacgaccc acgcccttga acgcgctccc    123420
     gatcgctcga agcgggttct cgcgattgat gaccttgagc gcgatccacg cgcacgcgaa    123480
     cagcgtcccc cacgccgccg ccgcccgccc gtacgccgac gccgggttcg gtcgctgcgg    123540
     cctgtacacc gtcgcgtacg tcccgggcgc gccgacgcgc gccggaacgt ccgcgcgcgg    123600
     cctgaacgcg cccgcgtcgc gcggcagcag cgcgtcgacg gctttttgcg acgccttttt    123660
     cacttttcgc tgcacttttc ggataaatcg ttgcgcgtcg ctccgtcgct ccggacgcgc    123720
     gcgcgcggcg tcgagcgcgc gcgtcgccgg cgcgacgtgc ttttcgacgt aatcgtccat    123780
     ctcgcgctcg taatcgcgcg cgctggacga tcgtttcttg gcttctttct cgcgaaggcg    123840
     attcttgggg ccggcgcgcg ggacgacgtc gacgcgaccg ggacgggcgc ggcgtcgcgc    123900
     gagcgtcgcg cgcgcgctcg cgacgcgcgc gccgaagcgt ggattcgtcg cgcgaagcga    123960
     catctcggtc gctcgcgcga gacgcgcgcg atgcagtgaa gggcgcgcga gtcggtttcg    124020
     tctttgatgc tacaagccgc ggcgcgcgcg cttaaatttc caatttggac gtcgtgcgct    124080
     cgaacgaggc gtcgctcagc ggcgttccac cgtcgcccgc gctcgaaaac gccgctatcg    124140
     gcgacaccgt cgcgccgtcg aacctcccgc cgccgtcaaa cttccccggc gtctcgtcca    124200
     cgctttggtc gagcagccaa tcgctcccgt tcaacgacgc ctccaatttc gcctccatcg    124260
     ccgcgatgtc gctcatgacg cccatcgacg ccacctcatt cttaatcatt atctccacat    124320
     cgctcacccc gagatcggcg gcgatgttct ccgtcttgac cgtcaattcc atcgctcgaa    124380
     cgcgcgtctc cgcgtcgtcg tcgccgagcg ccgcgcgctt cgccctcgcc aggacgcctc    124440
     gcagcccgcg ctctggggac ggcgtcccca gttcgcgcat gtacggctgc ttcagcaacg    124500
     ccgcgaccgt gtccaggtct ccctttcgag tctcgggtcg ccgcgcgcgt cgtccgagga    124560
     gaaacgcgcc gacgagcgac gcgccgacga ggatgaattg cgtcgcgctg atgtcgtcga    124620
     tttcgtcgcg gatttctttc gttttctcgc gcacgcgcgc gcgggcgtcg tcggcgacgc    124680
     ttcgcgcggg tttctttcgc gtcggcgcgc gcgcgcggtc gaagacgccc atcgccgcgc    124740
     gatctcagcg tcggcgaatg acgacgacga ttggctggtc ggtcgagact ttttacgacg    124800
     ccgccgagcg aacgcgacgc ggaaacggga cgaaggactc gtgatcggac ttgtccttgc    124860
     cgggcagcgg cggcgacgag ggaatcccaa agtcgcgaga tcgaaacgcg cggaattcgc    124920
     gcttgatggc ggcgtacggt ttgttctcca tcgcccgacg cgcgcggggc gggagacggg    124980
     ataaaacgtc ggcgtcgaag gaggcgcaca gctctcgcgc gcacagggcg gaggacgccg    125040
     cgccggaggc gcgacacttt ttgccgtagc cgtggaggaa accgatggcg ccgagaaggc    125100
     gctcgacgcg gccggatgcg atgtcgacgg cgccgacggc gtcgttgaac tcaaacgtcg    125160
     atcgcgacgg cgcgacgtac gtcacgcacg tcggcgacgc gacgcgatcg ccgtcgacga    125220
     cggcgcgata ggacgagaga tcgtcgctcg gtgcgtcgac ggcgacgcat cgtggttcga    125280
     cccggtcgtc ggattgtgag tcgtccaatc gcgctcgttt gacgatcgcg cgtttcaacg    125340
     cgagagcgac gacgcgtttc gtctcttcgg cgcgctcttc gcgaacgttt ggaatggaca    125400
     cgcagatcga ccgtggcttg atcgcttcgc gcgcgacgag gcgcatgagc gtgccctgta    125460
     aaccatgcat ctgccagcga cacattttat ccgaacagct caaacaaaac gatggcgcgc    125520
     ctctgcccgg cttccatcgc acggcgccga cttcttgcgt cgggcgatcg cgttcgggat    125580
     ccgcgccgcc gccgccaccg ccgccaccgt tcatgtccgt caatattttc gcacccgtca    125640
     cccccgcacc tccgcccgca ccccccgtcg tcttcgctcg cttcaccgtc gccgtcgaag    125700
     cctccgcgcc gccgtcgctc cgcctcgcct cgctcggcaa ctcgaacacg ctcgcgtcgc    125760
     cgcacggcga ctgactgcaa tacgcgtgca cctccacccc cgcgcgcatt cgcacccgat    125820
     tcccagcgcc taatatctca tcccacgccg tctcttcgtc gcacccagcg ccgcgttcgc    125880
     gcgtcacctc gaacacgctc gctcgtccgt ccctcgcctc ggcgtactcg cgctgcaacc    125940
     accgcgtcaa cgcgcgtctc gccaacacct ccgcgtgaca gtccccgatc gcgcccccgt    126000
     cgcgcgcgcg gttcgccatc ggcacgcact tcgtccccgt cgcgaacgcc gcgacgtagc    126060
     acgtccctcg cgcgctcgcc gcgtcgtttc gctcgacgat gcaaaaagcg cacagcgtcg    126120
     tgtacgcatc cttcgacgtt ttctcgcgtc cgcgcgcgtc gtacgtcgcc agcgcgcacg    126180
     cgcgcacgac tgcggcgacg cgttcgacgt cgtcgacgtc gtcgacggcg tgcgcgcgca    126240
     tgcgcgcgcg cgagactgcc gattcgcgcg cgcgtctcgt cgcgcgcgtc gccgcgcgcg    126300
     tcgagcgtcg cgcgcggctc ggacgcgaag tcgagcgcgt tcgagcgccc tcactgttcg    126360
     cgtatacgcc atgtgtccga acatcgcgcg cgcttttcgc gtttcgcgcc gcgcgcgtcg    126420
     tattgcgcga cgacgcgtcc catcgatcgc gacgcgcgat cgctaagcgc gatcgcgacg    126480
     cgcgcgaccg accgaccgac cgccgttaca tgcgccaaca ccataaatga ggttgcgcat    126540
     cgcatctttc gccagatcgc gacgcgcgtc gcccgcgacg ccgcgaacga ggacggcgaa    126600
     cgaccggcga tgacgcgcgt cgagcgcgtc gcgctgctcg gacgcgcgcg cgacgtcgag    126660
     gacggcacgc tcggcgcggg aggcgcgttc ttcgggacga acaccgcgcg cgacggcgac    126720
     ggcgacgacg acggcgcgcg agagcgcgcg cgcgagcgcg gcggcgcgcg gcgaggacgg    126780
     gggacgatcg cggtgggagc gatgtgcgtc gcgatcgggg tcgcgatcgg atcggtgacg    126840
     acgtcgacgc gggagggagg acggacgacg ggcgacgtcg cgagcgtcgg cgcgaacgcg    126900
     ccgagcggag cgacgagtcg cgcggcgcgg ggcgcggaag aggcgaattt gggcgacgcg    126960
     acgtcgttgg cgatcgcgag cgttcccgcg gattcgtgga tgtcgttctc gacggggaaa    127020
     gtgcgaaagc gaaagtatcc ggattcgttt tattacgtcg tcgcgccgga ggcggacgag    127080
     gaggtcgggt atttgggcgc gccgagcgac tggccgaccg gggatcgggt gacggtggat    127140
     ctgcacaccg ggtgctcgcc gatcgacgct ctgccgttcc agcgtcccgg gtttgatttc    127200
     gacaccgttc aggcccgctt tgtgagcaag aagctcagca tggagttcat gtttgaggac    127260
     tcgcagccga tgaccaaagt cgggtgcgga catttccggg ccacggtaga gctctcgaaa    127320
     ggatgggagt ttgggttcta tcttcatgcg aatggcgacg acagcgacga gaacacgatg    127380
     ctcgacatcg ggtgcgaaac cgcggtgccg ggcgccaaca acaccaagtg tccggatttc    127440
     gcttcaccgg cgatgctcgc gacttcggag tgcacggaca aattcgtgtg taatcatggt    127500
     ctgtacacgt tctggaatcg aagatacgat ggcgaacaaa cgtcgttcct gtggggggct    127560
     tgcggaagcg agtgtccgca ccaggactgc ggccacatgt actgcgcggc gaacgagcgc    127620
     gtgcagaacc aagcgtgcgc gtcgtgtccg cctgggacga cgaacgatgc gggcgataag    127680
     aacgtcggcg ccgatacgca gtgtgatccg gtcatctgcg gagcgcacat gcgcgtgcaa    127740
     gatcacaact gcgtgcagtg cgtcgccggt aaggagaacg aagccggcga cgacgcctca    127800
     caaagtaaca ccgagtgcga cgccgtcatt tgcgagccga atcatcacgt ggcgggcaat    127860
     gtgtgcacgg cgtgtcccgc cggtcacgcg cacgccggcg gcgacgtgca gcacggccct    127920
     gatacgtcgt gcgacgaagt gctttgccac acgaacgagc gcgttctcgg ccaccagtgc    127980
     gtggcgtgtc ctccgggctc gacgaacgcc gccggcgacg gcgcggcgag cggcgatacg    128040
     cagtgcgacc acactatttg tccggcgaac atgcacgtcg ttggtcacgt gtgcacgccg    128100
     tgtccaccgg gtatgaacca cccaggtggc gacgacgctt ttttcggcga cacgtcgtgc    128160
     agcgccattc tctgccagtc gaatcagcgc gtgctgggtc acgcgtgcgt cagctgtccg    128220
     cccgggacga cgaacgatgc ggacgacgac gcctcgggtg gcgacacgca gtgcgatccg    128280
     gtcatctgcg gagcgcacat gcgcgtgcaa gatcacaact gcgtgcagtg cgtcgccggt    128340
     aaggagaacg aagccggcga cgacgcctca caaagtaaca ccgagtgcga cgccgtcatt    128400
     tgcgagccga atcatcacgt ggcgggcaat gtgtgcacgg cgtgtcccgc cggtcacgcg    128460
     cacgccggcg gcgacgtgca gcacggccct gatacgtcgt gcgacgaagt gctttgccac    128520
     acgaacgagc gcgttctcgg ccaccagtgc gtggcgtgtc ctccgggctc gacgaacgcc    128580
     gccggcgacg gcgcggcgag cggcgatacg cagtgcgacc acactatttg tccggcgaac    128640
     acgcacgtcg ttggtcacgt gtgcacgccg tgtccaccgg gtatgaacca cccaggtggc    128700
     gacgacgctt ttttcggcga cacgtcgtgc agcgccattc tctgccagtc gaatcagcgc    128760
     gtgctgggtc acgcgtgcgt cagctgtccg cccgggacga cgaacgatgc ggacgacgac    128820
     gcctcgggtg gcgacacgca gtgtgatccg gtcatctgcg gagcgcacat gcgcgtgcaa    128880
     gatcacaact gcgtgcagtg cgtcgccggt aaggagaacg aagccggtga cgacgcctca    128940
     caaagtaaca ccgagtgcga cgccgtcatt tgcgagccga atcatcacgt ggcgggcaat    129000
     gtgtgcacgg cgtgtcccgc cggtcacgcg cacgccggcg gcgacgtgca gcacggccct    129060
     gatacgtcgt gcgacgaagt gctttgccac acgaacgagc gcgttctcgg ccaccagtgc    129120
     gtggcgtgtc ctccgggctc gacgaacgcc gccggcgacg gcgcggcgag cggcgataca    129180
     cagtgcgacc acactatttg tccggcgaac acgcacgtcg ttggtcacgt gtgcacgccg    129240
     tgcgcgccgg gtcgtgacca cccaggtggc gacgatgcga ctctcggcga cacgtcgtgc    129300
     agtgccatca tgtgcgggcc caaccagcac gtcgtgagcc acgcttgcac ggtgtgtcca    129360
     gcaggaatgg ttaacgatgc gaacgacgac gcttcgggtg gcgacacgca ttgcgatccg    129420
     atactgtgtc catcgaatca acgcgtgcag ggtcatacgt gtgtgcaatg tgcgcccggg    129480
     aagaccaacg cacccaatga tgatgcctct aggggcgaca ctgagtgcga tattacgtac    129540
     tgcgccgcaa atcagcgcgt acagggccat caatgtgtcg cgtgtgcgcc cggcacgacg    129600
     aacgatgccg gcgatgacgc ctcgcaagtc gacacgcagt gcgctccgat catttgtggc    129660
     gcacacatgc gagttcaaag tcacgcgtgc gtacagtgcg tcccgggtcg cgagaacctg    129720
     gcgggtgacg acgcctccgg ccaagataca ccctgcgatg aaatcgtgtg cgaagagaac    129780
     cacaaggtcg tgagccacca gtgcgtggcg tgccccgcgg ggaagataca cacggctggc    129840
     gatgttgctt cggggccaga cacgtcttgc gacgcggtga cgtgtagcac gaacgagcgc    129900
     gttcaaggcc accagtgcgt ggcgtgtccg gccggcacga caaacgacgg cggcgacgac    129960
     gcgtcgggtg gcgacacgca gtgcgatccg gtcatttgtc cagcacaaac gcacgtacaa    130020
     aaccacgtgt gtgaggtgtg tcctcccggt catgcgcacc caggtggtga cgacgcgtct    130080
     caaggcgaca cgcagtgcga cgcagtgatg tgtggggcaa attatcacgt gcaagatcat    130140
     cattgcgtgc catgtccaac gggtaaagac aatcaagcga acgacaatgc cgcgggcgca    130200
     gatacagagt gcgacatcat ctattgtgct gccaatcaac gcgtacaaaa caacgtctgt    130260
     accgcgtgtc cgcccggcac aattaatgca ggcggtgata acgcgtttga ccatgatacc    130320
     acttgcgata ccgtttattg cggcgtgaat caacacgtct ttgaaaatga atgcgtccct    130380
     tgtccggcag ggatggtaaa cccgtcggga gacgacgcca ccgggccccg cacgttttgc    130440
     gagccaatca tctgcggcgc gcacatgcac gtacagaatc atcagtgcgt gcaatgtgct    130500
     ccaggtgatg aaaatttggc tggcgatagt gccgcgcaac acgataccac ctgcgacgag    130560
     gtcacttgtt ctgcgaacga gcacgtggtg agccaccaat gcacggcgtg tcccgccggt    130620
     cacgcgcacg ctggcggcga cgtgcagcac ggccctgata cgtcgtgcga cgaagtgctt    130680
     tgccacacga acgagcgcgt tcaaggccac cagtgcgtgg cgtgtcctcc gggctcgacg    130740
     aacgccgccg gcgacggcgc ggcaagcggc gatacgcagt gcgaccacac tatttgtccg    130800
     gcgaacacgc acgtcgtcgg tcacgtgtgc acgccgtgcg cgccaggcta cgaacgactt    130860
     gccggcgacg acgccaccgg tggtgatacg caatgcagtg ctgtcttgtg cggcgcaaac    130920
     atgcacgtgc agaataattt gtgcgcggcg tgccccgctg gcacgacgaa cgccgccggc    130980
     gacgacgcct cgcgaggaaa ctcggaatgc gatcacacta tctgcgaagc gcacatgcga    131040
     gtgcagagtc atcagtgcgt cgcgtgcatg gatggcaagg aaaatctggc gggagacgat    131100
     gccgctgggg gggacacaca atgcgatgaa gtcatctgcg ctgccgatca tcatgtatta    131160
     aaccatcagt gtgtatcgtg cccttacggt cacgcgcacg ccggcggcga cgtgcagcac    131220
     ggccctgata cgtcgtgcga cgaagtgctt tgccacacga acgagcgcgt tctcggccac    131280
     cagtgcgtgg cgtgtcctcc gggctcaacg aacgccgccg gcgacggcgc ggcgagcggc    131340
     gatacgcagt gcgaccacac tatttgtccg gcgaacacgc acgtcgttgg tcacgtgtgc    131400
     acgccgtgcg cgccgggtcg tgaacaccca gccggcgacg acgccaccgg tggtgatacg    131460
     caatgcagcg ccgtgatgtg cggatccaac atgcacgtcc aaaaccacgt gtgcacggcg    131520
     tgcccggccg ggacgacgaa cgccgccggc gacgacgctt ccggagcgaa tacgcagtgc    131580
     gacccaatct tgtgtggcgc gaaccaacac gtcttgaatc atcagtgcat gcagtgcccg    131640
     cccggcacgc tcaatgacgc cagcgatagc gctgccggtg gtaatacgca gtgcgacgcc    131700
     gtgcagtgcg gctgcaacca acgcgtgcag ggccatcaat gtgtcacgtg tgcgcccggg    131760
     acgacgaacg acgccggcga tgacgcctca caaggcgata cgcagtgcga tccgaccatc    131820
     tgcggcgcgc acatgcgagt gcaagatcac gcgtgcgtag cgtgtgtgga cggtcgagag    131880
     aacctggcgg gtgacgacgc ctcacaaggc aacacgcagt gcgacgaaat cgtgtgcgaa    131940
     gagaaccaca aggtcgtgag ccaccagtgc gtggcgtgcc ccgcggggaa gatacacacg    132000
     gctggcgata ttgcttcggg cccagacacg tcttgcgacg cggtgacgtg tagcacgaac    132060
     gagcgcgttc aaggccacca gtgcgtggcg tgtccggctg gcacgacaaa cgacggcggc    132120
     gacgacgcgt cgggtggcga cacgcagtgc gatattaccc ggtgcacggc gcacatgcac    132180
     gtacaaaacc atgtgtgcgt gcagtgcccg gccggtaaag agaacgtcgc gggtgatgac    132240
     gcctctggag gtaacacgga atgcgacgtc gtgcgatgcg gtgccaacca gcacgtcgtc    132300
     gaccacgtgt gcacggcgtg tccggccggg acgacgaacg atgaaggcga cgacgcttcg    132360
     ggagcgaaca cgcagtgcga tcccgtcatc tgtgaattgc acatgcgagt gcagaatcat    132420
     cagtgcgtcg cgtgtgcgcc tggcaaggag aatctggcgg gcgacgacgc ctcgcaaggt    132480
     aacaccgagt gcgacgccgt catttgttct gcgaacgagc acgtggtgag ccaccaatgc    132540
     acggcgtgtc ccgccggtca cgcgcacgcc ggcggcgacg tgcagcacgg ccctgatacg    132600
     tcgtgcgacg aagtgctttg ccacacgaac gagcgcgttc tcggccacca gtgcgtggcg    132660
     tgtcctccgg gctcaacgaa cgccgccggc gacggcgcgg cgagcggcga tacgcagtgc    132720
     gaccacacta tttgccctgc gaacacgcac gtcgtcggtc acgcgtgcac gccgtgtccg    132780
     ccaggtcatg aacacccggc cggcgacgac gccaccggtg gtgatacgca atgcagcgcc    132840
     gtgtcgtgtg ggcccaacat gcacgtccaa aaccacgcgt gcacggcgtg cccggccggg    132900
     acgacgaacg ccgccggcga cgacgcttct ggagcgaata cgcagtgcga tgcgacaatt    132960
     tgcgcacaca acaagcatgt tgtcaaccac gagtgtgttc cgtgtccaga tggccatgaa    133020
     cacccaggcg tcgctgatgc ttctggctcc gatacttcgt gtgatgtcac gctgtgtggc    133080
     gcgaaccaac acgtcgtgaa tcatcagtgc atgcagtgcc cccccggcac gctcaatgac    133140
     gccagcgata gcgctgccgg tggtaatacg cagtgcgaca ccgtgcagtg cggcgtcaac    133200
     caacgcgtgc agggccatca atgtgtcacg tgtgcgcccg ggacgacgaa cgacgccggc    133260
     gatgacgcct cacaaggcga tacgcagtgc gatccgacca tctgcggcgc gcacatgcga    133320
     gtgcaagatc acgcgtgcgt agcgtgtgtg gacggtcgag agaacctggc gggtgacgac    133380
     gcctcacaag gcaacacgca gtgcgacgaa atcgtgtgcg aagagaacca caaggtcgtg    133440
     agccaccagt gcgtggcgtg ccccgcgggg aagatacaca cggctggcga tattgcttcg    133500
     ggcccagaca cgtcttgcga cgcggtgacg tgtagcacga acgagcgcgt tcaaggccac    133560
     cagtgcgtgg cgtgtccggc tggcacgaca aacgacggcg gcgacgacgc gtcgggtggc    133620
     gacacgcagt gcgatattac ccggtgcacg gcgcacatgc acgtacaaaa ccatgtgtgc    133680
     gtgcagtgcc cggccggtaa agagaacgtc gcgggtgatg acgcctctgg aggtaacacg    133740
     gaatgcgacg tcgtgcgatg cggtgccaac cagcacgtcg tcgaccacgt gtgcacggcg    133800
     tgtccggccg ggacgacgaa cgatgaaggc gacgacgctt cgggagcgaa cacgcagtgc    133860
     gatcccgtca tctgtgaatt gcacatgcga gtgcagaatc atcagtgcgt cgcgtgtgcg    133920
     cctggcaagg agaacgaagc cggcgacgac gcctcgcaag gtaacaccga gtgcgacgcc    133980
     gtcatttgtt ctgcgaacga gcacgtggtg agccaccaat gcacggcgtg tcccgccggt    134040
     cacgcgcacg ccggcggcga cgtgcagcac ggccctgata cgtcgtgcga cgaagtgctt    134100
     tgccacacga acgagcgcgt tctcggccac cagtgcgtgg cgtgtcctcc gggctcaacg    134160
     aacgccgccg gtgacggcgc ggcgagcggc gatacgcagt gcgaccacac tatttgccct    134220
     gcgaacacgc acgtcgtcgg tcacgcgtgc acgccgtgtc cgccaggtca tgaacacccg    134280
     gccggcgacg acgccaccgg tggtgatacg caatgcagcg ccgtgatgtg cggatccaac    134340
     atgcacgtcc aaaaccacgt gtgcacggcg tgcccggccg ggacgacgaa cgccgccggc    134400
     gacgacgctt ctggagcgaa tacgcagtgt gatgtcacgc tgtgcggcgc gaaccaacac    134460
     gtcgtgaatc atcagtgcat gcagtgcccg cccggcacgc tcaatgacgc cagcgatagc    134520
     gctgccggtg gtaatacgca gtgcgacgcc gtgcagtgcg gctgcaacca acgcgtgcag    134580
     ggccatcaat gtgtcacgtg tgcgcccggg acgacgaacg acgccggcga tgacgcctca    134640
     caaggcgata cgcagtgcga tccgaccatc tgcggcgcgc acatgcgagt gcaagatcac    134700
     gcgtgcgtag cgtgtgtgga cggtcgagag aacctggcgg gtgacgacgc ctcacaaggc    134760
     aacacgcagt gcgacgaaat cgtgtgcgaa gagaaccaca aggtcgtgag ccaccagtgc    134820
     gtggcgtgcc ccgcggggaa gatacacacg gctggcgata ttgcttcggg cccagacacg    134880
     tcttgcgacg cggtgacgtg tagcacgaac gagcgcgttc aaggccacca gtgcgtggcg    134940
     tgtccggctg gcacgacaaa cgacggcggc gacgacgcgt cgggtggcga cacgcagtgc    135000
     gatattaccc ggtgcacggc gcacatgcac gtacaaaacc atgtgtgcgt gcagtgcccg    135060
     gccggtaaag agaacgtcgc gggtgatgac gcctctggag gtaacacgga atgcgacgtc    135120
     gtgcgatgcg gtgccaacca gcacgtcgtc gaccacgtgt gcacggcgtg tccggccggg    135180
     acgacgaacg atgaaggcga cgacgcttcg ggagcgaaca cgcagtgcga tcccgtcatc    135240
     tgtgaattgc acatgcgagt gcagaatcat cagtgcgtcg cgtgtgcgcc tggcaaggag    135300
     aacgaagccg gcgacgacgc ctcgcaaggt aacaccgagt gcgacgccgt catttgttct    135360
     gcgaacgagc acgtggtgag ccaccaatgc acggcgtgtc ccgccggtca cgcgcacgct    135420
     ggcggcgacg tgcagcacgg ccctgatacg tcgtgcgacg aagtgctgtg ccacacgaac    135480
     gagcgcgttc tcggccacca gtgcgtggcg tgtcctccgg gctcaacgaa cgccgccggc    135540
     gacggcgcgg cgagcggcga tacgcagtgc gaccacacca tttgccctgc gaacacgcac    135600
     gtcgtcggtc acgcgtgcac gccgtgtccg ccaggtcatg aacacccggc cggcgacgac    135660
     gccaccggtg gtgatacgca atgcagcgcc gtgtcgtgcg ggcccaacat gcacgtccaa    135720
     aaccacgtgt gcacggcgtg cccggccggg acgtggaacg atgaaggcga tgacgcttcc    135780
     ggtgcgaaca cgcagtgcga tccggtcatc tgtgaagtgc acatgcgagt gcacgatcac    135840
     gcgtgcgttg cgtgtgcgcc tggcaaggag aacgaagccg gcgacgacgc ctcgcaaggt    135900
     aacaccgagt gcgacgccgt catttgcgag ccgaatcatc acgtggcggg caatgtgtgc    135960
     acggcgtgtc ccgccggtca cgcgcacgcc ggcggcgacg tgcagcacgg ccctgatacg    136020
     tcgtgcgacg aagtgctttg ccacacgaac gagcgcgttc aagaccacca gtgcgtggcg    136080
     tgtcctccgg gctcgacgaa cgccgccggc gacggcgtgg caagcggcaa tacgcagtgc    136140
     gacagcacta tttgcggggc gaacaggtac gtatcaaacc atgtgtgcgt gctttgccct    136200
     taccaacact atcgcgccgc cggcgacgac gccaccggtc ccgacacggc atgtatacga    136260
     tattacggtc tcggatagat gtttaatttt taataatacg tcctaataat cgacaaacga    136320
     acgcgcggcg cgcgacgcga gcgccgccgc gacgcgcgca cagcgccgcg ctggcgcgca    136380
     tcaaaacgcg acgctcgagt cgacgcgatg cgcgcgtccg cgcgcgtcgc gagcgcgcgc    136440
     gcggtcgtga agcgcgagcg cgacgcgcga tcgacgcgcg cgcgcgcgtt cgtgccgccc    136500
     atcgtcccga atccgcgcca gggcgacgac gacgcgaatg ctgacgcggc accgacgctg    136560
     ccgaacatcg aacgcgcgct ggcgccgcac ggatgggcga tcggcgccga gcgagggtac    136620
     gacgacacgc cgcacgcgtt caagatattc aaagtgcgcg atgggcatca cacgctggaa    136680
     cagctgcaag aggcgctgta cgtgagcgac gaacgagggt gtcggatacg acgcgagacg    136740
     cagtcgttgt tttacatgtg ctgcgatggc gtgcggtgtc ggttgaacga ggggaagaaa    136800
     gagatcgtgg tggagatgcc gtgtgatttg gacagcgtgg gagcgtacgt ggcgaaggcc    136860
     aaggtgattg aggacatcat taagagttct caaaagaaga gggcttcgtg agcgggcggc    136920
     gaggttgtaa aacattcaac atttttctaa aatatgcgtg gtggctaatc gatcgttcgt    136980
     tctttcgttc tttcgttcgt tttctcgttc gtccgtccgt ttttgttact aggtgatcaa    137040
     cgactcgcgc ttcctcggct agaacgccgc ggcgttcggc ggggcgtcgg ggttggcacg    137100
     acgacgggcg ctttgctcgc gcttcgcgtg agacgaacgg cctcgtcggc gagcgattgc    137160
     gcgttctcat cgttccaatc gtcgtccatg ctcaatctgg gcggatcgta ttgcgacgcg    137220
     ggttcttgcg aagcgtgaac ctcgtcccat ggcatctcgt ccaccaaaga ctcggcgttt    137280
     tcgggcacgc ccgtgagtgc tctcgcgcgc gacttcaacg acgcgatgat cgagcgcgat    137340
     cgatcgtctc gcgagccaca aaatcgctcc aaatcgcgcg acgcaaccga aatgcgatgg    137400
     atgcctggcg tttgcgccgc taacgtcacc gaaacatttt cgatcggcac gcgcgcgacg    137460
     tagacgccgt tgtccgcgtc gtaatgttgg aactccaaat ttcgcaaaac gagcggcggt    137520
     ccacactcgt gccgcgcttc ggtgaataac ttcgtggatg gcatccaatc atccgccttg    137580
     acaaagctgt catcgtcgta tccagtaatc tctaccgcca aaaggtgcgg acgcgccgcg    137640
     ttcggagtcg tcgaatcgag gacggatgaa tcaaagcaaa atatccattg cgacagtcga    137700
     ccgcgttgtg tcgatcgtgg aggcccgcag tgtaaagtac acgccacggc gtcgaattct    137760
     ttgcgcacta gacccgatcg cgacaagtca gccaaatcca cggctgcgcg cacgctcaag    137820
     cagcgccatt catgctcgct gtgctcgagt ttttgcgcgg caatatcttc ctgcgggatc    137880
     ggggtccaac gcgtgtagcg cgtggtggat aaacttaact cgccctcgat aaacgcgttc    137940
     gcgcgtggtt tgattgccgt caccgcaaac gactgtcctg gctgcgccgc atcgacgagt    138000
     gcttcgtccg cgtcccaaat cgtaagaatc gcactcgtcg atccgcgggt gatcggccct    138060
     cgatatgatt cgtgctttga cgacggcatg aagccgacaa cgttcagacg aagaaccgcg    138120
     ctcgtacgac gatcgtatag attcttctct tgaagcgcct cgcgaatcgc tcgctcttga    138180
     tcgacttcgc tgccccaacc tccgatgcga ttgtgcattg cgtcttgcaa ctcgtgcaag    138240
     acgctgtcac gagcgcgctg ccattcagca tgcgctcgac gctcagcgat ttcgcaacgc    138300
     aatacgttct tgtctgcatc cctacgttct tgatgcatca tgggatacgc gtgtcggaca    138360
     tgaatcaaca tacgcggcac gacgccgccg tcgggcacca ctgaacgcag gggtatcgtg    138420
     agattgtacg tgacgcgtcc caaagccgca tcccacggcg cgagccgcgc gccgttcacg    138480
     tgcaggcata cgtacgccat ctctgcatcg tccgacagtg gtgacaccgc atccgtgaca    138540
     cctcgtagct cggcaccgac aacaaatatt ttgtacccga cgcgcaagcg tccttcgcgc    138600
     accgctcgcg taagcttcgc gtccagccgc gcgcgaacgc tataccatcc atccgaaatt    138660
     tcgatttctg acatcgtagg tacattaccg ataccggaag cggtcgtcat cgatcgaatc    138720
     gcgctcacga cgtacactgc cggcgcgcct gggttttcat ccttttctaa aatcctcctc    138780
     acgtgcggtc gctccgcgcg gttaatttcg cgttcatact tgtacaacat gcgctgcagc    138840
     acggcggatt cgctcaagac gccgaaagca tacttttctg gaaacgctcg cgccatgcat    138900
     gcttgtgtcc acacgatcca cttgtacgca ttcgccaccc actcgttcgt cagagacgcg    138960
     tcgctcgcgc cggctttaat catcaactcg cgcatctctc gccaaccaac caggccgcgt    139020
     tcgacgcttg gcaagcgcaa tgacttcgcg gtatcggcgt tgagcgtcgc gacgcacgtg    139080
     tcgacgaacg ctgggcgaac ttgaaacggg agcaaattat tgaagaatgt gcagagcggc    139140
     gctctcatgc ccatgcgaac gcgcgcggcg aataagtcgt gcacggcaac acccacggac    139200
     gcaccagtgc catcgtggcg cgatctcttc gcttgtcgcg gtgcactcgc cgccgttcgc    139260
     gcgccgagta ttgacatcgg cggcgtgaaa gccgtcgtgc tcttcatcgg cggcgtgaac    139320
     ccgggcgcct tcgatggcgc cttgcgaacc gccgggagcg acttcggcgt cttgaacgac    139380
     ggctgcggga acgccgcacg cactggcgtg ttttcattcc cgacttccgc gagaaaagcg    139440
     cgcgacttct tcaacgccgc ctcgctcagc tctaaagtcg cgcccgcggc ggtctggaac    139500
     accaaacctc cgccgccgct cgccgcgggc ggcgttgcgg cggcggcgct cggtcgctct    139560
     cgaccagacg acgacgggtc gttttcatca acgtccgcaa acatcgcgcg cgcgcgtcgt    139620
     tttacgtctt cagacaccgc gatgctcgca ccaccgccgg tttgaaagac caagcccttg    139680
     ggcgccgccg acgtaaacac gcccccgctc tccgctctcg tcgtcgccgg cgtctcgatc    139740
     gcggctcgaa acgtgaacgc gtcttcgtac gcctcgtcgt cgtcatcaaa tctaggttgc    139800
     tcgtcggttc gaatcgcgcc gttcgcgcgc gcgatgacgc tcttcccact cgccgtcgtg    139860
     agcgtcaccg aatccggcgc cggcgcgtct aaattcgcgt acggcgtcgc cgatcccgcc    139920
     atgtgtcgtt gcatgatcac gaacgggctc tgcgccatcg ccgtcgctcg cgcgctcggt    139980
     cccggcgccg acgccggcgc ccgtcgccga ctcaccggcg tcaccgcgtc cgcgtcgtcg    140040
     tcctcgtctc tcaaatacat gaaccccttc cctctcgcgc gccgcgccgc cgccgccgtc    140100
     tccggcgtcg tccgctgcgt cttcggccac gccggcgtgt gcgcgaacgg gttcccgcac    140160
     ctcgcgagcg cgcccacgct cactcccggc gacggcgccg gcatcgcccc gagcccactg    140220
     atcgacggac tctccctcgc gcctcgcgct tcgtccgcgt cgtccgcgtc gtccgcgtcg    140280
     tccgccgtcc tcaccgcctc gtcgtcccgc acctccgtct ccggcaccac tcgccccgac    140340
     cgttccatcg agtctttcgc gccccttctc gcgtcgccgt cgcccttttc gcgcgtcttt    140400
     tccgcctcgg cgtctcgcgc gcgttcgaac gcgtcgacag ctcccgcgcc gtttgaatct    140460
     ctcctcgagt tcgtcgtcgc cgtcgtcgcc gctcgcgccc gcgcgacgta cgccgcgcac    140520
     gcgggctcat cgccgtcgtc gagcgcgccg agcgcgtcgc acagcggcgt cgcgcgcgtc    140580
     gcgcgcgtcg ccgcatcgtc gttcggtcgc gcgtcgttcg gtcgcggcgc gcgctcgacg    140640
     tcccagcgcg cttcgctcgc gcgcgcgcgg cgccgcgcga cgaggctcgg catcgcgcgt    140700
     cggcggccgc gcgcgcgcgc ggcgcgaggc gcgcgcgacg gtgtgcggcg tcacagcgcg    140760
     gtgcgcgcgg attcgatgcg cgcgacgctc gcgcgaagcc tcgtcgcgcg cgcggcgcgc    140820
     cgcgcgcccg gacgcgcgcg gtcgcgacgc gcgatgtcgc gcgcgcgatc cgcgagcgac    140880
     gcgggcgcgg aggcgctcgc ggaggcgctc gcgaggcacg aatcgcgcgc ggcgcgattg    140940
     tcgttcgcgg aggaagcgcg cgtgattctc gacaccaacg gctgcggcgc gctgtcgacg    141000
     ctgggaaacc aacgcgcggg cgtcttggcg gggttcccgt gcgggagcgt cgcggcgtac    141060
     gcgagcgatg aggacgggct gccgatcttc gcgctgagcg cgctgtcgca gcacgcgcga    141120
     gacgcgaggg aaaacggaaa ggcgacgctc acggtgacgc gcgcggagtt cgaggacgtg    141180
     agcgacggga gagtgtcgat gagtggaatc ctgaccgagg tcgacgcggg cgaggcgacg    141240
     gcgcgggcgc gagcgcggta cctggcgcgg cacccggggg cgttttgggt cgatttcggc    141300
     gacttcgcgt ggtacaagat gaccgaggtc gtggcgattc gcatcgtcgg agggttcgcg    141360
     cgcgcgggga gcgtgacggt ggaagagtac gcgaatgcgc gaccggatcc ggtggcggcg    141420
     ttttcggcgc cggtgtgcgg acacatgaac gccgaccacg gggactcgct tcgcgacgtg    141480
     gtgaagcact acgtcggcgt ggacgtggat tcggtcgaga tgcgctcgat cgacgcgctc    141540
     gggatgaact gtcgcgtcgt caaggatggc gaaaagtacg cgtgtcgcct accgttcgaa    141600
     agcgcggcga ctgggcgcaa agaagtgaag gatcaaatcg tattgatgac gcgaaacgcc    141660
     gcggcggcgg cgaacgcgca gtaaaatcga cgtcctccgg cggcgacgtc gagcctcgcg    141720
     atcgacatcg acgctccatc accgaagcga cgcgcgtcac cacctaatct ttatgtttat    141780
     cgcgacaccg cgacgattcg tttccatccg cgcgcgcctt cgcgcgttcg ccccgcgtcg    141840
     cgtcgcctca caccgcgccc tccgccgcgc cctcgcggtg catgcccgtg tcgttcgtgt    141900
     atcaaaagtc gtctcgatcc aaacctcgcg cgggcgccga cgtctgcgag atcaagtgca    141960
     agaagctcag ctgcgcgata caaaagtgca tctccagact gcccgccacg cggtcgcgca    142020
     cgagcgcgtc cacggtgaac tttgacgcgt gcgcgccggc gatcgagcgc tacgacgcgt    142080
     gctgcgccgc ggcgagggcg gcggaggcgc gaggacgcga tgacgacgac gcgaagcgtc    142140
     gcgagtgaag cccggaggct gggttcgagt cggacgcgcg cggcgcggcg gcgaagcgtc    142200
     gcgaacgcgc gatgcgcgac gcgaggttcg agcgggcggc gcgcggtgcg gtcgcgatgg    142260
     aaggcgacgc gcgcggcggg cgacgcgagc gacgaagacg actcgggaag gtttatcaac    142320
     gacgacgcgt tttcggcgct cggcgggttg aagaagacga aggatccgtt cgcggcgaac    142380
     gcggcgcggg aaagaccggc ggcgagcaag gcgcgcggtg tcggtggatt ctcgaaagcg    142440
     ggcgcggaga cggcgagttt gccgacgacg cgcgacgcgg atgtgatttt gaagcgtttc    142500
     gacgagacgc agcggcgcga gggagcggag gcggcgacga cggcgtgtga gcgacccgcg    142560
     atggaacgag cgacgagagc gctcgcgtcg cgcgcgtcgc gcgttatgct gggcatatgc    142620
     gccgcgagcg cggaggaggg attggcggcg ctcaagacgt ggacggcgga gttgggactg    142680
     ccgaagggaa aattacacgg catggataag gatggtatcc cagtggatcc gccgaaaggg    142740
     gcggtgttca tcaagtacaa ctcactttcg ggagatgcgt acatttctgg ctacggtggg    142800
     acttttcgtg gggttttgtt cacccccgag ctcgacgacg gggcgtttcg ccaatacgga    142860
     tatttaccgc tcgacgtgtt gctctgatct tgtagatctt gtagacaaat ctctagtacg    142920
     gctaagctaa atcgcagtca cgatagattg ttaccagaat gtttcgcggt aatccttgag    142980
     gaacttgccg aacacaggcg gccacgcttg cggcggttcg ctgaaacctt caaacaccgg    143040
     cgcgagaacg cgcgccgcgg cgtcttcctc atcgatgggc gtctggaaac ccttctcttt    143100
     cgccaatctc gccgcttttt ccagtggatt ctcgtcgtta atccaaccgg tatcgattga    143160
     gttcatatag atgccatctt ccgcgaagtc tttccccgac gtcgcgctca tcatgttcaa    143220
     cgccgccttc gccatgttgg tgtgcgagtg cgtactcagt ttcgcccgag cgaattggcc    143280
     ttccatagcg gaaacattga tgataaacgc cgcggcgtac tcgaccccag cctctttatc    143340
     gacagcgacg gtcttggcca tcaatggacg aagcttgccg ttcagcacga aaggtgcggc    143400
     ggcgttcacc gcgagcactt cgagcaactc tggagtctca atttcgccaa gcttcatcgt    143460
     ccacgagttt ttcgtcctta aatccacctg ctgcccgttg acatcgagcg cgccttcagg    143520
     gaagtgttcg ttggactcat cggcgtcgga agcgatcagt tggagctgcg acattgcggc    143580
     tgagggcgcc atccatccag cttctttaaa cttatcgccc tgtcgccaat cgctcagcgc    143640
     cgtgggcgac ggcgcctcgg cgtcggcgct cggtaaaaag tcgcaccgag cgttcgcgcc    143700
     agcgagcgag cgagtaaacc ccgagcgcgc ttcggcttgg agaaggtgct tgtaatacgc    143760
     tggaggtcgc cgcacggtct gacacgcgtt gttcacgagg acgtccaatc gaggcagcgt    143820
     cgcgagcaaa tgcgcgcaga gcttttccaa agcgggcaag tcgcgcaaat ccatggcgag    143880
     tatctgcagt cgaccgatcc attgtcccgc gtcatcttct ccttcgaagc gcttcagcgc    143940
     gtccacggga aaacgcgtcg tcgcgatcac gttcgcgccc gcgcgaagaa gtttcaacgc    144000
     gatgcgatac ccaatcttca cgcgcgcgcc cgtcaccacg caaaacttcc ctcgcatgtc    144060
     cgccgtctgc gaccgctttt cccaattcaa ctcggcacac tccggacaca acgctgcgta    144120
     aaagtgatgc atctttcgaa atcgcgactt gcacacgtag cacgaccgca ataaattgaa    144180
     ctcctccgcc tcgccgtttt cgctcgccgc gatcgacgtc gccgaagcgc tcgcgacgcc    144240
     gtcgggaatc atcctctccc ccaccccatc cccgttcgcc tcttgcaacg cgctcaatcg    144300
     tttcaacctt tcgttccgca gcgtcgtttg atccatcttc gctcgatccg ccgcgcgttc    144360
     cgccatcttt ttcctattcc gctcgcgttt cggcagcttc gccgcgacgt actccgcgcg    144420
     agacatcccg tggaacattt tcccgtgcat tcgctccaac agcggcagca gcgctctgcg    144480
     cagcgcttta tgtttcgggt gctccagcac cgcgttcgcg cgcgcgcgcg cgtcgtcgtc    144540
     gtcgccgtcg ccgccgtcgc gcgcgctcgg tgcgcttttc gtcccgctcg cgccgccgcc    144600
     gacatcgccg ccgcacgccg cgatcacgcg cagcgcgcgc gcgagatcgt cgctcgtgaa    144660
     cccccgccac gcgtcgagcg cgtcgccgtc gagcgcgcgc gcgtcgtcgt cgagcgtcgt    144720
     cgtcattcgt ccgcgcgacc gcgagtgcgg ctcgccgatg gggcgccgcg cgtgacgacg    144780
     cgcgcgatgt cgtacgcgaa atcgacgcgc ccgacgcggt tcttaagggt gtgcccgctt    144840
     cgcgcgcgcg acgaggcgcg cgcgctcgcc gaaggcgcgg cgcgcgaggc ggtggaagtc    144900
     gacgcgcggg acatcgacgc gaaacgcgcg gtgacgttcg agttcgcgcg cgtggaagac    144960
     gcgacggcgg cgctcgagcg cctgcgcgga ggacgcacgc gcgcgtctgt gttcggcgcg    145020
     ggcgtcgcgg acggcgagac ggcgctcgcg tgtgggtaca gcgcgcgggc gagcgactcg    145080
     cgagcgccgg agcgcgagcg aacgaaggcg tcgcgacggt cgtctgtcga gggactgacg    145140
     ctgatcgaga atttcgtcac ggtggacgag gaaagagcgt tggcgacgct cgcggcgacg    145200
     tcgggggacg agacgcggtt ggcgcggcgc cgggtgaaac attttgggta cgcgttcgat    145260
     tacggcacgc gagacgcgaa cttgaaggtt gtcgacgaga ttcctgagct ggcgatggaa    145320
     gtgttgcgga ggcttccgcg cgagacgcct gggtatgaag gcgcgatgcg gtgcgaccag    145380
     gtgacggtga atgagtatcc tcgaggcgtc ggcttggctc cgcacgtgga cacgcactcg    145440
     gcgtttggcg acacaatttt atcgctctct ttgctcgggg ggacggtgat ggaatttagg    145500
     acgagcgggg aagcgcatcg ggcgatttat cttccgcctc ggtcattgct agtcatgcat    145560
     ggtgaatcgc ggtaccgatg gcagcattat ataccgcatc ggaagtttga cactctcgag    145620
     ggcgaagccg cgccgacgcc tcgagacgat gtgcggctct cgtacacttt tcgcgagcgg    145680
     agaagtggac catgcgagtg cgcattcccg ttgcagtgcg attcgaggga tggcgcgcag    145740
     tcaaagtgta gcaaacgtaa gacgggtaag acccaggcgt tcgcagagct cgtgggagag    145800
     tcgggagata gcttttagtt ttgtgtagtt tacagatgtc ctagttgaaa tctcgcgcga    145860
     gactaaagtg aaaacgcgca tttccttgat catttttcgc gtaatcgaag cgaattggta    145920
     acccgccggt ctcgaacata cctgcaacgc cataactgta tccgcttcca ggcttgccgc    145980
     gcgtgcccgc gggatcgccg agcaccgaac cgccgctgtg caaatcgctt ccgtaatcga    146040
     aaaacgccgc gccggtaatc gtgggggtga ccggcacgcg catctcggcg ctaccgacga    146100
     cgtacttgcg ccccgtaccg atggcaccgt cgttatatcc acgaacgctc gacgtcccac    146160
     cgatagcgaa ggcttcgtaa ggaggcaaat cgccgacgac agatccgcct ttggaactca    146220
     aaacgagctg caccggcccg ggcaggctac ccaccgacag caagttgaag gatcgcttgg    146280
     ctttggcaac catgcgtgtg tagttgagcc actgcggctg tacagggagc gcctgctcgg    146340
     cgcttaacat gagctgcgcc gcgtttggtc cgccgtaagt gaaacgcatt tgcgccgcca    146400
     acgcggtgtc gcatttcgta ccgctaaacg tcaccggggc accgtaagcg tcgaaaagag    146460
     agtgattccc gtcgttatct aacaccccgg ttcgtttgaa atccacggaa aacatcccat    146520
     tccatccatt cagcagcggt cgcgagtgtt cgaccgacgt ctgaagcctt tgtaacgaca    146580
     tttcgctcaa gcccggggac gtgatgtcgg gttggtcgcc gtcgacgttt gtcgagttga    146640
     caccgtgtgt agatcgcata ctactgctct cactacgcac tgacatcgct ctggacgtgc    146700
     gcgtcggtcc gaaccctacc caagggtctt ggtactgcaa attcacttgt ggacgcacga    146760
     cggtgagacc tcgacctcct tttcgcggcg tcgcctcgac gccgaggttg agcatcttgc    146820
     cttgaccgaa caagttcgtg tgaaaggcgc taaaatgccc ggcgatgcca ctaaatatgc    146880
     cctcagataa gcccctggcg gacatgccgc ccccgcacgt gacacccttc atcgactttt    146940
     ctttaagcga caccaacagc gtgcgcttgc cgagcggtcc aggtttcggt aacatgttga    147000
     tttgtggctc gccgaatcgc ggattttgcg cgcgaaatcg gtcgatggtc tcgcgcacgc    147060
     gcataccatt caaaactttg gtagtcttga tgttttcaaa gtacggcatg acgctgtcaa    147120
     ccttactcaa caccttgttt tccttccccg tcttggcgtc gatggacgga tcgatctcca    147180
     ccttgacgtc attgatgtcc acatcgacga aaccgagacg caaaacccca tcgctcggtt    147240
     cttccagcaa agaaatccct tcgatcgagt cgattcctcg cttactttcc gcgtaagcct    147300
     tgaagtactc caccgcgcca gagacgtgat tcgagttaat cggcttcccc atcatcggcc    147360
     gaaacgtctc ctccaccacc tttgccggca ccgcctccaa accttgcaac tcgactccgc    147420
     gcaatatttc gaacggcacg acctcaaatg tcacgcgcat tccatctcga gtgtccttcg    147480
     cgagcgcacg aacgctctta aagatcccca actcgctctt aatcacgtgg ctctccccgg    147540
     cgacttcgcg cgcgcgatag gaataattcg gcttgagcgt catgacctcc cgtatcgccg    147600
     cctcttgcgc gggcgtcgcc ccgacgatat caaatgcaca tattaacagc gctttatcca    147660
     cgtcaaacgt cgtcacgtcg acgccgtgtt cgctcttcgc gctcgagcgc ggcgccggcg    147720
     ccgcggcgcc gttcgcgtcc gccgagtctt tacgcccacg cgcgatttct gcaatcttac    147780
     gccccggtgc gacgttcgag cgacgcgtag tggtgttctc cgtcgtcgcg cgcgacgacg    147840
     cgctcgcgag ggcgcctcga gagcgcgcga cgacgcgacg aagcgtcgat cgcatcgcat    147900
     ccaggctggg cgtccgcgcg ttcgcgcgcg gtccgcgcgg cgcttcggcg cttcggcggg    147960
     cgtcggacat ggtcgtcgac gatcccgctc gcaaagtgcg tcgttcggtg cgcgagcggc    148020
     cgcgcgcgag tcgcgcgccg agttttggcg gttgggcgcg cgcatcttgc gcgcctgggc    148080
     gcgcgcggcg gttgagtcgc ggcaatgact tcgattcaga atagacgtat tttacaggtt    148140
     ctcgaaaact aaagcttaaa gaggcgctca gtcagctgca ccaccgcgcg cgcgcgcgat    148200
     ggaacttgaa tgtggctcga atgactcggt tgtattggtc gagattcgag agaggcaccg    148260
     acgtccgtcg gtcgccagac taggagaaat caacgtgaag tcgcgcttgc gcgcgataat    148320
     aacagggctt aattgtcgcc gactgcttag tcttcgtcga cattgcgcaa atcgaacata    148380
     cgctcgagtg cgtgcatatt gacgagggtc aaagcgacgg cggtggggtc ggagccatcc    148440
     gagcgaagcg ccgccatcgg gccgtgcaaa atcttgttga tgatgccccg ggagagttcc    148500
     tcgacggcct tcttttgctt gttcgtcaac ccatcgccga gcttggtcat agccttatcc    148560
     aattccgcgc tacggatatt ttcagccttt tgacgcaagc gcttgatcgt cgggacggtt    148620
     tccaagctat ctctccacgc ctcgaagttg cgttgctcct ctaataaaag cgcttcagcc    148680
     tcgagacccg cggcttcgcg cttcgccttg ttgatctcag cgagttcctt caggtcgtca    148740
     acgttgtaaa ccagcgtgtt ggggtcttcg cagcagttag cgtccacgtt acgcggcacg    148800
     gcaatgtcca ccaagcgacg cttgccgccg acggcgtcgc cgcacaccga catcttggcc    148860
     aagtcgtcct tgcaaatgat cggatcgacc gcgctggagg ctgtgaaaat cacgtcatgc    148920
     tcgcccgcga gcgtcaggaa ctgatccatg agttcgatac gcatattaac ctccgggaac    148980
     tcttctgcga gcgcctcggc gcgcggcttg gtacggttca cgatggtcat ctccgtgcag    149040
     cgcttggacg ccaagtgctt gaccaagagc ttggacatcg tccccgcacc gacgatgagc    149100
     accctgacgc cttcgaacga ttgcgaagga agcttcatct gcaccagctc agccgcggcg    149160
     gaagacacag acacggcgcc agaggcgatg gaagtctcgc tgcgcacgcg cttcccggcg    149220
     gtgatggccg ccttgaacaa cccagtcaag tggcgaccaa acgccttttc actttcaccc    149280
     atcgcgaata cgctcttcac ctgcgccaag atttgtcctt cacccatcac aaccgaatcc    149340
     aacccacccg aaaccttcaa caaatgtccc gtggactcgc gatccttgag cacaaacaag    149400
     tgctcgcgaa gcgactccac atccacgccc gagtgcttca ccatccactc ctcgacctcc    149460
     ttcaacccac gctcgtagct cagcgccacg acgtaaatct ccatgcgatt acacgtcgac    149520
     aggatcccag cctcctcgat gtgtggatac gcgcaaagct ccgccaccgc atcgttccaa    149580
     gcctccggcg gcaccgccat cttttcccga atctccaccg ggcagttgtg aatgctcaat    149640
     cccaccgtca cgatggacga cttgcgttcg ctctcgtacg ctgcgttcga caaaatcacc    149700
     accaaccgtc agtctcgcgt tccttttcac atttcgcgcg cgcttcctcg ccgtgcatcg    149760
     cgtctcacga tctccaaacg ccctcggcct cgctcggtcg cccgcgcgtc gggcaaatca    149820
     ctggataagc ccgtcgccgt atcttccccg atcgcgtctc cgcgcgcgtc caccgccgcg    149880
     cgtcgagttt gagcgcttct acgagacgaa cgaaacgaac gaaaactaca cgtacgattt    149940
     cctccgagcg cggcgagcgc ctcgagcgcc ttgctcgaat ccaccaccgc gtcgctcacc    150000
     cccgccggac gcagcgtcac cgcatcgcgt gtcgggcgtt gcacctgcat cggcttcgtt    150060
     tggtctccct gcggcgtctc gctgtccacg accgcgcgca acgcgtgacg aaagtttttc    150120
     ttcgtcggtt ttcgcgtcgc gcgggcgccg acggcgatcg cgcgcggtgc gagcgcggcg    150180
     gacatggcga cggtggcgat gcgatgcgtc ggtcgcggga ttcgctctgc gacggcgtca    150240
     cgcgcgcgcg atgccgatcg gcgctcggtc gcgggcgctc ggtgcgaggc gaacggacgt    150300
     gcgccggcgt cggcgcgaac tgtcgcgggt cgcgccggcg tcgcgcgggg acgtgtgcgg    150360
     atgcgcgcaa gccagggttg gcgcccgcgt cgttcccgtc ggactagctg gattcatcgc    150420
     gcattcggac attcggaacg tgttttaggt gtatttatgt ctgtatgtaa ttatgtacat    150480
     cttcgtgatt ttggtcgtaa tcaaacgtgt gcgggtgctt tgtggaatgt ctctgaaaat    150540
     atcctgcggc gatcggcgag atctcatctc gagatctcgg ctcgctcgag cccgcgaggg    150600
     cgtcgacgac gcggcgcggc ttcgatgttc gatgcggtgc ggtcacaaaa ctgaatgcgg    150660
     attaaaactg aatattggcg atctcgctcg cggtggaaga gacgtccacg ggacctggga    150720
     gtaagacgag gaaggcgacg gcgatgagcg cgaaggcgag cgtggcgcgg ccgtcgtcca    150780
     cctcggtgac gtcgtccttg ggcgcgaatt caggcgtgcg ttgcgtgagg acgatgtaaa    150840
     tggcccacgg taacgctaat gaactggcta tgatgccgaa actgagcccg atgtacgtac    150900
     cgagggaggt ggcacccaag acgcgacggc cgaacgccgt ttgcgtcatg cgaccgccgt    150960
     cgatggaacc gacggggagc aagtttaggg cttgcgtcgt cagcgcgcac cagcctgcga    151020
     tgaagtacgg atgcaccatc acacccttgg cgcctgcgtg taagaagagt tgcgagatgc    151080
     cgccgagtaa gagactagag ttgaacaacg cgttgggaat gggaatcaaa tccgggctgt    151140
     cgccgcccat ggagagcgtc aagccgtaca cgaacaagtt cagggcaacc atacctcccg    151200
     caacgggacc cgcagcggcg acgtcgaaga gatcagcgcg agtttccggc gtgctcttga    151260
     tttgcgtcag cgtcccgaac gtgccgagct gggagttcgg gatgagaaag ggaatgccga    151320
     ttttaatctt gcgcatgaaa gccgcgattt gatgtccgac ttcgtgaccg acgctcgccg    151380
     ccatgacgcc gatcgtcacg ggaagcgccg attcgacgta cgcgacggag tcaaagttct    151440
     ccaacccggg tggtagagca ccctcgggca gttcgacgtc gccggcttgt tgcaaccaag    151500
     acatcgtctc cggcgggagc ttggacacct ctgccaccaa gccgagctgc acggcggacc    151560
     cgacggtgag acccatgagc gccaatgcga gaagatactg ccatcccgcc gtgcccggac    151620
     tcgggcccgc gcgatcgctc gggacgatga gaaaactcac gcgcggaccg tacttcgagt    151680
     cgatggcgac gtctccgctc ggaccatcct ctcccggcgg ttcttcaagc atgaacgccg    151740
     tgtactcgcc gttgaacatg cgttcaagat cggcttgcac ggtttcccac accttggcgc    151800
     gctcggtgcg caagttacct ttgaataata ccccagctcc gttcatctcc gcccccaagt    151860
     tctccacggc ggtgacgtaa aatgtttgca tgccaaaaat ttccttcttg atccgctcca    151920
     catccttcgg cgcgatcgcc gcctcctcgg gagactccaa gatgttcact aacttactga    151980
     acgacgcctg gagctcgggg tcttcatccg ctttcttccc cgacgcctta ttcttgctcg    152040
     ccctggcgct caagtcgttc agaacctttt ccaactcctc gcctttgtct ttccccaatc    152100
     cctgcctctg cgtctccgca ttcttcagcg cctccagcgc ttgcgggctt atcgacgtgc    152160
     cactcactcc ctcgtccgag ctcccatcgt ccaccgaaga cgccgcgtcc tcgtccgtgg    152220
     acggctgtcg cagcgtcgct cgaaacgccg cctcttcctc ctccttcgcc ttcgcctccg    152280
     cctcgctgtc gatcccgagc aacgcgtcca aatcgctcag cgtcgtcttc atgtccaccg    152340
     gctccaaatc cgacgaccca ctcacgttcg gcgtccaatc accgctcgcg ttcgcgttcg    152400
     cgttcgcgtt cgcgtcttcg ggtttccccg tcgccgcgcc gtcgtcgtcc ccgtccggct    152460
     tttcgtcctc ctcccgcgcc tcgccctcgt cccggctgaa gaactttttc aaaaaccgcg    152520
     cgcgcgtcgc gtcgccgcgc cttcgcgcgc cgccgtcgcg ccgcgccgcc gtcgccatcg    152580
     ccgacgtggt cgatcgagcg tcgtcatctc tctcgcgcgc cctcgcgagt ccatcgatcg    152640
     cgcgtcgcgg tcgcgccgcg cgcgtcgcgc accgtcgcgt cgtcgcgcga ccgcgcggcg    152700
     cggcgagcgc gcgcatcggc gcgcgcgcgg tcgtcatcgc cattccgcgt cgccgtctga    152760
     cgatgctgcg gtgcgcgcgc gcgccgacgc cgccgacgcc gacgccgacg ccgacgccga    152820
     cgcgcggcgc gcgcgcgcgc gtccgccgcg cgtcgacgcg cgcgcgcgcg ctcgacgacg    152880
     acgacgcgcg acgcgattcg agattcgcga gcgaggacga gcgccgacgc gccgtcgagc    152940
     ggctcgcgcc gccgaagcgc gacggcgatc gcgccaagcc gcgcctgcgc gagctcggaa    153000
     agaagcgcgc gatgggattt acgagcggcg cggcgtcgag cggggaggcg cgagaggcgg    153060
     cgcgaagggc gaggctggag aggcgagacg cgcgagcgac gcgcgagtcg agagaaatca    153120
     tgtcggcgat gcgcgacgcg ctggacgcgt gggagagcga gatcgatggg atgacggatt    153180
     tcgcgcgcgc gagcgtcttg gaacaggcgt cgacggcgac ggagatgttc gagaggcttc    153240
     gagacgaagg gttcggcgcg gtcgagagcg ccttcgcggt gatgagctgg atggacgacg    153300
     cgatcgagga cgccgcggcg cgcgcggacg aggacgcggc gacgtcgacg tcgacgtcga    153360
     aggaacgggt cgaggacgcg tcgaaggcgt cgaagtcgaa aacggcgccg gacggcgtcg    153420
     tcggcgcgct ctccgacgcg ctgagacaat ggttcgcgat agacatcaca gagttggagg    153480
     atggtcgcaa atcgatcgtc gtcaacgcga gcgcggagtt tttagcggtt ttcattctgc    153540
     ttctcgtcgc gtcggcgcac tttggcggtg agttagtgag cgacttcttg gcgcccgacc    153600
     cgctgctgcg gtgagctcgg aacgagttcg ggaacgagtc gcggacgatg aatgagttgg    153660
     gaatagcgtg cgtttagaat cgcgcgagtt tagcatcgac gatagcagcg gtcgacccga    153720
     cgcggttgta acgcacgacg acgacgacga cgacgcgccc gcggcgccag cagcgccgca    153780
     catcgcgacg tcgagatgtc tcgtcgcgcg gtcgacgccg cgcgcgacga ccgagtcgtg    153840
     tcgtgcgatg acgacgtcga ctcgcgttcg ctcgcgtccg atccgtcgcg cgcgtccacg    153900
     tcgcacgcgg cgacgacgga tttcgccgtg ctcttgcacc cgaccgcgca cttcatcctc    153960
     gtcgccgcgg ccactattgg ctcgctcgcg ctgtacggcg tcttgcaaga gcgcgtgatg    154020
     acgattccgt acgcgcgcga gcgcggtgag agcgtggcgc tgggccgtgg cgatggcggc    154080
     gacggcggcg cgttggctcg ggcgttgcga ggggcgttca cgcgccgcgg cgagacgagc    154140
     gcggccgagg acgcgccatc gaaggaggac gtattcacgt gcagcatgtt tctagttttc    154200
     atgaatcgct gggtcgcgct cgcgtcctcg ggggcgttgg cgatggtgac gggatggggc    154260
     ggaggcgcga cgcgcggcgg cgccaaggat tacgccgcgg tgtcctttag taatctcgtc    154320
     gccacggtgt gtcagtacga ggtgctgaag tacttgacgt acagcgtgag cacgctcgct    154380
     aagacgatga aggtggtgcc ggtgatgatt tggggacagt ttttaggaga gaagaaattt    154440
     acgtcgcgag aatactttga cgcggcggtg atgacgttcg gatgtttcgt cttcgtcgcc    154500
     aatcgtggtt ggcgcagcgc ggtgcagaag cgatacgagg gtgagtacga cgaatcgtcc    154560
     ttggaatggg ccgccaacgc cggttttctg atattggctg tgtactttgt cttcgacggc    154620
     ttcacgtcga cgtttcaaca aaagatgtac cgccgagatg gcgtcacggt tacggcacaa    154680
     gtattcttca cgtcattttt cacaaccgta ttcgggttcg cttggctcgt catcaccgac    154740
     cagctttcgc cctcgattcg gttcgtgcac gaccacccag cgatcgttgg cgacatttta    154800
     ttattgagct gcgcgtccac cgtcgcgcaa ttcagcatcg cgtacaccat caagagctac    154860
     tccgccgtca tcttagcctc catcatgacg ttccgccaat tcctcagcgt cctcatcagc    154920
     tgctacgtgt tcagttcgcc gctcaacgtc gtgcagtggc tcggcatctt gctcatactc    154980
     gcccccttga cgttcaagca cgtcgccttc gcgaattggg ccgaatccgc gcacccgtcg    155040
     tcgtccaaat ccgacgacga tcgcttgaac gccctgtaat ccacgctctc tcgcgcccgc    155100
     gttcgcctcg aatcgcgcgc gcgccgtcgc catcgctctc atccgtcgtc gtccggcgtc    155160
     gtcgttcgag attcgtcgtt cgagtcgcgt ccctcggcgc ggcgtctttg aatccccgtt    155220
     cgagctgtcg gtgcgacatc gatcgtcatc atcggacgcg tcgcgtcgcg cgcggcgcgc    155280
     atgtccatag ctgcgtggtc caccgcgcgc gacgccgcga ccgcgttcgc cgcgcgcgac    155340
     gccctcgtcc cgatcgacga cgccgcgcgc gccgcgttcg ccgaactgcg gtcgcagcgc    155400
     tgcgaagact tgctcgagcg cgcgtttctc cgcgcgttcg agcgcgcgct gcgcgacgac    155460
     gcgctcccgc gatggcgcga agcgtgcgcg atgccgtcgt cgatcgacgc gggcgcgctg    155520
     gagcggacga acgcggagga gagggacgaa gaggaggagg agacgcgcgc gcgcgccgag    155580
     gggtggacgc gagcggaggc ggcgccggcg acgacggcgt tcgcggagtg gatcgaaaga    155640
     gggcgcgaac gcgcgcgagc gttcagcgcg ggcgtgcggg gggtgagtga ggacgatgac    155700
     gcggtgcgga cgttcgaacg ggcgttcgat gcgatggtgg gaggaacgtg cgcggcgcgg    155760
     ggaccgccgc ggttgtcggc gattttgagc gcgtggtaca gagcgagagc gcgggagttt    155820
     gatcacgccg tgcgtaagag gtggggggag acgagcgatg atgacgagaa cgataggatg    155880
     gagacgagcg tactcgagcg gcagagctcg atcggggcgg atatagcgag ttgtggcgag    155940
     gtcatgggga gggcgtgggc ggcggagacg agcgcgatgg gcgaaacgtt ggcgcgatgt    156000
     cacgcgtcgt tgggacgagt ggcggaaaat gcggcggctc gggcgttagg agagtgtgtg    156060
     aagcgacatg tcattcgtcg ctgtcgcggt gcgttcgatg cgccgaagct gtggccgacg    156120
     ttacgatggg ttcgagcggt gccgctcgag tttttcaaga cggcactgcg attaaagcgc    156180
     gtcgacggcg cggcaatcga gtcttggcgc gggcgattag aatacaccgt gcacgaacac    156240
     ctcggcgcgc tgcgcattca cgagctgttc gacattattg tcgactatcc tgactctttg    156300
     cccgcgatta cggatttgcg cacgtgttta caaaacacga cgctacacgc ggcgctcgtg    156360
     gactcgttcg tcgacgcgat gcggtcacgt ttactccacg ccggcgcttc gacggtagac    156420
     atcgtgcagc agtacatcgg tacgatcaaa actctgctcg agcttgaccc ttcgggcgtc    156480
     gtcctcgaac tcgtgagcgg gcccgtgaag gaatacttgc gcgagcgcaa agataccatt    156540
     cgctgtgttg tgacgatgct cactgatgac ggcggtgaag acggcggcga aggcggcgaa    156600
     ggcgcacttt acgttgagct cggtcgtctc gcacgaggag aaagcataga aatcgccgag    156660
     tcgagcgtgc cagcgccgaa tccaaacgcc actgtgagcg gaacagacaa cttggaccga    156720
     atggacagca tcacggctga gatggtcgcc atcgccgccg gagcgaacga tgacgatcta    156780
     gccgacggtg tgcagtcaac acagcaagtt ctgtcgggct gggacgcatg ggagcccgag    156840
     cccgtggaga cggaggccgc ggcgagtcgc ggacgtcgac gcaaagcggg agacatcatc    156900
     ggtcttctgg tcggcattta cggctcaaag gaactcttca tcaacgagta tcgtaccatg    156960
     ctcgcggaaa aactattgag caagtcgaat tacgatactg agcgtgaaat gcacgcgttg    157020
     gagttgttga agcttcgatt cggtgagacg agcttgcaca actgcgaagt catgctcaaa    157080
     gatttcgccg acagtaagcg cgccaacgcc aacatcaaga cgcgtccgac gacgggtact    157140
     ccgtccgcga aggacagacg cacgagtgat attttgatac agacgcccgt tgaggcgacg    157200
     atcgtgtcat cgttgttctg gcccgcgttc tcgaccgatt tgaccgattt caaactcccc    157260
     acagagattc aagaacacat ggatgcgtac gcgagacgat atcatcaaat caaggcgccg    157320
     cgtaaaatgg aatggaaggc ttctcttggt acggtggtca tggacgtcac gcacaacgat    157380
     cgaacgttcg aggcgagcgt gaatcccctg caggcggcga ttttgcatta cttccaacga    157440
     gagaaagttt ggcgagcgaa tgatttagcg aacgccttgg gcgtgagcgt ggacgctctg    157500
     cgcaaacgta tagtcatttg gatgaacaac ggcgtgctcg tcgagcgaaa ggaagggcat    157560
     gtcatatcat acgcgctcgc ggaaccttcg gatgaagtcg acgccatgga tggcgtacac    157620
     gacgacgatg agcacgtcag cggcgtcgcg acggcggagg aaaccgccgc ggcgggaatg    157680
     atggtgtacg agcaatacat catgggtatg ctgaccaatt tcccgagcct accgctcgat    157740
     cgcatccata atatgctgaa aatgttcgtc gtcgaacctg tgtacgataa aaccgtggca    157800
     gagctcgagg gtttcttgtt agaactcgtc gcgcaggata aactcgcgat ggatggttcg    157860
     gcgttcgcga agaaaaagta aatagtgatc acgacggatc cgcgttatag ataatacaac    157920
     agattagcaa catatacgat gcgtcgcagc gggcgggcgt gtgtgcgtgg tcgtttcatg    157980
     attttcttgt ttgttgcttc tcgaggctcg ctcttcggct tgctcgccta cttgtcgtcc    158040
     aacaccggga aacccttcat ctcctttatt tgcctcaact ggtcttcgtt caagttctct    158100
     ttgatttgac gcccgatttg cgtctgttcg agcgctaaat ccaagctcca ttcgctcggc    158160
     gacggctttt cgttttgact cggcggcaag cggctcagca tgacctcgta aagcatcttc    158220
     ccatccatga tgatcggaaa gaagtgcggc tgtccatcgc tctttgtctg cgtctcctta    158280
     aagtacacca agcacggaaa tcccggccac cagaactccc aattcgtgat ggtgtcgtac    158340
     gcccagcgat tctccccgcc gccctgcagt ttattatcgc cgctcgacgc cacgtccgtc    158400
     gccagcgccg ccgagtcatc cgcccccggt tcgatgaaca ccacctccag atccgttcgc    158460
     gtgaaccgaa atcgcacgcg cgacgcctga aacgcgagaa atccgcccag gaccccgtgc    158520
     accaagaact gcgtccagag gtgcagcgcc ggtcccgtga gcagcgcgac gccgagcagc    158580
     acgccgccga cgcgatagtc ccccggcacg accacgacgt cgtcatcgag cgacgacgcg    158640
     cgcgtcgcga cgctcgcgcg cgcgcgcgcc gccgtcctcg gtcggatcga ttcgatttcg    158700
     atcgttcgcc gaacgccaac cgtcgcgcgt ttgagcgcca acgcgtcgcg cgcgcgcgcg    158760
     ccgcgccccg ttcgacgcgc gcacgcgttc aagggcgcgc tcgcgcgcgc gagtgcggac    158820
     gcgcagcgca tggttcgctc gcggacgcgc gatgcgcggc gagatgtgcg gcgcggtcgg    158880
     tcggtcgccg tcagtccgcg acgcgcgaca tggcgtcgcg cggcgcggcg atggcgcgcg    158940
     cggcgctcgg cgtcgtcgac gcgaacgcga acgcgcgcgc gcgcgcgcgg gacgacggcg    159000
     cgggcgatcg agcggcgaag agggcggcgg gacgggacga cggcggcgcg gggtgtttga    159060
     attcaaactc gagcgcgacg aaacgacggc ggagcgacgc gggaaggcgc gcggacgacg    159120
     cgcgggacgc gagggaggag gacaaacgta gcgcgcgagc gtccggggcg aacgaggtcg    159180
     cgcgggcgac gacgggggag gcggtggcgg cgaatgaacg acagaggctg ccgaaaaagt    159240
     ttgaaacgct gcgagcgacg agcgaggcgg cgttggtcgt cgcgcgattc atgcgcgcgc    159300
     gagggcagag ggcgaccgcg gatgcgatgt gtgcgaatat tgagcgatcg acggggcggc    159360
     ggtgctcgtt ggagacgttg cggatggtgg cggcgtgcgc gccggcgggg acgattacgt    159420
     ttcgagcgaa gacgagtcgg gcggatgatt tgaagaacat tcacgtggat gtggatttag    159480
     gcatcgagga gggatcgagt gggaacgata aggctgggat ggtcgccatg cgggcgaaaa    159540
     tggcggcgat acgggcgaag atggttatga ttgtggcgaa cacgcacgaa ggcgacgcgt    159600
     acgacgcctc ggcggcgccg ccagagtcgt ggcgcgagga tttcgatctc gaaagcgtcc    159660
     ctctgcccga accggtgaaa atcgcgttca tggaagattc atcgagagac ggtccgcgac    159720
     tgttatcgtc cacgagcgcg ccgttgctcg gcgaagcgtc gacctcggcg ctcggtcgcg    159780
     gcggcgtgag cgaaggagag ctcacgcgcg ccatgtcaga tttgggtccg gacggtaaag    159840
     gcatctccgc gcgcgccgtt caagccgtgc ttgagcgaca agccatcgtc gaggcgttca    159900
     atgatcccag cgccgtggct gatcgcgagc ggcgtcgtct gcacggtcga cttccgcacg    159960
     tcttcgacgc cgtgcgcacc gccttcgccg cgcgcaagcg aagcgtcatg gaactcgacc    160020
     cacttctgga cgagctgatg cacacgaacg ctcgcgccga gatcagcgcg cacgaactcg    160080
     ccgacggtgt tcgcatcctc gctcggatgt gccccgagtg gtgcaccatc gttcacgcgc    160140
     ggcacgggga cgaagaactc tttcgaatcg tctctcgcga cccggcgacg gctcgcgtcg    160200
     cgcgcgccaa actcgccaag ctctgccgtg acgccgcgtg agcgtcgcga cgcaatatag    160260
     attttcacgc gtacaaatat ttcagatata gaatttttca tcgacgtcca ctttccacgc    160320
     gctgcccgtc gccgtcgtct cccgcccgcg agccgtcggc gcgccgccct aattcaatca    160380
     acttcacttc accgcgcacg gacgcgagtg cggtcgcggg tctaactcgc tccagaggtt    160440
     gaaacgcgcg cgcaccgcgt cctcgatcgc acgtcgcgcg ctataacgcc tcacgcgccg    160500
     cgaacatgga ccctttgcgt ttgattagag atcataccat cgccggtata atcgccgagt    160560
     gcgtcctcga cgcgccgccg ctcacgcgct cacgcgccgc gcgccgcgcg gaaacggttc    160620
     gaacgcgcgc gactgacgat gggcgctcga aacgggacgt aggtcgacgc acgacgatga    160680
     aaggattcac ctgaaggatg tcgacgtcga gctccggcgg acgacggaga cgaattacag    160740
     atccaaggct gggaacaagc tgctgaaggt ggaggcgata tggtatttca tcaagtatca    160800
     cgttgcgaac cccgacgcgg cgcacacggc ttacatgaag gcggcgatcg cggcggggtt    160860
     ctcgacgctg tctatgttgg atcggaaaga tttgatcgcg tacttgacgg gggagcgagc    160920
     tacgagcgat cgaatcgata tcaccgtgcc ggtgatcgtg gatgaggagg gtgtgtcgac    160980
     ggttgacgcg aaacgcgcgc gcgaggaaga cgaggcggaa ggcgtgccgc gagagcgcgt    161040
     gttaagagat aggaactcag tgcttcgcgc gccgaaggat atgacgagcg tgttggattt    161100
     cttcgcggcg ccggaggagg agaaggaacg tttagaagag gagaagcagc aggcggctga    161160
     tttagccaag gggattaaaa accagagata tcgcgacgtg aaggagcagg tgttttggag    161220
     agagcacgtc gggagcgact ttgatatgat gaatttggac accaatgcgt ccttcttgag    161280
     tgggcccaag ccacccgtag acgacggcac cgacatgttg atgacggacg cacgcgcgat    161340
     ggaaaaacag ccgaccgcac cgagcggtcc gtcgactgcg agtcgtggag gacccgctgc    161400
     ggccgccaag gctccgcgca agacatcagg caaaccgggc ggcgtcccga tcatcatcgt    161460
     ccccgccggg ttcaatcaaa aggtcgttct caacatgttc aacgccaagg agttcttgca    161520
     ggacggcaag tttacgcagt gggatgtggt gcaaaaaggc ggcgctaaaa agtcaagctc    161580
     cgtgtacatt tcgcgcacgt acaagcgcga cggcgccaag gtcaagtacg aagtcaccga    161640
     aaaagcccct cacaaacgtt ccgaagactg ggcccgcgtc gccgcggtct tcgtcctcgg    161700
     tgctaagtgg caattcaaag actggccctt ccgcggcgtc gaagacggtg atctcgtcga    161760
     aaccttcacc aagattcgcg gctttcacgc ccgctttgac ggcgatcccg aagtcgacgt    161820
     cgtcaagacc tggaacgtca agcccatcac catcagtcgc accaagcgtc acggcgatcg    161880
     cgccgcgttc gagttcttct gggacgagct cgatcgtcac ctcgcccttc gtagcagcgc    161940
     cttgaagtat taatcgccgc gtccgcggac gcggacgctt ccaaacgaaa acccatccca    162000
     agtcgctcac ctcgcgtcgc cgcgcgcgcg tggtgacgtc gcgcccccga cgtcgacatc    162060
     gcgcacaccg cgtcgcgcgc gaccgtccgt cgcgcgtcgt ccgctcgcaa accgacgcga    162120
     gtttttctca ccgtccaccg ctcgcgcgcc cgcgcgcgaa cgacgcgcgc gcgcccgcac    162180
     ggacgcgcga acgcgacgcg cgcgccgggc ggcgacgagg gcatcgcgtg acgacgcgca    162240
     tcgcgacggt tttcgcgcga cacgcgcgcg tcgagcgcgt gcgaaggcgc gaacgcgcgc    162300
     gagcaggcgc gcgcgaagga accgcgagag tcggcgcgcg cggagaggcg agaaccggcg    162360
     cgcgcgggcg aggaaggcgc ggtgaagacg cggtgaaggt tgatcgaatc aaaaagcgct    162420
     cgaacgggac gcgcgatggc gacgaaaccg ggcgcgttgt atgacttccc gtgggcggag    162480
     tggggatcga tgaagtatgc ggtgtttttg ccgttcgtgg cgacggtagc gctcggaaaa    162540
     gacgatgggg attcgttttg ttggcacttg ttggcgatcg cggcgctgcg gtacgcgagc    162600
     gcgcaacttt ggataagctt gtcgcgagtg cacgcgtgga cgaggaaaac gcggatacaa    162660
     gccagaggga tcgactttaa acaggtcgat agggaggata attgggatga ttacatattg    162720
     ctccaaacgc tggtgatcgc gctcgtgcat tggatgccgg gattggggtt taataatttc    162780
     ccggcgacga atgaaaagac ggcggtgcag ctgttgttgt tgcacgcggg gccgactgag    162840
     ttcatttatt attggctgca tcgcgcgttg catcatcaca aattgtacag tgcgtatcac    162900
     tcgcatcatc acgcgagctt tgtcaccgaa ccgatcaccg ggagcgtgca tccgttcatg    162960
     gagcacttga tgtacaccgc gaacttcgcc attccgctca tcgggacgtg ggcgctcggc    163020
     ggcggctcca tcgcgatgtt ttacatgtac ttgctcggct ttgacatgct caacgccatc    163080
     gggcactgta actttgagtt catcccgcgt tggttcatga gactgccgct gatgaagtac    163140
     ttgatttaca cgccgagcta tcattcgttg caccactcgc gcgtgcacac aaatttttgc    163200
     ttgttcatgc cgctgtacga ccacgtgtac ggcacagcgg atgtaacgag cgacgagttg    163260
     tacgagaagg cgatcaatgg gcgggcggta ccggtcacgg cgcctgatgt ggtgtttatg    163320
     gcccacggaa ctgagttatt gagcgtgttc cacttgcctt tcatgttgcg cagcttttcg    163380
     tctcgcccgt ttgtctcgca gtggtggctg aaaccgtttt ggccgctgtg cgtgcctttt    163440
     gtgcttgtgt tgcgaatgtt cggcaaatct ttcgtagccg atcgacaccg gctcaagacg    163500
     ttgaactgtg agacgtgggt gacgcccgcg tgggggtttc aattcttcat caagagtgaa    163560
     tttaatcaca tcaacaggaa gattgaggag gcgattttgg acgccgatcg cgccggagtg    163620
     aaagtcgtcg gcttgggagc gctgaataag aacgaggcgc taaacggggg aggcgcactg    163680
     ttcgtcaaca agcatgggaa gtctctgaag acgagagtcg tgcacgggaa cacgctcacg    163740
     gcggcggcga ttttacagaa aatcccgagc gagtgcaagg aaattttcct cacgggggcg    163800
     acgtccaaac ttggacgagc gatcgctctt tattgcgtgg agagaggcat gcgtgtggtg    163860
     atgtacacaa cgagcgaaga gaggttcgaa aagatcagaa atgaagcggc gaagaaggat    163920
     cagcatctcc tcgtgcaatc tacgtccctg agcgacgggg caaagataaa ggactgggtc    163980
     atcggcaagc actgcccgga gaaggatcaa aatatggcgc cgaggggcgc gatattccac    164040
     cagtttgtcg tgccgccaat ccccgaaacg cgaaaggatt gcgtgtacac cgacctgccc    164100
     gcgttcaagc ttcctaaaga ggcaaaagac ttccggtcat gcgagatgac gatgaagcgt    164160
     ggtcacattc acgcgtgcca cgcgggcgcc ctcgtgcact cgctagaagg ctgggatcac    164220
     cacgaagtcg gtgccatcga ccacacgcgc atagatacta cttgggaagc ggcgctgaag    164280
     cacggattcg ccttggctta agctttcacg ctcttgcata atttttagga tgacttcgcc    164340
     gaggctctcg acattacaga gccgattcgg ggttgtccag tcgctcgctt cacgcgattt    164400
     tgtagccata ggggcctgcc ccgcaactca ttgaaatttc aacgctaatg ttaattcgcg    164460
     aacgaacgaa cgaacgacgg acgggtcgaa atgcgcgttt gcgcgacgcg cccgctacgt    164520
     cgaaaacctc aggcgagggc tttactttac tggcctgcgt ttgtgactga atgaatgatt    164580
     ttatttaaac aaagtccaaa gagctatact ttactttatc tcaagctact agaggcggca    164640
     aagctagttg gcgagcactt cgcccgtttt cttcaacacg cgaaccttct tgcctccctc    164700
     ttccttcgtg ccgatgcgcg accggacgga cttcgcctcg ctgtagtgca tcacgttgga    164760
     gtgatgaatc gggaactcac gctgaataat ttgtcccgtc tcgccttcgc cgcgcggctt    164820
     gacgtgcttc gtcttcacgt taacatcctt gcagagcacc tccccggtct tggtgaagac    164880
     ttccaccacg ttcgtcacct tgcctttatc cgcccccgcg atgacgacga ccttgtcgtt    164940
     cgtcttcacg tgcatcggga tgcgcaccgg aagtccacgc ggcgtgagcg cttgcttttc    165000
     ccacttcttc ttcgccacga tttccatgcc gcttcggcgc gccgcgggca ccgggctcga    165060
     gacctacgtc gttcgcgtcg tgcgcgtctg tcagtcgtcg ctcgggggtg ctgattctag    165120
     cctcaatcgc ttttccaccc ttctcacgtc tcgcacgcgt cccgcgcgcc accgcactgg    165180
     acgcgtcgac gcgattaata cgcatccacc gcgtactcgt cacggcgtca tcatagcgcg    165240
     tcgcgcgtcg tcgtcgtcgt cgctgacgct tcgcgcgcgc gtaaacctag ggcttcgcgg    165300
     tcgtcgcgat gcgtcggctc tatcgtcgcg cgcgacgcgc gcggcagctc atcgacgacg    165360
     caccttgtta gaagaaatag cattcgcgtt gaacgcggcg tggcgcgccg agagggcgtg    165420
     agaagccaac atgtcgacgc ggtgttcaat gcggcgtgac gtggcgacgg cggaggggtg    165480
     tcgaagggct gtaatccgtg ttttaagtgg gatgcgcgcg agactggacg cgtcgacgac    165540
     gcgcagacga cgcgggcgcg gttcgagggc tagattgcta tgaaagacaa tgtttctagg    165600
     acgtcgcgtc gctcaggtga cgcgaacgat gaaatcgcac agcggggcga gttgattttt    165660
     catcgcgctg acgcggtcgc acacgacgcc cgggcgtctc gaggctttgg taaaggcgtc    165720
     gaacgtgaac gtttccccgg gtctttgaca gagcgtacgg tacttgtcgc gctttttctt    165780
     tgccacggcg ttcgcgcggc gctgagcggc ggtgattgcc atttcgggga gggagccggc    165840
     gtcggcggcg cgcgccgcgt cgatttctcg ttccagacgt tttcgaatga aatccggtgg    165900
     gtgcgccgtg agcttctcgc acttgttgca cgcgatcatg agtgggatct tgcgcgtttg    165960
     aaacgattcg tcgctcagga tgtcgaacag gaacttggcg acttccttgc gttcgctcgc    166020
     gaaggacacg ctgtccacga cgaagacgac ggcgcgcgcc cgcgccaact ctcgcagcgc    166080
     ttccttgcgc agcttggcgt gtcctggaac gtccacgacg cgcacgtgcg actttgtcac    166140
     ctctcgccct cggctattct tcccgacgac gaccgcgtcg ccgcactcgt tcgcctcgac    166200
     gctcgtcgtc gtcctgaaac gctgctctcc gtacttcaac ccctgccaca gcgccgtctt    166260
     cccgcaacct ttaccgccga gcagcaacac cgcgggttta tacgtcttcg aacgcgagcc    166320
     cggaccgctc gcgagggcgg cgaaggcgcc accgacgccg aaaacgacgc ggaaagcgac    166380
     gacgatggcc aggagcgtga cgatcgcgac gagcgcgtgc gcggcgttgg cgtcgtcgac    166440
     ggccaaacgg tgcgagagga catctcgcgc aaacgtgtgt gaggtgttgt acgcgtcgac    166500
     ggcgcgcgcg gtgagggcgg cgacgtccat ggggcgttgt gcgggacgaa gcgcgagacg    166560
     actggcgacg ggcgaaaccg aaccggcgag ctagcggtgg gtactaatac aacgcgctca    166620
     ggacgcgttc aggatggact gtcgaagttg cgaaatcacc tgcgcgggat tggcggcgcc    166680
     gaagacggcg ctgccggcga cgaggacgtt ggcgccggcg cgcgcgcaga gctcggcggt    166740
     gctcggattg acgccgccgt ccatttgaat gtccaagtct ggatacctcg cgcggagggc    166800
     ggagactttg tcacacaccg cggggttgaa cttttgacca ccgaacccgg gttcgacgga    166860
     caagcacagg accatgtcga cgagaccggc gtcgacgagc tcgtacacgc cgccgtcttc    166920
     gtcgcacggc gtggacggtt tgcacgccac ggcggcgcgc atgccgagcg atcgaatggt    166980
     tttgcagagc tcctctgcgg cggtaccgct gacaacttcg atatggaacg tcacgctcga    167040
     cgcaccggcg gcggcgagcg cgggaacgag cgtcgcagga ttgctcacgc tcaagtgaca    167100
     atcgaagaac gcgtcgcgcg ggccgacgcg tttcgccaaa tccgccacca cgggaggacc    167160
     gatggtcaaa ttagggacga aatgtccgtc catgatgtcg acgtgcaacc aatcagcgcc    167220
     ttcgtcgagc atgcggttga cttcggaggc taaagcgcct tggtcggccg ccaacagtga    167280
     cgggcaaacg atggcgcgtt tggtcgtcga aaccgcgggc gctcggcgcg cgccccacgt    167340
     ctcgcggaat gacggatata gtcgtaggta cgcggcgtac acgtcggcat acgctgcgtg    167400
     tgcctctggg ttcggactga tgacgcgcga tttgcgaacc atcgccgcga cggcttcgcg    167460
     cacgcttcca aacaaccccg cgccgaaggc ggcgagtatt gcgcaaccga gcgcgggggc    167520
     gtccgaacac tcggtgacga catgcggcac tcccgtgacg tcggcgtgaa tctgtaacca    167580
     aagttcgctt cgcgtcgccc cgccggcgat gacgacttcc ttcggttcgt accctccgcg    167640
     ggtcatggtt tcaaaaatca atcgcgtacc gcaacacacg ccctccaaaa tcgcacggaa    167700
     cacgtgcgct ttcgagtgct tgagcgtgag accggagatc actccgcggc tgagtgcgtc    167760
     cacgtgcggg gttcggttgc cttgaaagtg gtcgagcgcg acgacgcctt cgcatccagg    167820
     cgggatcgcg ctcgcttcgc ggttcatgtc gtcgtaaaac gaatcgccgc cgccgcataa    167880
     attcttaaac caattcacca cggaccccgt gctcgtctga ccaccctcga cgacgaacgg    167940
     cgcgctctcc acgagcgcgt ttctatacgt cccgaagata cccttcgcgt gaaattcctc    168000
     ctccgcgacg cccaagtgca ggtgcgacga gcccgtgatc agcgctaact gccccggttc    168060
     gatgactccc agcccgacca ttcccacgaa cgcgtccgcg cctccctgaa tcaccttcgt    168120
     gccctcgagc aacccgcacg ccgccgccgc tcgtgccgtc atcccgccca ccgccgcgcc    168180
     catcggtaat atctccttcg gccacttttc caccaactcc gcgcacccaa gcttttctaa    168240
     catcgtcatc ggcggtctcc cgtcgccgtc gaagtgccac cgcacgccga cgttgttcat    168300
     cgacccgcag taccgtcccg tgagccacag gtttacgtaa tcctgatact cgcaaatcat    168360
     cgtcgctctg tcgtaccgct cccggtcgtt tcgcttcagc cacagcgcct tgggcaccat    168420
     ccactccgcg ctcaccggtc ccgcgcccgc gcagttgacg cgaagcgcgt cgtcttccgt    168480
     ctcgacgcac gccgtcgcct cgtcgctcgc gcggacgtcc atccacagca cgctgttccc    168540
     gatcgcgtcg ccgcgcgcgt cgagcgcgac gaccgagcag cacgtcgtgt cgacgcacac    168600
     ggccgcgacg tcgcgcgcgt cgacgccgca caggcgccgc gcctcggcga tggcggtcgc    168660
     gagcccgtcg agccacgacg cggggacttg ctcggcgcga ccgggcgcgg ggtgcgaggt    168720
     ggcgtacggg acgtcggcga acgcgagcgg gacgccggtg agggtgaaga caccggcgcg    168780
     gatgccggtg gtgccgccgt cgacgccgac gacgacggga ggcatgacga gggggaggcg    168840
     cgcgaggcgc gttgagcggc gagcggcgaa cggcgacgac gccgcgaagt tacaaatcgt    168900
     cgtcggaatc gatccaaggc ggacgcggga cgacgagggg attgggttcg ggcgcggcgt    168960
     tcggtttggc ggtgacgtgg acgtatcggg agagtaaagc gccgcggagg atgtcgtcgt    169020
     cggcgacggc ggcggcggcg gcggcgctcg gcggttcggg ggcgtcggcg aggtctgcgc    169080
     gcgacgtcgg gtcgaacgag cgttcggagt ccgtcatcgc gatgatactc ggcggtatgg    169140
     gagcgtttgt gaggtcctcg ctcgaggcgg cggcggcggc ggcgagccga cgcgcgcgaa    169200
     gcgtcgcgga gcccaagcgt cgatgggacc tttccgacgc ggtttcgctc gtcgtgtcgc    169260
     tcgtcgtctt gaactttcgc ctaggtttca cggacacggc ctcagaggct tcggaatcgg    169320
     agtcgccgcg cgttggtgac ggtggattct tcgcgcgcgg cgcggaagcg cgaagtcgcg    169380
     gattctcgtt cgcccgtcgc cacgcgtctt cgagttcttt ttgtttgtca gccagatcca    169440
     tcaagtccag gttcagcgtt cggctgatct ctcggatctc cgtcgagagc gtatccatgc    169500
     gcttcagcag gtcgtcgtct gcgccactcg tcgtcgcgat gatggatgca atttctcttc    169560
     tcaccgcctc tctcgtcgcc gcctctttcg tcgccgcgtg ctcgatgtct tcctcccatt    169620
     tttgctcacg aacgtcgata gcgaactgga gcttggcgaa ctgtgcgttc actgacgcca    169680
     tctcaccttt cgctgcatct aagagctgct gcgcctcctc gcacgtgatg gcggtgtcga    169740
     gttttgcaag gtgcgcgtcc gcgtctacgg cggcggcgcg gtcggctttc agctgttcaa    169800
     tttctttctc gagcgcgacg acgtgcgcat cgtacgcacg cttactcgac tccatgtgct    169860
     cgttcaatcg atccatctct tcgatcgcct tcgactctac gaaccgcacg cgctccgacg    169920
     ccttagtggc gagcgacgcg tactcttcgc cgaatttgtt caacgcctgt tccatgcgct    169980
     cgatgacttt actctttttt cgcccgctcg aacgttcggc ttcgagcgct tttacgacta    170040
     accgtaaatg tctcggcgca gcatcgcgct cgtgcgcgcg tagctccgtc tccgcgccga    170100
     cttctagaca gccgaatgcg gcgaacgcgc acggcttgct cgccccgacg caaaagaatt    170160
     cttggtgggc gtcaaacgct ctcgtacgca ccatggcgcg gcatcgagga caaggccgtc    170220
     tagactcttc acacttcacc gcgtgtatcg atgcgtgcat tgcgttaacc acggcatcgc    170280
     agctcggaca gtgccacggg cgaaagtcgc aatctgtcct gtgtgagtcg atggcgtcac    170340
     gctcgcatcc gtacaagcag ccgttgccgt cctcgtgctg caagttaata aatccacact    170400
     tgatgtactc ccgagggcag atctcacggt gttcggcgag ctcacgtcgt ttaccatccc    170460
     actcgcactc gttcgggcat ttcacgagcg cgctcgggca cgtcaacgcg tgctgcgtca    170520
     tcttacaaaa cggcacaacg tcttcgcaac ccttgacgtc gcacttcacc gaccgccacg    170580
     cgcattcact cacgtgactc acgtaggcaa tcttcgtcac gatcgcgccg cagtaatccc    170640
     tcccctttcg cgcctcgttc gcctcgcact ccacgcgcga gtcgtacgga taccaacatc    170700
     gtctcggcac gaaggcgcac tcgcgatcgt gcacgtctcg taaacgcaac cgaataccgc    170760
     tctcaccgca cccatccgcc ttccagcacc actcactcgc gccctgcgcg tttcgcttca    170820
     acaccatcgc gcgtctgcac agcacgggca acgactgaat cgcatcctcg acctcggcgt    170880
     cctccgcgag cgcgtcctcc gcgtcctccc tcggcgcgca cttcgcgcaa tacgtcgtcc    170940
     cgttctccgc caccacgggc gacagcatca cgtctcgaca ctgcggacac accaagctcg    171000
     cgtgcggaaa ccccacgaaa accgtcggcg cgtgttcgag cgcgtcgtcc tccgcggctt    171060
     cctccgcgtc gtcgccgcgc gtcgccgccg tcgaatcctc gcccgcggtc tccatcctcc    171120
     ccgacgtcat cgccgcccct ccgcgcgcgt cgacgccatc cagcgtcgcg cccgcgtcgc    171180
     gccgcgcccg tccgagcgcg ccgcgcgccg tccacggcgt cgcgcggttc gttgacatcc    171240
     aaaaatccgt tccattgcct cgcgcgtccc gaagcctcac gagcccgccc atggcgcgcg    171300
     cgccgcgtcg cgcgtcgcgc tcgcgcgcgc tcgcgcggtc cgtcgcgacg tcgcggttcg    171360
     cgcgacgccc gcgcgacgcg cgcgcgtctg acggtcgcgc gccggcgcac cggcctcgag    171420
     tccccccgtt ctcgaatcaa gactcgtcaa atgatgggcg tttcgagttt gatgggcgtt    171480
     tcgagcgcgc aatacgtgga gcgaggcgcg cgcgcgcgga cggcgcgaag tctcgcctca    171540
     gtgcgcgtcg cgacgccatc gcgccgccga cacgccgccg cgcgacgcgt cgatttccac    171600
     gccaccgcga gacggcgccg cgcgaccgcg aacgccctcg agcgacgcgc attcgaacga    171660
     attctcgaac cctattgatc cccgcgatcg accgcgcatt ccgtggaatc gcattcgcga    171720
     cgcgttcacc gacgaaacgc gcgattcggc gtcatgtcgc tcacgagcga tgagatgaat    171780
     tatttggtgt atcgatattt gctcgaaagt gggttcacgc acgcggcgtt cgcgctcggg    171840
     aacgagagct acgtcgatgg gcgaaagttg accgacggcc aacgcgaggt tcccccgggg    171900
     gcgttgatct cgttcgtgca gaaggggttg cagtactgcg agctcgaggc gaatctgaat    171960
     gaggtgcgtg aagtgatgac gcgcgcgcgc gacgcgggag gcgggcggaa cggggcgcgc    172020
     gggacgacgc gggcgcgcga cgcgtcgacg cgcgcgagcg aggaaatgtt aaaaattaaa    172080
     cgcggacgaa cgcgcggcga cggtgcgcgg atgactgacg gtgtcggtga cggttttatt    172140
     tcgttatgta ggatggtacg gatgttgacg ccgattttag cgtgctgagc gctaaggatt    172200
     tgctgtcgct gagcgtggac gagttgaagg aactcgtctc cgcgcggaga aatatgacag    172260
     aggaggagcg caaggcattg agggaggagg aagagaagga ggcgcgcgcc aaggcggagg    172320
     cgaatgggat caagatcgag agtgatattg agcgagagat caagtcggag gaagtgacgg    172380
     tgttggatgg acacacgagc gaggttttca tatgcgcgtg gaacccgacg aagcaaatgc    172440
     tggcgagcgg tagcggagac agcacggcgc gggtgtggac cgtgccggct gggccgtccg    172500
     ggcgcgaggc acagacgaag ttggcgaagc cgaaggtgct ggatcacaaa gcgagcggtg    172560
     atggcgtcga ggcgatggat acagacgaga agagcgcggc gcccgacggc aagtcgatgc    172620
     aaggcgacgt caccacgctc gactggaacg cggacggtac tctgctcgcg actggctcgt    172680
     acgatggcca ggcacgcatt tgggatacga atggcaagct aaaaatgagc ttgaagcatc    172740
     acaagggccc gattttctcc ctcaagtgga acaagacggg cgactgcttg ctcagcggtt    172800
     ccgtggacaa gacggctatc gtgtgggacg cgaagacggg cgacatgaag cagcagttcg    172860
     cgttccactc cgcgcccaca cttgatgtgg actggcgaag ccccacggag ttcgccacgt    172920
     cttccatgga tcactccatc tacgtgtgca aacttgggga cgacaagccc atcaaggcgt    172980
     tcaacgggca cactgacgag gtgaacgcca tcaagtggga tccgagcgga acgctcctcg    173040
     cgtcttgctc ggacgacttc acggcaaaag tgtggagctt gaagaaggat acgtgcgtgc    173100
     acgacttcaa cgagcacgag aaggaaatat ataccatcaa atggagcccc acgggccccg    173160
     gcacggagaa tcccgacctc ccgctccttc tcgccaccgc gtcgtacgac gccaccatca    173220
     agctttggga cgtggagtcc ggtaagtgtt tgcacacgtt ggaaggtcac actgacccgg    173280
     tgtactccgt cgcctttagt cccgacggca agtacctcgc gagcggttct ttcgataagc    173340
     acttgcacat ttggaacgta aaggatggga gcttgatgcg aacgtatcaa ggagagggtg    173400
     gtattttcga ggtttgctgg aacaaggaag ggaccaaagt cgccgcttgc ttttcgaata    173460
     atagggtgtc tgtcctggat ttcgagaatt agcgcgagtt agcggagaga gaagtttttt    173520
     taattcgaat ggtcgattcc agaaaatttc attccattat tcatcgcatc acggccgagg    173580
     cgtcgaatac acgtcccaca gcgcgtgcgc gtcgtcgagc gattcctgcg gtaccgcgca    173640
     cacgtccttg atgaacgcta tctttccatc atcgcatttc cactcctcga aacgctcacg    173700
     caagatgtgc cccgtcattt tcgtccgccg cgtgtcgtct ctcaagtgtt gcgagacgaa    173760
     gacggcccac tcgcaccgtc ctcgctcagg cataccaaga agctgcgtcg cgaaggcgac    173820
     ggtgatttcg tccgccaacg cgtccatgcc ctcgccctct agcacaccga tcgcgtttaa    173880
     gacgccgaat aggtgccaag caagcgacgc gttcaagacg tcatccgagt acgtgagcgg    173940
     gtgaaacgcc acgcgcacct ccgccgtgct cggcgacccg ccttcgtcct cggtggacgc    174000
     ggcgagggcg agaatgttga acgccacgtc gcgcaagtgt gtcgcttggt tcgcgtcgag    174060
     tgcttcgtaa gtcgcaaccg gcggcagcgg gttcgccgcg cgctgttgcg cgacggcgtc    174120
     gaggtagttc ttcaccacgt cgcgcagcgg cgacgtcggt ccggcggcga gccacatgtg    174180
     taagcctaag ttttgatacc aacccatccc gtcatcgtcg cgctcgacct caccggcgag    174240
     aagcttgaat gcttgctcgc tgaactcgtc gatgtacttg cccaccgacc ccgcgcgcca    174300
     gcgcgtgagc tgttgcttgg cgtagaacgc cacgtttttg ccggcgccga tttgcgccaa    174360
     acacgtcgcc aaacgcggat ctccgtgcgc tgccgcagcg cgtgcagcgc tcacggttcg    174420
     accaccggcg acgtgcgtta acgccgcacg tctaccgaac agctcttcct cgcaaggcgc    174480
     agcgcgcgcg acttgttctc gcaaccaagc gctcacgccg gcgcgtcttc ggtgcacctc    174540
     cgccgcggtg cctcgagacg ccccgagctt gtcctcggcg aacaactcac tcacgagcgc    174600
     ccacgcgctg acttccgccg ccgcgcgatc gcgcgcgacg acgtcgtcgc cattactatt    174660
     cgctaacgcc tcaaccacgg cctccaactg tcgcaagcac gtcgcggcga tgccatacgg    174720
     tttcgattcc gtcgactcgc gcgagcacgc ctgacgcaat cccccactcg cgcgtcgcac    174780
     cgactgatcc agggccacct ccagcgcacc cacgacgccc gcaaacgtca tcttcgtccg    174840
     aaccgcgcac gcgacgacgc cgtcgtctcc gatcgccggc gtcgccaacg cgccgcgcgc    174900
     gccgaacgcg gcgccgcgag accccgcgag cgcgccgtac gcgtccaccc ctcccaccga    174960
     cgcctcccgc gtcgccggcg ccgcgcgcgt cgacgcatac cgcatcgacg ccgtcgctcg    175020
     catcgcgtgt ccgagcgctc tcgccatggg cggcggccga ggcctcgcga ccgcgtcgcc    175080
     gcgcgcttcg tttgaatccg tctccaacgc gcgcgcctca ttttcaccgt catccacgga    175140
     taagaacgcc ccgaacgcgt ccgcggtgga ggtctgacgc gcgcgcaacg cttcgagcgc    175200
     gtcctcgtgc gcgcgcagcg cttccgcggt ggcgcgcgag tcgtaaaggt ctacgatcgc    175260
     atcgtcgcgc gcgtcttcat ccatgaaatc gtcgccgtcg acgcgcttcg cgagacgacg    175320
     cgcgccgacg acgccgagcg ggacgtcgtc atcgtccgag acgtcgctgt cggcgtcgag    175380
     gagaccgacg cgcgtggcca tggcgcgacg gcgtctgcgg gggacgacgc gcgacgcggc    175440
     ggttcggtcg cggtttcaaa cggtggcgtc gcgcggcgcg tgcggtgcgt gtttccgcgg    175500
     tgtctgcgtt tgcttgaatg aaatcacatc acggagcgat ggtgtctaaa gccatgtagg    175560
     tatcgcacca ggcggtgtgc agggcgctcg gttccgtcgc gtcgcgaatc ggcggtacgc    175620
     cgcggccgcg atacgccgcg cgcgtgagct tttccacttc ctccggcggt cgttcgttcg    175680
     ctaagttatc ccaatcgatg tcgcagagca gcgcggatcg cttgactaat gtggcgtcgt    175740
     gcatgcggtc ttttgggttg accacgagaa gcgcgcgagc caaggcgacg gctttgggat    175800
     cggcgtcgcc gcggaagatc gtggataaat cgcaccgaca aattgactcg tacgtcttgt    175860
     gcgtgacttt catcccgaac ggtggcgtcc cgttgagtaa gtgcacgatg aacgtcccga    175920
     gcgaaaacca gtccgcgcgt tcgtcgtggc cgacgccgcg aacgacttcg ggcgccatgt    175980
     acgccgcggc gccgcacgcc gtaaacgtct ttccgggcgt gtcgtccgtc accgcgagat    176040
     gtttagcgaa gcggaagtca gtcaaccgca gcgcgccgtg ctgatcgatc gtcatcgtct    176100
     ccgggtccat tcctcggaat acgatgtcca tggcgtggac gtactcgaac acgagcgtaa    176160
     acgcggcgac gtagtacttg acgacttcgg gcttggagcc gccgccgcac gcgatgacag    176220
     cttcgagcgc acatctcggc gcgaatgggt acggaatgga gatgaaactc gagtctttcg    176280
     atgggatggc gggtatggga atgaatgccg gcggcttggc tgagcccgcc gtgagcattg    176340
     tgatgatggc gcgctcgcgc aacacgccct cgactcgcgc gagcgattct gttctcgcga    176400
     gcgagatctg caccgtcgcc tccttagacg cccccttcgt ttcgcgcaag tgaccgagca    176460
     acgtcatgta cagcgcctca cgcgaggctc gctcgtcgtc cccgaaactt aatcgccgct    176520
     cgtgcggatc taaagcgcgc tggggcgatc ggatgcgttc catcgacgac gatcgctcga    176580
     gagtggcgct cgacgtccgc acgatcgcct cggttccggt gacgtttgtt atatcggtca    176640
     gcttaacgcg ccatacctca acgtcgtcgc tgatggcttg aatattagtc gcacacggcg    176700
     cgccacttct cgagagaagc gcgcgttcac caaaatattg cccactcgtc aacttgagca    176760
     ccaccctcgg cgtctcgctc tcgtcgcgcg cattcgcacg cacggtgcac gacacatccc    176820
     ccctactgat gatgtacata gcatttatct gctgtccctg acgcgcgatg agctcgcttg    176880
     tttgagcctt tacgagagat ttcccgcgct tatcgacgat gttcgtggcg attcggcgca    176940
     agtcgctgat gctcacggct ttcagcgcgt ccacgccgcg cagcgcgctc gtgagcgtgt    177000
     ttacgctcgg ctcgtcgtcc tcgcgcatga gacgcgtgta agtggcgaag tcaagcaccc    177060
     agaggaccac gtcactgttc gcggtgacgg tctcgtgcgg attttgggcg tgcgccatgc    177120
     actgttcgtt gaagcacatt ctgtcgccgc ctttgccata cgttcgcacc ttgacggctt    177180
     ccttcttctc cgcattctcg tctccctcgt tctcgaccca cgcgacgttg tcgcgccccg    177240
     tgagagtgcc actctgtacg gcataaagcg cacgcagcga atacttgtcg ttttgcgtca    177300
     cgacgacatc gccgtcgtac actcttttcc tgtacatcgc ctccgcgact tcgttcaaaa    177360
     tcgcatccga gacgccgata aataagaatg attgcttgag aatcgataat aacgccgatt    177420
     tgtcctccgc ggtggcgatg gacagatctc ccatctgctc ttccagtgaa cctctcgtgt    177480
     tgaacgagat atcggacggt aaaccgtaag ggtgcaccac gcgataactg cggcgcgttt    177540
     gcatggtgaa cgacggcacg acgcgacgtc gaggtctcgc cgacgttggg aacggcgacg    177600
     agagctggtt cgcgcgatcg ggaaagttga acagcgcact gacgctcacg gactttctcg    177660
     gcgtgacggg atcgggatcg ggatgggttt cgtccgggaa gtcttcaatc aagatgacga    177720
     tgacggtgat gtcgtccgtg cgcgtctcgt attgaagcca gagcttgtac gattccacca    177780
     cgagcgcgat tgcgctctgc tgtggatcgc tcgtcgccat cgcggctttg atcacgcttg    177840
     tggacggaat gaattcgaaa actccatctg aagcgatcac gatcgccttc gtgtctttgt    177900
     tcaagcgcac gcgctcgatt tccggcgtcg cgacgacgcc gatgcgctcg gcgacggcgt    177960
     cgcctatgga acgagtaaac gccgtgccag gatacatccc attcttcgcc cacagtcgcg    178020
     ggggatcgcc atcgtcgtct tgctccgtcc cccaacactg cacggtggga tctttgaacc    178080
     cctcgagctg atcgagcgtc atcacgcgcg cgcccgcctt cttcacccgc tcgcactcat    178140
     ccgcgcgaaa cggcgtctga tccgaactca aatccaccgt ctccaccaca acctctccct    178200
     tatcgtccgc cttctctatc cccatcgtcg cccgcgagtc ccccacgttt atcacgtaca    178260
     aatccctccc cttcacgtgc gcgatgatcc ccgtcgtccc gctcaacgaa tcgtccacct    178320
     cgctccttcg cagcgcctcg ttcgtcgttc gaaacgcctc ctcgtaccct ttcgcgtccc    178380
     caaactctcg cttcgccatc tccatcggca ctctcatcgc cgcgaacctc gcgcactccg    178440
     ttccaaactc cccgtgtccg tcgaagacgc cgaagacgca ctcgtcgtcg cgatctccaa    178500
     atctcgcctc gctcacgtgc gcgtcctggt tcgccttgct cagcgcctct gggtagtacc    178560
     ctcgctgcga gcacgccgcg tatcgcatcg cgtacgactg cgcgcgaccg cgttcgtccg    178620
     tgaacgccac tcggaccgtc ttcgcgccct tgacgccggc gagacgggcg ttgtattgct    178680
     cctgcgtcag cgggccgccg cgcaggcgca cttggtaccg cacgggggcg tcgtccgtcg    178740
     gatcgacgca ttcgtcgtcg tcgcgcgcgc gcgcgcgatc ggcgacggga cgaacggggc    178800
     gcgcgcgcga tggagacgcg ggcgcgcgag gcgccgcgtc gcgcgcggcg ctcgcggcgt    178860
     ccgcggcgga ggacgcgcat cccatgcgcg cggcgaagag tgcggcaacg gtttggattt    178920
     ggaggcgagc gggacgggac gcgcgagacg agacgcgatt cgaatggatc gagagaaccg    178980
     cgagggacgc gcgacgaaaa gcgcggataa ggtgatacta aggatgctac gcgcgcgcgt    179040
     tcgcgcgagg gacgaggggc gtcgcgacgg cggtggacgg gacgagctag agcgcgtcgc    179100
     gcaagacgcc gtcggcgcgg tacttgtcct tctcggcctg ccgcgctcgc gccctgtcgg    179160
     ggtcgacgcg acgaatgcct tggatgccca cggtcggggg acgacgctcg cgttcccaaa    179220
     cttcttcttc gttgtcgatg tgggtggtga cggagagctt cgtgccgcgt ttggcggctt    179280
     gttcaatctt ttcgcgaatg gcgtcggatt gtaacgcgct gaacggggcg gcgtcttttc    179340
     cgccgccggc gccgccgctt tgggagccgg actttctaaa atcaaatact tgtttaccgc    179400
     cgccgccgcc gccgccgtgc cacccgccag cctccatgct cagaccgttc gaggcgattt    179460
     gttgcagcga ctggtacacc gcctccacgt tcaactccat gttcagttgt ttctcttcaa    179520
     tcgtgtcgtt gctgatgatg atgtgtgaca cgttcgacgc ggtgtcttgg ccaacaactt    179580
     gcacttcctt gacagcgatc atgacttgcg cgatttgctc tgaaatattt actatgtcgg    179640
     cgtgcatttg ttgcatcgcg agcttgatgg cgcccatcgt cgccccgggc gccgctcccg    179700
     agactggtac attcgtatcc ttgaatccac ccgctgtgac cgttccgatt gcaccagctt    179760
     gctccctcgc acgtcttttc gtatcctctt gggcgcgttc ctgctgcagc aactcgcgcc    179820
     aattcgagca cacgttgcgc gttgtttctt ctaaaaatct tcgcatgtcg cactcgctca    179880
     acgcgatgcg cgccatcttt ggtttgttca gcgcttgtag cgcgtgcaaa aactcatcct    179940
     cgaagttacg caatagagtc ggttgatgtt gcgcgcaaat atcataaaac accgcgtggt    180000
     ccatgacgag cgcctcgacg tgtttgtcaa acggcatggc gcacaacatg cctttataga    180060
     acccggaaag taaaccgggg ttgagcactg tgcccgggcc gcggagcaaa cctttttctt    180120
     ccgcgagttc gatttgctgt tctcgcaatc gcttgcgctt gattttctgt acgtgggagt    180180
     ggtggaatcc ggacgcctcg tcgggggaat acgaaactct cccgttgagc gtgatgatga    180240
     acttatccgc aagttcgtac ggatagcata tacgtgcgcc tcgcgcgtac atgtgcgtat    180300
     ccatggtacg acagaggatc tctatcacaa tcccgtcggg ctgcaccgtg ccattggcct    180360
     ttaaacctat ggacagcgct ttaccgtaaa tgtaaaagtt gacgtcggcg cgaatcgcct    180420
     cggggagcgg ttggatgata tctcggttca ccagtttttg aggtttcgcg gaagccttgt    180480
     agtgcgaccg gacgcgcgat ttcaatccgt ttggcatctt gtgctcggac aaaagttcgc    180540
     gtacgtggtt catgagcacc gcgaagcgat tcccgggcga gtcttcatcc atggacatgt    180600
     tcacgccgga gatgatggcg gaaaatacaa agcccccggt gatcatcacg aggatggcta    180660
     tgacgcgttc atcgacagtg gtcggaacga cgttaccgta gcctaccgtc gtgagtgttt    180720
     gcaccgacca aaacaacgcg gcaacgtaca tttcactctt gtgcgactct acaccgctcg    180780
     cgtcttcgcg ttgaaagtcg tacacgtagg cgtacgcaca cgccatccag tgagaaagga    180840
     gcactaaaag cgcgagcaag cgcccgagag tcaccatttt atacacgcgc ataagattct    180900
     cttgataacg ttccaagatt ctacccgtgc gcatcacgcg aagtaggcgc agcattttga    180960
     acaaacgcag cacctcgggc acttgtgaat tctcagccgc ggcgccacac gccgcctcag    181020
     actcccacga acacgtcaac gtgccatcga tgctgcgaga aacgtaatcc acggggatta    181080
     gcgatatggc gtccggaatg aaccagcctt tcaagtaatg cttttgaatc ttccacaaat    181140
     tcgtcacgta gtgaaagtcg tcgtcatcgg cgctcgtctc ccagtacgcc gtgaagaagt    181200
     tgaaaaacat gtcaatgtag aaataaatat cgaccagaaa atccgcgacg taccacaatc    181260
     cgtacgacgg ctcgctgaac ccgatgcgat agggcacgga aatcgcgatg tacagcaaca    181320
     ggaaaatttg tagaaaatcc caatactgcc gcagcttcgt cgtcgggtgc atgacgaata    181380
     acgatctcgc ctcgtcgtca tcgccgtatt tcgcgatcgc cgaggcttca tcttcgtcct    181440
     catcgctgtc cgccgcgttc caatcggcct cggactcgtc gccgtgatcc aagaaatttt    181500
     ccaaccgggt ggtatcaaac atcttttgct tgtgcttctc cgacgccgcc gccgtcatcg    181560
     ccgccctcgc catcttattc tcatctaacc gccgcctcgt gtcgccctcc tccttttcgc    181620
     gcagcgcctt cgcgctcgtc gccaacccat gcttcgctct cgccgcgctt ccccgcggca    181680
     cgttgacgat gcccgccttc gccgcctcct tcgcccttcg aatcgcatcc ttcaccttct    181740
     ccgcccgcgt catcgctcgc gtcccgttcg ccgcgtcgag ctttccatcg ccatccccgc    181800
     gcgcgccctc gtcgcttccc gcgctgtcgt gcgcgctcgc cgtcgtcgcg tcgcgcgcgt    181860
     cgctcgcgtt tggtgttgcg cccgcgccga agaattcgtc gtcggaatcg ccgtcgcgcg    181920
     tcgcgcgcgt cgcgcgatcg cgcgtcttcg cgcgcgcgcg ctcggcggcg gccatcgcgc    181980
     gcctgcgcgg cgacgcgacg tcgcgacgac gcggtgtgcg acgcgtcgcg ccgcgaccga    182040
     ccgaccgacg cgcgcgtccg tgcgccacat cgtatgggca aacagtataa cgttaatata    182100
     aaccatcgcc ccgacgccgc gccgtcgacg cgcgcggcgc cgcgcacgcg cgcgcgccga    182160
     tgttcgcgcc cgcgacgcgc cgcgcgctga cgcgcgccgc gcgacgcgcg atgtgcggcg    182220
     cgcgcgcgtc cgtcgacgac ggactgacgc tcaccgacgc gtgcgcgacg cgcctgcgcg    182280
     ccatcgccga cgaagacgga agcgcgcccg cgcgcctgcg gctcgccgtc gagggcggcg    182340
     ggtgctcggg gttcaagtac gagttcaccc tcgagcgcga cgcggcgacg gcgcgcgata    182400
     agacgtttcg agcggcgaac ggggcggagg tggtggtgga tgcgatttcg tacgaattcg    182460
     tcaagggggc gacgatcgat tacgcggagg agatgatcaa gagctcgttc gaggtggtga    182520
     agaatccgca ggcggagacg tcgtgcgggt gcggggcgtc gttcggggcg aaggacggcg    182580
     cgttcggggg gtgacgagga cgacggaacg cgtcggcgaa ccgaagacgg aagcgcggga    182640
     gggggcgcgg ggggtaattt tttctgtacc gcgcggcgca cggcgcgaga tttaggatag    182700
     gactgcgatt gcaacacgac gatggctacg tttacgagac gacgacggag ggctcgagag    182760
     ggcttcgatc gcgcgcgtct acgcggtcgc cgcgtcgatt tccgccgata cgcgcgcggc    182820
     gtcgcccgcg gcgacgacgc gcggcgttcc cgcgggagga tcgcgacaca tctccggccc    182880
     aatcgtggaa tcgtccacca tggtgaagca cggcacgtcc ttgaacttgc cgtcggcgta    182940
     ttcgtgaatc tttttgacgc cgtccaaaaa cggcaagctc accatcgccg cgaactcgtg    183000
     cacgcgcgcg ccgagctgat cgacgagatt gaaccccgcc aacgccgtcc cacccgtggc    183060
     gatcaaatca tcgatcagaa ccacgcgatc gcccgctttg acgctcccca ggcgcatcac    183120
     cgtctcgtcc gtcgaatact cggtgacgta cgtcccgctc gacaccagca cccccggcag    183180
     cttcccagcc ttgcgaatca tcacgaacgg cacgttcagc gccatcgcga tcggcggtcc    183240
     gaacaggaac cctcgcgcgt cgaatcccgc gatgtgcgtc ggtcccgcct cgccctgcgc    183300
     gcgatacctc gcgacgaaca gctccgtcac cgcgcgaaac acctcgggat tctccgtgat    183360
     cccgctcacg tcgtaaaacg acggcacgtc gtgcggcgag tactcgggtc cgtaccacgg    183420
     cagcgccgcc gcgatcgcgc gcaccgccgc gtcgttttgg tccaagcaaa agtgattttc    183480
     cctgtcgcgc gcgcgcatcc atcccgaacc gtcgtcagcg cgtcgttcgc gcgcgcgcgt    183540
     cgtcgcgtcg ccgcgcgtcg atcgagcgcg cgttcgcgct cgcgcgtcgc gcgcacccga    183600
     gcgttttcac cgcgggcgtc gccatcgcgc gtgcgtcgtc gcgcgcgcgc gcgtcgaggt    183660
     gtgccgaccg acggcgtcgc cgcacgtcgc gacgcgcgtc ggacgcgcgc cggacgcgcg    183720
     cgcgatggcg tcgcgcgtcg cgtcgagcgc gcgcgcgtcg tcgtcgcgcg tcgcgcgcgg    183780
     cgaagacggc gcgaggcgcg cgcgcgcgtc ggcggtttcg agacggcgcg cgggcgcggt    183840
     cggcgacgcg cgcgtgtgcg tcgagacggc gctgcgcgac gacgacgaga cgtcgggagt    183900
     cgcggacggg ccggggtgct tcgcgctcga ggacgcggcg ggcgcggtgg tgttcgtggg    183960
     gggcgggcgg cgcgcgcggg acgcgctgcg ggcgtacgcg gcgacgacga cgagagacgt    184020
     ccggaacgag gtgttcgtcg gcgcggtcga gacgctgccg aagcgatcga gatcgagcgc    184080
     ggtgcgaaac gcgatgaagg cgatgctcga ggggttggag tacgcgccgg aagataacgc    184140
     ggcggcgacg acggcggcga cggcggaaac cgtcggatac gcgttctcga gcgatcacct    184200
     gcgcgcgctc gagcgcgatg ggtacgtcgt cgtggatgat ttgatatcgc aagacgtcgc    184260
     gcgggccgcc gcggcgtcgg cgcgggcgat gtacgatcgc ggggtgatgc agaatttgcg    184320
     acaagagggc agggacgacg acgtcgccgt gttggcgacg tcgagccttc cggccgggga    184380
     cgagttcgcc ggcctgcggc cttgcgtcga ggcgttgctg cgcgttccgg acgatcttcg    184440
     acgcgtcgtc gcgcgcgtcg acgacgacgc gctcggtgcg gacgtcgtat caaaagttcg    184500
     cgcgtgtcga gcccccgacc gcctgatgct cgctcgatac ggctccgaga gctgtcgata    184560
     cgtcccgcat ctcgacaacg acccctccga cgacgcgaac gacgccggat cgcccggttt    184620
     acgaccatcg gacagagtgt tcaccctgat cgcgtatttg aaccccgatt gggacgcgac    184680
     gcgcggcggt cgctttcgag cctatcgccc cggcgtcgcc gccgacgccg cctcgccgtc    184740
     tgatttcgtc gacatcgacc cgattctcgg ccgcgtcgtc gtcttcgacg ccgccaagct    184800
     cttgcacgag gttcgtccga gttttcacga ccgttacgcc gtcaccgtgt ggacgcgcgg    184860
     cgcagagctt ttgcccgcgt agctccggag ccagccttcc cgccatatcc gattgtcacg    184920
     cgagactgca ttattcgtca tcgcacggct cgacgcaccg cgcgcgcgcg cgccgacgac    184980
     cgcccgagcg agacatcgcc cgcgcgcgcg tcgtcgccga tgtcgcgcgc cgacgccgcg    185040
     tcagcgacgc ccgcggcgcc gattcccggt gacgaattaa tcgacgacgc gccgtcgccg    185100
     atcgacgcga ccgcgaccgc gaccgcgacc gcgacgggac gcgcgcgcga cgcggtcgcg    185160
     aatgatgact cgagaccgac gacgagcgcg tcgagcgagg actcgaacgc gacgatggag    185220
     gacgtgaaag cgtcggacgt ggtcgagaag aagatgtcgc taaacgcgag gcgggtggac    185280
     cgcggacgaa cggcgaacgg cgcgaacgcg acgggcgccg aacgaggatc gagacgacaa    185340
     catgagtcga ataagttttt gccgtggtta ccggagagag cgacgctcga ggggacgctc    185400
     gagaagaagg cggaggagac gagttggttc gcgagcgtct tcggcggcgc gacggatact    185460
     tggaatttga gacacttcat gctgtacgag gcgcacttgt tttgggggaa aggattcagc    185520
     acgatgcacg ggtacgggac gattttgagt gcgaaagagg cacccgaaca cggacctgcg    185580
     gcgttcgtga tcgagatgat ggcggtgccg aagcggtcgc tgcgtagaag tcttcaggaa    185640
     aacgccgact ttatggatct cctctcggga ttgtgctgca agcccgcggg gttcaagacg    185700
     atgactttgc gcgctggaag tccgacggat cgcgcgcgat ggatcgacgc gctgcaactg    185760
     ggaatgacga gctcgccgct ttcggcaaga atgccgcttg agtgctcgga cgagatcccg    185820
     ccgagcccgc gcgtttccac ggatagcgat cggtcctcgc ttgatttcag tttcgggaac    185880
     aaacacaaaa agtacgaaga accgccgccg ccgatgtcac caggtgcggc gcccgggcga    185940
     ctgtctcaaa acgctgctcc gatcgacgat gaagatgttg gaaaatacgc cttcaatttg    186000
     agcgagaaca caggcgtctc gagcggattg ccgccgctgc cgaagaaggt gctcgatcgt    186060
     atcccttcgg cgctcaagaa gggttcgagt ttttccacgt cgataaacgt caggcgtaac    186120
     tctagcgatg gaaactctaa gtcggtgacg ttcaacgagc acgtagagac gcaagtgatc    186180
     gccaagtcgc cgagtaaaca cggcctcgcc gcggcagagg agactgataa agagttcaga    186240
     acgcgcacgc gtcttctcca agccgcgggg aagtttaaga tcgcggagga agagttatcc    186300
     ataggtgcta aactcggtgt tgggtctttt ggtgtcgtgc atcgcgcgaa gtggaacgac    186360
     accgacgtcg cctacaaaac catgattgcc gacaaaatga acgacgacac catcaatgcc    186420
     tttgcggagg agattcgcat gatgcgcgcg ttgcgtcatc caaacatcgt actgttcctc    186480
     ggtgcggtga ttcagcgggg tcgaatggga atcgtttccg agctcatgaa gcgcggaaac    186540
     ttggagcaac tgttgcacgg caacggtaag tggagcgagt cgcttcgtag caatgggatg    186600
     cttcgcagac aaatggcggc ggattgcgcg cgcgggatgt tgtatttaca ctccctcgcc    186660
     caccctgttg tacatcacga cttgaaaccg gcaaacttgc tggtcgatgc aaattggaca    186720
     ctgaaagtga gtgattttgg gatgagcgag ttgaagagct acacgtacgg atcgaattgc    186780
     aaagctcccg ggggaacgcc cgaatggatg gcgcccgagg cgcttcgcgg cgacgacgtc    186840
     aacgagctct ccgacgtgtt ttcgttcggt gtcattctgt gggagctcat caccctgaat    186900
     ttcccgtggg ccgatctctc gtcacccgtg caaatcgtcg ctcaagtcgc gtttttgcac    186960
     cgacggttga aaattccgag ctgggtcgag gacccgatgg agcaactatt gcacgattgc    187020
     tggacgcgtg agacggaggc gcgaccaacg tttgcgagca tcgtcgaacg cctcgtgggc    187080
     gattacccag ccgcgtggtc gcaaggtaaa gagtcgaaat ccgccgagca agaagcggcc    187140
     gacattctcg ccctgatgtc caaagacgac ggttccccga cgtcggcgat cgaagacgac    187200
     gaattcgtcg acgctagcga cgacatcgac gtctccgtca tctctgcctt cgcccctcgc    187260
     ggattggccc cgattcgcac cccgacgccc gtccacgacg ccaccgcgtc caggactctc    187320
     ggttccgagg acgattccgc ggaggaatcc aactcgctcg attcctccgc cgaagtctcc    187380
     gtcgcgaatt cccctcgtaa gccccctctc accgccagcg tcgccgccaa cgtcggcgct    187440
     ttccgcccga agatcctctc gcccctcaaa acccctcgcg cgcgcgccgg cgtcgccgag    187500
     ccttagccgc cagccctttg taaagttata attcgactcg acgccgcgac gccgtcccgt    187560
     cccgcccagt cccacgctcc catcttcact cgacgcgtca caacgcctcg gcccgcgacg    187620
     cgcctcgcgc cgccgccgca ccgcgcgcga tggacccctc gatgttcacg cccgagatga    187680
     tcgtgcgtcg cgacgcgcga gcgccgcgcc gcgacgcgaa cgcgcgcgcg atgacgaccg    187740
     cgacgcttcg aaagatcgcg cgacgccgcg aacgcgcgcg cgacgcgagc gaacgactga    187800
     cggaacgacg gatcgcgcga cttgaacgcg aacgcaggcg caagcgcaac agatgatgtc    187860
     gaacatgacg cccgaacaga tggcgcagat gcaacgcatg gcggggtcga tgggcctcgg    187920
     cgcgccgccg ggcgcggcgg aggcgatgaa aaatatgacg gcggaggaca tgcgacgagc    187980
     ggcgcaagag atggggaaca tgacgccgga acagttgaag acgcagtacg aacaggcgca    188040
     gggacacgcg aaagcgagcg cggattatcg atacgcgggg agcgagacgc tgaagaagga    188100
     ggggaataaa ctcgtgggag aggggaaaca cgcggatgcg gtggagaagt acgcgcgagt    188160
     gaaggaaaac ttgaaggatg atgtgaacgc ggcggcgaag acgctgcggt tgtcgtgcat    188220
     gttgaacatg gcgctttgtt ttaacaagat tgggaagcac gacggggcga ttagcgagtg    188280
     caccgaggcg ctcgagctcg aaccgcggag cttgaaggcg tactatcgac gcggacaagc    188340
     gtacgtggcg aagggtgagc tcgaacaagg tgtgaatgat ttgatgcggg cgaataagct    188400
     cagtcctgga gatgagacag tggcgggaga gctcgaagca gccgtcaagc gcatggaatc    188460
     gcaaggatta gccgtgccgg ccgccgcgcc ggaattcgac catcccgagg cggcgcccac    188520
     gacgagcgcc ggctcgagcg gtagtgcgat gccggggatg cctgggatgc cgacgctcac    188580
     gcctgatgtt caagcacagg tgagcgcgat gatgagcgac ccgaacgcca tggagcaaat    188640
     gtcgtcgatg atgggcaact tgtccgacga tcaaatcgag cagatggcgg cgacgaatcc    188700
     catgatggcg ggcatggacc cggatcacgt gaaaaaggca gcgggcatga tgaagaacat    188760
     gaagccggag actatgcaaa gcatgatgaa gatggcgcag agcatgggca cggagggcgg    188820
     gaaaggcttc gacccgaacg accccgaaat gatgtccaag atgcaaaagg agttgaacaa    188880
     cccggagatg cgcgaggcca tggttgaaat gatccagggt atggattcgg agtctttgaa    188940
     ggagatgtcc aagagcatgg gcatgacgat ggacgacgcg caagctgagc aagcggtcaa    189000
     cgctctcaag aacatttcgc caaagaccat ggaacggatg ctctcaatgg cttccgtcgc    189060
     gggcgggatc tacagtcgat tcaagcgacc gatcgattgg gctatgcgca acaagcgcac    189120
     ggcgctcagc atctttgtcg tgttcacggc catggggacg acgtacgtgc tgcgatggtg    189180
     gcgtcgccgc ggaggagccg tggaagcggc tgacaaccaa acctcgacct caacgtttta    189240
     atgctatcct tcgtgtcaac aattacattc ctaatcgctc gtgtggacga tgcactgacg    189300
     ggcagcgtcg tacgagaagt gcgagtttct gaaggctgaa ctgccgtaaa acggcgccaa    189360
     atcctcgatg ccgtacgctc tcgccttgct ctcgagatcg cggcaacgca ctgtcgtcgt    189420
     ctgacccgcg gtatccgctt gactgttcgg cttggcgccg acattttccc agcgcatcgt    189480
     ttcccgaagt agtccgcgaa gaatttcgag gagcaaagcg tcgtagtcgc gatggaagtg    189540
     cgtgtatcgc gcaaacttct tctgcagggt cttttgcacg gattgctttt gagtgccgat    189600
     gaaagactgc agcatgcatc caatcgcagc gtcgatgtca tcagccgata cttgctggct    189660
     aagtcgcatc gccgctcgag cttcactcat tcggatgatg gactcgatgt gacgcacggc    189720
     gacgggcatg ccttcacgcg tcacagactc ctttcgcaat tcggcgtaga ctcgttgaat    189780
     cttcggcaag tcttgctgat ttagctttgg gcgacattct tttttcgcgt acgaaatata    189840
     cttgcgcaac aatttttgat caatcggctc gatgtcgtcg tcgtcatttt ccccaaatgg    189900
     attctgcaac ggcgcttccg gatcgtcttc aaatctcgga tggcacttga cgtgggagtg    189960
     taccacgaac ttagcgagcc tttcatctaa gacagggtca ataacgtcgc gaacgacgca    190020
     aagaatatcg aagcgggaaa ggattggatc cgtcagttca acgttgtcgc tgaacgtctt    190080
     ggacgaatcg tatcgaccgc cgatggggtt cgctgcggcg atgaccgagc atctcgcttg    190140
     taaagaagtc acaataccag ccttggagat agatatggat tgctgctcca ttgcctcgtg    190200
     aatggagacg cgatcttgct cgttcatctt atcgaattcg tcaatgaggc acacaccgcg    190260
     atcggcgagc acgagggcgc cgccttccag cacaaactcg cgagtcaccg gatctttgtg    190320
     cacggcagct gttaaaccga ccgcagacgc gcctttacca gtggtgtaca cggcgcgacc    190380
     cgcggtggct tgtgtgtact tcaaaaactg tgatttcgca acaccgggat ccccgagcaa    190440
     caacatgttg atgtcgccgc gcaatcgcgt cttgcccttg acgaactttt cttgaccgcc    190500
     aaacagcgca aatgcgatac ccatcttgat atcttcgtgc ccgtgaatgg acggcgcgat    190560
     agacttcatg atgcgtcgaa cgattttggg atcacggctg agctttctga tgtcctcgcg    190620
     atcttcatcc gtgagattgc ccgacgagta caaatctcct tttcgtttga cgtaattcgc    190680
     ctcgatgtac gtcgtgaata cgggaaatcc ctgctgacgc gtgttcagcg acgcttcgaa    190740
     gttatttgtg tacaccccgg tgacttcaat ctcgtcaccc ggtttcgcca tgtcaatcaa    190800
     gtcgttcaac acgataacct ctttacttcg cggaatgcgg ccagccggaa cgcttcccgg    190860
     agattcctgc aacgtcaact tctggtagtt gcgatacacc gtctttgcgg agttaatctg    190920
     ccatctacct ttttgatggc actccgggca ggcattcggg cgctcctctt ctctgctact    190980
     attttggaag attggaccga cgttgtacga acacaccatg cacgtgtacg tcacattttt    191040
     cagttgcgga aacacacccg tgcgtcgcgt cacgacaccg ctgacgcgaa tcaatgagtt    191100
     taagtgcgat tggcgaatat cacgaatagc gtcctcgacg ggcaaatcca cgattcgcac    191160
     gaacacgtcg ggatgaatgt cgccgtacga cgggtaaagc ttcaacactt cggtgagcgc    191220
     gacttcgtcg aatagatcga gcatgtcctt cggcgcgtcc gcgacccaaa ccgcgatcag    191280
     agactcactc ttcgccaggt gcatgtaact gatttccaaa ctctgcaagt tgttgttgca    191340
     catctcgcga atctttttgt gataaagcga ccgcccggct tcgtcgactt gtcctttgcg    191400
     caaaaaccga ctcaaacgct tgcgaatctc caccttcgtg cgatccttcg tgatccactc    191460
     gcgaagaggg caatcgtaca cgtcaatgtt cacgtcgaat tcctcgtcat cgtcttccat    191520
     gtccccatct gcggcgcgat ccgcggccct tcgccttcgc gcctgccgca accattcgtc    191580
     ctcgccctcc tcgagcgccc gcggccgcac ccgacccgcg cgtcgtccac cacgatcttc    191640
     ataaatatcc cgctgttcca tcaactcttc cgcgcgcaat cgcgcctcga gttcggcctc    191700
     cgcatcgtac tcttcgtcct cctgcgccag tcccgcctct tcgtactggt ccaagtgcgg    191760
     catcacttgg taatccctac gccgtacgaa aataacgcgt tcctcacgtt cgtcagtcgc    191820
     gcgatccgac gctcactcca tccccaccgt cgcgtctcgc cccgcgcgcc gcccttggcg    191880
     cgtcttcccc gctctcgcgt cgtccgcgcg cgagcgacag ctcgaaattc aaatattcaa    191940
     acccgcgtcc cgtccccgtt ctcgccctcg cgcgtcgcgc gtcgctcgcg tcgctcccgc    192000
     accgttccat gtcgttcatc aaatcctctc catcgctctc gtcgtcgctc ccgcgcgagt    192060
     cctcgctcgc gtcgccgtcg ctcgccccga cgtcgtcgcg ctgatcgtga tgcggcacga    192120
     acggatcgtc cgcgcccgcg cgctcgaacg cgtcccgcgc gtcgtcgtac gcgtccgagg    192180
     cgtcgtcgcg gtcatcgcta tcgctcgtcg ccatcgcggc gcgcgcgcgt cgtcgcgtcg    192240
     cgtcgcgtcg cgcgtcgtcg agtgtcgcgc gcgcgtttga attcgcatca cagctcgacg    192300
     cgcgcgcgac gcgccggcga cgcgccttcg gcgagcgcgc gcgcggcgag cgcgagcgag    192360
     cgacgtcgcg cgcgcgcgcg ccgcgcgagg acgaaaccgc gcgcgaggac gacgaggcgc    192420
     gcgatcgcgg atcgcgaatc gcgacgcgcg ggcgatggaa acgaaacgcg tcgtcttcgt    192480
     gtcgctgaaa ccgtcgtcga cggcgagcga tgatcaacac gcgtcgagga acgcgcgacg    192540
     gaagcgcgcg ctcgggatcg aggagagggc gacgtgggag gagtttgtga gcgcggcgtg    192600
     cgcgcggttg caaatcgcgg gcgcgcgggc ggtgtatcac gcgagcacgg gcgaacgcgt    192660
     gcacgggata gaggacgtgc aagacattga agatttaatc gtcgaggagg atgagagcgc    192720
     gcggatgatg acgagcggcg cgacgccggg ggtgagcccg ttgcgaacgc cgaacggacg    192780
     cgcgaacggg gcgaccgcgc gcggaacgcc gggaagggat tacgacggtg attacgacga    192840
     cgacgatgga aagagtaaac cgcgaaggat gtcggtgctg ttgtcgagcc tcgtaccggg    192900
     actcggcagc gcggtgggcg acggggcgtt gaggaaactg gacagcgcgt tggacgcggc    192960
     ggagcgcggc gacgacgacg gccgatcgaa gaatcatcgc gtgccgacgc gcaagcccgt    193020
     gggcgcgcga aagacgttga agcgaaagaa gcgcttgaat aggcgcgcgg cggcgttgtt    193080
     gctgatcgtg ttcgtcggta cgttggtgta cgtcttcggt cgacgctttg aagacgcgcc    193140
     gttctaatag tctagttgta aaacagtcgt cattgcgtcg cgttcgcgac tttgtctcgg    193200
     cgcctccgcg cggtgcgcat cgcgcgaacg cgtagcgcgc gacgcatgcg ctcgttcggc    193260
     gcgccgtcga cgtcggcggc tcgtccaacg cacgtcagga cgaaaagtgc acccagacac    193320
     aaatcccgct cgcgcgccgc gccgcgcgcc gcggacgacc cgcaggcgtg ggaacggttt    193380
     tatctcacgc acagtaaaga cggcgccaaa ggacacgacg tcggggcgtt caaagatcgg    193440
     cattacctcc ggaaagcgtt cggggaactg gtggacgaag aagcgcgcgc ggcgccggag    193500
     acttttcgcc cggcgcttcg cccgagcgag ctcccagacg tggacgaaac gcgcaaaatc    193560
     gatgttttgg agctcgggtg tggggtcggg aactcggtgt ttccgctttt gagggcgaat    193620
     ttaaacatgc gagtcgtggc ggtggactgt tcgccgacgg cgattgcggc ggttcgcgcg    193680
     aacccggagt tcgatgcgcg acgacttcgc acgcacgtcg tcgatgcgag cgcgcgtcgt    193740
     tcgatggaga gttgcgttga cgacgcatcg gtcgacgccg tgaccgcggt gttctttctt    193800
     tccgcgctca cggcgaacgg gttgcgaaac gccgctgagg aaattcggcg cgtgctacgt    193860
     ccgaatggtg tacttttatt tcgagattac gcgagagggg acgttaagaa cgcagatgcg    193920
     tcgtcgcagt ttgtgccggg cgaacgcatc gatgagaatg cgtctttgtc gtcgacgtcg    193980
     aacgagcaaa cgtaccgccg ttccgacggc acgctcgccg tcttcttcga cgaagacgag    194040
     ttaaacgacg tgtttgcatc cgtcgggttg gtgggcgagt gcgaaatagt cacgcactca    194100
     atcacgaacc gcaagctagg agtgacgatg gatcgaaagt ttgtgcaagg gcggttcgtg    194160
     aggctcgcag ggtgagtcgt ttgaatatag atttgtcatt tacatctgta gcgatcccta    194220
     tctcacgccg caaccgattg agcgttcgcg tcgccgagca ccgcctcgct cgcagtcggc    194280
     ggggcgagga tcttcctgct ctcgtggaag tattgatgcg gcgtgtgcac gcccgcctcg    194340
     atttcgacgc cgtcgtgaat cgccgcaaac gtcataccgc acgcgatttg gtagtgcata    194400
     ttcgtcgcct tctcgacaat cgcgtgcgac ttagcaccag agattttcaa cgtaccgagc    194460
     aactcgtgca aacgtgcgcc gttatccttg acgccagacg tgagcgtctt gaacggacaa    194520
     ccgtgcgcgt ccttcacgcc cggatccgct gcgatgcact gaccgcacgc gtgcggggtg    194580
     tagttgacgc gcttcccttc cttaccgtac gcgtgtctga taccatacgc gtaatctttt    194640
     tcaaacttct ccgcggagca tttcgggtgc tttgtgaact ctgtcttcca aaacacgagc    194700
     gcctggtcca gaggcaagcc gatgcccttc aaatacagtt gcagttgtcg tcgaccgccg    194760
     tgcgtcaggt gatgatcttt cttgagcgcc ttgtaaagct ggcgcatgca cagcgggaaa    194820
     gactcttgcg tggcttcgat gccggcgatc gacatcgtgc cgtcttcgcc ttggaaatcg    194880
     tacccgcttc ccgatcgacg gttgtgcaca gatttcaaaa gcggcgtcaa acggtgagcc    194940
     tccttctttt caaacttgtt gaagagcgtg atggcttcgg cgaccatctt gttcagcatc    195000
     gtcttaaacc gaccgaacac gagttgatcg agggtttctt tacgaatcca cgcgtttccg    195060
     ccgatcaagt acgcccgtct cgacttgacg agcgggcaca cctcttcgaa accgacgacg    195120
     aaccaacgcg acgcctcgct cgccgcttcc tcgcacatcc tctggtactc catcgtcccg    195180
     agcttaccat ctttactgag acttcgacgc atctgcctat actcgtggtc cgccatcaag    195240
     acgtcccgca aatcgtcccg tctctcccgc acttccttct cgctcgcccg cgcgtaatcg    195300
     ttaaacccat tcgtccgcat aaactccatc ttcgcgtcca aactcagctc accgtaccga    195360
     tacttgaaca actccaactc gttctcccga aaccatcgcc tgtgttcttc gcttcgacag    195420
     ctcgccaacc tcaacaaaaa atgactcgtc gcgtctctcg ccgcgccctc cgcgtcaaac    195480
     gtcccccccg tcgtccgtcg catgttatat tcctcctccg cgctcgcgat cgcccgtttc    195540
     aattcctcat ccttcttccc accgcttcgc gcgtcgtcga tcgcccgcaa gacgccgtac    195600
     cgatccatcg ccgcgcgctc caggtactcg atggagcgtt cgtcatccgg cgcggtgttg    195660
     tacgcgtcca accgcgccgc gtttccgccg tactttcgct cgagcgcggt cttggcgcgc    195720
     gcttccgctt tctctcgatt cgtgcgcagc gcgccgaaga ccatggcggc gtcgccgccg    195780
     tcgtcgcgcg tcgccgtgtc gcgcgatcgt cgagctgtcg ccgcgtcgcg atttcaaatt    195840
     tcgtggcgtc ggcgccgcgc gcggtgcgat ttcgagggtc ggcctcgcgc accgcgcact    195900
     gtttacccat acgcgcgtcg cgatttcaaa tttcgtggcg tcggcgccgc gcgcggtgcg    195960
     atttcgaggc gtcggcgccg cgcgcggtgc gatttcgagg gtcggacctc gcgcaccgcg    196020
     cactgtttac ccatacgcgt caacgcgcgg acgcggcgcg acgcgcgacg cgcgcgcgca    196080
     cgtcgcgacg cgcgcgcgac cgcgaccgcg accgcgcggc gacgcgccat gtccgcggcg    196140
     ctggcggaga cgatcgcgcg cgacgccgcg gacggacgcg cgggcgagta cgacctcgcg    196200
     ggattcggcg aggcgtgggt cgacgcgctc gtcgaggcgg cgttcgcgac gccgacgcgc    196260
     gcgaaaggag ggttttacgc gtcgtgcaag ttcatcgtcg gcggcgggaa gaagacgcgg    196320
     gcgaagtacg acgatgaggt ggtgaaacac ttgacggcgg cgctgcgcgc gagggggttc    196380
     gaggacgaca gaggcgcgag cgcgtgcgag gcgtgccaag ggacgtataa gtaccagcac    196440
     gacacggata aggatttaaa atacttgcac gtgtttccga gggtgacgca cgaggcggag    196500
     gggggggagg cggcggcggc ggcgggcggg acgcagtcgc ccgagtatcg cgcgtgcgcg    196560
     tgcgatttgg aggagttcga gcgattggtg gagatgtatt gtccgagctt ttcgcaaaag    196620
     cgcgcgctgt tgcgcaggat gaaggtgatg gagcacgcgc tcggggcgct ggaacaaaag    196680
     gtgatcgcga tggagagctt gaatgatcgc gagcagacga tgtacgactc gatggttgaa    196740
     gtcgcggcga agattgagtt cttacaacag gcgctggacg acatgatcaa gaagggtcga    196800
     ttgacgaaag gcgaacaagg agaaatcgtc gaagatttgg agctcaagct cgaagatttg    196860
     aacctgatgg tgaacgaggc gaacgaggag gggaagccga agcgcgcgga gatgctcgag    196920
     agcaagaagg aaatcgtcgt caagaagatt gactcggtgc gcgcgaaacc tccaatcgtg    196980
     tacacggtgc cgcacgaacg cgaacttttg gacttgaaga aggagctgaa ctcgctgaaa    197040
     aaaattgccg cacaatcgaa aggaaagttg atgagcggtg cggacgcggc gaagtgcgcg    197100
     aatattccca agctcgaaga gcgcatagcg aatttggaaa actccgagga aaaaggatgg    197160
     tacgaggacg aatgccgagc gcttctcttt ccaccggtcg ccgaaaagaa agcaccggcg    197220
     aaggccaagg cgagtggcgc caaaaccaat tcgggatggc tcaccaaggc ggcaaagggc    197280
     ggatcgcgcg gcggaggtgg atccgcgaaa gcttcgtcga ctcgtggtcc ttccaacccg    197340
     ttcgcgatgc tcggcgacga ttagcatata gcgggtgttt atatatcaca acattcatca    197400
     aaatgtgcgt atcaacgttc actgtggtgt ctgggcggtc gaaacggcaa aggttcgacg    197460
     ttccaaatct tcgccgcgta ctcccgaatc gtgcgatcgg atgaaaacat ccacatcgaa    197520
     cacgcagctt cgatgcactt tgcggtccac ttctcttcgt actgatacgc cgcatcggct    197580
     tctgcaatcg cccctagata cgacggaaaa tcatgcgcgg tgaggtagac gtctttcctc    197640
     ggatcgatgg cgtccaagag ctggttgtac gctccgtcgt ccggcttgcc gaagatgccg    197700
     gcgcgaatca ttcccatggc gcggtgaaga cgaggatcaa tttttggtgg gtcgtgcgcc    197760
     atcttgcgtc gaatcgccgc gacttgatcc gccttcgcgc caaacgtgaa catgttatgc    197820
     tcgccaatcg cttgttctat ctcgatgttc gccccgtcca ttgtacccac gatcaatccg    197880
     ccgttcatga cgaacttcat gttcccggtg ccgctcgcct ccatacccgc agtggagatg    197940
     tgttgcgaga tatcactcgc gggaatgaga atctccgcta gagacacgtt gaagttggga    198000
     acgaacacca ccttgagtaa gtcacgacac gccgcgtcgg agttcacgac ttcagacacg    198060
     gcgcatacga gcatgacaag atttttcgcc atgacgtatc cgggcgcagc tttgccggcg    198120
     atgatgtgca cgcgcggcac cattgttttg cgctgttcgg gcgtagcctg cgtgatttcg    198180
     gcgtagcggt gcacgattcc aaggacattc aacaactggc gcttgtattc gtgtatgcgt    198240
     ttgatttgca tgtcgaacaa ggcgttggga tcgacgcgga tattcatcga acggtacagc    198300
     cattccgcaa gcgcttgctt gttcgtttgc ttggccgcgc gccaacgctg tcgaaattgc    198360
     ggatcttgcg ccatcgtctt gatcggctcg agtcgcttga gatcgtttac ccacccaggg    198420
     ccgaccatgc ccgtgtaaat gctcgcgagc gctggattcg cttgcaacag ccatcgtcgc    198480
     ggcgtgacac cattcgtcac gttgatgaac ttttctggcc acatcaacaa aaagtcgggg    198540
     aatagcaaag acttcaaaag cttggtgtgg atcatcgcca ccccgtttac ggtgtgcgac    198600
     ccgatgacgg ctaagttgga catgcgtacc atcttgggtg atgactcttc gatgatactc    198660
     atcgacgaca tgcgcgcggt gtcgtttggc cacatctttt gaacctcaag caaaaaccgg    198720
     tggttgattt cgtaaatgat ttgcatgtgt cgcggcaaga gctcggtgat catcggcacc    198780
     ggccacttct ccagtgcctc cgggagaatg gtgtggttgg tgtacgcgaa gacttttctc    198840
     gttatttccc acgcctcgtc ccaaggtaga cgctcgatgt cgaggagcaa acgcatgagt    198900
     tcgggaatag caatcgccgg gtgcgtgtcg ttgagctgta tcgccacctt gtccggcata    198960
     ttcttcatcg tcgtagaccc acgaccgacg ttcttcttga aacgtctata gatgtcttgt    199020
     aaagtcgcgc tgacgaagaa gtattgttgc ttcaatcgca aacgcttacc ttcttccgtg    199080
     gcgtcgttcg ggtacagcac tgacgtgata ctctcgcaac gttccttcgc ctcgaccgcg    199140
     ccgtagtaat taccggcgtt aaacgaggcg agattgaatt cgtgcgatgg cttgctactc    199200
     cacagtcgca tattgttggt gttgtacgta ccgtagcctg gaatcggggt atcgtacgcc    199260
     tgcgccatga cgacttcgcc gccctcccac gcgtacaacg tgttcccgtc cggatcttga    199320
     aactctcgaa cgtggccgaa taaacgaacc gggtactgca cgtctaatcg ttcaacttcc    199380
     cacgggttcc catcggtaag ccaataatct ggaaactcca cttgtttacc attcacgatt    199440
     ctttgctcaa acattccgta cttgtagcga atgccgtacc cccacgcggg ataattttgc    199500
     gtcgcgagcg tgtccaagaa acaagacgcc aagcgcccca gacccccgtt cccgagcgct    199560
     ggctcttttt cctctgacat gatatcttcc aaatcgtatc caatctgccg caaagcctcg    199620
     gcgtaggcgc ctcgtaaccc gagatttgag acggcattgc cgagcgagcg gccgattaaa    199680
     aattcgagcg acagatagta cactttcttc gcccctttct tggccgaata ctgctgcgtg    199740
     tccgtccatc gctcgatcaa tcgatctcgc accgagtgcg cggtggcttg ataaaacgag    199800
     ctcgtatcga gcttgtacct ccttcgcgcg agcgtatact ccacgtgccg caccaacgat    199860
     cgctgcaaac tcgccacgtc gtttggcaag tacgtgctcg atagcttcca caacaactcc    199920
     ttgtgcgcca agtgatcgac gcccatctct gcatcgtcga cgtactgacg cgggcgatcg    199980
     aggatcgtcg tcgcgctctc caagaacgat gactcggtca cgtccgcgcg atcgctttcc    200040
     atatccacgc taaacgaatc cagctgcccg agcgagtctt tcctccgatg ctgcaacaaa    200100
     gacgctccgc tcgaccgtgg actgtgcaag ctcaccggcg gtcgccctcg atgatgattc    200160
     tgatgttgtt ggtactgata tccacccctg tcgacgccca cgatcacggg catacccgtc    200220
     tcgtcgtccc ctcgcgcgta cgatcccgcg ccgctcctcg ccatccgacc gccgtacgcg    200280
     ctcgacgtcg acgagtcgtt ctcctgcgcc agattcgccc gcaagctctg ttcgagccac    200340
     gcgtccacgc gcgtgttttg cccgctcgcc acggacgagc ccggcttccg cctcgcgctc    200400
     gtcgtcgtcg tcgtcgtcgc gtctggctgt cgcgccgcca accgcaggcg cgtcatcagc    200460
     gtcagctctt cgctcgaccc cacgtcgcgc gttcgccctc ccgcgaacgc cccgcgcgcg    200520
     aacgacgtat ccgcggcgtc gtgcgccgcg ccttcgtcgt cgcccgtcgc gtcgcgcccc    200580
     gtcgtcgtcg tcccgtcgcg atgccgatgc gtcggcgtca acctctccgg cgcgctcctc    200640
     gcgaacgccg cgtcccagaa cgtcttcgcg tcgcgcgggc gcgcgtcgtc gtcgtcgaac    200700
     gcgacgtcat cgcgcggcat cgcgtcgcgc gcgcgcgcgc cgtcgtcgcg cgcagatctc    200760
     tgaagaattt ggatgacggt aaccgtcgcc atctcgcggc gcgatgtcga cgcgcgcgcc    200820
     cgcgttcgtc gccgtcgtcg gcgcggagag cgcgccggtg ttcgtcgcgt cgctcggcgc    200880
     gcgcgagggc gcgaacgaag cgtgcgtgac gcgcgcgagc gcgggatttc gtctcgaccg    200940
     cgcgcgcgac gagacgacga gacgacgaga cgacgtcgac tgacggcgaa ctcgcgcgtt    201000
     tcgtcgcgca gcgcgcacgc gtcgcgcgcg cacgccgcgc tggacgcgat cgacgcgaaa    201060
     ctcggcgcga tgacgacgga gagcgcgacg aggtacttgg gggagtgtca ccgcgcgcac    201120
     gacggcgtgt gctacgggta cgcgacgcgg tcgagggcga ggatggtgct cgcgtacgag    201180
     gaagacgcga gcgaggagac ggtgaggaag gattttgatt atttagcgac ggcgtacgcg    201240
     gaggcggcgt gcgatgcgtt cggggagatt ggggggagga cgacgagcga gcggtttcgc    201300
     gagcgatgcg aagcgttggg atcggacgcg cggcggcgcg aggaggggac gggcggtggt    201360
     gggtgagcgt cggcgcgacg cgcgtggatt tcgcgtgatt tcgcgaatgg agtggtttag    201420
     gagtcagcat gaagacgggg ttagcgattg tttgacgcat gagaccagag tttagttttg    201480
     cgcaagggac gttttagtga gaaaccaaag tttaaaatga ttacatgtcg tagcgccgct    201540
     aagaatatat atactctcgc gtatgactta cgagtcttgc ttcttaagaa gcgggaacgc    201600
     gatgacgtcg cgaatcgacg gcgaattcgt gagaagcatg acgagacgat cgacgccgag    201660
     acccataccc gcggtcgggg gcatgccgta ctcgagcgcg gcgacgaaat cttcatccat    201720
     ttcgacgtcg tacgcctcgt cttcgagcgc tttgagttcg tctttaccac tcgccgccgc    201780
     cgcttcgcgc tgcgccgcgc tcgttttcgc gtgcgtcacc atctgcgcct cgaggcgttt    201840
     acgttgatcg atgggatcgg tcaactcgct gaacgagttc gcgagctcgc gaccgacgac    201900
     gaagagctcg aaccgttcgg tgactcccgg tttactacgg tgcggtttcg cgagaggaga    201960
     aatctcgagc gggtggtcga gaacgaacgt gggctgaatc aaatcgcttt cgcacgcggc    202020
     ttcaaacatt tcgttcagca cgtgaccgac gctcgccgcc aacttgacac ctttgatgcc    202080
     ttccccagct ttcttagagt gcgccttgag cgcgggaatt gccgctgcct tggctccttc    202140
     caagtcatcc ccgaacgcca tgacgtctac gcccgtggct tccttgacta gatcgttcat    202200
     cggcgcccgg cgccacgggc gttggctcaa atcaatcgtc acgtcgccgt aaggaatcgt    202260
     cagcgtcccg cacgccttca tcgcgcatcg acaaatcatc tcttccgtga gctccaacat    202320
     gtccgtgacg tcggcgtacg cctgatacac ttctatggac gtaaactccg ggttgtgtcg    202380
     cgtgctcaag ccttcgttgc gaaacacgcg tccgagctcg tacacgcgtt cgaaaccgcc    202440
     gacgacgagt cgcttgagat gcaactcggt ggcgatacga agcgtgagct gcatgccgag    202500
     cgcgttgtgg aaggtgttga agggcttcgc gtccgcgccg cccgcttgcg tgtgcagcac    202560
     gggcgtctcc atctccaaaa acccgtcgtc gtcgagcatt cgacgaatgg tggagatgat    202620
     gttcgagcgc gccttgaacg tgtttcgcac ctcgggcgac acgatcaagt ccacgtatcg    202680
     ctgccggtat cgcttctcca cgtcctgcaa tccgtgccac ttatccggca acggcagcag    202740
     cgcctttgtc aacatttgca ccttggccgg cacgatggac agctccccct tatcgctcct    202800
     tttcacgctc ccgtgcacgc cgatgatgtc cccgacgtcc acgagttccg tgatcatctc    202860
     aaacgccccc gggctcgtct catccaaccg tttcttatcg caaaacaact gcacgcttcc    202920
     ccgttcgtcc accagcgaca aaaacgccaa cttcccgaac gaccgcttcg ccatcaccct    202980
     tccgcacacc gcctcgctcg agccctcgat ctcgaccccg ttctccaatc cttcgtgttc    203040
     cctctgcagc gcatcgcaat atttcgtgcg atcgaaccgg taatcgaatc cccgctgtcc    203100
     gagcgcgccg agcgcgtcca gcttttgcgc gcgcagcgcc ttgacctcct cgggcgagct    203160
     cgtcaccccg ctcgcgtctc gtccgccgcc ctcgccgcgc tttcgattcc ccgcgccgcc    203220
     gtcgcgcttt ttattcgttc ccgcgtcgct cgcgcgcgcg cgcgtcctcg tcgtcgcgcc    203280
     tcgtcgtcgc gtcgtcgccg ccgtcgccgt cgcgcgcgcg ctctcgcgct cgctcgcgcg    203340
     cgtcgacgcc cgcgggcgcg ccgcgagcga cgcgcgcggc gtcgagaccg tccttcgcgc    203400
     gaacgcgcgc gcgagcagca tgctccgcgt cgcgctctgc gcgcggcgcc gcgacggatt    203460
     cgcgcgcgct cgactcgagg ttttcggtgc gacgaatcgt cacaccgcga cgcgcgcgcg    203520
     tcgcgaaagc gcgcgcgaat ccgtcgaaac gatggcgctc gtcacgctgt cggtgtacga    203580
     catcaagcac gcggagaacg cgcggatatc gagcgcggtg acgtcgctga acacgctgac    203640
     gagaaacgcg ctcaacgtcg gtggcatctt ccacggcggc gtcgaggtgt tcggcgacga    203700
     gtggagcttt gggtactgcc cggagggctc gggcgtgtat cgatgcaacc cgcggatgaa    203760
     tccgatgtac gaataccgcg agtcggtgcc gctgggggtg acgtcgctgt cgccggcgcg    203820
     cgcgagcgcg gcggtggcgg cgctgcgcgc gcaatggcga gggagcgatt acgaggtgct    203880
     ggagaggaat tgtaatcact tttgtgaggc gctgtgcgag gcgctcgggt gcgagggacc    203940
     gccggagtgg ctgaacgcgt tcgcgaataa cgcgaacaag gcgcgagggg cgtaccagag    204000
     cgcggtgagc ggggtggaga gcgcgtacga gagcgcggtg agcggcgtcg cgggcgcgtg    204060
     ggcgtggctc gcgagcggcg gggggacgtc ggcgtcgagt tacgcgagcg cgttggagag    204120
     cgagggcgag cgcgagggcg gcgtggtgga cgggccgcgc gcggacgacg acgacgcgcg    204180
     gcgcggcgcg cgagagtagc gcgtcgcggt cgtcgtcgat gcgttcgagc gcgttcgagc    204240
     gcgacgcgga tgaaacatcg cggtggatgt atttcttggt cgtctctttc gctcgcgcgt    204300
     cgtcggcagt agtcagggtt gaagcgctgt tatagataga tttggtagtt cggcgtcccg    204360
     cacaacgcgc ctcgcgtcat gctttcgcgc ggtctcgtct cgacgtctcg agcgtctgtc    204420
     gcccgcgcgc gcgcgcctgc gagacaacag cgcgcgacga cgtcgcgccg cgcgtcgatc    204480
     gtccgtcgaa ccgccgcgcg cgcgacgaac gacgacgata aagcgtcgtc ttctcaagat    204540
     gtcccggacg acgaaccgac gcccgcggtc ggcgacacgg acgtcaacag cgcgctaggc    204600
     gacgtcatca gctcgccgtt gttttacgtc acgttcggcg tcgccggcgg cgtcggactg    204660
     gtgcgcgcgc tcggggagaa cgcgagcttt ctgctgagcg cggcgccggt ggtcttgctc    204720
     acggtgattt cgaagacgtc gttcggcgag tcgctgatga agaatatcga cgaccaacga    204780
     ccggcgttgg tggcggagaa ggcgcgaagg gaaaacgaac gcgcgcgagc gcgggagaga    204840
     agttcgctgt acggcgcgcg gcgagtgaaa tttttgggag acgcggagta cgagtatccg    204900
     gcgcacttgg acggctcgct gtgcggcgac gcgggattcg atccgctcgg gctcgggaaa    204960
     gatgatttgc cgcgcatgcg cgaattagaa ctcttgcacg cgcgttgggc gatgttggga    205020
     atcgttggtg tggcggtgcc agagctttta gagcgctacg gcgtggcaga tttgggcgag    205080
     ccggtgtggt ggaaagtcgg cgcggcgaag atgaatagcg acgtctcgct cgattacttt    205140
     ggcttgcaag gttttcatat cgccggcgga tcggggatag ccatcatcgc ggcgtgccag    205200
     gttgtgttga tgggcggtcc agagtacgcg cggtacgtcg ggatcgactc gctcgagccg    205260
     gtgggcgttt acctcccggg cgacaaagat tatcctggcg gcgcgccgtt tgatccgttc    205320
     aagatttccg acgacgccga cgagttcgaa aaacaaaagg tcatggagat taagcacgga    205380
     cgcttagcca tgatcgccat gctcggagtc gccgcgcaag cattcgtcac gcgcgcgggg    205440
     ccgatcgaaa acttagcgag tgtgtttagc ggttgaaaat tgattcttga ttaaaaagac    205500
     gagaacgcgc gtttcggtta cacgctctcg acaccgaacg gctcgttcgc atccggtgcg    205560
     gggggctcat cgaacgccgg cacctcgggc atcgcttcgg gcgccggtat ttcttcatcg    205620
     ggctcgtccg ccttgacttt gacgtcctcg taacccaagt caatcttgct gaacatgcct    205680
     ccgaaaatct tcgcgtcctt cttcgcctga tgcgcctcga gcgctttcaa gcgcgtcaac    205740
     attcgcgtgg cctcggcgtg cgattcatct gcttccaata ttttcttcaa cgaacgacgt    205800
     gattcgtcgt actcttgtaa ctccatcgcc gcttgcgcga agcgatagag cgctttttcg    205860
     ttcgaccctt caatcgcgag cgccttttcg cttgacttgc gagcgctcat ccacgacttg    205920
     gttttgatgg ccaccgccgc ggagttcaaa ttcaagctga gcttgagctt cttgctcgct    205980
     tgcttctcct catcagagaa cgactcgtcc atttcgacga acttcaacgc cgcgtcgtac    206040
     ttcttcgtag cgcgcgcaaa cttaccaccc ttgtacgcgt cgttcccgct cgtcttgtat    206100
     ttttccgccg cctcaatctt ttccgcgttg ttcatcgacc attgctcctt ggcgcgctcg    206160
     agtttggtca ttttgaccgt gtactcggtc ccatccgcca gcttcaccag cgccttttcg    206220
     ttcagcttca tcatcgcgat cgcgctctcg agctcatccg ggacgtgctc gtcgccgacg    206280
     acgatttcgt gcgccggctt ggtctccgtc gtcgcgccgc cgacgcgctt ttcgtactca    206340
     atctcgcact tcgccccatc gttcggcgtc tcgtaccctt caccttcctc caaaatcttt    206400
     ttcgtcgccc cctcgacgcc gttcacggcg accaccgcgt gaatcgcgtc gagcatcaac    206460
     tccaccaccg cgccgtcctt cgccgtcgtc aacccctcgg cgtacgcttc gctcagcgtc    206520
     acccgcgccg tctccccccg cttcatcttc agcagcgccg cgcgcacgcc ctcgcacggc    206580
     gcgtctccat tcgccgccaa cgaaaacgtc cgcgtcgtct tcgccacgag cgtctcgtct    206640
     cccgtcctcg tcttcgcctc catcgtcgcc gtcgcctcgt cctccgcgct cgggctcgcg    206700
     tatccctcgc cctctctcac cgtctccttc atcacccccc catcgccgca cagatccctg    206760
     tgcgacttga acgacagcaa ttccacgtca aatatcagcg tcgcgccgcc gggaatcttc    206820
     ggcggcgccc ctcgatcgcc gtacgcgtac tccggcgcgc acgtcagcgt cgcccgttcg    206880
     ccgacgcgca tcgtcgccac gccgacgtcc cacgcgtcga tcacctcgtg ttttcccagc    206940
     gtgaacgtga acgcctcgtc gcgctcgcgc gaggaatcga acgtctcgcc cgtcgcgagc    207000
     gagccgacgt agtgcacggt gacggcgtcg cccttttcgg gcgcgcgcgc gtcgggcggc    207060
     gcgggcgtcg cgatgcgttt cgtgacgccg ccgtcgccga cgggcgagac gtcgacggcg    207120
     tcgacggcgt cgtcggcggt cgtcatgtcg cgcggcgtcg cgcgttcgat cgagtcgcgg    207180
     gcgcgggcgg gcgcgatcgc gcgtcgcggt gtgcggggac gcgcgtcggt cgatgtgatt    207240
     aatcttctag aaacatccgc cgcgtcggcg cggcggatta attcgggtcg tcgtcgtcgg    207300
     cggagggcgg tgattcggcg cgcgcgagct cgatggcgtc catgtcttcg ctgactcggc    207360
     gcagggcggc gcgcatgcgc tcggcgtagg agacgccgga atcgtcgtcg gcggcgtcgt    207420
     cgtcggcggc gtcgtcggcg gcgaaatcgt tcacggcgag caagacctcg tccacggcgg    207480
     tggattcgtc gatgtctttc acgcgcttga cctttcgaac gacgtcttgg aataagacgt    207540
     tgacgtcgcg cgatatcgat gggtcgcgcc gcatggcgtc gacgacgtcg cgacccatgc    207600
     gtcgcttttt cctcgccaac atgtttttaa acgcggcggc ttgcgccctg cgaacggtgt    207660
     ccggatcggg cgggccggcg ccgcgcgcgg gcgcggcgtc gccgagcgcg cgctcgatga    207720
     aacgcgtcat cgtgttccgt tgatggatga tgtacatggc gtccgcgacg tagccgccga    207780
     cgatcggggc gaacacgcct ccggtgacga cgaaggcgag cgattgcgag acgaagagca    207840
     atcgactgcg gctgccgtcc aaaaaatctt tcacgctctt tccgcgcagg atgttttcga    207900
     acgcgcgcgt ctccgcgacg ttcggcgctt cgtttgcgga cagcggcgac gacgactcgt    207960
     cgtccgcggc ggcgtcgggc ttcttctccc aaaacttgag cgacggtttc ttcgtctttt    208020
     cggcgctcgc cttgatgtcg tcctcgctca ccggcaccaa cttttgtttg cccgtcacct    208080
     tgttccgctc cactctgaac gcctgcacgc gcgtttgtct ctgcacgcgt cgcaaacgcg    208140
     cctcgaggac gaggtacacg ccgaacgccg ccgccgcctt ggccggggcg tcgacttcgt    208200
     acggctcgaa ccccgcctcg acggcgcggt cggcgagcca cttggcgagc aaacccaaaa    208260
     ccactccgcg ctcgagcatc tcgtccgcga ctcgcgcggt gagcgcgacg gacgcgtcca    208320
     tccaaaacgg catgcttctg cacggattat tcagcgtctc ctcttcctga tacctcgaca    208380
     gcggctcaaa gtaccgctcg agcgccgacg cctcgcgaac ctcccccgac gcctcctcgc    208440
     gcgcctcgtt cgtcgcctcc gcgcgcgcgg tccaatcgac ccccatcacc aacgcgtcgt    208500
     aaatcgccgt cggcgccgcg aacgccaatc cgatcgacgc cgcgcgcgcg aaatccatcg    208560
     cctcgccccc cgtcccggcg ccgaaatcgc caaacgcgct cgcgcccgcg gcgtacgcca    208620
     agcacaccgc cagcgtccct ttcacccctc ccacggccac caacagcgac agatactctc    208680
     gcatcatcgc cttctccggc gtttccgacg acgacgcgtc cgcgccgtcg gcatccgatt    208740
     cgcgcggcgt ctcgccgcgt cccgacgccg ccgtcgaatc cccgcgcgcg cgcgtcgtcg    208800
     accttcgcgc cgccgacgcc cggtccatcg cctcggtcgc gcccgcgctc gacgcgcgcg    208860
     cgtcctcgtc gccctccgtc gcgtcgtcgt cgtccagcga ctcgccgagg acgctgcgca    208920
     gcgcgtcgaa cgtcccgctc ggcgacgccg acgcgagcga ctcgtcctcg tcgtcctcgc    208980
     gcgtcgcgcg cgcgcgccgg ttcgcgacgc cgcgcgcgcg gcgcgctcga cgccggcgcg    209040
     cgctcgggcg tcgcgcgagc gcgcgcgcgg gcgcgcgcgt cgcgcgcggc gccatgatgt    209100
     gacaccgcga cgcggcagca tggcgccgac gccgcgcgcg ggcgagcgcg acggcgccga    209160
     cgcggcgcgc gacgacaccg cgcgcgcgcc ggcgcgcgag agggagacgg cgaagccggc    209220
     gccgcgcgag gagggcgcga acgatggcgt cggtgcgatg cgcgaattca acgacgacga    209280
     cgaggacgcg acgacgacgg cgacggcggc gacgcgcgac gcgatcgagc gcgaaacgac    209340
     ggcgtcgacg acgccggtga cgccggagac gcgcctgctg ggcgaacgcc tggacgcgct    209400
     ggacgaagag gcggagctga cggtggagtc gtttctgagg gcgaagttcg acgcggcgac    209460
     gacgacgacg acggatttcg agagcgcgtc cggacggtcg gagagcgatg cgggcggaag    209520
     aggcgaacgc gtggacgacg cggagacgct gtacgcgcga gatacggatt tggaggaggc    209580
     ggaggaggtg gacccgcgcg tgggcgacgc gctggacgag ttgaacgatt ccatgacgga    209640
     gtgcaacggg ttggaaaacg cgctgcaaga ggcgaggaag gcgcgctcga ggacgcaaac    209700
     ggtggcgaga aagagactgg attcggtggc ggcgaggttg tcgtcgagcg tcatgacggc    209760
     ggtgcctgtg tttcacaagc gagcgttggc gcagctgtat caggtgcgaa gcatcgaggc    209820
     gctgcgggcg tacgagagcg cgcacgacgc gcacgaacgc gcgaagaagc ggaacgatga    209880
     gctcgagcgc gagctcgtgg cgagtagcgg taaagtagac atcgagctca tggaggtgtg    209940
     cgcggaggcc atgcgcgagg tttctgagac gacggcggtg aagctccgag cgaccgaggt    210000
     gcacgagcgc aacacgcgac gcgccgtcga ggccaccgcc gaagcggccg gtctcgagcg    210060
     cgagcgcacg agcgcggtga aaaaggctct cccgtggttc aacgctaaag ctttgggcga    210120
     ggcggagtgc gcgcaggcgg acgaacgcgt gagcgaatta aaactcgccg ttcgccaagc    210180
     caaggcgaga tacgaagccg cgctccgcgc gttgaacgaa atcagcgagg aagtgcacgc    210240
     ccgtcgcgag gcgcgcaagc tcgcgcgcga ggcttcagct ctagatatca gcgccgttcc    210300
     cgagatcgaa cgggaggaag gcgtgtaaat tattgtagat aatcgtagtt gcgagttgcg    210360
     cgccgaaaac cgtcgcggaa aacctgctcg aggtcaatgc ggcgatttcc cgcacacgtc    210420
     gtcggcgcac gcgcgcgcgc gtccgacacc gctcggacgc acgccgggcg ttcgagcaaa    210480
     catgctcgcg cttccgcgcg cgagcgtcat cgacgcgcgc gtcgcgcggc gcgcgaacgc    210540
     gcggcgcgcg aacgcgcggc gcaaactttc ggcggcccgc ggaggaaacg ctgggccgtt    210600
     atccgcgtcc cgcgacgcgc gctcgacgcg cgctcgaggc gacgcgcgat gcggcgacgc    210660
     gcgcgcgagc ttctcgacgg cgtcgacgcc cgaagcggcg atgcgcggcg cgatgacgcg    210720
     agtgagaggc gatttcgtcc tcgcgcgggc ggagagccga ggcgtccgcg gcgcgcccgg    210780
     cgggtcgacg caccaatccg agcgctcggc gcaaggaaaa acgcagaaag agacgagagt    210840
     tgccgtgagg gtggccgcgc tcgtgtttgg cgcggtcgtg acgtcggtgg cgttcgcggc    210900
     tcgagcgagc ggagcgttgg ccaaggttgg cgcgcaggtg gcggcggcga acaaacaagt    210960
     cggatccatg gtgctcaccg cgggcgtgct tttggtcatg tcggcgtttt tttcgttagc    211020
     ggaaacgtcc atcacgacgt tgtacccttg gaaagtgcga gagttggcgg atcaggaagg    211080
     ttcgacgggc ggggtgtttc agattatgcg caaggacgtg acgagatttc tcacgacgat    211140
     tttgataggg acgacatttt ctgggatcat ggccaccgcg ctcattacgg aggctgcatt    211200
     gatactatat ggcgatggtg cgacgaccgc ggtgacggtg gcgctgacga tcgtgatgct    211260
     ggtgtttaca gaaatcgctc cgaagagcgt ggcggtgcag cacgccacgg tgattgcacg    211320
     cgtcatcgcg aaacccattt acttgctctc cttcgtcgtc tacccgctcg gtcgaacgtg    211380
     tcaaatcgtt gtgaacgcca tgtttgccct tttcggtctc aaaacttccg ctgagccgtt    211440
     tgtgagtgaa gaagagttga aactcgtcct cgccggggcg acgaagagcg gcgaagtgga    211500
     gagcgcggag aaggatatga ttcaaaatgt gttggatctc gaagagacgg tcgtgagaga    211560
     tgtgatgaca ccgctcgtgc aagtgcacgg cgtgcgaagc gatgccacat tggctgaatt    211620
     tcgtacggaa tggatcgagc acaagtactc tcgcgtgccg gcgtgggagg atcgcgtgga    211680
     caacatcgtg ggcattgttc gagcgaatca aatcatgcag ctcggaatag aaagagatct    211740
     tcgcccggag caaagtaagg aactcgaaga cgtcctcgtc caggatgtca tgcttcgtga    211800
     cacttatttt gttcccgaaa gcatgtccgt gagtaaactc cttcgcgagc tcatgcagcg    211860
     caagtctcac atgtgcgtcg tggtgaatga atttggcggc actgtaggta tcgccacact    211920
     tgaggattgc gtggaggaga tcgtcggtga aatctatgac gaagaggata gtcaaaaggc    211980
     aaacgcggat gaggatgagc aagatgcgac gccgttcatt cgcgaggtgg gacagggggc    212040
     gtatctcgta gacactcgcg cggcgctatg gaaattggcg gatgagttgt cgctggacat    212100
     tcccgagtcg cctctgtacg aaactgtggg tggtttcgtg tgtgatttat tcggatctat    212160
     tcccgacgtc ggggcgtcga tcacgacaac gtttgagcac gtcgaggacg aggacgctag    212220
     ttcggatgac gagagcgacg gcgagactga tgggctcgaa ttcgacggca tcacgcagcg    212280
     agaagtcgtg gtgacggtca cggacgcgga tacgagacga gttaatgaaa ttcgtgtgca    212340
     aataaaacgc tctggaaatt ctataccccc ggaagattcg gacgacgaag agtcgggatg    212400
     gggcgataga aaaccaaagt tcgcatccca ggctgcgtaa gctcgacgag cgttcgcatt    212460
     gtataagcgc tttgttgtaa aaccaaacag gcggcagtaa aatcatcaat ccaagtcgtt    212520
     caaccacgtg acgacgtcgt aaaaaagcgc ttccgatgtc tcacgctcga tgaaatgatc    212580
     gactccgttc aacttccatt gctcgacatc gacgttgttc tcgcatcggt cgtacttcgc    212640
     cttggcgacg cgcacttcga cgctgttgcc atccgcgggc agggtgtcca tgctcttggc    212700
     gacgacgttc gagcaatcca tggccttacc cagcgtgctg aacgaatcgt ccgccgatgg    212760
     aaacggtatg cctcgagcgt tcacacctcc atcgataggt acagtgtgat cgtcggtgcc    212820
     gtgcacgagg agcacgtttg tttcgccgct ctttggacga catctggacg catcagaaaa    212880
     cgtaccaccc gcgagagaca cgacgccgcg gaagagttcg ggcttttcgc acgccaagcg    212940
     gctcgccatg aaacctccag tagcgattcc aacgacgtaa atgcgctttt catcgacgtt    213000
     gaattccttc ttcgcggcgg cgacgacttc tagaatgtac tttacgtcga ggtcgtccgt    213060
     cgccgagatc tctggcagcg ctacggcgtc acttccatcc cacgcgcggc actcaaactc    213120
     tggactgtct cgtgcgagga ttcccgtgat ccacgatccg aacagtctgt cttgcgaatt    213180
     cggtgaactt tcctgaaggt tacacagtac acactcgcgc gtcgtgcggg gagctcgcgg    213240
     cgccaagtaa atccaattac ggtcgagcgc ggcttctcgt agcccgcttt ggacgagcgt    213300
     ttgctgccgg cgacgggcga tacccaatcg gttacgcacg gctggcacgt ttcgcatgga    213360
     ctcgagcttg agcgtttgct gcgcgtcgtc ggacaagcaa tatccgtgaa ggaagaccag    213420
     caaaggcctt gcttctgagc catcgtacct cgaagacgtc aacgcacgca cgtccacggt    213480
     ggtgctcagt tgagccttga agtcggcgtc tcccgcacgg cagctcgcgc acagagtgag    213540
     cagtaaagtg agaatgagaa acatttggag gagcgaacgt cgaagaatga agtccatcac    213600
     tatcacgagc cgtctctttc gtcgtctcga acaacctcgt cctcacgaac gcacttgttc    213660
     tttggtagta ttccaacccg ctaaaatccc gctaattatt cgtgcatgta atgacgctca    213720
     ctaaaatcaa ttcgaagacg cgcacggcga ctcgtcgctc tccaacgcgt tcccgcactc    213780
     ggcgtcgcgc agagtctcgc tcaccccgca ttgacgaaag caaggcgacg caaacgccgg    213840
     atcagcctcc accgaaggcg gtgtcgcgcc gtacgtaaac tggcattcaa atgtctcgta    213900
     atttggtgtc aacgtcaccg gcaagccaat ctcttccgta aaaaactttt gcgtcggatg    213960
     cttgcaaacg ttcgcgcaaa ccgcggcgca cccggtttcc tcgagaacgc gacatcgttt    214020
     caacaaaacg ccctgcttat accccgcccg cactttcggc gcaccgatca tcgccgcgaa    214080
     aacactcgtc gacacgtcat cgctcacgtc tagcgcgaca tcctccggcg cgtcgttcac    214140
     ctccgcctcg ccgacgagcc acggcaacaa catcggagtc accgccgcgg cgtgccgagc    214200
     cgcgaaccat ttcgggaaca accgcagaaa tcccccgaac gcacccgcaa agccgggcgg    214260
     cgcgcaattt cgtatgatca tcaacccctt cgctcgcgtc tcgcgcgcgc ccgagctctc    214320
     gcgcactaat cgcaggcacg cgtcccgcac gtccgcgaag tcgtcgccgt cgtcgccgcg    214380
     tgcttttcgt cccggcgtca actcgcgctc catgaccgac gcgaacgccc tgagaaacgc    214440
     cctgtcgacg aacgaagtct tgtagtcggg tttcggcgtg ctcggaccgg cgcgttcgcg    214500
     tcgaaggtct ctgggcgtcg tctccgggcc tcggtcggta gatgacgcag ccggtgacgt    214560
     ccgcgacgtt cggcgactat tttcggcgcg cgcgcgcggg ctcgcgcgcg tgcggcgacg    214620
     cgaacgcgcg catgcgtgac cgcccggcgc ggacgaggac gcggcgcgcg aggacgccgc    214680
     gcgcatggtg acggtcgcgc gcgggaatgt gaggcgccgt ccgcccgtct acaacgctaa    214740
     agagcctaaa gagctatgtg tctacttacg gtcgtacgca gtgcgctcga acttgttgcc    214800
     gaggacggcg tacgcttttt gagcgagttg aaaccgctcg gcggcgcgct tcttggccga    214860
     ggcgtcgccg gcgaccttgt cgggatgcgt ctcgagcgcg acgagccgaa acgcggcttt    214920
     aatttcttcc tccgtcgcgt gcccgagctt ggcgtcgagg cgaagggtct tgtagaagcc    214980
     gtggatgtcg cgagagaaac cgggatggcg tccgctgggg gcgccgtgcg cgtcgtcgcc    215040
     gcgcgaacgc ttccagttgg cgccgtactt gcgctccatc tccgcctcgc gtctcgcggc    215100
     ttcgtccgcg aggtgcgcgc gctcttccat ctcgtgtcgc atctcttgac gctcgcggaa    215160
     tcggaatatt tgtgtctcta gaatgctgta cgcccacgcg cgacgtttat ccggatccca    215220
     gcgcatcttg tccgtctctc gccatcgtcg ccattcggcg tcgtcgcgtc gtcgctggac    215280
     gctctcgtcc atccactcgc tgttccctac tgatcgcatc gcacgcgcaa acgcgcgttc    215340
     ctcgtcgtgc acgcgcacgg cgtcaatttt atcttgacgc atcttcggca cctgacgcgc    215400
     gagcaccgcc gcgcccgccg ccgcgacggc ggacgccaac gcgccttggc cgagaaaaaa    215460
     atacgcgctc tcgggccaca cgtacgcggc gatactggcg ggaatcgcga ccgcgctgaa    215520
     cgcgagggcg cgcgccttgt ggtcacaaat caaatcatcg ctcacgacga ggcccgtgac    215580
     gccgcacacg acggcttcgc gcggctgttg aataatcttg tttgcgtttt cgtcgacgac    215640
     gtacccgtgc tcgaaggaca cgtaccacac cggatgatag accgcgtaca cgtctctcga    215700
     cagcgtcgtg aactcgacgc atatgtctcg cgtcgacgtc gcgcccttgt gtttcttcat    215760
     cagctcctcc gaggcctccg cgcgcgccac atctcgcatg cgcgccgcgg cgagcgacaa    215820
     cgccatgctt cgcctcatct caaacggctc gaccaccgtc ccttccggcg ccttcgcgcg    215880
     cgcgcgcgcc caatccatcg cgtcgaaatc gttcggatca aagctcacgc acgccccggg    215940
     cagcaaacga tccacgaaat ccctcctgtg cgcgaaactc gcgcatattt gactcgccct    216000
     cgtcgtcgcg tcgaaccgcg tcgtcttcgc cgccgtcccg cttcgcaccc aactcccccc    216060
     cacctccacc gatcccgcgc acgacgtctc cgccgtgacg tcgaacaccc aatacggcgc    216120
     gtacgccgcc cgaaacgtcg gttcgcgcgc gccgtcccgg ccgcgaacgc gccgcggccg    216180
     cgcgcctcga cttcgcaacc accgccgcag ggcgtcccgc gcgtcgcgct cgtcgcgctc    216240
     gaacgcgcgc cctcgcgcgc cgcgcggtcc cgacgcgcgt cccgcgcgcg cgtcgcgcgt    216300
     cgccgccgtc gtcgagtcgc gcgagtcgtc gcgcgtcgcg cggccgcgcc gcgcgtcgaa    216360
     tccccatcgc gtcgccgtcg tcgcgcgttc gcgcgcgagc gcgcgcgtcg cggcggcggc    216420
     gacgcgacgc gcgcgcgccc gcatcgcgcg ccgtcgcctg gcgccgtcgc cgcgccgcgc    216480
     cggccgtcgc gccgcgcgcg cgtcgcgcgc gggcgtcgcg cgcgtcggca ccgccaaccc    216540
     tcgcgtcact acataccgcg aaacacacgc taaacacgcg cgcgcgacgc gcataaatcc    216600
     agtccgaccg cggtgattcg tgacgctcga caacaccctc gcgattccgc gacgcgacgc    216660
     ggttcgccga gatggcgcga cgacgcggac cgcgacgccg cggggacggc gacgacgacg    216720
     agtcgacccc gctcgtcgct cgcgggcgcg ggtcgacgac gccggcgacg gtgacgcggg    216780
     tgacgctttt agtgttggtc gcgatgggcg tcgtcggcgc gtcgaccgcg ccgcgtcgac    216840
     gattctcggc gcgagtcggc gttttcaaga agggattgaa aacggtgacg agcgcggcga    216900
     gcggggtggc gagcgcgtgg tcgaagacgg gcgacgccgc gtggaccagg gcggaaaatc    216960
     tctctaaaaa cgcgcgtaaa aaggttggcg ccgagttgac ggcggccatg caatccgggc    217020
     accaagagat ttttaagcaa tacgacgagg cgtcggggtg gtcccagcaa gcggcgaatc    217080
     aagttgcggg agaggcgaca gaactcgggg acgacgtcga gaagacggcg aagatgattg    217140
     ccgagttcct cgacggttat aaatgcgaca tcggcgtcaa agacttgaag aagaccgttg    217200
     acgatattaa aaacgcggtc ggctcaaact ctttgaaatc catgtacgac aaggtgacgg    217260
     gatctccgaa taggtatttc aagaacatgg acgacttggc ttgccagatg atgtgggata    217320
     cgtctggatt cgcgcaagct gcatccgtga tggaggcttt catcgagttg gccaaggata    217380
     agtgtccgct cgtcgtcaag ggttcgagta agcccgcttt cacctatggt ttctccgtct    217440
     cgggtgacat tgtcggcgtc gtactcagcg ccggtcgctc tggcgaagtc ggtctcggca    217500
     tcgacttgtc tggccaaaag ttttgctacg ctggccattg cgtctactcg ggcttcacct    217560
     tggatgtacc tcaagtgggt gtggacttca acgtcgttgt ctccggttgg aagtcgatgt    217620
     cagacgtgtc tggtcggtcg aacatgatgg ctttcggctt gagtggcgag ttaccagact    217680
     ccgccatccc agattttgac gttgatctca cgctcgtcac cggcggcgcc aagatgagca    217740
     acatattggg cgtctccaag gcgttaggcg tcggtcaaga cgcgtctgag ctgccggtga    217800
     cgggcagctt cgccaagggt acgtgtataa ctccttggtg cgtcacgtat gaaggaggtt    217860
     cgtgcgccgg tgatccggga gaagggcgcg atttcaagtg ctatatctcc agacattcgt    217920
     cgttccggct tcctgctccc tttgcgggtc aaaccgttca agaccgatgg gattactaca    217980
     atcgcaaatc ggaatcgggc aaaaagatgc gcaaagaaat cgaatcgaat aatgacaagt    218040
     atccgattta cgaagggtgc gagttcggcg acgccgagat ggagtgttac tacgacaagt    218100
     tctacgccaa ggctcatcca aaggattacg acgacatcga gaaaaaagtg aacaaagaat    218160
     cttgcaacgg cttctcctct gactctgaat gctccaagaa tcgccgcgag aggatcatcg    218220
     agaagaaggt gagccgcgcc aaggctgatt tcttcaaaga taagggtggc tggaaaaacg    218280
     aaccgacttc ttacgcgaag tgcggcattt aagacgcgcg ttccaccgcg ggcgcgcgcg    218340
     ccgcacgatt ttgccgacga cgctgtaaat aatattgaaa tcatcgctcg cgtccgcgcc    218400
     cccgtcgtcg tcgtcgtcgc ctttccccgc gtccgtccgc gtccatcctt cgtcgcggcg    218460
     cgcctgcatt cacaataaat tcgtcatgat gccgttacgc acagtcagaa tacgccattt    218520
     gacgcgtata acgcgcatgt ccgcacatgg cgcaaacgcc gaggcgatta gggcacgcgc    218580
     gatcgacgcg aattatgcgc accgcacatt cccgcgccgc gcgcgacgaa cgcgcggatt    218640
     cgcgcgacga cgccgtcgac gcgcgcgttc gtgggagacg cctcgcggcc gggcaccgtt    218700
     cgaaacgatc gcgaacgcgc gacgcgaaaa acggacgtcg atcgcgttcg cgacggcgga    218760
     atcataagag tcgtttgttt gaatttcgga ttcgaatccg agcgacgcga gcgcgcgctc    218820
     tcggcgagcg ggagcggcgg gcgagcgaga gcgaatggcg aggagtgcgt ggacgcggcg    218880
     aggcgatgcg aggcgcgcga gagcgaggac gagggcgcgg ggggggaagg acggggcgcg    218940
     cgcgacgacg cgcgtcgcgc gcgacgcgcg cgaagaaaga cgacgacgac gcgacgacga    219000
     cgacgcgacg acgacgacga tcgcgggact gacgagggcg ttgatgtgcg cgcgcgcgca    219060
     ggcgtcggga gcggcgcgat gccggcttcg gcggaagatt ccatcgggtg gtacctgagc    219120
     ttgtactggc cggcgatgaa taaggagttc aagggcgtgg tgcaaaagta cgatcacgat    219180
     tccaagcatc acacggtgaa gtgggataac gcgccgaaag ggagcgatgg cgtgaccgag    219240
     gttgatttga ccgagggcga gttgacgtgg ttgaaggcgc cggagaagcc cgtgaagaag    219300
     gccgcgaagg gcaagccggc ggcggcgaaa gcgaaaccca aagcgtacaa ggagtacgat    219360
     gccttggaga ccatggatga tttggaagcg cgattcacgg gcaaaacgac caaggcggtg    219420
     gcgtttcaag tgttgaagaa cagcggcgta aacgggatga cgcttcaaga aatagtcgac    219480
     gagtcgcaaa agcttgggct tcgggactgg acgcagtgca aacagccaaa gacgaccatc    219540
     aacgtgtgcg tgagtcaaga ttcggcgttt gtgaagattt ctcccggacg cgtgggtttg    219600
     cgcatcaacg gcgcgcaaac gagagacgct tcgcaagaac ccaagcacgt gaaggcgtcg    219660
     ggcgcttcga aaaagcgtgg gcgtccgccg aagacgggcg aggccaagcc gaaaaaagtg    219720
     caacgtcaag aaccgcaaca ctgggagcgc aagcctccga ttgatttgtc gattgaggtg    219780
     tacacgagca acaacacgca cgtgaccaac gcgccaatct cagttgcgta caacgttacc    219840
     attaaggctt tgaaaaaggc catctcgaat aacaccaagg gcatgctcaa gccgcactat    219900
     cagcaacttt accacgataa ccgaaacatc ggtatggatg aggatgcgtt tttggtgcac    219960
     gcggttcgcc cgcacaaatt tgagcgcacg ctcgatttga agctcgtcat cagcgatcag    220020
     tagacactac aacagtgaca gcggtaacag gcacatcata gcccgcgcga caacaccagg    220080
     cggaaatcta atcatcgatc atgtgtcgcg cgcgttgtaa atcgaatatt ccataaacga    220140
     cttcgtctcg agttgaatta caacgtctac gccgcgacag ccatcatgcc gcgcaaaacg    220200
     agctcgcgaa gcgcccaagt gggcttggtg tactttcgcc cgtctttggt ggtatactcc    220260
     ttatccacca actgcatggc ccaaaggtag tggacggatt gaatgtcgtc ctcggcgccc    220320
     tcgacgacgg cgccggattt gtcgcgaacg cagttgattt gttggcaact aaaagtcagc    220380
     acgacgaggg gctcgttttc catcaaacga acttccatga gctcgacttc acttaaatct    220440
     aagatcctcg gatccacgtg ctgtccttcg tgcttccaaa ggttcatctg cccggataac    220500
     cgctcgagca tttcgctcga aatattcgtt tgcttcaacg cctcgacgtc gcccttgagg    220560
     taggcgccga gaactttggg aatatctctg cgcacttcgg cgataaaatc gttaatgtta    220620
     aacatcggat ctcgctgacg aatcatgcga tacgcctcgc cttgctcggt ctcgctgaac    220680
     aggttatcct gaaagtcttg aatgcggtgc accacgggcg agtcgctcgt ctcccatcgt    220740
     tcgcgcatat cctccgccag ctccgccccc ttggcgtacg gcgcggtctt cttcaacccc    220800
     tcgagcttat cgaacgcgct cgcgatcccg agcttggact tcacccctcc ccacaacttt    220860
     ccgaacgcgc tcggtttcgg cgccgccgtc gtcgccaccg ccgtcgtccc gtcgtacggt    220920
     tcaaacatcg cctcatcgta ccccgccgcc ttccttcgct ccgccgccgc gtcccccgga    220980
     tccatcatcg ccaaccgata ctcctccttc accgcatcga tcgccatcgc cgcgaatccg    221040
     ctcggcgtcg tccacgactt tttccccccc gccctcgcgt cgcccgtcgc cgccgccgcc    221100
     gcccgtcgtc ccgccttccg cgccgcctcg cccgcctccc tcgccgcgtc gtccaccgcg    221160
     tcgacgtcga tgcccgacgc tctcgcgcgc gcccgcatct ccgccgccgc ctccgccgcg    221220
     tacgtcgtcg cccgcgcgcg taaatcatcg aatccccgcg cgtccgatcg cgtcgacgtc    221280
     ttccccgtcg cctcgctcgc cgcgtcgcgc ggcgcgcgcg agcggcgcgt cgcgtcgccg    221340
     tcgtcgcgcg tcgcgtcgcg cgcgcgcgcg tcgtcgcgct tgagcgcgcg cgcggacgcg    221400
     cgaagcgacg acatcgcgcg cgcgcgcgtc gcgtcggcgc gcgtcgtcgc gctcgaacgc    221460
     ggcgcgacgc gcgcgagcgc gctcgagcgc gacgcgacgc gcgcgagcga cgcgtcgccg    221520
     agcgcgcgcg cgctcaggcg cgcgagcgcg cgtcgcgcgc gcgtcgccat ggcggctcga    221580
     agtgacgcgg cgacgcggcg cgcacttcga tgcgcgcgcg cgccgtcgcg cgatgcgcgc    221640
     ggcgcgtcgt cggcgcggac gcgcgaccgg acgcgcgacc gcgaccgcgc gcggcgtcgc    221700
     gtccgcgcgc tcaagcgcga cgacgacgcg acgaggacgc gcatcgcgcg acggcgcgcg    221760
     gcggcgacgc gcgcgcgctc ggcgcgctca tgcgctggct gcgcgcgcgc ggcgtcgaag    221820
     cgtcgcgcaa gacgcagttc gcgcgcggac gcatgggcgt cggcggcgtc gcgatcgagg    221880
     acatggcgca gggggaggtg attttctcgc tgcgaatgcg agacgacgac gacgcgccga    221940
     tcgcgctgac gacgacggag gtcgagaacg agcgcggacc gctgcgaacg ctggcgaaga    222000
     tggtgaacgc gacgaggctg acgagtaggt acgctggggt gatcgaggac gagtggggat    222060
     ttccgttgga ttcgacgcgc gcggcgacgc tggcgctggc gctggcgcgg gaagtcgagc    222120
     tgggggacga cgcgtactgg cgcgcgtacg tcgatttgtt gcctcgagag gtggatagct    222180
     tgcagatgtg ggacgatgac gagctcgagg cgctgcaggg gtcgagattg atcgaaaggg    222240
     cgcggcgaag acgcgcgctg gtgcgacggg aatacgaagc gacgcgcgag gcgttggggg    222300
     cgacggcgcc gtcgtacgag tcgtttcgat gggcgtacgc caccgtgctc gcgcgcgcgt    222360
     tcgtgcttcc agatttgaac tgcatggcgc tgttgccggg attagatttg tacaattccg    222420
     cgcgcgacgc ggaaaagtgt acggtggagc gactcgggca cgtcgaagac gacgacgacg    222480
     aagacgacga cgaggacgtc gcgttcgcga acgagggcga agcgcaagtc acgcttcgcg    222540
     tcggtatcgg tggcgcggcg gcgggaacgc agctgtttca cgattacgcc gaccacacct    222600
     cgggcggggc gttgctcgaa ttcggtttcg tgtaccacgg cgaacgcgag cgaggctcgg    222660
     gcgtggacgc cgtcgagacg agtcttgtgc gcgcgtacga cgcactcgac gcgcgttcgc    222720
     gcgcgtttct cgccgaacgc gtgttcggtg cgttcaacgt gcgcaccagc ctgacgtttg    222780
     agctctcgaa cgtgggtggc gtgtacaaac ccgcccttcg cggcgccgcg tgcgttccgc    222840
     tcgaaatgtg gcgcgccgcg agggcgttgg cgctctcgcc cgagcgcgcg ctcccggcgt    222900
     cgttagacga cgtcttggac gaagacaccg aaattcgagc gcgtcgcatc atcctcgacg    222960
     ctctcaaagc cgagcgcgcg cgctacgccg cgacgtcgat cgaggaagac gtccgcgcgc    223020
     ttcgcctcgc gctcgacgcc ggcgccgccg cgcgtcgaac cgccgccgcg ctcgacgtgc    223080
     gcgtcggcga gaaatccctc ctcgacgacg tcatcaccga tttagaaacg aacgcgcgac    223140
     gcgcacggcg cggatagctc tcgacgtggt aaactagtaa acatatttat tcgtacatcg    223200
     ctcgacggcg tcgtcacgcg cgcgcgtcgt cgtcgtcgtc gtccttcgcc tcccccctcc    223260
     cctcctccgg ctcgtactcc acgcgcagca gcgcctccag gctctctcgc ttatacatca    223320
     gcgcgtcccg ttccttatcg atgtcccacg cctcgctcgg gtcgtccgtc cgtcgccatc    223380
     gcttattctc ctcgacccgt cgtcgctcat cctcatccca gatctcatcg tcgtctttct    223440
     tcgaccacgc gcgcgcgatc gtcgacgtcc cggtcccgcg cgcgcgcgcg atccatcgcg    223500
     gcgcgcgcgc gacgacgcgg caccgcggct tcgtcgtcgt cggcggcatc gacgagtgcg    223560
     gcggcgtcga cgcgcgcgcg gatcgcgcgg cgcgcgtcga aaatcggtcg cgtactgttt    223620
     gcccacacgc gacgttttcg cgccaaattc attgacatgt cgcctcgcac atcggtcgcg    223680
     gactgtttgc ccatacgcga cgttttcgcg ccaaattcat tgacaaatgt cgcctcgacg    223740
     acgcggacgc gcgacgacga cgccggcgcc gacgcgagag cgcgtcgcga cgacggacgc    223800
     gacggcgcga cgggaggcgg cgatgacggc gcgcgcgacg cgcgagcgcg acgacggcgc    223860
     gcgggcgacg acggacgagg gcggcgcgcg ggcgacgacg gacgaggatc gcgcgcggct    223920
     gacaaagtat tggttgcgac gacggtgctc gacgggatcg cacgcgagcg aggcgacgga    223980
     ggtggggatg ctgacgggag gggagagcag caacgagagc catcaggcga cgggacggcg    224040
     agcgcgacgg ggggggtcgg cgtcggcgtc gacgccgccg ggcgcggggc gacgcgcgga    224100
     gagaggaggg atcgatacgc cgggacactt cgcgttcgcg acgccgatga gcgcgagggt    224160
     gcgcgaggag gggatgacga cgccgagaac gccgacgctg gcgaacgata gtccggatcg    224220
     agcgcggttg gatgagctct tggcggcgcc cgtgaagccg aatttcggta cgcgggcggc    224280
     gatcgagtgc acgccgcgac acacgccgtt gaagctgcga tttgatgata acgtggacgt    224340
     cgtcgtgagt ggaacgcacg cgacgagtaa gaagcgcgcg cgtgggaagt tgagcgatgt    224400
     gttcaaggcg accaagtcga cgacgccgag gctcacgcgc gcgcgaaagg cgatgttgtg    224460
     agcgacgcgg cggttcggcg cgcagtaata attaatcacg aatgtaaaac aacgacgaga    224520
     gtacttattt gattacaggt cgtcgcgacg acggacgtcg aaacgtccgt cgtctcgggc    224580
     aaaacactcc aatgacacga acaaagcgac aaaactgtat atatttactc ggaacccggc    224640
     acgaggtgcg gctcgagcgc ggcgcgagcg aactcgggca gcacgaacgc cgcggcgtgc    224700
     acttgcgggt tataatagcg catcggtttc agcgcgcttt catcggcggg tcgcggaaat    224760
     cgcttggcct tggtgaaatc caccgtcgac ccgtccgccg cgggtttgct gcacatcatg    224820
     aaaccgattt gtccgctcgg gtaagtcggt atcgtggtgt acccgtacgc catggaccca    224880
     ccgacgaaaa tacccttgca catcttcgcc aagtcctcga tcaaatcgat gtgcaaccac    224940
     acgcactcgg cttgcgtgca cacgacgccg ccgggcttga gcgcgcggtg catcttttta    225000
     aagaacgcct cctcgaacaa aacgctcgcc ggtccgatcg gatcgctcga gtcgacgatg    225060
     atggcgtcgt acgtcccctc ctccgcgtcc ccgacgtact tgatcccatc gcaaatattc    225120
     acctccactc gcgcgtcgtc gaaccccacc gccatcgacg gcaagaattt cttcgacatc    225180
     tccaccacca tcccatcgat ctccgcgatc tcgatccttt cgatcgatcc gtgtcgcgtc    225240
     acctccctga gcacgcctcc atcgccgcca ccgacgacga gcacgcgttt cggttcctcg    225300
     ttcagcgcgc acagcggcag gtgcgttatc atctcctggt acgcgaactc gtcccgctcc    225360
     gtcgcctgaa tcaccccgtc cagcaccagc acgttcccgt acgccgagtt tttaaacacg    225420
     tacacgtctt gaaactcgct ccgtccgcgg aacagctcct cgtcgatctt cagcgacatc    225480
     gcctggcctt tccacatttc gctcacctcg cacaaccatc cctcaccgca cgcgccgatg    225540
     cacttgtccg cgctctgcgg cgcgtcgtcg gcgtatttat tcatccctcg cgcggtcgtc    225600
     gcgcggcgac gcggcgcgcg gacgcggagc gcgcggacgc ggagcgcgcg gagcgaaatc    225660
     gcgtctcgga gtggcggcgc cgcgccgcac agctcgacgc cgcgtccgcg tcgcgtcgcg    225720
     tcgcgcgctc gcgtcgcgac gcgcaccgcg cgcgcgatgg cgctcacgac gtcggtcgcg    225780
     agggcgcgcg acgcgcgcgc gagcgccgat cgcgtcgtcg gtttggtcgg cggtcttcgc    225840
     gtcgtcgtcg acgcgctgcg cgagcacgcc gcggatggac tcgcgacgaa cgtcgcgcac    225900
     gtgcgcgagg acgcgatgta cgtcgtgttt ctcgcggcga gcgtgatcgg gttcgggacg    225960
     gtggcgagcg gggagatgat gagcctgcgg cgacgacggg acagggcgcg cgcggcgctc    226020
     aaggagtgcg cgacgatgtt ggatctgaag agcaaagaga cgagcggcgc ggcggcgacg    226080
     gcggcggtgg ggcggaaaac gcgcgacgcg ggacggggga agcggacgcg cgagatcggg    226140
     gtcgggaaag acttttggaa cgagttggga tatctgttaa aggtggcgtt tcccacggcg    226200
     gggagccgag gagggcagtt gttgggcgcg cagttcacgc tgctcgtcat gcgcacgctg    226260
     ttgacggtca gggcgaataa ggtgaacacg ttctatttga ccaaggccat ctcgagcgcg    226320
     tcgtggaagt tttgggtgcg gtggtttttc aactttggcg gttggatggc gagcggcgtg    226380
     gtggtgaaca gcgggctgcg atacaccgag agtttgatca cgatcgaact cagagcggcg    226440
     ttgacgaaga aggcgcataa gatgtacatg gaaaacaata acttttacaa gacggcggtt    226500
     ttgcgtcaag gcgggttgga taacgtcgat caacgcatcg tggcggacat cgacgccttc    226560
     gccaaggaga cggctttcct gtacgggcac tcgttcaagc ccattttgga gttcacgctg    226620
     agcttgaccg aagccgcgaa ggagttgggc tattctcgcc cgctcgcgct tttcgcgtca    226680
     caaatcatca tcaccggcgt tttgcgatcc atcgccccgc gactcggacc gatggtcgct    226740
     cgcgaagccg cgctcgaggg cggtttccgc cacacgcacg cgcgcttgat cgctcacgcg    226800
     gaggaaatcg ccttattaga cgggggcaaa cgcgagattg agattttaga tgaaggcttg    226860
     gataatttgg tcgtcacgca gcgctggcat gcgctgcagc gtattcgcaa gagcgtcgcc    226920
     gacaacgtat ccaagttcca aggcttgctc gtgggcagta ttttcgtaca cgtcccgttc    226980
     atgatgaagg catcagtgtc cgaaggcgag cgcatttcat ccttccgagc caccgaggag    227040
     ctcatgcttc gatgcggcgg cgcgttcacc gaagtgttgc ttctcggcaa aaatctcgac    227100
     gaactcgccg gatacacgca ccggctttcg caactgttca aaacgttgga tctcgcgagc    227160
     aaggaagcgc gcgaagacaa ggctaaactg gcttcggcag gcgctgacca cgccgaaggc    227220
     tcgccgatcg tgttcgataa agtcaccgta ggagcgcccg agccggatgg ctcgcaacgc    227280
     gtgttggtga aggacttgac gctcgccgtg gcgtcgggtc aacacttgtt gataactggt    227340
     ccgaatggat gcggaaaaac gtcattgctt cgcgtgttgg ctggattatg ggcgcccgtg    227400
     tccggcaccg tcaccagacc gtctggcgta tccagcatca tgtggttgcc gcaacggccg    227460
     tacttgttgc aaggatcgtt gcgcgatcaa gtcgtgtacc cgcgcgacgc gcgcacggag    227520
     aagatcgtcg acgcgcgcgt gaaggagtgt ctgatgatgg ctggcctggc caaattcgtg    227580
     gacggctcca tgaacgttgg attaaacacg cggcacttgg agtggaacga tgtgttgtcc    227640
     ggcggcgagc gtcagagaat cggtttcgcc cgcctttact atcacgcgcc aaagtttgcc    227700
     attcttgacg aagcgacgag cgcaatcaat ccagacgaag agtccaagct gtacgaacgt    227760
     ctcatcgaaa ccgacaccac cgtcgtgagc atcgcgcaca ggctcgagct tagaaaattc    227820
     cacaagttgg aactcaaaat cgcgggcgac ggcgaaggcg gttttcgaat cctcaaactt    227880
     tagattactt gtgatagcac gtatattaca ttaatgcgtc gacgtcgtca agtatgcgaa    227940
     caacagcatg ggcgcgccga agaggccgac catggtgagc atcgcctgcg tgttcagcgc    228000
     cttgacttct tcttcgtcga tttcgcccgc aaacttttcg ttcgccatct tgatcaggta    228060
     ctcgtcgtac gcgtctagtt ttgcggcgtc catgtaatcg aataagtccg atttcatctt    228120
     cttggaagcc gtcgtcatcc cccaaatcat tcgatccgct tgcttggaca cgtttccgta    228180
     ctggtttccg atgcaccgac gatactgctt caacgcctca tctcggcgct gcaagttgtc    228240
     cagacagatg gcgtagttga agattatcct cccgcccatc tccgtctttt gcccgatgcg    228300
     atcgagcgcc cacggctcga gcaaatcgag cgcgtcttgc atgtatcctc gcttcatcgc    228360
     ctcgcccgaa cgctccaaaa cctcccgcac ctccgcgtac tccgcgttcg tcagcgtcat    228420
     cccctgatcc tcgcgatatt tcgccaattt cttcgccact ctcgcccttc gcgccgcgat    228480
     cgcctcctcg tcctccaact cctcccgttt aacggttcgt ccgccgccgt acgtcttcga    228540
     tatatccggc ggtcgctcga acacccccca cgtgctcacc gacggtttat acaccgcgtc    228600
     ctccacgtcg taccccaccg ccttctcgtc cgcgtcgaac gggtcgtaat cccggtcccg    228660
     cgtcaagatg cgcaccgtca cctcccgttt gcgcgtcgcc cccgtcgcgc cgtcgctcgc    228720
     cgtctcgctc gcgaacgtcc cgtccgtcgt cgacgcctcc atcgcgtcgt cccgatcgcc    228780
     tccgtcgccc tccgcgcgcg cgcgctccat cgccgccgcg tactcgcgcg cctttttcac    228840
     gcgatcctcc accgacgcgc gcagatcgat cctcgcgtcc gcgtcctcgc gcggcgccgc    228900
     gcgcgcgcga gagcgacgcc gtcgcgcgac gcgcgtcggc gcccgcggcc gcgcgacgcg    228960
     cgcgacgcgc gccgcgcgcg ccatcgcgcg cgccgctctc gcgcgatcgc gcgcgcgcga    229020
     ccgcgcgacg ttcgcgtctc gaggttcgac gtcgaaaccg acgcgaggtt cgatcgcgcg    229080
     cgctcgaacc tcgcgatcgc gggttcgatc gcgcgcgcgc cgacgtcact gcgcgtcgat    229140
     gcccgcgacc gggacggcgt cgtcgcgcga cgagatcgtg cccccgcgac gaggcgcgcg    229200
     aaatccatgg gtgctcgtcg gtgcgggcgc cacggcggcg gtgttgctcg cgggattcgt    229260
     cgcgttcagg gctggggacg cgcgcgcgtc gcagcggatg atgcgcgcgc gagtgctcgc    229320
     gcagggcgcg acggtggcgc tgatggtggc gacgtccgcg ggaggactgt cgagcgcgac    229380
     gtcttggacg ctcgcgcgtc ccggcgcggg cgggacggcg ggcgaggggt gacggacgcg    229440
     cgggcgaacg cgcgcgggtt cgcggcgagc gcgacgacga cgcgcggcga cgacgacgcg    229500
     tcgacgtcgc gcgacggagg cgcgagcgat ggtggggagc gcgggcgcga cggtgacgcg    229560
     agagacgcgc gcgcgaggcg ggacgaggag tcgcgcgcgg tgctgcgcga acgcgcgctg    229620
     cgagcggcgt tgaagcgcgt gcgcgagctg ggatggacgg acgccgccgt cgacgcggga    229680
     ttgagggatt tgaatttgtc gcccgcgatg cgcgcgatcg ttcgcggcga cgcgggggcg    229740
     ggcgcgaggg actcgggacc gggcgacggg ctcgcggggg agttggcggg atactttgag    229800
     gagtgcgcgg acgcggcgtt tcacgcgaag gtcgtcgccg agggcgagac gctgcgcgcg    229860
     atgaagtcgc gcgagcgcgt gaagtggctg atgcgcgcgc gtttggagat gatcgagtcc    229920
     aagctcgatt cgtggccgcg cgcgctcgcc gcgatggcga cgccgcggta cgcgatgacg    229980
     acgcttcggc gtcgcgccgc gctcgcggat ttcatcgccg acgccgcgga cgtcgacgcc    230040
     ttggacgtgc ttccggattc gttggatacg tttcgttggc acgccgaacg cgccgcgatg    230100
     ctcgcgctgt acgccgccac cgagttacgc ttgttgacgg attcgagcaa ggatcgtcgc    230160
     aagacgtggg cctttctcga cgcccgcgtc gacgacatcg cgcgatcccg cgtcgacgtc    230220
     ctcgagctca agtcgtacat cgacgtcttc gcgcgcgacg ccgacttgac gacgctcggc    230280
     gcgtcgttcg cgagcaaaga cgcgctcgcc gcggcgttcg cgcccgtcgc cgacgtcttc    230340
     gctcgcgcgt ctcgcgccgt cttctcgacc ccttcgcgcg acgcgtccga gcgcgacccg    230400
     ccgcgcgact cgcccgatcg atagtttacc cggtagtctt aatgctcacg cgcgcgcctt    230460
     taaccgactt cgcgcgcgct cgccgtcgcg ttttgtgtcg cttcggtcgc tccactcccg    230520
     ggtgtttcac gcccgaatcg tcgcgccgcc gcgcgccgcg cgtcacgcgc gcgcgctcga    230580
     gcgatgtcgt tcgacctgcg ctgcgccgtc ctgtgctacg ccctcgccgg cgtcgcgcac    230640
     gagctcgcgc acgtcctcgc gcacgccgcg ctcgcgctcg cgaagcgtcg cgggtcggtc    230700
     gccgtcttcg acgcgtgcgc cgcgctcgac gcgcgcgcgt cgccgtcgtc gctcgcggcg    230760
     acgctcgcgc gcgcgctcgg acggtggagc gcgttcgcgg acgcgctcga cgacgcgtcg    230820
     tgcgcgaacg cgcgcgcgat cgtgcgatgg gcgggcgcgc tggcgagcct gggcgcggcg    230880
     gcggcggcga cgacgcgaac gcgaggcgac aaaagcggaa cgagcgcggc gctgcgagtc    230940
     gcgtgctggg cgacggtcct ggacgcggtg tgcacggacg tgctggacgc gctgccgcgc    231000
     gcgcgaggga cggtgctgtg cgggaacttt gggattattt tgataaacgc ggcgtggtgc    231060
     gagagcgaac gcgggaagcg ggcgtttgat ttgttggaga agatggtgta cgtgacgatg    231120
     atgcgagggg cgcagagcgg tggagtcgtg acgttcgacg agtgccgtga gaaggcgcga    231180
     ggggagggtg cggctgtggc gctgcgcggc gcgagaagtc gcgtggtgaa catgaagcgc    231240
     acggatttga gcaagctcgt gcgagcaaag gcggaacgcg actgcggagg ggcgaagatg    231300
     ggtcgacaaa acgtcacgcg catgatcgtc ggccacacgc ggttcgcgac gacgtccaag    231360
     gctacgtttg acggcacgca tccgcatcag tggtcgccgc cgcagcagtg tctcgtgtac    231420
     gggcaaaaac agaaaacgcc cgggccgacg cgcgtcggcg tggagaatta catcacgcac    231480
     aacggcgatt tcgactttta ccaaatcaac aaaaactggt acgagctcgg tgagatgcag    231540
     cggtggttag aaatcgccac gggacatccc atgccgagcg tggtggattc tgccgccatc    231600
     gctggcgtta tcgatttact cagagcgcag gggagcttcg cgctcgccgc gagatttgcg    231660
     gtgtgcgtgg ggctgaacac gagcgacgcg tcgaaggacg cccccgtgcc aacgctcgcg    231720
     aaattcgaag aaatcgcgcg gtattttgaa aacgctttgg atgcgtcgct gagtgcaggt    231780
     aaacataccg ttcgcgagct cggctttcag gcgagcacgc gcgagttgct cacggaaaag    231840
     gtcgtatccg cgctcgaggg cgaaggcaaa gcagcgatcg agtgcatcaa ctattacatc    231900
     gatgaagaaa tgggatcgag tctacgacac tttgtgcgat cgacgatcga tgcattcttc    231960
     gacaacgata gcttattcgt gacgaagaca tttctcgcca acgcgaaagg ttcgtttggt    232020
     ttgatggtga caaactcttt agatgcgcat cggcagcttt gcgtcgccgc gcgggggcaa    232080
     actataagca tcgcgttcta cccgaagaag ggtttgattt gttacggctc tgaacaagcc    232140
     gccgttaaag cgggtttgtc gatcccgaca ccaggtggtg acgtgttggc gagcgttcac    232200
     ggcggtgaat tcggcgacga caacgccgcc gtgcgtctcg acttggacga tttgaatggc    232260
     gaaatttgtt tgttagattg ggaagacggc gacgaacccg cggtgtcgtt cccgaactcg    232320
     cacttggagc aatacccact catgggtggc aaagttaccg tcgtcctcgc cgctgaaggt    232380
     acatctggcg tgagcaagtc aaccatcgga acgcctgcgc agagtctcgt catgcgcaag    232440
     ccgagcctac acgtgggcgt tagcgtggac aagaagctgt ttcgccgaat gactcgactc    232500
     gaagggaacg acctcatcaa gccgctttta cccgatcgag aggacttggt gctgcacgat    232560
     attcacgata ttcccaaaat tttgcgaaac attcaggaag actggcaaaa tcgcccacag    232620
     gccacgatta gtctcaatcg actcacggct tggaaccttg cgcgttgttt gcggcgacgt    232680
     ctcgatcgcc gactcaacag tacgacaaag tcatcgcgtt caatagatgt cgtcgtcacc    232740
     ggttgtgaag tgtcgctttg gctagccgaa caatttgcgg ctgatttaca gcaagcgttc    232800
     ccccggctga cggtgaaagc tgtgagctcg aataaaatac tcggtttgtt cggccaagac    232860
     attcccatcc caacagtggg attcccagac tcaaagaaga acgatgactt tacggactct    232920
     gtcgtcattg tcgtcagtca ctctggcggg acgtttgcgc cactcgcgac ttcgaatctc    232980
     ctcgtgagct ccacgagctc catcttcgtc gtcgccagcg aatgggacac acaaatcggc    233040
     aaacaactca gagcgatcaa gtctgatggg gccttctgca gccgtatctt tagcacagat    233100
     gttggcgtcc gaccagctga gccgtgttcg gtgagcgttg cggcgacgca gcaacttttg    233160
     acgcaaattt tcatgcacat gtcactcgtg attctcggta acgccgatta ccgcaagtac    233220
     gcgggcgccg tggttacgaa gcacgacttg gcggaactcg aaaggtgcaa tcaaatgaac    233280
     atcaccgcgc tggaagaaat agtgggagtg aaagcgacgg gcgaaaaggt cgactcgtcg    233340
     acggagcgta gtcttcgagc gcaaggcgac gagtggtccg atcacgttct cgaaggcgtc    233400
     aaggggtgga tgatgtcgtt tgcatacatc gtcggcaccg taacggcggg atacccgctc    233460
     atcaccggcg ttgccgccgc ttgtggactc gcggcgactt gggcgtttta cctcacacga    233520
     ttcttcgacg cgttgattta cgtgtttctt cctcaaatca acataaccat tattcgtttg    233580
     gtgcaaggac gaaacttgcg tcatcgcatg acgggtcgaa cggttgtcat cggcgacgtt    233640
     ccgtgggtcg cacaggctgc agatgcgttt ctgtcaaaga tttttgcatg ctcgtactct    233700
     gccgctgggt tgaacgttct cagtggtaat ccaaacgatc atctcgtgca ccgacacacg    233760
     caccgcgtcg ttcgcggcgc attgctcgtg gtcggtcgtc ccgacggtag gctcgccgcg    233820
     ctaacgtccg ctgaggcgac gacatcgctc tcgctcgccc aagcaagttc tatccaaagt    233880
     tacggcggaa cgtgcgaatc gatcacgatc gggcactcac cgtataagct tccactatca    233940
     aagaatggta tcttcctcaa acgacaccgc ccgatgtact tgtgcgagaa gctcgtgctc    234000
     gagcgcgagg gggaaaagag tttagacggt cgctcgcccg gctccttgct cggcgtgtac    234060
     aacaagtatc acgaggaagg ggcggaactc tctgtacatt cgctttcgcg tcgaaacgcg    234120
     gtgcaagttc tcacagcttc gaggattaag gcggatagac agaagggtaa tttgcgctcg    234180
     gtgttcgacg aaatcgacgt caaccgcgac ggcaaactat gcctcgctga gttcacgcaa    234240
     gcgtacaaga aagtggacga atcgctcaca gacgcacaaa tagcgaagct tttccgcgat    234300
     gcagacgttg acaacagcgg tacattggac tacgatgagt tttgcgaagt catgaacctt    234360
     cccgaaatgg acatgttgaa cattctcgag gcagatgctc gaaacgagga aggtttgctc    234420
     atggtggagc cgtcgcacga agattatttc gggcaatcca ttcgacgaag cgcaccgaaa    234480
     aagatcaagg cgtacactct ggtggagtct caagagttca gcatgagctt gtacgaatca    234540
     cgaatcgcgt ctttgcagcg cttcgtctcc atgacggtga tgtttcacca aatgggtgac    234600
     cgggctcaaa agttttggcg aaacgtctct ttcggatatc tgggatatcg catggatcgc    234660
     acgcacagta tcatgcgtat cgccaccacg gcctcacccg tgagcggcgc tgaagtgcgc    234720
     gaccggcgtc attttatcgc cctcgtcacc gcgttcaaca acgcgctcgg cgtcatcgac    234780
     aactccggcc acattcttct ctctcgaaga cgcacggaaa gctaccgcct cacatcgcgg    234840
     caaaagtccg ccgcgaggct ttcgcgtcag agctccgtcg ctagcgccac tggcgcgtga    234900
     atctagcgca tctcgcgccc atttgtttta ataccgaagc gccgtcgcgt ctcgctctcg    234960
     tcccgccctc gccccagacc tcgccgcgcg atgcgccgcc gcgccctcgc gcgcgcgctc    235020
     gcgcgctggt gcgacgcgcc gttgtcgtcg tctcgtccgt cgcctcgcgc gcgaacgatc    235080
     gcccgcgcgt cgtcgacgaa gccaaacgac gacgacgaaa actttgtccc gagcgccaaa    235140
     gcgcgcgcct tcatgcgcgc gttaaacctt cgcgacgacg atctcacgac cgctcgcgac    235200
     gaggtgcgac cgagggacaa agcttacgtc gatcggcgtc gcgtgcgcgc ggagggagga    235260
     cgcggcggcg gcggggtggc gtcgttcgcg atggatggcg gttcgcggcg gcgacgcggc    235320
     gccgacggcg gcgacggcgg taagggcggc gacgtcgttc tcgtggcatg cgcgcggacg    235380
     aaagggctgg gagacgtgaa gaatttattg cgaggcgcga cgggaggtgc gggaggggcg    235440
     cagggacgga tcgggagtcg aggcgcggac gcgcgcgcgc gcgtgccgct agggaccatc    235500
     gtgtggcgcg aactcgcgga cggcgacgac gacggcggcg gcggcgcgat cgatttcacg    235560
     cactggggca cggattcacc ggtatcgtcg acggcggacg cgtcggaaag cgacgatgaa    235620
     tcgcgagtga atgagaatgg ttggacgcgg ccgcgcgggc tcagtagagg cgaatggctc    235680
     gtcgtcgccg acttgacgcg cgacggacaa acgtgcgtgc tcgcccgagg cgggaaggga    235740
     ggtaaaggga ataaacgcat gcccgttgga cgcgaagccg ggacgcgcga gccgggcgct    235800
     ccgggtgaag aaggtaaatt cgtgttggag ttgaaaaccg tcgccgacgt cgggctggtg    235860
     ggactgccga acgcgggaaa aagcacgctc ttgcgcgctt tgtccaacgc gacgccgcgc    235920
     gtcgggtctt acgcgttcac cacgatgcaa ccacaacttg gcgcggtatc ggcaacggac    235980
     ggcgagacga tcacgctggc agacattccc ggcttgatca aaggggcaca cgaaaacaaa    236040
     gggttggggc ataatttctt gcgacacgtc gagcgatgcg aggcgttggc gtacgtggta    236100
     gatttatcga gcggcgacgg cgtcaaacct tgggatgcgt tggatatcct caagcgcgag    236160
     ttggaggagt acttaccagg actttctaaa cgccctgggt tcatcgtcgc gacgaagacg    236220
     gatttgccgc acacggcgcg gacgttgaag gcgcttcgag cgcgcacggc gcctacgccc    236280
     gtctttgctg tgtcagcggc gaatcgcgaa ggcacggacg aggttcttcg cgtgtttgag    236340
     aacgaaatca taggaaatag acgagtgtag cgatttagcg acagatgtag ataactaaca    236400
     agaactagag gtgcagtaag tttacgccga ttgccgcgtt ggacgcgcgc ttcgcgcatt    236460
     gggcgcgcgc tcctttttcg acgacgattt ccgagcgggc gcgcgcgcct tactctcacg    236520
     agtactccct tccaatggcg aaagctcagc atctcgttct cgctctgccg ccgcgttcag    236580
     cttgcgttgc cacgaaatca agtacgccgc cgtcgtcgtg acggcgacga tccacgcgat    236640
     gactacgtga cgaggccaag gagcggtgaa tttaccgcga ccgtttttca cgacgaccaa    236700
     aaattcaacg atgagcaccg cgagcgctaa ccacgcgttc gggccgagct tggcctcccc    236760
     cacgtccggg gtttcgatga agacgtaata ttcgcgaatc gcgatgttag acatggcgaa    236820
     ccacaacccg agacggtaca agcaaaagtt gtgcgacggc ggcacgtgca agacgaactt    236880
     catgaagaac aggttcaagt caaacaccaa cccacaaaac acgagaaacg cgcacttcaa    236940
     gaaccgactg ggcgatccgg tgggacgcca cgtgtagtga tcgacgctcg ccggcgtgag    237000
     cgacgtcaaa accgtcttca gcgctccgcg caccggcgaa cgcggcggct ccttcgccgc    237060
     cgccgatcga gacgacgcct tcttcccgct ccaatcgtga aatttcccac gcatgaactt    237120
     cacgagccac attcccgcac agatgcccaa caagttacaa atcatcacgt cccacaccca    237180
     catgtcccac cagcactcgt taaaattggg ttgccagtgc tcaaacgtca gctcgcacag    237240
     ctcgaacgcg attgaatacg cccacaacaa cccccaatcc ctgatcgcca ccgccttacc    237300
     gaaccatccc agcacgtgag ccacggtaaa ctcatcgaac agcgtttcgt acacgattcc    237360
     aaacgatccg cttcgatgtc ccggcgtgta cacgcggcaa tcgccgccgt agctcctcgt    237420
     cggcagcggc gtccccaagt cgtcccaaaa gaatttcagc atcttttgcg cgtccgcggg    237480
     cgtttgaaac agcagcacta tcaacgccag aaggtacatc gtgaacgccg cgtgcaccac    237540
     cttccacacc gccgcgtgcg gtcgcgtcat gtgcgtcgcc ggtccctgca gcgcgccgta    237600
     cgccaggtac gcgcccagcg cgcccgtcgc gcctcgacgg atcccgtcct ccgtcgtcca    237660
     tcgcgcgtcg ttcgcgtcgt tcgcgaacgc gtgcgtggcg accgccagcg cgaccgcgcc    237720
     gcacgcgagc atcgtgagcg tgtgcggcga gcgcgcgagt cgcgcgaccg tcgacgtgct    237780
     attctcggcc catcgcatct tcgcgcgcgc gtcgcgtcga gcgcgtcgcg cgcccggcgc    237840
     ggcgcgcggt gcgttcgcgc gcggcgcgcg gtgcgttcgc gcgcgcggtg cgcgtcgagc    237900
     gttcgcgcgc gtcggccgtc gcgcgtctcg aagtgaagat ttgtcgtcga cggtgcatcg    237960
     cgtccacgcg cgcgcgaacg cgaccgccac acgcgcgcgc gcgcgcgacg acgcgatgca    238020
     ccgcgcgcgc gacgacgcgc gcgacgacgc gcgcgacgac ggcgacgacg cgcgcgacga    238080
     cgcgcgcgac ggcgcgaacg attggatgcg agcgattgaa aatctccaac cgacgacgcc    238140
     gcgcggctgc gccgcgtgcg cggtgctggt cgcgatcgcg ctcaaggcga cgacggcgaa    238200
     cgagtcgtcg ttcgcgctcg gcgcgctcgt cgggtgcgcg ggaacgctcg cggcgcaggt    238260
     ggcggcggtg acgcgcgcgg tgcgagcgaa cgcggcggcg acggcggcgc gagaggtcgc    238320
     ggacgcggcg gcgcgggagg agttcgatcg cgggcgcgac gacgacgcga gaaacgggga    238380
     cgaggggcgg aacgcgggcg tcggggcgac gacgagcgtc ggggaggcgc cgcattcggg    238440
     atggatcgtg gtcgcgcgag cgaacgcgaa gagcgcgaag ggcgcggcgg cgagcggcga    238500
     gaagaagttt gcgcgattga cgcgcgatgg gaggttgcag ctcgcgaatg agcgcggtgg    238560
     agaggtggtg gacgtgatcg atctgtgcgg gtgcgatgtg gcgttgacga agtttccggg    238620
     attggaaaag ccgacggagt tgcgatggca caagtcgacg ccgatggtgg tgcgtcacgg    238680
     cgatcgcgcg gtgtatcgat cgatgaagac ggtgtggctg tttgcgttgt cgtcaccggc    238740
     aaaagaggcg tggttcgtgg cgctgatgac gtgcgtggag cgtttgcgcg cggagagtgg    238800
     cggcgccgaa gcggacgcgc gcgcgctcga ccgcatgcgc gtcgaggcgg atgatttcgc    238860
     aaagtttacg caagagacga agaaatacaa ggaagaatcc gcgcggcgag acgcacacgc    238920
     gcaaggcacg cactctgcgg gcgcgggtac ggctggggcg acgataaacg ctcttggatc    238980
     gaggctgcta ttcgacatgt ttcgcgacga gcgttggcaa ctcgagcaaa aggaaaagtt    239040
     ggtcaacaag atgaataacg ctccgggcac gcccaagttt gtcggtacgt ttgagatcac    239100
     gcatatcgac ttcggatcaa cggtgccgca catcattagc gctcgcgtgc cgagctttag    239160
     ctcgtcgagc gcgccctggg atggcgcctc tatgccgggg cgcggcttct cgcacgcgct    239220
     cgaactcgac gtcgagtacg ttggtcgggc gacaatgacc gtgcagacgc gcgtggattt    239280
     gtccaagtac gcgcaagaca tggagagtga ggcgaataac gtgtcgaacg cggagtccgt    239340
     cgacgaaatc gcgcggagtt tttcgagtat aaaaaaggcg gcggctcgcg aggcggcgag    239400
     agttgtcacc tcgctttctg atacacttag cgcgacgccg ttgcgcttca cgctaaccct    239460
     gaagaagtgt cagggcgtca tgcgtctgtg gattccaccg cccccgggcg atcgtttgtg    239520
     gtgggggttg atcaaggagc cggacatcga tcttgaaatc atccccgagc tcggcgccgc    239580
     ggcgatctct catgagggta tcgcctcgcg tgtctcgcaa ttccttcgca acctattcgt    239640
     tgccgacatg cactcccaac ttctgctgcc gaactgcgtc gctgagcctt ggaaggagct    239700
     tcgaccgttc gtaagcgcga tggagttgtc gctcgccgag gcggcgacgg aggagttctc    239760
     ggccttgcag ccgccttcgc cttcgccctc accaatcaac actgaacgtg aacgtccagc    239820
     tgaacgtgac cgtccagcag tatcgaacgt gacgacgcca gcgtcgactc ccagaccctc    239880
     gttcgacacc cccacgtcac caccgcccga gcaagtgatg gagagtccac ctgtgtcgcc    239940
     gaaagcgtcc gtcgcgccca tcgccgccgt gagcgcgtcg ctcccatcct cccccaccgc    240000
     caccatcacc ggtctcgcga cgacgacatc taccgagccg ccacccaaac gtccagcatc    240060
     cgaagacatc caagccaagc caacgtcgtc tttcttcgcc caggcgaaat cgttcacgca    240120
     aaagctcgaa cgttccttcg gcgacgactt caaggatttc accgccgccg tcaaagacgc    240180
     cggcgtcgcc ggcggattga agcacgtctc caagaacatc gaaaaagtta tcgcgccgac    240240
     gtcaagcaaa gatcccgcgc aaccatcctc ttcgaatgtg ttaaagaacg attagcccgt    240300
     cgccgcgctc aaaaatttga aatttcaaac cagctgtcgc aacttcacgt cgacgtcccc    240360
     acaccgcgac gctcgtcgcg cgtccgacgg acgacgacgc gaaccgcgcg caaaccctgc    240420
     gcgtgctgcg cccccggctc gtcgttcaat cgcttcgcct gcgcgctcgc cgacgccatg    240480
     gctgcggcga aacgaaaacc atccgcgagc gccgcgtcga tgaaatcctt cgacgacgac    240540
     gtgccgagcg agcgcgacgc gctgaaaacg tggaacgaca tggacgacgc cgcgctcgag    240600
     gtcgagatcg cgaaatatcg cgacgcggtg gcgcggttga aggcggagat cgtcgcgaag    240660
     gatggcgatc gcgcgatcga tggggtggac tggttcgagt acgaacgaga cgcgacgacg    240720
     acggtcgacg gcgccgatgg cggcgccgcg ggaggtgaga acgacgacga ggatgaagag    240780
     cttggaaata tcgatgacat cgatccgcgg gagtggatgg tgccgaaaca gtgcatcccg    240840
     gtgcacgcaa acgtgacgac gtacgactgg aagccgatgt acgaacacga acagttcgac    240900
     gtcatcatga tggacccgcc gtggcagttg gccacggcga atccgacgcg cggggtgagt    240960
     ttgggatact cgcaattgac ggatcagcac atcgcagact tgccgttgcc gcaattgcaa    241020
     aagaatgggt tgttgttcgt gtgggtgatc aacgcgaagt atcagtggtg cctcaatcag    241080
     tttaaaaaat ggggctacga attcgtggac gagatcgtgt gggtgaaggt gacgaaaacg    241140
     agacgactgg cgaagtcaca cggcttttat ttgcagcacg cgaaggaagt gtgcctggtc    241200
     gcccgtcgag gagacgcgcc gccgggattg aagaacagag ccatcgggag cgatatcatc    241260
     ttcgctcctc gtcgcgggca atcgcaaaag ccgacggaga tttacgagct catcgaagag    241320
     ctcgtgccga acgggcggta cttggagatt tttgcgcgta agaacaacct gcgcgactat    241380
     tgggtgtccg tcgggaacga ggtcacgggg actggtttgc ctccggacga cgtcaaggcg    241440
     ttcgaagagc gcgggcacat tccgtccgcg aaatacggcg cgtctaatcg atagtcgcgt    241500
     cttcttagct ctcattgtga ttggtgattt cctgtgtgac ttaaataact actgaaaagt    241560
     gactcagaac cgcgtcacgt cccaaagcac cccccgcgtc gtcgtcgcga gcacggtgat    241620
     aaccaacggc accacgatcg ccaccgccaa ccccacggtg agttcattcc agaacccttt    241680
     acccacgaat tgatcgccct cccaattttc cgtgtacaaa tccggccgat cttcgatcct    241740
     tttcccgttc gcgtctctcg atcgcgtcgg cgtttcgttc ttcgccttgg ctctcgcctc    241800
     gcgcgcctct tcctccgccc tctcctcctc gctcatcgcc gcggcgacca tctcctgcgt    241860
     caccgttatt tccttctcca gcacgaacgt gatctcttcc gctcgcgtcg accgtatggc    241920
     atccttcacg aacgccaagc gttccgtatc cgaaattatc caaagcttgt ccgcgtcccc    241980
     caccggcgac gtcaacgcgc gcagtctttg tcccggcacc acccccgcgc gctcgcaatc    242040
     gctctcgcgc gcgacgccag cgacgaatat cgctcgttcg ttgtcgccga cgacgagggc    242100
     atcccatttg atgcactttc gcgcttcttc cgtcgtcatc ctgatggtgt actcggtgct    242160
     ctggtccgtc gagtcgagga gttgtgcgcg gcgcgcgtga tgcgcgcggc gcgcgcgcga    242220
     cgcgagcgcg cgcgacatcg gcgcgttcgc gcgatgggcg cgcgcggagg cgagcatgac    242280
     ggcggaaaga cgcgcggcgc ggcgttgtga gggctctatc cactcggcga gcgggacgac    242340
     gaagccgagc gtcgtcgctc gattgaaaat aagctatggg ctaccgctcc gacgcgtcag    242400
     tgttttggtt tagtgttgcg gcgtgacgct cgacgtgtcg tcgtctgcgt cgtcgcttcg    242460
     ccgacttgcg cgtgtgactt atcgccgccg tgcaggaact cctcgaggac gctttccttc    242520
     ggcggacatg tcggcgcgtt gttgacggcg acgcgttcgc ccttgggcaa acgctcggcg    242580
     agttggccga gggtgagacc tatcaattcc ttcggcaccg tctgtgaggg cgcgcccagg    242640
     ttcgccgcgc tgcgcatgat gtcgtaacct aaatgttcga aatcgccgcc gtagaacgtg    242700
     ttgaagagat tcaaaagctc cggatcaaag cgcgaccagc acgagtgcaa gtcgggcttg    242760
     gggacatcct tgtgccacgc gttcgtcacg accatttcga tctttttgtg atatcgatgg    242820
     tgaatgaaac taatgatgtt ttcctccttt acggacgcgc ccccatgtcg tttagaccac    242880
     ggcgtcagcg gacactcgcc ttcctccgcg ccgaagcact cttcgattcg aaaaagattt    242940
     tcggcgcgcg acgccatgag catctgcggc gcccagtgag acaacgaggc gacgcctccg    243000
     tttatttcat cctcgcactt cttctgcgct ctcaactccc atccacccgc ttcgtagcac    243060
     gctcgaattt ttgaatcgtg cacgttgagc gtcaggtgcg cggcgaactt ttcgcaattc    243120
     ccctcgtcgt acccaacctt caggctgtcg aacaactttc tatcgtacgt cccggtccag    243180
     tacaaaaact ctgactccgc gcgttcgtac ggattcctca cgatcgccca cgactttcgc    243240
     acgtaatcct tcggaatcga gtgccaattt tcccagccgc ggtacctcgg gtgcagctcg    243300
     tacgcgcgat cctcgcgctt gatgcagtac ccttccgcga tccccgacac cccgagcgag    243360
     gtctcgatcg tcgtcccgcc cgtcttcggg atgtgcaaaa atatcggaaa tccgtggccg    243420
     gatcgtttgt cgccgatcga gcgccgcacg tccagcgcgc gcgccttttc cgcgtcggtg    243480
     tacccgaggc gcgcgcgcgt cgccgcggcg tcgctcgcgt cgcccgatcg tcccgcgatc    243540
     gcgatcgcca cgctcgcggc gccgagcagc gcgatggcgg cggcgccagc ggcgacgcgc    243600
     gaccgggacg gcgacggtga cggcgcgaag cgcgagcgaa cgtcgtcgtc gcgacgggtg    243660
     ttgacgccga tcgcgtcgac gtcgacgacg atggcgtcgt ccgcgagcgc gcgcgggggc    243720
     gagaacgcgg agatgaggcg ctcgcgttcg ttgagcgtca tggcgccgcg cgccgagggc    243780
     ggtgcgacgc ggtgggcgcg agccgaagtg aagttacgca gaccgcgtcg cggcggagct    243840
     aacgctagaa gactagaaat ctactgggaa tcaatcgtcg acggcgaacg ccgagccgcg    243900
     aagacgaatg atgaaatcgt cggtgaacgc gcaccagtcg ctccacgcgc ggagcgtggc    243960
     gaggacgtcg cgcttgaagg cgcgccgcga ggctgaggac gaagcggcct cgaggtacag    244020
     ctcgaggcgc tcgaagacgc tcggaagcgc gctgatgaag agcgcgcggt acgcttgcac    244080
     gcccttgacc ggtgcggcac agttatgaag taaatctgaa acgacgtaca ggcgtgcggt    244140
     catcgtttga cgaggggttt cgaggttgca aagcgacgtc gcgatgacgt cgacgacatc    244200
     ggcggcgcac tcggcgcgct cgacggcgaa ctccatcgca tcgcgaatgt cgtcccgtgc    244260
     gacggtgatg tgctgaagta tctcaaccag actcttgcga tccgccgtag agagcttcat    244320
     cgccgcgcgt ttcgacgatc gaccaacacg attctctagt cgcgaggctt gcgtctcgtc    244380
     caggggcggc gggatccatc gcgcaccgtc acgaatcatc acgaacggct cggttcgcca    244440
     cgtctctaac gcgtcgctct gtgcaaacgc gaacacgcgc cacgcgtagt acgcgtgggc    244500
     ttgggaacat tcgtcgaaca aaaaccgata ctcttcgttc gtagcctctc gagcctttaa    244560
     agcgcgctca aatacttcgc catcctctgc gacgtacgcc gcagttatgt ctatgcgcct    244620
     cttgagatct tcatcatctg gaatttgcac gacaacgtcc gcttcgtccg acgtatcact    244680
     cgtcgccgtc ggcgccacgc tccacggaat gtcaccaagc acttccgcgg gcgcgcgggc    244740
     caaaagttcc gccgcctcat tcgcgtgcaa cgtcgtcggc cacatcgcgt gttgtggaat    244800
     cctcatcgcc atggatatga caacatttac cgtgttgccg aaaagtagcg cgtcgtgcat    244860
     ctcgtccacc gcgcgctccg cgctcgttcg cgacatgaag cacacgtatc cgctattcga    244920
     cgtctcgcgg ctctccttac tcggccgcca aatttttacg ctcgcgatcg ggccgtaccg    244980
     ctcaaacgct cgcgccaggt caacggcggc gacgtctacg ggtagatttg tgattcgcac    245040
     gtttgagctt cgcgaggcgt ccgtcgccgt cgccggttcg acgcgctccg acgtcgacgc    245100
     cggctccgag cgcgccgacg cttccggcac caccggcgcc ttggccgcga attcctccag    245160
     catcgcatcg atcgctttga gcttcttctt cccgcgcggc gcgctcggtc cggcttcgac    245220
     gtcgttctcg gcgtcggcgc ctttgcgttt cgccgccggc gccggtccgt cgcgagcgcc    245280
     gagcgcgtac acctccccga cgccctcgtc gtcgacgccg tcgcgcgcgt ccggtcgttg    245340
     taaccctccg cgcacgaaag tcacggcgtt cgctcgtcca tcctcgtcgt cgtcgtcgcc    245400
     gtcgccgaat tcgttctgaa acgtctcgag cacggcttcg acttccgcgg cgtcgcgcgc    245460
     ggctttgcgg gcgtcgcgcg cgcgctgcag cgcgagacga ttgcccttgc gcggattgtt    245520
     cagggagaag tgcatcgcgg cgcgcgcggc gcgcgcgcgc gcgagagtga ggcgcggggg    245580
     cgacgggggc gacgccgaga aggccgagcg cgcgcgccgt cgcgatggta ttatcaacgt    245640
     cttctagatc gcttacgacg cctgtccctg gagcgcgagc gcgaggacga tgaactatgc    245700
     gagctcgatc cactggatga actcgacgaa ctacgcgacc cggaggtcga actcgacgaa    245760
     ctggagctcg agctcgacga actggagctt gaactcgacg aactcgacga gctcctagag    245820
     cgcttcggca ccgtcttggg agctgttttc aaccactcac gcatgtcctc agtaagcgca    245880
     ccaagagaga tggaggtgaa aaagttgatg ctaaaccgcg tgttgcgagg ctcgtccttg    245940
     ggcatgatgc cttggaagta ctcacgcatt tcaggatttt gcatcttttc gttgagctgc    246000
     ttcaaaccga gcgcctctgc gagttcttgg aacagaatct tgataaaaat tcgtgaactt    246060
     gacgtcgtag cttcctcggt gagttggatg tatgccagac acgtccacga catggcgtcg    246120
     gtggcgagta agtgcgcaaa gaattttgcc acgttgcgaa gcttgtttgt ctccaaacgg    246180
     tgaatcgtac tgtactgctt catgaaaact tcgtcgaaca gttgcgggta gattttgtgg    246240
     atgaaacaaa accgttgcgc gagcaaaccg tagtaccgca agtaggtgcg ctcctgcgac    246300
     gcacattcaa cgagcatcgt gcacaactct acttcggcgc ccggcggaat gttgagcttc    246360
     atcaatttat gcccagcttc ttcgaaatct aacgaagaca tgatggtgag ataaatcgtc    246420
     cttcggaggt ttacgagatt tgtctccgtg agatccgcga tttcgacctt gccatcgcct    246480
     cggctcgcca caatggcgcc cgcgccctcg tcgtcgctcg acgaagaact cgacgacgaa    246540
     ccactgtcgc tgtcgctgtc gctatcgctc gagctcgagc tcgattcacc gagaatttcc    246600
     ttgcgaatgt ctgcatatcg acgctcgttt tcctcaaact cgggatcttc tttgaacaca    246660
     tccaaaccag gctgcgcttg catctcgtcg tccaagccga tttcgtgcac gatttggtcg    246720
     tcctcgtcga ccaaatctag ctcgggagag accccctttt tcccctcgaa tccacctttt    246780
     cgaaacgcga acaacccttc gatcataaac tgaacgcgct tgtcgatctc accttcgtgt    246840
     aaaattcctc taaatcgctc aaagatgccg tgcaaacctt gcggcgtgag ctcttggagc    246900
     gtgaagccgc actccttgac aaaatcaatc gcaacctcta cgctgtcgtc cgtgggagtg    246960
     cctagcaaca cagtcaataa ctctagtgct atcaactcgt gaatgatctg tcgagaaaaa    247020
     aggtaaacgg tcaatcaccc gcgctggaga agcgccccgt cgcgtcggcg accgcgtcgg    247080
     cggcggcgtg acatcagtgt taaaaagctc gatatgattt tgatcctcac gggaatcagt    247140
     gagtgttgcg tgatcataat tcatcctctg tcacatcgcg cgcaccgcgt cgcatcgcgt    247200
     cgtccatcga gcatcgtacc tgttgattaa tcagcgccgc caaaaacctc gtcgccgcca    247260
     cgcacaccgg cttatcgttc ctcttatacg cccgtctaaa ctgcaaaacg catctcttcg    247320
     cgatcaactc gccgatttca ggaaacttcg tgttcaccac cgccaccagc gcggcgaaca    247380
     caccactaaa ctgcggcgac gccatctgag acttcatcac gctcctcgcg aacaatcccc    247440
     gcccgcgtat caaattctcc tgaaacagct ccggcaccac gtgttgcacg ttcgacgcgt    247500
     tcaccttatt caccaatcca ttgatcgatt tcttcagcgc gtcccacgac atgcgttgat    247560
     actcgacgct cgtcttatcg ttcgtctcgc gcatcatctg cgccagcttg aacggcggca    247620
     cgtacgcgcc ccccgtcctc gtccctctcg ccgccgtccc gcggctcgcg ctcggcgccg    247680
     tcgccgtcgc cctcgcgcgc gcgtccgcat cgttcgcgtc cggcgcgatc tctcctcgtt    247740
     cgagcgtcgc gccgtcgtcg ccgtcggcgt tcgcgccgtc cgaggatcgc cgccgccgcg    247800
     cgcgattcgt cgtcgcctcg ccgcgcgccg cgtcgccgcg cgtcgcgcgc ggcgagccgt    247860
     cgcggcgcgc gtcgccgtcg ccgtcgtcgt cgtcgcgacc gcgcgagcgc gagcggcttc    247920
     gcgtgcgcat cgcgcgcgcg tcgacgagtg gcgacgcttt accgcgacgc gcgcgtcgtc    247980
     gcgatgcgac gcgtcgccgt cgcgcgcgcc gcgttttccg gcgccgcgcg cggacgcgga    248040
     cgaccgagcg cgcgcgcgcg cgcggacgcg cggcgcgacg ggcgcggacg cgcgcgcgga    248100
     cgcgacgtcg cgcgcgcgtc gacgacgggg acgacgcgcg aggacgacgc gcgcgacgac    248160
     gcgcgcgacg acgcgcgggc ggcgtacgac gcgacgtacg aggggctcga tcgcgacgcg    248220
     ggactggcga tcgccgagcg cgcggaccgc gggaagacgc gagaggacga gtggttctac    248280
     ggcgagttgg agttcgcggc ggcgcgagac gcgctgcgaa gagtgtgccc gaacgcggga    248340
     gaagggcgag agttcgtcga tttgggaagc ggactcggga aaatggtgat cgtggcggcg    248400
     ctgagcgggc tgtttgaacg cgcgcgaggg gtggagttgt tgacggagct gcacgaggcg    248460
     gcgacgagcg cgagagcggc gttcgacgac gcgttggcgc gaggggatgg tgaagtgatc    248520
     gaaggcgcgc gcgcgtgcga ggtgacgctg gatgagggcg atttgctgaa ttacgacgtg    248580
     tcgagcgcgg acgtggtgta cattcacgcg acttgtttca cgccgcagtt gctgagcgcg    248640
     ttggcgttga agttggcgag cgagttgaaa acgggcgcgc gggtgatgat catgagtaaa    248700
     caattcccgg aaggttgggt gttcaaacca ttcgacggcg gttacgccgc gttggctcaa    248760
     ccgcagagca aatggaagct cgattgcttt ttgtacgaaa tatcgaggtg agagcccgct    248820
     cgtcgagcgc cggctcgctc gaggtgtaaa ttacaattat aatacttctt cacgaactcg    248880
     atgagctcga actcgaatcg tccctgcgag agcgtttctt ttccctcttc ttgcgcttct    248940
     tgcgctcctt cttgcgctcc ttcttccgct ttcgctctcg acggcttcgc gcgtctacgc    249000
     cgtcgtcgtc gtcgccgagc tccatctcgt acgtcttcgt cgccccgtgc gatctcgaca    249060
     gcgcgtcgag cccgcgcgcg ggattcaaca cgcgcgcgcg taaactatcc aaatcctccg    249120
     tcgtcgcgcg cgcgccgacg ttcgcgccgc tccgcgcgcg ctcgagcctt cgcgcctttt    249180
     cctcgaccgc cgccttgtac gccttcgccg cgccgtcgtt cggatcaatc ttcaacgccc    249240
     gatcgaaatc ccgaatcgcc tcggcgtaca tccttcgatt cgcataacac gcccctcgcg    249300
     cggcgtacgc cctgacgtgc tctggatcga gttccagcgc ctgcgcgaag caccgctccg    249360
     cctcctccca tcgctccgcc ttcgtcgcca gcgcgccccg cagcgcgctc tccttcgccc    249420
     acccccatcg caccctcgcc cgcgcgcgct ccatgatctt cgccctcgcc atctcatctc    249480
     gcacccgttc cgcgcttcgc gcgtccggga tcgcgacgcg cgtcaccgcc cgcgccgcgc    249540
     cgtgcgcgtc gcacagcgtt cgcgccgcgc cgccgacgcc gaaccctctc gacgcgcgcg    249600
     cgtccgcgac gaacgtcgac gcctcgccga ggcgcgccgc ctcggcgtac gcttcgaacg    249660
     ttttcgcgtc gccgtgcgcg tgcgcgcgcg ccgcgcgtcg tcgcgcgcgc gtcgcgtcgt    249720
     cctcgtcctc gtcgtcctcg tcgcgcggca tcgtcctcgc cgtcgcgtcg cgcgcgcgcc    249780
     gcgacgccgt cgcgcgcgcc gaccgggtcg gcgccgtcgc gtcgccgcgg ccgtcaccgt    249840
     cgccgcgcgc gcgcgcgtgt gcggcgcggc gccgtcggcc gacgccagac ggcgacgcgg    249900
     cgacatcatg cccggcgcgc gcgacggcgg cgccgaggcc gcggcgcggt accgacagta    249960
     cgagtacaag gcggtgcgtg acgacgacga cgcgcgcgcg cgacgaccga ccgacgcgac    250020
     gcgcgcgacg accgcgcgac gaccgagggc gcggcgatcg aggacggcgg cggcgggcga    250080
     acgaatgcgc gacgaaatcg acgtcgccga gcgcggacgc ggcgatgaaa cgcgcggtga    250140
     ccgaagcgaa cgcgcgcgat gtaaacgcgg cgcgacgcgc gagcgcggac tgacgaagag    250200
     gcacgcgcgc gcgacagaac gcgtcgttgg tgctggagag cgatcgacgc gggcgaccgc    250260
     ggggcgaacc cacgggcgcg ccggagtcgc tcgagggaaa gatcgacgcg tcgcggttcg    250320
     gagatcgagc gcgaggcggg acggacggtg atttcgcgga aaaacgggag cgagcggcga    250380
     gacgaagggc ggaaaaacga gcgagagggg acgcggggga ggcggaggcg ttcgggaagc    250440
     gcggccgagc gacgaagggg gcgagcgttc tgggagggag tgagtatggg ttgtataaac    250500
     cgaagacgcg ggaaacgcgg gcggcgtacg aggggttgtt gagcgtgttg cagggagtgt    250560
     tcggagatca accgcaggac gtcatgcgcg gcgcggcgga tgaggttttg gcggcgctga    250620
     aggaggaggg gaagacggaa cgcgcgaaac aaaaggacgt cgaggcgttg atggggactt    250680
     taacttcgga gagattcgcg caaattaccg ccatcgggaa gctgatcacg gatttctcta    250740
     ttccaggtga aggtggcgaa ggcgcgggcg aggagttgga cgacgacatc ggcgtcgccg    250800
     tggagtttga agaggaagaa gaggaagact cggacgtgga cgaggtgtta gaggcgtccg    250860
     acgtagacga cgacgacgaa ggcgacgaag gcgcgtacga cggcgccgtg ggcgcgagag    250920
     cagtcgagga tgagtacacg ccgaacgcgg accacgggtt gaatccggcg gacatcgacg    250980
     cgcactggtt gcagcgcgcc atctcgaaag cgttcgggtt tacggactct gacgccgcgg    251040
     agagcttgaa gctgtccgaa gacgtatatc aggtgttgtc caccgaagat gaccgcgagt    251100
     gcgaaaatgc gctcgtgtca atgctcgatt acgacaagtt tgatttgatc aaagtgctgt    251160
     tgaagaaccg actcaaggtg ttttggtgca caagactcgc tcgatccgcg agcgaggaag    251220
     aaaccgcgaa catcgaggcg caaatgaaag ccgatccggc cgctgctggg attttagcgt    251280
     ccatgcgcgc gacgcgcgcg tccgcacgcg atcgacagac ggcgacggag caaaagattc    251340
     gcgaagaggc tcgcaagctt cgcggcgaag tcgcggagat gcgaactcaa ggcggcgccg    251400
     ctgcggctgg acgtcagctt ttggagctcg acgcgcttgc cttcgtgcaa ggttcgcatt    251460
     ttatgagcaa caagcgatgc gagcttccgc ccggttcgtt tagaagcgcc aaaaagggtt    251520
     acgaagaagt acacataccg gcgctcaaac agccaccgtt caacgacgac gaagcgctcc    251580
     gtgcgattga agaaatgcca gagtgggcgc aacctgcgtt tgagggcatg aagacgttga    251640
     atcgcattca gagtcgcgtg tacgaatgcg cattgctttc gccagagaac atgcttctct    251700
     gcgcgccgac gggcgcgggt aagacgaact gtgcgatgtt gactatttta catgaagttg    251760
     gtcttcaccg tcgtcgtgac gggagcgtcg atacgtctgc gtttaagatc gtgtatgttg    251820
     cgccgatgaa agctctcgtc gcagaaattg tgggcaactt gagtaatcgt ttgaagacct    251880
     ttgggatcca agtgcgagaa ttgacgggcg acgtttcgct gagtaaggct gaaattgaag    251940
     ccacgcaaat catcgttacc acgccagaaa aatgggatat tatcactcga aagtctggtg    252000
     atcgcgtgta cacgcagctc gtcaagctta tcatcatcga tgaagtccat ctcttgcacg    252060
     acgaccgcgg tcccgtgctc gaatccatca tcgcgagaac ggtgcgacaa gttgagacga    252120
     cgcaagaaat ggtccgttta gtcggtcttt ctgcaacgct gccaaacttc gaggacgttg    252180
     cgacgtttat gcgagtaaac cctgagaagg ggttgcacgt ttttgacaac tcgtaccgcc    252240
     cgtgtccttt gcagcagcaa tacatcggcg tcacggtgaa gaagccgttg cagcgaatgc    252300
     aactcatgaa tgaaatttgc tacgaaaagg tgatggaaag tgcgggcaag agtcaagtac    252360
     tcgtattcgt acacagtcgt aaggatacgg cgaaaaccgc gaaagctctt agagatttgg    252420
     cgatggagaa cgagactcta ggaaagttga tgcgtgacga ttcggcgagt cgtgaaattt    252480
     tactcaccga agccgagacg gtgaagagct ccgagctgcg tgatttgctc ccgtacgggt    252540
     tcgccataca ccacgccggt atgagtcgcg ctgatcgtac attagtagag gagctcttcg    252600
     gcgacggtca cgtgcaagtg ctcgtctcca cggcgacgct cgcgtggggg gtcaacctgc    252660
     ccgcgcacac cgtgatcatc aagggcacgc aagtgtacaa ccccgaaaag ggtggttggg    252720
     acgagcttag tttccaagac gtcatgcaaa tgatgggtcg tgcgggtcgg ccgcagtttg    252780
     acacgttcgg cgaaggtatc atcatcacgc aacactccga gttgcagtac tacctgtcgc    252840
     tgttcaacca acagctcccc atcgaatctc aattcgtcaa gcagctcgcc gacgctttga    252900
     acgccgaaat tattctcggt acgattcaaa acgttcgtga cgcggtgatt tggttagggt    252960
     acacgtattt gtttgttcgc atgttgcgaa acccaacgtt gtatggcgtg tcggtggatg    253020
     ctgtcgagga cgaccccgtg ctcgaacagc gaaggtcaga tttgattcat actgctgcgg    253080
     cgcaactaga taagagtggc cttattcgct acgataggcg aagcggtgca ttacaaggca    253140
     ctgacttagg tagaattgct tcaacgtact acgtctctca tggcacgctc atggcattca    253200
     atcaacactt gaagcctacg atgggcgaca tcgagctgtg tcgtctattc tctctcgccg    253260
     aggagttcaa gtatattagt gtgcgggagg aagaaaagat ggagctgtca aagctcgctg    253320
     agcgagtgcc aattccagtg aaagagtcga tcgaggaacc gacggcgaag ataaacattc    253380
     ttctccaggc gtacatcagt aacatgcgcc tcgatgggtt tgcgctcatg tccgacatgg    253440
     tttacgtgac gcagagcgca ggtcgcatct tgcgttgtat tttcgaaatc gtactcaaga    253500
     agggttggtc gcaactcgct gagaagtcat tggcgctgtg taagatgtgt gctcgcagaa    253560
     cgtgggcttc acaaacgccg ctgcgtcagt tctccgctat acctgtggac gtcttgcaaa    253620
     agattgaacg aaaagattta gcgtgggata ggtattacga cttaagtagt caagaaattg    253680
     gcgagcttat gcgagcgcca aagctcagta aggctttgca tagattcatt catcaggttc    253740
     ctcgattaga gctctcggcg cacgtgcagc cgatcacgcg aagcgtgctc aaggtggatt    253800
     tgaacatcca accggacttc atttgggacg aatctgtaca tgggtacgtc cagggcttct    253860
     ggatcattgt ggaagataac gatggcgaaa atatcttaca tcacgagtac ttcttactca    253920
     aggggcataa cgcggaagaa gagcacggag tgtcattcac ggtgcctttg tccgatccac    253980
     tgccaccgca gtatttcatt cgcgtcgtca gcgacaattg gttgggaagc gacacggtga    254040
     ttccggtttc gttcaagcac ttgatgttac ccgagaagaa tccaccgcca acggagcttc    254100
     tggacttgca gcccttactc gtgagcactc tcaaagcaga tggctacgac gagctttacg    254160
     ccggtcggtt cacgcacttt aacccgattc aaacccaagt cttccaatgc ctgtacaaca    254220
     cagatgaaaa cgccctcgtt ggtgcaccga cggggagcgg gaagacggta tgcgcggagt    254280
     ttgcgatcat gcgatcactt atgacgaatc aggatggacg ttccgtgtac atggcgccga    254340
     cggcgacgct tgctgatgaa cgatacgacg actggagctc gagatttggg gcgcttggcg    254400
     tctccgtcac caagctcacg ggtgatacga cggcggatct gaaattgtta gaaaagggac    254460
     aaatcgtcat caccacaccg caacagtggg acgtcataag tcgtcgatgg aaacagcgaa    254520
     agaacgtaca aacggtgtcg ctgtttattg cggatgaact tcagctcata ggcggttcca    254580
     acggtccgac gatcgaagtc gtcgtctcgc gtatgcgtta catgtcgagt caactggcga    254640
     aacctgtcag agtgttgggt ttgtgtacct cgttagcaaa cgctcgcgac ttgggcgaat    254700
     ggatcggtgc gagttctcac ggcacgttca acttttctcc gggcgttcgc ccagtgccac    254760
     tcgagatcca cttccaaggc gtagatatca tcaactttga ggcgcgaatg caggccatgg    254820
     cgagaccagt gtatggggcg attgcgaatc attgtcgtcg atcggagccg tcgattgtct    254880
     tcgtgcctac gcgtaagcac gcgaagttgg cgtctctcga cttgctcgcg tttgccgctg    254940
     cggagggcga gccgggtcgg ttcttacaag ttgaagaagg tgatctcgag ccttacttgg    255000
     cgcaaatatc tgatgagtct gtacgccatg ccctgacgtt tggcgtcgcg cttattcacg    255060
     aagccatgag cgaaaaggag cgaaaggttg tcgaacgagt gttcgccgtc ggtgcggcgt    255120
     ctgtgctcgt cgccactgcg cccctggctt ggggactcac gactccctgc aagctcgtgg    255180
     tcatcatggg gacgcagtac tacgacgccg ggggtgctgg tgcggcggat tatccagtga    255240
     cggatcttct tcaaatgatg ggccgtgcat ccagacctgg catcgacgat gccggtgtgt    255300
     gtttactctt gtgtcacgcg ccgaggaagg aatactacaa gaagttcctc ttcgaaccgt    255360
     tccctgtcga gtcgcacctc gatcacttct tgcacgatcc catggtggct gaaattgtca    255420
     cgcgcacgat cgaaacgaag caagacgccg tggactacat cacgtggagc ttctactaca    255480
     ggcgactgac gcagaacccg aactactaca atctcaccgg cgtttcgcac cgccatcttt    255540
     ccgacgctct ttccgagctc gtcgaaacga ctttgggtga cttggaggcg agcaaatgta    255600
     tcagcatcga ggacgatatg gattgcgctc cactgaacct cgggatgatt tccgcgtact    255660
     actacatcac gtacacgacg attgaactct tcgccgcttc gctcacggcg aagaccaaac    255720
     tgaagggttt acttgaaatc gttgccggtg cgactgaatt cgagtccttt gccgtcagac    255780
     cgggcgaggc agatatgctt cgacgcatac tcaaccacgc gccgatcacg ttatcaagca    255840
     ataaaaccac ggatccgcat gtcaaggtcg ccgctcttct ccaggcatac tttggccgaa    255900
     cgagcattca cggcgacttt acgcaagact tgcaaaagat tttgcccgac gcaacgcgcc    255960
     tgctccaagc tatggtcgat gtcatctcat ctaacggatg gctcggcccc gcgctcgccg    256020
     cgatggagct ttcgcaaatg atggtgcaag gcatgtggga caaagaccca gcagtgatgc    256080
     agttgccgca catcgaccaa gagaccggcg agcgatgtgt cacggctggc atcgagggtg    256140
     tctacgactt gatcgatatg gaagatgacg cgaggcgcga tattttacaa ctcagcgatg    256200
     agcagctcga agacgtggcg gaagcagcga atcgttaccc gagcattgaa gtagcattcg    256260
     acgtcactga ccccgacgac gtcaccgcgg gcgacgcagt ggagatcgtc gtcaacctcg    256320
     agcgcgagat cgagggcgaa atcggtccag tttttgcgcc gcgatatcca gggcgaaagg    256380
     aagaagcttg gtggctcgtc gtcggtgacg tgagaaaagg caccttgcac gctattaagc    256440
     gcatcacgct cggcaagagg caaaaagtca agctcgagtt cgcggcgccg gaacaagtgg    256500
     gcaaggcgga cttgactttg tactttatgt gcgattccta cctcggatgt gatcaggagt    256560
     acgaatttac cctcgacgtc aaggagggag aggacgagag cgatgacgac gcgatgaaac    256620
     cgtgatggaa acactgaaaa aaatactgtc gagcagcgcc gtgctagcgg acgcaccaaa    256680
     agttgtcaac acatgcaaaa ctttagtcat tactgttctc actacgacta cgctacgacg    256740
     ctaataatac aacacacgga gcaattaaac gagcaccgga cgcaggagcg cgccgagccg    256800
     aacggaagca atgtgggtcg ccgaggcgac gccgcgtgaa cgcgcggcgc ggttcgacgg    256860
     cgattgagcg cgcgcaacga cggatacgcc gcaggttcgc gcgcgatctc cacgggcgcg    256920
     catagccgga cgccgtgcat cgatgccaac tctcatcgat cgtcgtgggt cgaagcacga    256980
     ggcgatgacg ccactagcgc gttttgtggc gccgcccgcg ctgcggtccg cgcggcgcac    257040
     caaggcgccg aatccgagcg tcgccgcgcc gaacgcggcg agattcggcg ctaacgccac    257100
     gggattggcg aacgacacgt gcgcgaggac ggcgatcatc gcgccagaca ctagatttgc    257160
     gtagttaacc aacgtcgccg cgaacgggac gttcaacgcg aattccatcg cgtacgtgac    257220
     ggtgagcaaa ggcaacggcg acagcatcgc catcaacgcc accgctgacc cgatcgaacc    257280
     cagcgtgccg cccatggtgt ataaaactgc gctcgcgcac agcatggaag ccccgtaacg    257340
     gcgcgctaac gcgcacacca tgtcccgcgc ttcatccctc gccatgttcg gctggaacaa    257400
     aatcccgagc gcgagcaaag ccgcgggctt gttcgcgccg gccaaaaacg ccaaaaaccc    257460
     atcaatcgct ggcggaaatc ctccgtcgcc ccacaccgcg cgataacaca gcgttacgaa    257520
     acacgccaac agacacggat tcctcgcttg cttgaccatc gaacgtcgca tcgattccag    257580
     aatcttcgtc gtcgatccgt cctttgccgc ctcgcccgcg ccgtccacgt cgattttcga    257640
     gcatctccac gtgtatatcg cgtgcgccac gatcaacaaa aacacttgat tcgtcgcgtc    257700
     gaacacgacg atcagttcca gcgccttcgc tccgtacaat atctccgcca acgggtacgc    257760
     aaagttcccc agattcaacc cgaccgccgc gccgctcacc aacgcctcgc gcgaccgtcg    257820
     cgacatctcg atcaacgcgt ctcccgacga ccgcgcgttc gcgccccgca tcgcgcgcgt    257880
     cgtcgtcagc gacaccagca cgcacgcgca tccgaacgcg catcccgcga gcgcgacgca    257940
     ccgcgcgctc gcatccattc gcgccgtcgc gaacgtccgc gccatgacgg ccggaagcgt    258000
     cgagctgaat atgatcacgc acagcgaccg tccgtcgcgc tcggtgacgt agcccaggtg    258060
     ccgcagcgcc gcgccgaacg cgaccgcgct cgcggcgacc gcgagcgaca tgccgcgccg    258120
     ccgtcgcgcg tcggcgtgtg cgaggcgttc gcaccgcaga acgcgacgcc gcggcgcgcg    258180
     cgacgacgat cgacgccgcg cgcgagagag agagacgccg cgggggcgtc gtcgcgcgcg    258240
     agagcgaccg cgcgcgcgat cggcggcgcg cgcgcgacgt cgcgggcgat cgagggcgcc    258300
     aacactataa aacgtcatgg agaacgcggc gctgcgcgat gcgcgcgcgg tgacgcacgg    258360
     agcggcgtcg gcgagcgcgg acgttgaaat cggtgatgat ggatgcgcga tcgcgggcgg    258420
     gcgcgcgcga gagacgcgcg cgggaggacg cggggggtgg ttgacggccg gcgcgtgcgc    258480
     ggcggcgtgc gggctgggcg tcgcgctcgc gatggcggga tcgcgaaatg gtgacgagac    258540
     gggcggacgc ggcgtgatcg cgcgcgagga catcgatgtg cgacgtttcg tggcggtgcc    258600
     gatgctcgga tcgaagaggg gacgccgggg gacgtcgtcg aagcgcggcg acgacgacga    258660
     cgacgcgccg gggctcggga tcgatggtga cgacgacgtc ccgccgttcg cggcgaatac    258720
     gggatatttt gcctacgagg aatggttcaa aaaattcacg catgggaaga gccctgggga    258780
     aagtaagcgc gaactcgcgg gcgcggcggc ggcgacgccg attcaagaga gcgcgcatcg    258840
     cggcgtcgtc gattcggatg gttggaagac gattcgagac gatttgaggc acgctggcgg    258900
     taaacgtaag ttattgctac ttctgcgcca cggccaggcg acgcataacg cgtggggtga    258960
     tactgtcgac gaagagttgg agacgctgcc gtgcacgtgg cgagaccatg gtgacttact    259020
     cgatccgtcg ctcacggatc gcggcgtaga gcaagctttg acgacgcgtg cctcgctcac    259080
     gacgagagat gggttcttta aggcgattcg aggcggctca gacaaaaagg atagaattcg    259140
     cgtggcttcg tcgccgctct cacgagcgat ggaaaccgcc atcatcgtca cgtctggcgt    259200
     cgatcacatc tcgcgtccga ttgctgtcac ggactacttg cgcgagcgca tcgaactcaa    259260
     cgccccgttt gaagttcgcc gaccgatctc catagacgag ggcgaagact cggacgcgtc    259320
     gaagttgatc aagaattccc acgcgcacgg atgcaaattc cacaaaggtt tgcgcgagct    259380
     ctacggcgac gacgcattca tgctcaacgt agagacgcat cacaagcatc actcggattg    259440
     tagggtcgac aagacgactc cgctgtcgta cacgcactgc ggcggcctca cgctcacgca    259500
     cgaggccgat ttggagttgg gtgacgagag ggaggagaac atcatcgcaa tgatgaatcg    259560
     cgtgaaagtc gtcctcgcca acgtcttcga caggtacgac gaagaagtgg tcatgctcgt    259620
     cacgcattcc gactttatca tttcggcgtt gatggagtta tatcccgaca cgctcggttt    259680
     tgtaccacaa aacggcgaag tggtacccat cgtcgtcgag gaccgccgaa cgaatcattt    259740
     gcctgaggcg cacgccacgg acgatgacgc gagtgaaacg gcgtcgaaag ccaagacaaa    259800
     atcaaaggct gcggtcggtg aggcggatca caacaggaag cacgccaaaa gcgaagacga    259860
     agaaacagaa gatcgcacgg cgcgtgggaa gaagtcgatg cgagcgaagg cttcgacggg    259920
     cgacgaaatc gtcgtagatt cagattcttc cggtccggcg gcgacgatca aatacttcga    259980
     tgacgacgat cagacggcga aagaatccgc cacgcggcac aaatctagaa agcgtgaagc    260040
     ttctctcggg aatgatttgt cccgtcgcgt cgaggaatcg ctaaaaaatt tccacaaaca    260100
     atttgagcgc tctgcggacc tcggtagtga atagaatcta acaatctaca gtagcgttac    260160
     aagtgcgtgt aatcacgact agtcatgacg ttctcttgat tccaactgcg cctgcaccaa    260220
     cgctcgcata tcgtccaaca cgcgtcgctc ctttgccgcg cgttcctcct tgctcaacgc    260280
     cgccagcgcc gccttttcct cagccgagta cacctgcgct tccttccgca tccgtaccgc    260340
     gttcatcctc gagtgccggc ttcccgacat cacgtatcct aagttttcga accgttcaat    260400
     ctgatccgtc tttaatccaa tctctcctcg tcgcgggatg cgttcgcccg ccgccgcgaa    260460
     tcgtcccatg gcttcgcctt cgccggcgag caaatgtttc ccgtgattga tcgcgtcgcg    260520
     atcgacttcg aacgactcgg gagggggagg gggtccgata agtgcctccc cggcgtcgag    260580
     cgcttcgcgt tcggcgcgct cggcggcgcg tcggacggat tccagtcgct cgtgtcgctt    260640
     tttgagaaat tgcttaaacc tgtgcgtttg gtcgccgtct gcggcgtcgc gcgagcgact    260700
     gcgcgagcgc gaagacgacg acgacgtcga ggcgtcgcgt ttcgagcgtt tcgaacgctc    260760
     gtcggcgcga ccgcgggggt cgggagacgg catgcgcgca ggactaggtc tgagggacga    260820
     gcgaagcgac gcgcggcgtg ttgcgcgtgc gagtgtgtgt gaatgtgaga tagaaataca    260880
     cgcgttgata tcactcgacg ctacttgtcc ggagcgcttg tggcgcttaa gctcgaggtt    260940
     gagcccttac gcgcggcgcg tagcgccttt tctatgtcca cttgctccct gtagacttcg    261000
     cgcaaatcgc ccaggacgtc tttgaacgcg ctgcggcgtt cgggttgggt ggcccacgcg    261060
     ccgtggatga tcttgcggta accctcgggc gcgctcgctg ggagttcaag gttttttgcg    261120
     gtcgccgcga gcgaggcgtc gagatcggag gtcatttgga acacgatttg gtactcgttc    261180
     aagtcttccc acgggatgcg ccgagtgagg agttcccaga ggatgacgcc gtacgcgaag    261240
     acatctgaag cttcgctgaa tttaccgcca cgtatcactt cgggagaggc atagttcacc    261300
     gtgcctgtca tacccgtctg acgcgaaagc cgtgaactgt gcttcacttt gctcaaacca    261360
     aagtcggtga tttttaccat gccatcgcga ttgacgagaa cgttgttcgt gttcaggtca    261420
     cagtgcacga ttgggaacgg tttggcggag tgcaagtaaa ccattccttg cgcgatcgtc    261480
     atcgcccatc gcgtgagcgt gagcgtggtg tacggcgtag tcgttcgatg gagaaattgg    261540
     tgaagcgatc ccttatccat gtactcgaga acgatggtca aattcggcgc ttgcgtgcac    261600
     gcgccgagcc acaagacgat ggacgggtgc ctcagtcgcg acaatatctg cacctcgcga    261660
     cggaaatcgc tcaacccttt acccatcata tcttgattga atagcttttt caccgccacg    261720
     agactgccgt gataccgacc gaggaagacc tcgccgaaac cgccgtgacc gattcgattt    261780
     tgcgacgacg gcacgcctcc ttcaaactcg atatccttgt aatcaatctc ccactcggtg    261840
     ttaagctcca tgactcgatc accctcgacc ggttcgtctt cgggtaaaat tgaacgcgaa    261900
     agatccgaaa gcggcgtcgg cgaaaacgaa cgcgcgccga cgttcagtct gctcggcgac    261960
     ggcgtcgaga ggcccggatc cgaaggcggc gtgcgatacg gcgatacgct ctgcgttcgc    262020
     gataagcgtc ctgcgggcga attttcccca ggcattttcg caggcgtcga acgaggtcgc    262080
     tcgtactcgg tgtgttcgtc atccatgttc aacgctgcga actcctcgaa agccttcact    262140
     tctaagtaca gctgcatgag ttgctcgccg agctttgtca aatcgcacgt gctcggaaac    262200
     agtttcctac gcggatccca ccccggagtc gactctaaaa tgtccaacac gcgctcctcg    262260
     agcgcgtcct cacagcttct cgacgcctgc agcgtcgcct cgcaataaac gctgagctgt    262320
     ggaccaggtt cgtcgtactc ggccgccttg acttcgtcca agacgtgcat gaaccatcct    262380
     atcaaaacgc tcgcgcgggc tttttcagaa atgaactcga tccacgacac gtcgagctcg    262440
     agctcgagcg ggctcagtcc accgcgtggc gcgcctaaag gtttgctcaa aggcggcgtg    262500
     acgcccgtct tctcgtccgc gttccccttt tcggcgtccg cggcgccggc gctcgcgcgc    262560
     aaaatgttaa tcgcgcgaat cactcgcacg cgttctaaat ttcgctccaa gtgcagcgat    262620
     tgcttcaagt ctgcctcggt caaccgcaac agctcgtatc cattcacttt agcgctcgcg    262680
     aacgcgtcca ctaactcctc gagttctgag ctcttcaacc actcgctcac gtcgccgatg    262740
     ctccacgcgt ccacgccccg cgactgactc tcctctaaaa gtgacgattg cgacgcattc    262800
     ctcgacggcg acttcggcgt cgccgaattc ccaccatctc gcgtccccac cttccccagc    262860
     gcccgcgcca gcgccttcgt cttcacctca accgtaaacg tccgactaaa ctccgcgcgc    262920
     tcgttcgaca gttccaccgc gtgcaactcc cgcaccggtc tcacccccag caccctatcg    262980
     aacgtcaccg tcacctccac gtcgcacgac gtcttcaccc ctcgcaattc gcattcaaac    263040
     ggcgcctcgt ccacccgcct ctctccgtgt ccgccgccga acacgaacag cgcgctcttc    263100
     atcgtcccgc gcccgcccct cgcgaagcac gtcacgtcgt acgttccctc ccccgacgct    263160
     cgcgccgcgt tcccgatcgc gcactccagc gcatccgtcg tctcaccgtc gtccgcgtcg    263220
     tcgctgtcgc tctccgcgcg tcgtcgcgcc aggcgcgcgc cgagcagccc cgacgtgcgg    263280
     ttgacttgcg tctccttgaa aaactcgccg agcgtcagcg tgcgcgcgtt cgcgcgctgt    263340
     ttcgagcgtc ccatggcgac gacgcgcgtc gcgcgcctcg accctcgccc cggccctcgc    263400
     gcgccgccgg cgcgacgcga actcgcgcgc gcggcgacga atgcgtcgag ttcgagtcgc    263460
     gccgaataaa cggacacacg gcgtatgggc aaacagtgag acaccgagcg cgccgttggt    263520
     gtcccgcaca cgcgggtgtg tcgcgccgcg ccgccccgcg cgcgccgccg cgcgccaccg    263580
     cgcggcgcgc gcgactcgac gcgcgcgatg gcgcccgcgc ggcgcggaag cttcgaccgc    263640
     ggcgatgccg acgcgcgcgg acgcgaaacc gacagcgacg acggcgacga gcggcgacat    263700
     cacacgctga cgctcgcgca gggacgcgcg ctgcggcgcg agctgagccg acacacgctg    263760
     cacgcgctgg gcggcgagcg cgtgtgcgag gagagctcgc cggagaccac gcttgggtcc    263820
     acgcaggcgg aggcgctggg acgcgcgttc ctggcgtcga cggaaagggc gaacgatggg    263880
     gaggcgacgg aggcggaacg ggcggcggcg cgcgtcgagc tggaaaacgt cgaacgcgaa    263940
     cgaaggtcga cggaaagacg gtcgagcaga cattcgatcg acgcgccggc gcgaaaggtg    264000
     aagtttgatg cggtgccgga gatgattccg agggtggcgt cgggcgacga cgtgaaaatg    264060
     gtgaacgcgg cgaacgcggg gacgggggcg acgacgctga gcgcgtcgac ggggaaagaa    264120
     ctcgcggcgg aattgaagaa gacgcgatcg aagatggacg aaataaaagc cagcgtgtcg    264180
     aagaagtcgt cgtcgtataa agcggcggac gtcacgggcg acgaaaacgt gctcgagggg    264240
     aaggaggaga agacgcgtcg cgccatcaaa gcgattcaac gacagacgga cgcgctgatg    264300
     ttcctcgcgg acgccgtcga ggctaaagac ttgcctggtc tcgctgagag aatgcgcgaa    264360
     cgtctgcgaa cgatgaaaga aaactatcac gacatcacgt cttacgaagg tttgcgtcag    264420
     cgtaaaaaag gggcgctcaa ggcggcaaaa aagatggatt tgttgcgcgc cgcgttcaac    264480
     gtcgacgagg cgccgaagga cgcgtgcccg atgccgacac acaagagcga taagccgctg    264540
     aagagaaaac gagagtatcg tattttgggg acgaaaatgc tgtgcgcggg tgtgtgtttt    264600
     ctcgtgcttc tgatgattcc gttcttagtg acgcagtacg aagaacacga gcaccacacc    264660
     ggttgcgatt cgataagcca gggtatgatt aagctcgacc acgcgagctc gggacaactc    264720
     gaagtgaact tgttggttgg tccgtgcacg tacaacgcga gtgattttca tatgtcttac    264780
     aacatctatc aatcgtacaa ccaccatacg taccaattgg gagcgcttgg caaaccgttg    264840
     acgacgccgc attggagtgc ggcgtccagt gggcatcggc gtaaacttct cggtggtggc    264900
     ggcgccggtg tcagcaagca cgtcaaagca agttttgaga cgtatatttt gagtgaatat    264960
     caatccaaac acgggagcgt gtatatgaac tttaccacag attgtcccac gccagtggcg    265020
     atctcgctca ctgcgacgga taccggcttg gtgggcatcg ccggtatgtg gctcggttta    265080
     gttcttctca tcagtatctt cgggttgatc attactgaaa tcattcaccg caccctagtt    265140
     gcgttcattg gcgccgccgc tgtgctgttt atcctgtctt tacaacatcg cttgccatcg    265200
     atagcgacga ttttgacgtg gatggatcac ggcacgctcg cgctgttgtt cggtatgatg    265260
     atcatcgtcg ctctactttc ccgcactggc gtgttcgagt atatatccgt acatattgtc    265320
     gagtactcaa agggtagcat gtggcgcttg ttcttcatgc tcatgatatt cgacgcagtg    265380
     ttgagcgcgt ttttggacaa cgtcaccaca atgttgctcc tcgcacccgt ggcgctgtct    265440
     ctgtgcaaag ctttgaacat tgatccgcgt ccacttttga ttccgctctc cattttcggt    265500
     aacattggtg gatgttccac actcattggt gatcctccga acattatcat cggaaacgcg    265560
     ctcaaggagc acatcggttt tgtcgacttt ttacgagtcc tcggtccggg ggtcttgctc    265620
     acgatgccgt ttattttcgc ttttgtcaag tggtactacg gtgacgcatt gtttggtcaa    265680
     aagatcaacg tcgacatcga cgaattgcgc gcaaagtatc ccatacgcga catgaacttg    265740
     ctcattcgca gcggaacgat tttgattttt gtcattttgc tattcttttt gcaccccgtg    265800
     atgcacatgg aaccggcgta cgttgcggtt ttcggtgcga tcgcaatact tctcacagga    265860
     agccacgatg agtttgagta cgcgctcgaa aaagttgagt gggactcttt gttgtttttc    265920
     gcgggcttgt ttgtgttcac cgagggcatc gctaagctcg gcttgctcag agccatcgcc    265980
     gatgagctct cgacgctcat cgcctccttc cctatcgggc agcgtcagat cggcgccatg    266040
     ttgctggtgg agctcgtcgc tggtatcgcg agcgcattcg tggataacat tccattcacc    266100
     acgaccatgc ttccggtcat catacaaatg agcgaaaacg tacagggcat ctccatcgaa    266160
     gcgctcgcgt gggccctctg cttcggcgcc gacttcggcg gcatcggaac tttgatcggc    266220
     tcttccgcca acatcgtgat ggctggtatt gccgccgaag ctggttttcc catcaccttc    266280
     aagtccttct tccgaatcgg ctggcccgtg atgtgcatct ccttgtgtat cgccggcgcc    266340
     tacctcgccg cgcttgaagg cgctgggact ttcaaagtca aagacgacga cagcgcgtcc    266400
     tacagctgag tcgatcgcac gtatgtatcg cgtttgtcat attattatct gcgtattgtg    266460
     ccgaccgcgt cgtcgttccg tttcgtatcc ttcgtcgatc gagcgccgag ccgtcgcgcc    266520
     gtcccgagcc gtcgccgtcg ccgtcccgcg cgtcgtcgcc gcccgcagtt cgcgccgctg    266580
     cccggtgcgt gactcccgtc gaagcctgga cggaccgcgg gcgatggata aatacagaaa    266640
     gcaacaacgc aagcgcgaga tagagaaaaa caaggaacga cgcaaggagg cgcgcgcagt    266700
     cgcggcgcaa acgaaagatt tgagtgaatt acaggctgaa cgtgagcgac tggaaaaggc    266760
     gaaaaacgcg ccgcaaatcc caggacagcg cctgcgagtg gataagattg atgaaaagct    266820
     cacgtggctg tcgaagcaaa tcgacgcgaa gcgagcaagc gatgcgcgag atcgagaggc    266880
     tgggttgacg ccgcgaagcg cgaaaccgcg agggccgacg tcgacggcgt acgcggttgg    266940
     ggcggaacag tactataaac cagaggattc ggtgtattgg cacccgaagt tgaatccgac    267000
     cggacgtccg ccggctggga aaccgcagaa gtggaaggca gggatcgtgg tggatgaatg    267060
     cgcgagcgct tcgagacaag cgttgccggc ggcgacggcg gctagcgaca gtgatagcga    267120
     cagcgacagc gacagcgacg cgatgccgcc gccgcctggt ccgccaccag ggtttgaatt    267180
     ggtgatcccc gcgttgccgg tgaaagatga tgcgatcgcg gcggcgaaga cggacacgaa    267240
     cgacgaggac gaaccgttgt tgccgccgtc ggcgccgccg gaccacgagg acgaaccgtt    267300
     accgccgccg ccggtaccag cgggcgacga agatggatca gactctgagg ctttaccacc    267360
     accaccgatg ccgccgactg ggacgagcgg cggtaacgaa gtggaagtgg cgccaccgcg    267420
     cgttacggag acgacgactg tggtgcgccg cgcaccggtg ggatcgatgc cgcgcgttgt    267480
     tccagtgcag agaagaccgc cgccgccacc aaagcacggt gtcggtggtt tcttcgccgc    267540
     cgctcctcgg gcagtacgaa aaccgccgtc cgatccggcg acatttacga agagcgctgc    267600
     gccgacggcg acgcccatcg ttcgcgccga acacaacgtg aaactgaaag cactcgttcc    267660
     cgcgagcgtt cgcgtgaacc ggcaggaggc acccaacgca aaacgacaac gcgttgtaac    267720
     tggacgagcg attaacgctg cgccgaaggt cgccgcgtcg tcatcagcag gcggctcggg    267780
     caaggcggca gacgaaacgt acctcagctt cttagacgag atgagcgaac taggggcgtt    267840
     cgcagagtag aatctagcac aatttagtaa tacaacgatc cctaacgctt ctttgcgaga    267900
     gcgagaactt cggattcgcg aacttcgcac gcccagtgca ataacgtttg tctcactacg    267960
     ggtgaaatgc gtgaatcgtc ccaactcgcg ttagcgttga taatcttgtt gatgagattc    268020
     gtcttccatc gccccttttc cccgcacacg cctttccaac gtgatatttg cctgtcgtct    268080
     tcgccgtcgt tcaaccgcct tccctgataa aatctgcagt accagtgaaa ccatcctcgt    268140
     gggtcccgcg agtcgatcca cccgctctct tcccagtacg tttgcgtttg ccccgccttg    268200
     acgccgtaca tgttcgtcgg aatgttatat ttgcgactcg cgtaccagct cttatctaag    268260
     ccctcgaacc attcattcgg aaactccgaa gggtcgatgt tgcatggtcc tcgaataccg    268320
     ggcttgccgc cgcgcggatg gaaatagcac ccaccccacg atccggccgc tatcacttgc    268380
     gtgggcgtga ggttgggctt aaagtctggt ctgtctttga acactagatg tcctttggtc    268440
     ggatgtcgcg gcaccgcgcc tcgccgttcc ggcagcgcca aagcgctctt gcgcagcgcc    268500
     tccgacggcg gcggcggcgg ttcatacgcc accctcgcgc gtcccgcggt gctaacgatc    268560
     gctttatcaa cgtccttgaa catgtcctca tcgctgtaac tctgcaccgc ctttcgcgcg    268620
     cgtccggacg tgcgtcgcgg cgcttcgctc gctgacgtca ccgccgcgct ttttgagact    268680
     ttcggccgcg gtgacgcgcg ggatttgcgg acgctcgcgg cgaggacgtc gacgcccaac    268740
     gctcgcattc gttctttgtt cgcgacgatc ttcttttcgc gcgcgcgttc gtatgaatcg    268800
     accatcgcgc gagcgaatga cggttcatgt tttttgtctt cgctttttac tctctcagtc    268860
     tcaattctat gttttcttcg ccgagcttga ctgaaattgg atcggcttgg cgtcggcgtc    268920
     gtggcgcccg cgcgcgcacg gcgcaagctt tagaaagtca tcgaagtcgt agacgagttt    268980
     gccgcagcac gaccaaccct tcttggtttc gtgaaagatg ggagcgcccg agtgatgttc    269040
     gcacgcgtcg tccgcgttgt cgcgctcacg aaactttcgt ccgcatcccg gattcttgca    269100
     cgtctgctcc gtgtccaaat ctacctcggg tttgaccttc tgtgcgacgt ccggcgtcgt    269160
     ttcgcgcgct tctgtcgttg aagtcgtcgc cggcgacgcg ctattcgcgt gctcggcgca    269220
     ataaaatccg ctcttacatc gaacgcacgc gctcgcgtcg ccctcgcctc gcgcgcgcgc    269280
     ttccatggac aaaggcatcg ccggtgctgc aggtaatcgc tcaaccaccg ccgctgcttc    269340
     gtcgtcttca tacgttatct tcgcgcacgt gtgcgtcccg ctcgcgcaac ctttgattga    269400
     catgaactcc ccgaagtcgt gcgacgactt cccgcagcac ggccacgact tgacgccgtc    269460
     tcgaaagcaa ggtcgtttcg tgtgatgcac gcacgaaccc gggacgttcc cggggcccgg    269520
     ggcgtagtac gcgtcgcatc cgagtcgttg acaagcgtat gtgccatcgg ctctggtgca    269580
     gggcggaagc gcggtcaagt catcttcgaa cgaccgcggc gtcggcgtcg acatcgatcg    269640
     acggcggacg tgaaatgatt taattctgtg cgcgacgacg cggcgaggcg cgcgcggggc    269700
     gcgatcgagg gcgtcgcgca ctgcggtcga cgcgacggct tccgagcgtt tcgactactg    269760
     cactcggtca taaattacaa cactgattgc gatgacgatc gctttgtcgc gacgatgatc    269820
     gatcgtcatc aaatcgtggc tcgactgccg ccgagcgcga ggacgtcggc atcggccgcg    269880
     tcgacgtcga cgagcggctc gaacggcgac gcccaacgca cgcgcacgcg aggcattcga    269940
     ccatccgctc ccgcgggcgc gcacagcgac atgacgtgcg actgcgatgc gcgcggtttc    270000
     aacagcgcga accgccaagg gacggtacca tcgtcggtga catcgcgcaa atccatcgac    270060
     cacgtcttcg ccgcgtcctc ggcgacgtcc cacgctatgt caaactccct gaacggacgt    270120
     ccggcgattc ctaaccctaa agccttaaca tacgactcct tcgcagtcca caaccgcatg    270180
     aacgctcgcg cgcgttcgtc gtccgcgacg atatcgctca gacgccgcgt ctcgtcgtcg    270240
     ctcaaccacc gccgagcgaa tttccccaca tccgtcccta ttcgtctatt ctcatcctcc    270300
     acatcgatcc cgcacgcatc cccgttcgtc gtcaccgcca ccgcggtgag cccgtcgcag    270360
     tggctgacgc tgaacccaca ccgcgccgcc agcgtcgccg gtccgcgcac gctcggcttc    270420
     cctcgcgcgc cgtacgcgaa cgtcacgtct cgcgcgtctc gcgcgtcttc atcgtaccgc    270480
     atcagcaccg tccgcgcgaa cgcgcgcgag atcaacctcg tggcgtttcc catcaactcc    270540
     gttcgctcgt cttcgctcac caacgcttcg gcgcgtcgcg cgagctcgtt ctcgctcgcg    270600
     tcgtcgcctc gcgtccccgc gcgcgcgtcg tagcaccaca cgtcgatcgt ctcgcccgcg    270660
     tccccgccgc ccgcgccgcc gtcgtccgcc tccaccgacg tcgtccgcgc gacgccgcgc    270720
     gcgacgccgc gctcgaatcg cgcgcgcgcg cgcgtcgttc gcgtcgttcg cgcgccgcgc    270780
     gcgcgccgag tcaacgccca gcgcccatcg cgcggcgccg ccgcgccgtc ctgcgcgccc    270840
     gcgcggcgtc cgcgcgcgcg cgcgcactcg cgcgcgcacc atcgccgcgt cgtcgcgctc    270900
     gcgaacgcgc gcatcgtcgc gccgcgcgcg tcgtcgcgct gtgccggtca aagccgcgat    270960
     cgcgtcatca caccgcgacg cgcgcgcggc gcgcgacgat gcccgcgccg ggcgcggagg    271020
     ggacggagcg cgcgtgcggc gcgtccggac gcgcgctgcg cgaccgcgcg acgctgaaac    271080
     acacgagcag acagcaggaa atcatcttgc aatcgattcg agccaccgaa cagacgatcg    271140
     gcgcgatcaa acgcgcgtcg ctgagcgaag agatcgaaag aaggcgcgag acggcgcttg    271200
     gaatcgtgcg tgatatcgat gcggcgtgga aggcgatgcc ggcggtgccc gaacgcggcg    271260
     cgggggcggc gagggagtgc tttttgcagt gcgacgccgc gggctgcggc aagtggcggc    271320
     gagcgccgcg cgcgatgggc gacgcgctcg cgggcgacgc gaagttttac tgcaaagacg    271380
     gccgagacgg gagatttaat cgatgcgaga tggcgcagga ggtcggcgac gatgaggtgg    271440
     atagcatttt ggatgagagc gtcgcggcgg acgcggaggc gcgggagagg tgcaagcggg    271500
     acatctcgaa cgagcgaggg aggatgtatc agaaacggaa gaggttgttg gagttggagc    271560
     gaaggcacga tattggagag atcgaacttc aggaggacgg gacgtacgtg acgctggcga    271620
     agcgggggaa gaatggaaag aatgggaagc gtcacgggaa taacggcgtc ggcggactcg    271680
     gttcaaaggc gccgccgcat cctggtccgt tcgatgagtt cgcgtgggtg cagtgcgaag    271740
     cggaggggtg tgggaagtgg cgtaaggtga agcatgcagc ggtagagggg atgtcggtgc    271800
     gagatcgttg ggtgtgctgc atgaacgaag acaaggagca ttcgacgtgc aaaacgcctc    271860
     aggagatgag cgacgaagac gttgacaagt ttaaagtcga tcaagagagg cgaatgattt    271920
     tgcaccagaa gcaattacaa gagcactatg cgcacttcgc accgcgaggg gcgaagttgc    271980
     ccgaaggttt gattcgcgtc acggtgccgg tgcaggacac aacgccgccc gaggcggagc    272040
     cgcccgccgc ggtaccagtc gcggcgccgg cgccaggaac cgccgagacc actagaatat    272100
     cgatcgacga tggaccggaa gactcgccca tgtgggtacc cgggataccg cgtccgatgg    272160
     cgccgcttgt gacgccgaac accattcctg tgcaagtggc tgtttcgtgc aacgggcacg    272220
     cgggagtcta ccttccgcgt cggaacctgt ttagatgcca ctgcgagcaa ccagaacaca    272280
     tgtgtgcgtc ggtgagcggc gatggtgacg gtcgtttatt cgggggatca gtttgggagg    272340
     cgcactgcgg taaggcatcg acgagaaagt ataaagcgtc cgtcaaggtt catatgaatg    272400
     ggccgaatcc gcaaatgttc attggccgct ggttcgatcg tgtcggcttg aaagtcgccg    272460
     acgcgaaagg cggcggtggt ggaggcaaac cgaagaagcc aaaggtgaag agtttcatta    272520
     tggagctcga agaggcgatc cttcctggac cgattaacca actgtcgctt cgtaatttga    272580
     tgaccatttt cggtttcatt ttggacggca gcgccgtcgg cgaagttaaa gtcaagactg    272640
     aaggtgagga aaaggaaaag ccgaaggctt tgaccgcgaa tgagcgacgt gaagaaggtg    272700
     caaaagaact cgggcgattc gcatcggtat gtaaggcgtg gaagcaggcg tcgttgacag    272760
     tgttgaagac ggcgggcgta gccaaggcgg agaagaagaa ttttgacggg accgcgctgc    272820
     gaacgcagtt taccgtgatt acagagtacg tcgaccgcaa agatgagaag gagtgccaaa    272880
     tagaacgctc agtgacgctc gcggctaatc accctttcga caaaaagtca aagatgaaga    272940
     cggcgcacgt cgacgacgga acccctcccg ggtggtggcc gtcgctcggt gtcaaggcgg    273000
     aacgtaaaaa gctcgtcaca gaagtcatcg agcaagaaac ctacggtgtt gatttcgtta    273060
     ccggtcgcga cgcaacagaa acactcaagc gcgtgctgcc cgattactct gaagacgatg    273120
     tatggggact ttacaagcaa cttctcgcgc aagtgaacga aagctacgga gcgatgactc    273180
     ccgatacttt ggcgacgcaa aacttggcgg ttgccgctga agatctcgcg gtaaagcttg    273240
     aacgtaaggc ggacgctaag agtttagcgt tttcaaaggc tttatggaaa ctcgctgcgg    273300
     cggcgatcga gacgccagaa tattattacg tgcacagaaa aggatttggc gtcgtgtgca    273360
     accaaccgat taaaaagggt gagtttctca tcgactttct tggtgagatc tatccaccct    273420
     gggcgtgggc cgagaagcaa gatgccatcc gtcaggtgca aaaggcacgc ggccttcgcg    273480
     atcgcggccc tccggagttt tacaacatgc aaatcgagcg cccgggaggc gacgcagagg    273540
     gttactcggt gctcttttgc gacgcgatgc acgagaacaa ctatgccggg cggctttcgc    273600
     acacctgtga tccaaacgtc gaagtcaact tgaaggccat taatggcaag tatgagattc    273660
     atttcatcac aactcgagac attgcacctg gcgaagagtt agcgtacaac tatcacagct    273720
     gtacggataa catgaaggag gtcgagatgg cgttttgctt gtgtggcgct cgcatgtgtc    273780
     gaggttcgta tttgaacttt gttggcgaag accaccactc gcaagttttg gagagcaagc    273840
     ataagcttat cgatcgacaa gtgatgtcgt tcaaggcgat cgataaggcg gcggatccgc    273900
     taacttcgaa acaagagcga tctctggcgg cggtcggatt ctatcctggg aaaggtttac    273960
     tcagaaactg cccgggatgg ttgcttcagt ttgtgggtga tgtagcggtg tacatggata    274020
     ccgagctcaa cgaacttccc aagcacatcc tcgcggcggc gaagaaagag catgcaaagc    274080
     tgttggagaa gaacccgcaa gctgagtttt cttacaccga aaagtttgcc aagattgatg    274140
     cgcttgcgat gcgggaaaac cgaacgcagt gcgtcgccat catgctgagt aaattgcgtc    274200
     gacttttgac gcgggcgcgc gatgatggtc cgcagaaaag cgtgtacgag tgcatggatg    274260
     tgtttgaaaa gtccgcacca ccgtacgtta cgctcaccga agccgagatc gccgcgcatt    274320
     tttgggggtc tggtccggag aatttcgaaa agtccatcgt ctgtggtctc attcgcgcca    274380
     tgggcccgca cgagcgcaaa aacgacgcgg ataagttcat caagtggact agtatggtgg    274440
     aaagtgtcgc cgtggaagtc cgcaaaggca agatgacgcg taaagagtca ttactttggc    274500
     ttcgtgatga actaaaaaag ctcaagcaaa ccgatggcgc gcgccacgac ctcgctgcgg    274560
     gacttattca cttatacgcc gagaccaatc ggttctggca gccctcttcg gcaccagagc    274620
     atcaagttta taagagtgac aaggtcgcgg tgcgcgaaga cgaagtcaac gcgtggggcg    274680
     ttggtgcggg tggcggtggc gataaaatcg tcgccagagt ggagaaaacg tatcgcccgg    274740
     gattttctgc ggcgacgatg ctgcagtggc acaagcaaga gatggccgac ccgacgcagt    274800
     acatcaccgc gaatcgtagg ggtaacttga gcatgccaga tatcgcgtgc tgttattcca    274860
     gtcgtcccgg acagcctctc gcgaggtcga gtgatcgcga gcatgaaacc tggctggcgc    274920
     acttgcagag ctggcccgag gagccatggc cgcaatcaag cgggccgtgg ggggtcgcaa    274980
     actcgcaaaa actgatcggt tcgccggttt tagatgcttg gatgaagggc cagcgatcga    275040
     ttccggctaa atgcttggcg tggttgaaaa cgaacacggg ctaagcgata agcatgagct    275100
     tacaacttct ttcgtcgtcg attttgccta gaattctttg taatatttca cacgactact    275160
     cgccaattct aacactgctg ctgctcgcgc tcgcgcgcga gtttcaccgt taacgcgata    275220
     agcatgagct tacaacttcg ttcgtcgtcg attttggcgt actccacaaa atcattcgcc    275280
     ttgggcaacg cgccgttgag catgacgtga tcgtcgaaga acaatgtcag gtgctcggga    275340
     atacacaaca acttgaaata gaatgcgcaa cccttgcgca tcgcggataa taacgtcgaa    275400
     aatacgacga tcctgtctgt atccgtggtc gtcgcgatgt cgtccaatga cgcgcccgct    275460
     atgtgcttcg cgtacacctc gcgttcggta tccgtgagct ctatttcgcc cgcgcgcgcg    275520
     ctttgagcgg ataactcgcc tttatcgaca gcatcgtcaa agacgacatc ggtcggctct    275580
     tcgtcgtctt cttcgtcgtc gacgaacgcg ttcgcctcgt cttcgtcctc gtcctcgtcc    275640
     tcgtcctcgt cttcaacttc ctcgtccgac gactcgacgg gttcgggcag cggatcgcac    275700
     tcgtacggct cacccccgaa cgattccacc acgtctcgtt tcatcagcgc gcgatacact    275760
     agcagcgacg cccacgcatc catggcggcg tacttgatct gactctcatt caactcttcg    275820
     cgctcccaat tcgacattcg cgtcttgtcc ttgggcaacg tcttcccgag cacgtgttcg    275880
     cacaacctcg ccaacgacca cgacggcgcg ctcggacacc caccctcgaa ccgttctttc    275940
     gccaaaacgc tcaactcgat caccctcgac ggttctaacc cataatcccg caccaacttt    276000
     ctcgcgtcgc ccctgacgtt gaagcccgtc ttcccccgcg cgccgtctcg cgtccatcgt    276060
     ttgaatcgcc gcgtcaaccc cgcggtgtga atccgcgcca gcaccaccaa tttttcgctc    276120
     aaatcctcgt tcgccaccgc gatctgcacc agcgacgtct tgctctcccc cgcgccccgc    276180
     ttaaacgaca ccttccactc catgtcgaat ccgcagtgct tcgtcgtcgc cgtcgtcccc    276240
     gcgcgcgcgt cgaacgcctc gatccgcgcc atcgcctcct ccagctccct cgccgtgctc    276300
     gcgacgacga tctccccatc gtacgtcaga tcgtccatcg tcgtcgccct cgcccgcgcc    276360
     gcgcccgcgc ccgcgcccgc gccgtcgcgc gcgttttcct tcgcctctgc gtcgcccgcc    276420
     gtcgcgtcgt ccgttcccgc cgccgctttc gcgcgtttcg acgcgtcgcg cgcgccgtcc    276480
     gtcgcgcgcg ctcgacgttt cgtcggcgtc atcgtcgcgc gtcgcgcgtc gccgtccgtc    276540
     gcgcgtcgcc gtccgtcgtt cgctttcgct cgaatcgcgt ctcggccgtc tcggccgtct    276600
     cggccgtctc ggacgccgcg atcgcgcgtc gcaccgcgcc gcgccgcttt cgcgccgcga    276660
     tggcgcgcgt cgcgacgacg ccgcgcgcga tcgcgcgcgc gtcgtccgtc gcgcgcgtcg    276720
     atcgcgcgcg tccgcgtcgg cgtcggcgac gcgcgacgcg atcgcgcgcg cgcgtctcgg    276780
     acgtctcgga cgtctcggac gacgacgacg acgccgtcgc ggcgcacgcg ctcgtcgagc    276840
     ggcgatcgct gctcgacagc gacgacgccg aggcggacgc gcgtcggcgc gcgctcgcca    276900
     acgcgcgcgc gatcgcggcg acggcggacg gcggcgacgt catgcgcgac gtcgacgcgg    276960
     acgtcctgcc gctgttgctc cggctgcgaa gcgcgggcgc cagcgcggag gggctgcgac    277020
     gaggcgcggc gggcgtgcgg gcgtggaggg acgccctcgc gcgagggctg ctgccggacg    277080
     cgtcgctcga gtggccggag gacgagacgt tcaggacggc gctgatcgag gcgctggggg    277140
     atttagacat ggccaggttc acgcgacggt ttccgccggt gctggacacg ttgatgaaga    277200
     atgtgttgga tattttgtac gtgtacgaac gcgatcgaga ggacgaagac gcgacgccgg    277260
     agttgccgcc gacggagccg cgggattcgg agacggcgaa cgatggagag ggagagggag    277320
     acgcgcgagg aagcggcgcg ggcgagagcg acgaagagga gggggagggc gaggcgcgga    277380
     gtcaggcggg agggcgaggc ggcgcggggg aagaaaccga cgggagcgat aacgtcgacg    277440
     aattcgacgt ggggatggat ggcgacgacg gcgcgaacga ggcgatggag cgggcgaagg    277500
     agaagaataa ggagatcgtc tcgcggctca tggaggagtt caaagagcag tgggaaccgg    277560
     cgatggataa gctcgacaag gcggccaagg cattcgaagg attagattta gacgacctcg    277620
     ccgacggccc ggaaggcttc gacctcacgc gaggtctgtg gcagcagact gggtggaagg    277680
     agctcgattc gcttcgcaaa aagctgcaag acttgaaaga gttgcgcgac atggtgcgca    277740
     gtttgggccg aggcagtggt cgcggacctt tgcgtcgcgc gccgcgacaa agagagcgcc    277800
     aaggattccc cataggtctc gtgcgaagtc cgatggagcc cgaacaaaca tccggtttgt    277860
     gccgctcgga cgatttgtcc cgcatgatgc cgagcgagat ggtgctactc gcgtcgagtc    277920
     tcccgcaagc gcgtcttttg cactttgcgc gtcgcgccga gcgcactttg ctgtcgtatg    277980
     agcgcgtggg gtggtcggaa gaacccgcgg tgactgtaga gggcttcgag acgcgccccg    278040
     cggcggagtg cgggccaatc atcgtgtgcc tggacacctc ggggtcgatg atgggcgctc    278100
     gcgagaccgt cgccaaagcc atggttctcg agtgcatgcg gcaaagtcgc tcgcagcagc    278160
     gcgcgtgtta tttatattct tttagtggcc caggagattg ccaagagctc gagctcaagc    278220
     tcaacgccgc cggtctctac ggtttgttgg aatttctcag cggtagcttc cacggcggca    278280
     ccgacgtcga cgagccattc aatcgcgcgc tcgctcggtt aaacgaggcc gaatggagca    278340
     acgctgatat attgctcgtc accgacgggg aaatcaaacc tcccgacgaa accttgatcg    278400
     ccaatctcaa cgaggcaaag gaagagatgg gattaaaggt gcacggtttg ctcgtcggcg    278460
     acgccggcaa cgccgaagtc gtggaatcga tttgcactca cgtacacgcg ttcaagtcct    278520
     ggaccgcggt cggcggcaag ccatcgtaat tacgtacctc actagtttac gtatcatgat    278580
     aagcattctt taacgacctt tcgatcccca accgtcggtt cgcgccgcgt cgtccgcagt    278640
     gctcgcagcg atgctcgcgc tcacgcgcgc gcgcaacgcc ggcatccgca ccccgctcgc    278700
     ctttcgcgcc gccgtcgagc gcgagcgaac gcttcgaccg ctcgagctcg tcgagcgcat    278760
     cgacagcgcg tgcgcgccga cgtgcgtcga cctcgacgcg tgcgagcgtc ggtacctcct    278820
     cgtcggtgga atcgacggca gcgtgcgcgc gtacgacacc gaagccgtcg tcgagggcgc    278880
     tcgagcgcgc gatgatgact gctcgagagc gcggtcgacg cccgagctcg tgtgcgtcat    278940
     cgaaggcggc ggcgcgcgcg aggcgaatcg cgcgggcgcg agcgggacgg cgagcgggac    279000
     ggcgagcggg gcggcggcga cgagcgagga gatcggacac acctacgcga cctcgtgcgt    279060
     gcgatggttg ccgagtgata cggggatgtt tttctctggg tcgtacgaca agacggtgaa    279120
     gtgttgggat gcgaatagct tgcgctcggc gtgcgacgtc gagctgccga cgaagtgtcg    279180
     aacgttggcg ctgagcgacg cggcgacgac gcactcgctc gtcgcgattg gttcggacga    279240
     taacgtcgtg cgattgtggg atccggcgtc gaatgcgatc gcgcacacgc tttcggggca    279300
     tcgtggaagc gtgcacgcga tcgagtggtt acgatcgaac gagcacgcgt tggccacggg    279360
     cggcgccgag ggcgacgttc ggttgtggga tattcgaagc gcgggggcgt acatgatttt    279420
     ggacaggcac aatacacaac ctagcgcgcg tgtggacgcc atcaaggatg cgatgtacgc    279480
     cggcgcgagc acgagcggaa ctattgaggc tgggccgaaa ccggcgtcca gaaagatggc    279540
     ggattccgtg cccgaccact tacgcgcgga cgccgctcga cggtgctcgt cgtcgagttg    279600
     ggggcgctcg aacgacggtg gtgcgagttc gagctcaaag cgcggacgca acggtgggtg    279660
     gggaggctgg ggcgtgggat ttcgtgggaa caagagcgcg agaggtcgcg acgaacgcga    279720
     tgacgcctcg cgatcgcgtc tgttccccgc gggtgacggt tactcgtcta ttcccgctcc    279780
     cgcgcacgac ggacaagtga gcggcttgag aaccacgccg tgcgggatgt tcatagtttc    279840
     caccggcgcc gacggtcgca ttcgtcgctg ggatttatcc aatggattga acacgtacac    279900
     gccgtacgac tccgccggtg ccgcgccgac ggcgagcgcg tgccaaatcg caatcacggc    279960
     cgacggcgag cgtctgtacg tcccttgcac cgacacacgc gtgcgcgtct atcgcacgca    280020
     caccggcacc ctcgacgcag agctcaaagg ccatctcgac gacgtcgtcg cgtgcgccta    280080
     caaggatggc ggcgacgcca aactcttcac ctgcggcaaa gacgccaacg tcctcgtctg    280140
     ggcccccgtg agcgcgtcag cgtcgtcaaa gcactcgggc gacatcgacg gcgatgcgtg    280200
     gagcgacgac gacgacgcgg atggcgccgc ggacgcgtac gggcgcccgt ccgccgtggc    280260
     ggatcccaat cgctcgcgct cggcgccgcg cggtttggga taccgttcaa tccacacacc    280320
     ccgcgcgcgt tgacgcgcgc gaaccctcgt taggcatcat agtctagttt ttagccacac    280380
     agtctttagc cacgcacgca gcgtcggact cgcgtcaacc tccgcgcgcc gtcgacgccg    280440
     ccgtcgacgg cgccgacgtc aactgcacat ctcgtcgggc gcgaacgcac gtcgcgccga    280500
     cgcgatgccg tcgaagcgcg cgtccgcgaa cggacgcgtc gatcgcgccg cgaccgaccg    280560
     ttcgcgcgcg tcgacgccgc gcggcgtcaa aacgttgaag gttcgcctcg cgcgcgcgac    280620
     gaaattccgc gatgaaaatc gcattcccgt gcgcgacaga ctcggcgacg gcgcgaagac    280680
     gacgaaaagc gcggcgaaag acttaaggcg aacgatcgaa cgggcgacga cgacgggcga    280740
     cgcgcggacg cgcgcgaagg gtgacgtcgg tcccggggat ttgcggcgcc ggttgccgcg    280800
     gcgcgacgac ggcgccgcgg cgaacgcgaa agcgaaagcg acgcgaacgt ctggagattt    280860
     gagaaacgcg ttatcgggga aatcggggag aaaaggtgtc gccaacgcga aggggcgggg    280920
     agacgcgcgc gtgaacgcgc tgttgcgacg attgaatctg tcttcgtacg aggcggcatt    280980
     cgcgcgagag gagatcgatt tgatcgcgct gcgggcgatg cgcgacgggg atttcgacaa    281040
     gctcggcctg ccgtacgggg tcaaggtcaa gctcgcgctc gcgttaggac ggcggtgagc    281100
     gatgaacgat gtgacattag cgcgccgcgc gcacaaccga ctgctgtatt attacgacgc    281160
     cgattcgcaa acgccgattc gcctcgccga cgcgcgagac gacgacgagg acgaggaaag    281220
     cacacctcac tctcacgcgc gcgcgcgccc acgcgttccc atgtccgtcg agcactcgcg    281280
     aaccgtacgc ctgagcgagg atttgtccta cgttcaaccc acggcgccgc ttccctcctg    281340
     gctcaaaggt ttcttcgtca cggcggtgag caaaggacag gattcggtgg tccaagccgc    281400
     cattgaagct tcaaacattc tgaacgatta ctggttcaaa gtggcgtacg acgcccatcg    281460
     catcgacggg gaaaagccgt acgaacgcgc cgaggcgatg tggatccccg gttgcgacgc    281520
     gtgcgcgttc gtggcgcttc ggccggacga caacgacgcg aacgtctaca tgtgcgcgaa    281580
     agccatcgtg gaggagtgtc gaaagggcgc ggattggaag caaccgacgc acgtcgcgcg    281640
     gatcgttgcg gttgagaaaa gctcgagcga gctcgaacta gacgcgctcg cgcgagacgt    281700
     tctgtcgaag cactttccag agcgaggcgg cgactcggag cccgttactt tcggcattca    281760
     ctacgaagaa cactcgccga tgagacattt ctcgagcacg gacgtgaatc gctttgtcgg    281820
     ctcgcacgtt ccagacgaag ggtacaaagt cgatctcaag aatccaaggt tcacgatctg    281880
     cgtcgtcaac gcgggcggtt cgatgatgat gtccgtcgtc gaagcctacg acgcgctcgg    281940
     gcacttcaac gtgcatcgcg cggcgttcga ggacaaactc agcgataccg tgccggcgcg    282000
     cggcgacgat tccgcgcagc ccgcggcgtg agcgccgcgc gcggcctcgc caggggcttc    282060
     gcttcgcgac atttacgccg caatgtttga tgcgagtccg agccgtgcga catgtacgcc    282120
     gcgatgtgtg atacgattcc gagccgttcc cgccgtcggc gcaaaccccg cgcggagtgg    282180
     atagatcgtc tcgccgacgc accgccccac tgtgcgacgc ccgtcgacgc gcaccgccac    282240
     cgaacgctcg aacgccgagc gtacgccctc gaaacgcgct ctcgaccgct cgatcgcgcg    282300
     cgcgacggcg taatcgacgc cgatctttga cgaattcaaa gacgactgga atcgccatgg    282360
     cgctctttca cgaagtcgtg cacgcgctca agacgtcgcc ggcgcacttc accgtccccg    282420
     ctgtgctaat gacggtggtt attttcatct tcttgctcga tcagctctcg cacggaccgc    282480
     tgaagggacg aaagtcgccg ccggtgatcg acgtggcgcc ggtgtggggc ggcatgttgg    282540
     cctttttggc gggaccgatg aaactcatgc gcgaggcgac gccgaagtac ggtgaggtgt    282600
     ttaccgtgcc ggtgtttcac aagcggatca cgtttctgat cgggcccaag gtgagcgagt    282660
     tttttttcaa ggcgaaggat acggagatgt cgcaaaagga ggtgtacgag ttcaacgtgc    282720
     cgacgttcgg taagggcgtg gtgttcgatg tagatcacac gactcgtgcg gaacagttta    282780
     gatttttcgc ggatagtctc aagagtaacc gattgaggat gtacgtgggg atgatggtga    282840
     aggaggcgga ggatttcttc agcaagtggg gagacgcagg cgaggtggat ttgctcgagc    282900
     aactctcgga gttgatcgta ctcacggctt ccagatgctt gctcggaaga gagattcgcg    282960
     agacgctcta ctctgaagtt accgatctgg tgcacgattt ggataagggt atggtgccgt    283020
     tgtcggtatt tttcccgtac gcgccgatcg aggcgcaccg caagcgagac gcggcgcgca    283080
     aaaacttggc caagattttc gacaaagtta tccaagctcg tcgcgagagc ggcgcgagtg    283140
     aaccggatgt cttacaaacg ttcatcgacg cccggtacaa ggatggtagc aggctcacga    283200
     acgaccaagt cctcggtatg ttgattgccg tgctcttcgc cggtcaacac acgtcctcga    283260
     tcacgtccac gtggactggt ttgctggcca tcgcgaacaa ggagcgcgtg atgcctgcgc    283320
     tcgaaaagga gcaaaaggat atcatgaaga agcacggcaa ggatttggat ttcgacatct    283380
     tagcgaaaat ggatgagttg cattttgctg tgaaggaggc gcttcgaatg cacccgcctc    283440
     tcatcatgct ccttcgcatg gcgcaagtgc cgttcgaggt cgaaacctct acgggtaaga    283500
     agtacaccgt ccccaagggc cacatcgtcg ccacctctcc cgcgttctcg caccgcttgg    283560
     acaatgtcta cagcgacccg aacgagtaca agcctgaacg attccgcgaa ccgaaccccg    283620
     aagacaaggc ccagttcgcc tccttcatcg gtttcggcgg cggacgtcac ggttgcatgg    283680
     gggaaacctt tgcgtacatg caaatcaaaa ccatttggtc catccttttg cgaaactttg    283740
     agttcgaaat ggttggaaaa gttcccgaac ccgattacac cggcatggtc gtcggtccca    283800
     ccgcgggcca atgcaaaatc cgctacaagc gccgcgttct gtgagcgcgc gtccatgaac    283860
     cttagcgtgt tgcacaatgt cgatatctat aatctatttc catttcacac gcgcgccagc    283920
     gcgcgcgtcg caccgtttcg cgcgttcgcg gcgcatcgtt cgcctcgccg acgtcatcgc    283980
     cgcacttcgc gcagcgcggc caccgttcac atgcgtcgcg ccgcccgact cgcgcgcgac    284040
     gccctcgcgc gcgcgcgcgc gtcgagcgcg tcgttcgccg agacctcgac gagcgccagc    284100
     gcgttcgcac cgcgcgcgcg cgtcccgaac gcgctcgaaa cctcgcgcga tcgctctctc    284160
     gcgcgcggtt tcaccggcgc ctggcgcgcg ttccacgcct cggcgtcgat cgagaagcga    284220
     aacaaacgcc agaccgtgcc gttgacgctg gaagacatgg agttcgagcg cgtggaggcg    284280
     gtggaggacg cgagacggcg gttggcgccg acggagggga cgctctacgg cgtcgcgccg    284340
     aaaacgtgga cggaacgcga gcgcgacacc ttgaacgccg acgaagaagc gaaattggac    284400
     gcgctgttgt cgacgtacgt cgaaggcgcg tacgtcgagg gatcggggat gccgacgttc    284460
     gaggaagtgt tggcgggcgc ggaggcgagc gcggcgaacg acgacgacga cgacgacttc    284520
     gcgcgagact cgagcgaggg cgaggacgag gacggggacg agcgaggcgg tgatcacgaa    284580
     tccatggttc gagttcccat tcgtgacgtc gcgggaagga gttacggcac cgggaagcgt    284640
     aaaacagccg tcgcgcgcgt gtggctcgcc ccgggctcgg gcgaacacaa ggtcaacggc    284700
     aagccctacg acgagtactt ctcctctccc gccgcgcgtg cggacatgat cgcgccgttt    284760
     ttcgtgagcg atacgttagg tttattcacc gccgtcgtcg acgtcagggg cggtgggatc    284820
     tccggccagg cgcaggcggt tcgtcacggc gtctccgtcg cgctgcaaaa ctacgacccg    284880
     gcgtttcgac cggcgttgaa agccgcgggg tacctgaagc gcgatccgcg catcgtcgag    284940
     cgcaagaaac cgggcaaggc caaggcgcgc aaatcgttcg cctgggtcaa gcgttagcgc    285000
     gtcgcgaccg atgtagtaca atttagagaa gcgacgttcg ccggcgcgtc ccgcccgcgc    285060
     gccgcacatc gacgcgcgca tgacggtcgc ccgcgcctcg gcccgcgcgc tcgctcgcgc    285120
     gctcaccgcg ctcaccgcgt cctcgtccgc ggcgtccgcg ccgctcgcgc gcgcccgcgc    285180
     gtcgccgcgc gccgtcgatc gttcgctcgg tgtgcgcgac ttcatcgccg cgtcgcgcgc    285240
     gacgcatcgc gcgtacggcg tcacggacga gcaggcgttc ggcgtggacc ccgtggacgt    285300
     cgccgcgacg aacgcggacg acgcttcgcg gacgaacgcg cgcgaaggac cgacgaagcg    285360
     gaagaatcac atcaaacgca tgaagcagcg cgaggcgttt cgacggtcga acgcgaagac    285420
     gcacaaggag aacgaacgaa ggaacgcgat cgagaggcag gagaaacgat tggcgcggtg    285480
     gcgagcgggg gtggcgatga aacgggagta cgagatgaag tacgggggag ggctcggcga    285540
     gacgacggcg cgaggcgaat gattaggttc ttccgcggga cggattttgt aataacagta    285600
     cagtaacgac ttgatttcga acgcgcgaga gtcgacgaac gcacggcgat gaagtacagg    285660
     ttgtgtgcgt gatcaataca tgcatgcggc ggaagcgttc gcgcgttacg atttgcgatt    285720
     ggagtctcgc gcggacgaat cccaaggttc cgggacccac gacgcatcga gtttttccgg    285780
     agctttgagc gtattgttgc cagcgcccgt ggcgcgacga atgggctcaa ttttgttcat    285840
     tgtggtgtgc atggcgtgcg cgaacgtttc cttagctttg tcgccgagag acgggttgac    285900
     gtctcgcggg ctcaactcgg cggcgtctag gaatcgatcc gtcgcggctt cccaagacag    285960
     cctgtacgag tcctgcgcgc tcagaggcgc aggttcggac gtaagcgctt gcttcacgca    286020
     cttggtgaac tcttgcgggg tgttatacac gaggcagttg gggaaggtgg agaagaactc    286080
     gttactcggg tgcttggcgc acacgacaaa cttgcccatc gccaacgcct ccgcggtcgt    286140
     cgtggcgacg acatcggaaa gcgatgggtt gacgaagact ttgtagtcat gaatgtccga    286200
     cgcggcgtgg tctttgcggc cgtggaaatg cagtggcagc ttcatctttt cggcgttgga    286260
     tttgacttcg gcgaagtcgt cgccgttgcc aaacacgtcg agctctagcg ggcactcgcg    286320
     tccgtcttca ctcacgttgt gctctgagac gcggtcgaga agctctttgt agccctttcc    286380
     ccacacaacc ttgccgagaa agtacgctcc tttcgtgaac acgggttttt tacttctctt    286440
     ctttttcgtc gacgcgctcc cgatggacgc gagcggcccc tttaccatct cgacgtcttt    286500
     ctctttcgtc gcctcgatcg ccttcttcgc gccgacgtct aggaagatcg gcgaaacgcc    286560
     gtgcacgttc atcgtcgtac tctttggaaa ctcttgcacc gcatcagaga gcttgatcac    286620
     cttgtggcaa tgcaccgacg agacgacgtt gttcacaaac ttcaaagcct tctccttgat    286680
     ttcgccattc tcttcgagtc gcacgtagtc caggtagttt gtgtgcacga tgcccacgac    286740
     gtgcttgaac ttgtccgtcc atcgttcgcc ggagtggtac cagttgagat gttcgggctc    286800
     ctccaacacc gctatgtctg attcgcgatc gcccggaatg tacgacgtca aatcgccaac    286860
     cggaatgatg ctgtacttgt ccgtcgcgta tctccccggg tagaacgaca gcttcatttg    286920
     cggcttaaat ccgcaacgtt cttcgaccca cttgttgacg tactcgccct gttcctccgg    286980
     agtgttgaaa atcattccgg ggtgcacgag cttttgctcg ttaggcgcca gaaaaggaat    287040
     gacgagcgtg acgtcgtgaa ttcctcgtcg agccaggtac gcggcgcgaa gcaatggatt    287100
     caccgccgtc ccggtcatcc acggcaacgt agcggtcgtg acgatggcga ccgagcgtcc    287160
     gggctctctc accgaacgcg gggcgtcttt gccgcgagac gccttcttca acgcctcgct    287220
     cgcttctagc tcagccgcga gctccttgct ctctgctcgc ttgagcacga ccccggggct    287280
     cgacaggctc gcatcgtacg gcgatttcac cacgatttcc tccggttgac ccgcgaatcg    287340
     tcgcacggcg ttttgcaagt ccgtcgtgag cttcggcagg ctcggcgggc gaggaagtcg    287400
     cgaggcgagc tcgtccttct tcttcgtgat ttccttcttc aagctctcga gcacgttcgc    287460
     accgccctcg cgcggactcg acgtctcaga aagcgcgcgc gcgccgtgat cggcgtcgcc    287520
     atcgcccatc gccgtgagcg catccgtgga cgagctgcgc gacatctcgc gaggcgaacg    287580
     cgccgtttcg ggcgcctcct tcggcgactt tcgcggcgac gtccccggcg atcggtcgac    287640
     cacggtctcc gattgcgcgc gccgacggtt cagcgtgcga ttgggtcgct gcggtgtctt    287700
     cgccagcgcc ccgtcgtctt ggttgaaatt cgtaccgatc gccttgaaca cgtcccactc    287760
     ctcgccccac tttggaatcg ccggcgcctt gggtatattc ttcgcgatca acgcctgcaa    287820
     gtcctgcgtc gacgtcggtc gactctttcg ctcgtctcgc ttgctctccg acgtcctgcg    287880
     cccgtctcct cccgcgcttc gtctcggcct gcgcaacttt tcaaaccgtt ccatgaattt    287940
     ggcgtcgtcc agcttggcca acgagtcttg gctcgctcgc ctcgccatct ccctgaacgc    288000
     gcttatgctc agcgtcttct tcctccccgc cctgtgcgcg cgcgcgtcgt ccccctcgtc    288060
     cccgctctct cgcgcgaact ctcctcccgc gctccctcgt ccgaaaccaa agctaaaatt    288120
     actctctctc cacgcccgct ccacctcgct cgaaaagtgt cgatggtgcc tatccaccgc    288180
     cgcgcgcagc gcgtccacgt tgaacacccc atcctgcccc gccgcgccct ggctcgtcgc    288240
     ccgcgcgcgc tcgcgaccca accccgcgtc cgttcgttcg cccttcaccg cgccgcttct    288300
     tcgctcgacg tccgtctcgc gcgtcgtcgt cgtcgtcgtc gtcgccgccg cgcgcgcctt    288360
     atcgcgtcgg ctcgcgtcgt cgccgtcccg gccccgtccc gcgtcgcgca tccgcgccgt    288420
     cgcgacgccc cgcgcgcgaa aaccgtcgcg ttttcgcgcg tcgcgtcgtt cgcgtcgtcc    288480
     ttcgtcccgt cgtcgtcgtc gtcgtcgtcg tcgtcgtcgt cgcgtgcgaa tgcgtgaatg    288540
     aacgaatgaa tctcttcgtc gcgtcgccgt ctcgcgcgca cgcggactcg cggcgccgcg    288600
     tcgcgccccg ccgtcgcgcc cgtgcctacg cgccgcgtcc gcgacgacgc gcgcgtcggc    288660
     gtgtgcggcc gcggtgaatc gattcgaatc gtaaagattc gcgaaaacac gcgcgcggcg    288720
     tcacatcgcg acgcgcgcgc gccggcgaag ccgcgcgtcg actcgacgtc ggaccgcgcg    288780
     cgcgcgacgt cgcgggacga cgcgcgcgcg acgcggcggc gccgaacgac gcgtcggaag    288840
     atttaaaaga tgcgcggaaa cagatgcgcg gcgacggcgc gcgcgacgga cgatctgggc    288900
     gcgcgaacgg cggcggcggt gtgcgatgac gatccgttcg cgttcggggc gcgcgcgcgg    288960
     gcgctgttcg aggacatcga cggggagacg ctggcggagg acgacgacga cgacgacgac    289020
     gacgcgagac gcggcgacgc gcgaaggatc ggtcgggggg tgagcgtgtt cgagaaggtg    289080
     cgacgggaga aggcggggac gacgatgacg gcgacgacgg cgacgacggc gacggcgacg    289140
     gcgacggcgg aggaagagga agaggacgcg ttcgacgagc cgagggcgaa ggcgaaggcg    289200
     aacgcgaaga agccggcgaa ggcgaaggcg ggacgcgaga gagcgaggga aaagaccgcg    289260
     cgggacggcg gtgatgacga cgtgatggtc gtggacgacg acgtcgggga gtgcgcgagg    289320
     ccggcggagg atttgtttga cgaagtcgcg gcgacgggcg ataagcgcgc gaaacgcgag    289380
     gtgaagacgc tggcgcggcc gaagaagcgc gtcgtggagg cgccggcggc ggtggtcgag    289440
     acgcatgcgg tgatgccggc gccgtcggcg cgcgcgaagg cgtcgacgac ggggcgaatc    289500
     cgggcgtcga cgtccgccgc ggcgtcggcg ccgccgcccg cgaagaagaa gaaggtgtcg    289560
     ctcaaggagt tcgccgggga agaagacggc gacgagggag ggttcgacga cggcgaaggc    289620
     gacgacgacc acggtctggt gccgcaatcg ggcgcgcagt tggcggacat cgatgaggcc    289680
     aactacgcgg tgtcggggtt gtccaccgtg agggacgtca aggagaagat gcggtgcgtc    289740
     ggcgtcttgg ccaatttgat gggtaatcag cgcacgcgca ggctgttggc gtcgtacggc    289800
     ataccgatga agatcatcaa ggctgcgcaa gacgccgcga tggcgccgca cgcgcccaat    289860
     gcgttgaagt ttggcgccgc ggcgctgttg tatctcgccg cgagcgattt gcgggcgccc    289920
     gcgacggacg cgatgcgcag cgtcaagtcg gcgaacgcga ttcgcgcttt gctccgtcca    289980
     gcgagttcga gcgatgacgc gctgtacttg aaaaccgcca acacggttcg ctcggcgttg    290040
     aaggcgttga agtttttgcc gaacgaggcc aaggacgcgc cgacgctcgc gctcctcgtc    290100
     gcgcatcaaa cgctcaaggg tgagcaggac gccgtgctcg cctcgggatc gggtccgggc    290160
     gcgggtgacg ttgaaaatag cttccgaacg attttggcga atcaaggcgc ggtgctcgcg    290220
     acgtgtgaac tcgtcgcgca agccacgacg acgttgagca aattcggcgg cgcgtgtttc    290280
     gtcgcgtcgg cgtcggcatc gacgaacgat agcgttgacg acgagtccac gatcgaggag    290340
     tacgaacaga gtgccgcgcg cgtgatcgcg cgtctgttcc gcgcgtcgcg tgtgctcgag    290400
     tgtgtgagct ttgaatcgcc agccgcgtgc gcggtgattt cgacctcggc gcttggcgga    290460
     tcgaagagag acgacacgaa cgccgatgtg cgccctctcg acttgctcgc cgtgtccacg    290520
     acgcgcctgg cgccggaaga cggtctgaac tcgtcgcgtg gcgatgggag aggggttgaa    290580
     tccgcgacga cgacggcggc gattgatatc ccgtcgcctt cgcccgtcaa atcacgcatc    290640
     ccgggtggaa tcacgatgac cccgccgagc acgcccggcg cggtgcgcgt cgctggaaca    290700
     tcctacgacg acaacgatgg tttaaccccg ctttcgtctc ctgtaccgat cgggttgatg    290760
     caaacagccg cgacgcgaga caacgcggca gcgattcagt ggttggcgga taacgtgcgc    290820
     acccccgtga agggtggatc gcacaacgcg cgaacggcgt gtcgagcact cgtggaggcg    290880
     cttccgacgc ttgcggcggc gacgacggcg tcggtcgtag gcgcgaagaa aggagacgtc    290940
     gtgcaaggca tcgagattcg ttacaacgcc gccatcgccg tcgaccaccg cgtcgccgtc    291000
     ggcgcgttga aatccgcgtt gtgcacgctg acgaacgtga cgaacgagaa taaggagggt    291060
     tgtgacgccg tcgttgggga agatagtcgt ggattactcg tcatcgcgag tttaattccc    291120
     tggttggcgt tatcgattga aggattcacg cttcgcgacg cgaaggagcg caagcgcacc    291180
     cgaacgccga cggatgattc cggatcgtca ctcttgaatg ccgcgctggt gttgctcgtc    291240
     aacatcgtcg aagcagatgc gacgacggca gatgtcctgc gcaacgcaat ggtgcgctta    291300
     ccgggcgact cgtctcgagg cgcgtccttc gtcgaagcgc tcacgatgtt gtacctgcag    291360
     tcgggcggcg ccgacgaaga cgaagacgag ggcgaaaaag agacggccga ggaggcgcaa    291420
     catctcacgg cggacatgat taaatcttac tcgtcgaaaa ccaacggcga cgatttgatc    291480
     ttacaggcgt actgcggatt gttgctcgcg tttttgatcg aagacgacgc cgcgttgcgc    291540
     gccgaagtca cgtcgacgtt tcccgaaaag ccgcaaggca cttcgcgtct caagccgttg    291600
     gccgacaccc tcgagcgttt ccacgcgttt cacgagagtt tgaatagcat ctctgccgcg    291660
     tccagcgagc gactggtaaa ggtggtgacc tggctccgat gacgagacga tttcgacgcc    291720
     gatcgcgtag ccgtgtgcgt tttcttgtga taaaaatgaa acatcgtcgc cttcgaagac    291780
     gacgcggagt ggtgcgatgc aagcaaggca gtgctttttc ttgtgcgcag ctcgtaaaaa    291840
     aacttttgct cgccaaaaga gaagtcgtga cccaggcagg agtcgaaccc gcaaccttca    291900
     gataacttca acggcgtcct cgcgttcgcg aggagactct cgaatcactg gagtctgacg    291960
     cactaccatt gtgctaccga gccatacata ttaaagacac atttaagtcc atatgatatg    292020
     actaaatgag cgataaactc caattaatgc gccctctcgc ggggatcgca catgtgttac    292080
     gggcgcgtcg acgcgcgacg cgtcgcgcgc gaattcgcgg tccacgttcg cgcgcgccgc    292140
     acactccgca cggatctctc acccccacca cacctctcga gcgcgttccg ccctcgtacg    292200
     gtcgataaaa cgcacgcagt tttatcgttt catcgtttca tcgcagttca ggtgcgggat    292260
     tcgcgcgcgc gcgcgagaag gacgacatcg ggcgacaccg cgggattcgc gcgaggggtc    292320
     ggtcgcgtcg cgcggtggat gcgcgacgcg acgcggcgcg acgcgacgcg aatcctcgtc    292380
     gcggtcgcgc gcgcgcgggt tcggcgatac gttttcgtcg acgtcgaacg cgcgcgcgag    292440
     gacgcgcgcg aaacgatcga cgaggcgcgc gcgcgtcgat cgaacgcgac gaggattcga    292500
     gggcgagata aagatgggag cgaaggcggg agcgaaggcg ggagcgagcg agcgaacgac    292560
     tgacgcgatc gatcgtcgcg cctgatgtag actacgaaca cacagaagaa gaatgcccgg    292620
     cacgcaatcg gtatacgtct cgctgtccat cctcgccctg acgggactcg tcgggaccgg    292680
     ggtcgccatc ggctcgggcg tgtccatgat gtccatggcc atggtcgagg aagagcaaaa    292740
     gcagcaagcg gtcgtggctt ccgtgaagga ggcgtcggcg cgcgtgccgt ctcgcggttt    292800
     cgccgcgagc ggtaactaga cggcccgccg tcggtaaaca tgtacctacc gccttcactt    292860
     ccggacgtct caaatccgcc gttcgtcgtg ttcgatacat tcttcacctc catcgtgtac    292920
     ccgtaaaagt tactcacttt cctgatctgt aataaaaaga agcggatgat gaaatattaa    292980
     ttacacaagt ttgtttcgcg gtttatttca ctgcttactt gattttcatg acgtccacgc    293040
     gcgtgcgctt ggcgacgtcg tgcgggtgcg attcgccgtc gtcttgtcca tccgtcgtcg    293100
     ggtgcacgac gattttcgcc aagccgccgc cgacggcgcc gcgcgccaat cgaccggggt    293160
     tgacgcacac gacgccgtcg atgtcttcgg cgaatgtttt caagtcactc ggcatgatca    293220
     acacgtccgg ggtttgctta aacgtcagat cctcgccgta acgcgcgtcc aagcacgccg    293280
     acgcgtccgg cgggtacagc gggtacgcgc agccttgcgt caagacgtgc ttggcgagac    293340
     gcgcgaggcg gtctttgggc acgaatccct tggagatttc ttgtgcgctc agatgcttca    293400
     acacgtcgtg cgagcacgcg gaaaacacga tgccgttgat ggtgaacgtc ccgggattcg    293460
     aggcggagaa cgcgcgcttg gcgcgcgccg cgtcggcgct cacgtacgcg tcgagcgacg    293520
     ccgcgggttg cgggaacacg ggatcgagcg tcacgtcgcg gatgctcggg acgaagatca    293580
     ctttcgtgcg gatcgtctcg tccttgaaga gcttgtcttc aatcttatcc accacaacct    293640
     tggccacttc gtcgtacgtc aaccccccgc actcggcgcg cttgacaaag gcgttttcgg    293700
     cgtccacgag cgggccacac aaaaccaacg cgtcgggatt ttcttcgcgc acgtaatcca    293760
     acatatcgtt caatggctcg tacttcaaat cgctcgagca cgagaacggc ccgctggcga    293820
     cgatgacttt cgtccctctc gcgaacgccg gcgacgtctt tttcgaacgc gcgggcgctc    293880
     gcgcggagac ggcgtcgatg gatttcgcca ccaagcagtg ccccgcgggg ttgcgcccgc    293940
     acaccttgac gacttgtccc gggaacaagc tgtactcttt catgtcgcga agctccaagc    294000
     gcacgcgcgc gccgaacgaa ccctcggtcg agccctcgat ggcgacggtt ttctccgtca    294060
     acttggcgtc gccggcgtgc gcgctcacca cgcgcccgac aaagtgtcca tcttcgtcgc    294120
     cagtctttga ccccacggcg gagacgcgca cgacgtcgga cgccgaagtc gtcgtctgcg    294180
     tcgcctcggt cgccttgacg tcctcgtcgt cgtccgcgtc gcccaaaacc tcgaacaaat    294240
     tctccgcgtc tcgaatgcgc tcgtcgacga cgcgcacgcg gtcggagatc ctatcccgca    294300
     tgtatcgaaa tttgtccgcg ctcacgattt gcgtcatcga cacttcgctc tcttccgcgt    294360
     cgtcccgttt caccacgtcg cttcccaagt gcgcgttcat caccgtcccc gcgccgccgt    294420
     cgctccgact cgccaaactc cccgcgctcc ccggcgtcgc cgcgcgtttc gcgtactcac    294480
     tcgtctgctc cccccccacc gcgttcagcg cctccgacca ctccctctta ctccgcatcg    294540
     gcgttttata cgtccccgtc gacgtcgatt cgcgtctatc gccacccttc gcgctcgccg    294600
     gcgtcgtcgg cgtcgtcggc gtcccgcccc gtcgtcgttt tcttccgaat tcgctcgttt    294660
     tctgcgccgt tttcgtcgcg ctctgcgatt cgcgctgttg tttccacgtc atcgcgaatc    294720
     gttcgaacgt ttcgatgcgc tcgatcgcga cgctctggcg gtctcgcgcg tcgagcgtgt    294780
     tcgagagttc taaatcaaac atcacccagc agtcggcgag atctttcgac gtgaacgaca    294840
     gcgcgcgcgc gaccgacgcg agcgcgtcgc gggcgacgtc gctcgggacg tcgaagccgt    294900
     gctcttcgaa gcgctcgcgg atgtcgggcg ggagggcggt cgtcatggcg cgcgacggcg    294960
     tgtggcgatc gcgcggcgag gcgtttgaaa atttaaaatc cgagctgtcg ggggtgtacg    295020
     aacgcgcgac gacgcgacgc gacgcgaagc gcgcggaatc gcgatcgatc acttcgggcc    295080
     gtcgccctcg cccaggacgg tcttttggcg cttcgcgtcg cgcgcgtcgc cgacgctgaa    295140
     gacgtcgtcg aaggtttcga gcgcgtttaa aaacgcctgg tccatgttga agtacttgta    295200
     actcgcgagg cggccgacga agacgacgcc gggctctttc gccgccatgt cgcggtactt    295260
     ttcgtataac tcgcggttgg cggggttggg aacggggtaa tacggctcgc cgtgatcgca    295320
     cgagtactct ttgaagacga cggtgcccgc gtgctcgcgc gcctcgcgcg gctggttggg    295380
     cttgtgcttg tactcgacga cgcgcgtgtg ctcgacttcc ggaccggggt agttgagctg    295440
     taagcacggt tggtagaaga atggtttcgt tttgtcctcg ccctcgtggt actcttcgaa    295500
     gaaacgcaga cttcggtact cgagcttggg caaaccttga gacgcgtacc acgcgtcgat    295560
     ggggccggtg aagacgacga actttcgcgc cttgcttctc aacatgtctt tgtgctcaaa    295620
     aaagtcggtg ttcaggcgca cggtgatgtt cggatcgccc atgatcatat tttcgaaaat    295680
     cctcgtgtac ccgtgcttcg gcaacgcttg gtgcggatcg ctaaagtacc tatcgtcgac    295740
     gtcttcgcgc acgggtatcc tcgccaagac gctcgcgtcc agctcctcgg ggtacttatc    295800
     ccactgcttc ttcgtgtaat gcttaaatat cgcctcgtac agctccgccc ccgccctcgt    295860
     cagcgcgctc tcttctccgt tcttcggatt ctcgttcacc gaccgtctgg cgtccaacca    295920
     tcttcgcgcg tcctcgtccg tcttcaaatc cgcctcggga aacagcgcgt tgatcgtgtc    295980
     cctgttcggc ggcaccccca cgattcggta ccgcctcccc ccgtgttcgt actccccgtc    296040
     ctcgcgctcg atcgccgcct tcactcggtg ttcgtacggc gtccactcgc tgaatcgatt    296100
     cacgtattcc cacacccgcg cgtgcttcgt gtgaaacaag tgcacgccgt actgcgacac    296160
     cctgaacccc ttcgcgttca cgaagtcgta gcagttcccg ccgacgtgat cgcgcttgtc    296220
     cacgagaagc gtcttcatcc cgagctctcg cgacgcgcgg ctcgcgaaga cgcagcccga    296280
     gatgccggcg ccgacgacga cgaggtcgaa ctcgcggtcg cgaatccgcg cgtcgctcgc    296340
     gacgccggcg aaccagctcg gatcgtggtc gttgccgcga cggacggaga cgtccacgcc    296400
     cgcccactcg tcggcgtcgg cgcgcgcgcg catggcgacg cgacgcggcg cggtgtgcgg    296460
     cggagcggtc ggacgtcggc gaacgacgac cggtcggcga cgaccgcggc gtcgcgcgcg    296520
     acgtcgagcg acggcgcgcg cgcgtcggcg cgtcgtcgac gtcgcgtcgg cgcgcgctct    296580
     cgcgccgtcg cgcgtcgcgt cgggacaccg cgacggcgtg aagagtcgaa tcgtcacttc    296640
     ggcgcgccat gggcgccgcg ccgtcgtcgc cgtcgtcgcc gtcgtcgccg tcgtcgccgt    296700
     cgtcgccgtc gtcgccgtcg tcgccgcgcg acgccgcgcg cgcgtcgtcg tcgccgccgg    296760
     acgacgacgc gccgacgctc gcgcgcgcgc gcgaggacga cgcgacgctg cgaacgagcg    296820
     aaccgttgtt gacgccgcgc gtggcgcgcg cgctgcgagc gcgcgtcgag ccgagggcgg    296880
     gcgcggtgac gtggacgcgc gcgttcgatt cgcgcgcgtg cggattggcg agtcttcgtc    296940
     gcgtcgtcga gcggtgcgcg ggcgtcggac gcgcgctcgt gctcgtgcaa cccgaggcgg    297000
     cggacgaggc cgaggccgag gacgaggacg aggcgtacta cgtcgcgcac gtctcaccgg    297060
     gtttccaagc gaagcctcgg cacgatttcc acggcgacga cgcgtgcaag acgtttcgcg    297120
     tcgacggaaa acgcggcgtc gtcgtcgaca cgtccggggt ctccgtcgcg ccgctgtatt    297180
     gcgcgtacgg ctactcccga cacggcgacg tcgtcaacgg gttcgggatg ttcggtaaga    297240
     tcgggcgcca cgccttattc gtggacgccg ccctggaaaa cgcgcacgcg gacttcggcg    297300
     cgcgtcgctt ctccgtgcgt cgcgtcgaag tctgggcgct tgaggcgcgc gcgcccggaa    297360
     tcgacgccgg cgcttcgccg cgcgcggcga cgcgcgatcg agcgacgatg gcgcagttta    297420
     cgtcatccgc gatcgcccgc gacgtcctcg acgccacgac cggctgacat caagaccgcg    297480
     acggaacgtc gaggaaagat ctcgtcgacg cgctgtttcg cgagtgcggc ggaccagaag    297540
     gtgtgggagg cgctgacgga tacgcgcggc gtacgaggcg acgttcgcgg cgattgagga    297600
     cgcgcgtcgc gcgagataga tgatagattg atactagata gatctgatgc agctcctagg    297660
     cagtctccta cgcggtagga gaccttgttg taacatacga tgtacgacgg atccaaaaag    297720
     tgcgagcacg tcaccgtcga cgacccgtcc tcgagcgcgc gagcgcgacg cgccgttttc    297780
     agtgacaaaa aagaatggca actttgttac ctcaccggga ttcgaacccg agtctgttcg    297840
     tggaagcgcg tggcgtgtcc gtcagtgtcg cgttcacaat ttttggtgtc aacgtgtccg    297900
     ttcgcgtgtt cacgtgcgat gggcgcgaag atgcgtagaa tacgtacctc tagggtgaaa    297960
     gcctagcgtg ataaccatct acactatgaa gtaccgctcg accccgcaag gggccgcagc    298020
     gatcgatctc tccgatgttt cggagttcac gggatgtact catgtttcag ctcgtccaca    298080
     ctttcgtgtg gctagataga gatgtgtgcg gcttgacacg acgacgaggt cgaactcgcg    298140
     gtcgcgaatc cgcgcgtcgc tcgcgacgcg gcgtcgtcgc gcgtcgtcgc tcgcgggtgc    298200
     gcgcgcggcg ccatcaccgc gcgccgcgaa gtgacgacgc ccgcgccgct caggaaaaat    298260
     ttatatatcg cccctttaga gagtacctac acacatgacg agtcatgaac caaggatgcg    298320
     gggagatctc gccgtcggcg ccactcgtcg ccgcatacga tgaccgattc agtcgcgcac    298380
     gcctcaccga cgtggagaac gtactcatta gacccgtcgc tgcaaccgga ctggatgaac    298440
     ggcacggcgg aggtagaggc ggtcaaaaca gcggaggatg aactcgagcg ctcgtacaag    298500
     aacaagccat tcttcaagaa cacaagctac gaggcattcg ccagaaaacg aggcgagtat    298560
     gataaaccga cgcccgacgg cctcgaggag ttcaagcgtc tcctacgggc gagttatctt    298620
     cgcaccgtag agcgcatcga tgaagatacc caagttctgg aagcccagct acaagacgag    298680
     aatatctctg aaacgcgacg gtcggttatc ccgcagcaca tcgaggacac tcgtgcgaaa    298740
     ttaaaagagc aagacaattc attgaacgcg ctgtgcgccg atgtggatgc ggttatcgca    298800
     gatttgaaag gcttgcccga taaaattgcc gacataaaag aacacgcctc tgaacaactt    298860
     cagcaacaca aaagaaaaag aaccagtata tctttggaac gcaacctcga ggagctgagc    298920
     gatgcgctgc gcagctacga ggcgaaaaaa gaacaggaga ggctcacaat taccgattat    298980
     cgtgggaaat atgggtcatg tccatcccag tatgttcgcc agaccgcctg ggcacgcaga    299040
     ccttctggtc gtgaagaaat tagcttcatt gttcatcctg tgggtgtcat tggctgcgat    299100
     ggcagtaacc tgagcgttga tggacgtgtt tcgattgatg gttatggtga gtttaacgta    299160
     ccaaaatggc agcctgaatg gggacctgag aagcaaatgt gtgcgtgcga atgcttccaa    299220
     gagtggtaca aagtcgacgc ccaagacctt ctttacagcg cgcttcgtgg cgtagagggc    299280
     gcgctaaagg cgctcagtgg ttcgggagat gacacgtctt cgcttcgacg gcgcttgggc    299340
     gatgccaatt tggacgaagc aagcacgggg agttaatata tgtggacgta tattttgttg    299400
     tccacgaatg gcgcgatata gaataacgat aactagccgc tctccaccgc ctccagtctc    299460
     gacacagtat cactgagttc actgcgaagt tcgtcgattt gctgatctct cgaggcaacg    299520
     gcggcctcta aatcggcgat ttgagcgtcg tgctcgacga ttctttcgtg cagctcctgg    299580
     tttgacttga cgagcacagg aatgatttga gtgtattgcg cgtacggcta ctcccgacac    299640
     ggcgacgtcg tcaacgggtt cgggatgttc ggtaagatcg ggcgccacgc cttattcgtg    299700
     gacgccgccc tggaaaacgc gcacgcggac ttcggcgcgc gtcgcttctc cgtgcgtcgc    299760
     gtcgaagtct gggcgcttga ggcgcgcgcg cccggaatcg acgccggcgc ttcgccgcgc    299820
     gcggcgacgc gcgatcgagc gacgatggcg cagtttacgt catccgcgat cgcccgcgac    299880
     gtcctcgacg ccacgaccgg ctgacatcaa gaccgcgacg gaacgtcgag gaaagatctc    299940
     gtcgacgcgc tgtttcgcga gtgcggcgga ccagaaggtg tgggaggcgc tgacggatac    300000
     gcgcggcgta cgaggcgacg ttcgcggcga ttgaggacgc gcgtcgcgcg agatagatga    300060
     tagattgata ctagatagat ctgatgcagc tcctaggcag tctcctacgc ggtaggagac    300120
     cttgttgtaa catacgatgt acgacggatc caaaaagtgc gagcacgtca ccgtcgacga    300180
     cccgtcctcg agcgcgcgag cgcgacgcgc cgttttcagt gacaaaaaag aatggcaact    300240
     ttgttacctc accgggattc gaacccgagt ctgttcgtgg aagcgcgtgg cgtgtccgtc    300300
     agtgtcgcgt tcacaatttt tggtgtcaac gtgtccgttc gcgtgttcac gtgcgatggg    300360
     cgcgaagatg cgtagaatac gtacctctag ggtgaaagcc tagcgtgata accatctaca    300420
     ctatgaagta ccgctcgacc ccgcaagggg ccgcagcgat cgatctctcc gatgtttcgg    300480
     agttcacggg atgtactcat gtttcagctc gtccacactt tcgtgtggct agatagagat    300540
     gtgtgcggct tgacaccgca catctgatga atgactgtgc gctaaacttt ttcacccaga    300600
     aatcgcgtcg acggacgcgc gaatgttacg gtcgggcgtg acgtgttttc gcacgccgcg    300660
     cgccgcgcgt cgtcgcgttc gtcgcattcc gcacttcgcg atgccgccgc gaaagcgcgc    300720
     gcgcgaggct tcgggcgacc cggtcgaaac agaggagggt tcagcgcgcg ctcgggattc    300780
     gaccgaaccg ccgtcgacca ccgcgccgtc ggcgccgtgc ccgtacctgg acacggtgaa    300840
     cctcgcgaac ctggattttg actttgagaa gcggtgcgcg gtgtcgctgt cgcccgtgca    300900
     cgtgtacgcg tgcttggtct gcggcaagta cttcgcggga cgaggaaaga agacgcacgc    300960
     gtacgcgcac gcgctggagt gcggacatca cgtgttcatg cgcctggccg acggcgcggc    301020
     gtggtgcctg ccggatgggt acgaggtggt ggacgaaggg acgacgctgt cgaggattcg    301080
     agacgtgctc gcgccgacgt acgcgaaaaa gtacgtggag gaagagatcg agggcgcgcg    301140
     accgatgtgg cggcgcgcgc tggacggcac ggagtttctc gtcggcgtcg tcggattgaa    301200
     cgcgatttgg agcaaacgcg acgacggcgt gagcgcggtg ctgcaatcgc tgaacagagt    301260
     ggcgccgctg cggcgcgcgc tgttgctcga cgacgcgagg gaacgcgagg acgtctatcg    301320
     cgccttggcg gacatcacga agaagatttg gaacgcgcga aattttaaag gtcactcgag    301380
     cccgcacgag ttcatgcaag cggttcgaaa tcgatcgaaa gacgcgttcg gcgcggagac    301440
     ggggaaccac gacgccgcgc agttcttgcg ttggttgctc aacgaattga ttcgcgacga    301500
     aaagaaacgc ggcgaaaagc gatccgtcat tcagtcgtgt ttccagggag aagtggaaat    301560
     catcgacgat tcgtccgcgt cgcgcgcgtc gccgttcctc atgctctcga tggacctccc    301620
     gaacgcgccg ctgtttcaag acgtcatgga gaagaacatc atcccgcaag tctccctcga    301680
     gcgcgcgctg ctgaagaaat tcgacggcgt caccgcggac cccaagacgc ggcgcaggtt    301740
     caagatcacc aagctcccaa actacttgat cgtgaattat tcgcgcttca ccaagaacaa    301800
     cttcttcgtc gaaaagaacc cgaccatcgt gacgtttccg acgcgggggc tgaacctcgc    301860
     cgatcacatc ccggtgccga gaggggacga aaattcggcg acgtacgatt tgatcgccaa    301920
     catcgtgcac gacggcgcgc ccgacgacgg gtcgtatcgc gccatggtgt accacgcgcc    301980
     ggataaaaat tggtacgaga cgcaggattt gcgcgtcgcc gaggtgttgc cgcaacaagt    302040
     caacctcacg gagacgtacg tgcagattta cgagcgtcga gacaagcgac gagacgcgta    302100
     ggactcgaaa accacattta gaataataat agaaaacaaa cgtctcgcga tgacgaatac    302160
     aacgaataca aatacaatac acacgtcgcg cgtcgacgga cgctaatcgc cctcgccgcc    302220
     ctcgccctcg ccctcgccct cgccgtccca cccgagcgct tccatcgcgt tcgcgagctc    302280
     cgcctcgagc acgggcgcgt ccgccgcgcg cgccgccgcg ctgttctcca ccgtcgcgtg    302340
     atccaccgcg ctccgcatcg aatacatcac ccgccactcc aacgcccaag cgtccacggg    302400
     tccgaacgac cgcgagtcct cgtgtctccc cgcgctcttc gccgaatccg tctccgcgtc    302460
     cgcgtccgcc gtcacccacg cgtgatcctt cggcaccacg tacacgctcg cgttcgccgc    302520
     gtccacgagt tcgtcgccct ccgtcgcgct cacgcgtcgt atcagcgttc gcgtcgcgtc    302580
     gctcgggtgc gcgaacgcca ccacgtcccc gatcgcggcg ctccgaaacg ggtgcgccag    302640
     ccttcgcgcg agcacgtact ccgtcccgga tcctcctcgc gcgctcgacg gtcccggcgc    302700
     gtcgcgcgcg ccgccgcgca gcgtcggcgt catcgcgtcg ccgcgaaacg cgaacacgcg    302760
     cgtcatcgcg tcctcgccga tcgcgcgcac cgcctcggcg agcggcgcgc gcggcgcgcg    302820
     cggcgccgtc gtcgggtcgt cgtcgtcgtc gtcgtcgtcg tcgacgtcgc gcgagcgcgc    302880
     ggtcgcggcg acggggcgcg cggcggcgga cgacgcggcg acgagggcgg ggacgaagag    302940
     cgtcatgatt cgctcccagt ggtacgacag gcggagggcg cccatgacgg gcgtcggcgc    303000
     gtcgacgagt ggcgcgggcg cggcgcgagc gggctcgatc ggcgcgtacc gctgtctgtg    303060
     aaacgtggct aatgattcgc gacgatctcg aacgtcgagt cctaaacgct aggttttaat    303120
     tcgcggtttc gtccgccgtc gcgtcgatcg cgcgatcctc gatgcgcttt tcgcggcgat    303180
     tccactgggc gcggtcgcgc gcggcgagga gcaaaggtat ctccggcgga acgggcgcgt    303240
     cgcgcctgac gaagcaatcg cccatgaact ctttctcttg ttcgtctttg cacgacacgc    303300
     gctggaggaa atcgagcggt gatcgcggca cgccggtttc gtggtgcttc gagcgaaacc    303360
     gcgcggcttc gatgtaggcg ccaaagtcgc cgtgtttgac gccgagaaga tcggcgtcgg    303420
     aggagcatcc gcccatttta tcggctttgg ggaacacggt ggggcctttg gcgagcaccg    303480
     cgcacaggcc aaccttgatg tccgtgcttt gcactcgcaa gagcttgcgg aagccgggag    303540
     accacgtgct cggatgatcg taccgccaac tcgtgtactc gttgtacctc gactcatcgc    303600
     tcgcgatcgc ctcgagctcg gccgcgagcg cctcgaagct atcgtagtcg cgcaaatcaa    303660
     tgtatgattt cttcgtcggc atgagctcgg tgaacgaatc gtgaccagtg tatatcggaa    303720
     tcgagccgcg ggcgagcgcc atccacacct tctccgtcat gtacccttgg cacatcggtg    303780
     cgttctccac ggcgaaataa aacatgtagc gcgccatctt actctgatac tccaggtttt    303840
     ccaccccgcg gccgggcaag ttgcgcggca agtggtagtt attgaagcaa ttccccatgg    303900
     aaaacgtcgg aaagtgttcg gcgagaccga cgacgatgcc gggtcgcgga ggaaggcaat    303960
     cgatggcgat ccaagccacc gcgggaatcc tctccgagtg aggaatcgtg tacgcgggga    304020
     aatcttccgc catcgaatcc agcgacgggc cgaacggcca ccaaatagcc gaccgtttct    304080
     gatcgaaata cccgacgtaa tcgaactctc tgacgacttt cgggttttgc aaatccttcc    304140
     caaaagtcgc cacggcttcg tgcgccatgt acacgtccac ctgacccggg tctatctttg    304200
     caggtttcgc gtacgaaccg tctttccctt tattcttgcc gcgccacaag taccccgatt    304260
     gactaaacac tctcacgtcg gctctcttgt cgccgtcgca tccgatgacg accttctcca    304320
     cgcacgcgcc gggagtgaac aaccttccga accctttcac gtaggtcgag tcccaggcat    304380
     ccgccggcat gtccacgcac atcgtgaacc cggtctccga gcgcgtcacc gccggcgcgt    304440
     gcgcgtacga cgacacgtcg acgtcggcgt cgtagcctcg aaacgcgtcc ggcagatacg    304500
     cgtgccgaat cggatccaac gccgccgcca ccgcgagctg atccaccttc ccgtgcgcgt    304560
     tcctgtagta cgcctgcgcg atcatcgcct tccgagtcgc cctcgcgtcg ccgagcttcg    304620
     ccgcgctcgc gccgagaccg ccgtctcgcg tcgccgccgc cgccgcgccg atcgccgcgc    304680
     acgccgccag cgcgcccgcc ccgacccgcg cccgcgtcca ccgtccgccg cgcctcgcgt    304740
     cgccggcgtc gccgccgccg ccgtcgcctc gcgcgcgcgt cgcgttcgcc gtcgtcgtcg    304800
     tcgcgcgctc gacgtcgtcg aggtgttgac gccatccttc gtcatccgtc gccgtcgcgc    304860
     gcgcgcgcgt cagcagggac gcgcgctcgg cgctcgccgt cgacgccgtc ggcatcgcgc    304920
     gtccgacgcg cgcgtccgtc gcgacgcgcg acgcgtcgtc gtgtgtcgtt cggtcgcgac    304980
     gaccgacgaa gggtgttgac gcgccaaagc tctaaaccct acatcgccgc gcgcggcggc    305040
     gcctcgcgca tgcgcgcgcg cgcgcgcggc gccctcgagc gcgccgaacc ctccgcgcgc    305100
     gtttcccgcg ccgcgcgacg gcgcttcccg cgccctcgcg cgccgtcgcg cgcgacatcg    305160
     cgcgcgaacg accgatttcg cgacgcgcgc gacgacgacg acgacgacga cgcgcgcgcg    305220
     cgacagttcc tccgactcgc gcgcgacgcg cgcgatggat cgtgggcgct gcagagcgcg    305280
     acggtgacgc tgcggccgcg cgacgcgagc gcgcgagcga cgcgagcgct gcgggtgtgc    305340
     gcgctggtgc actacggcga ggcgcggtac tatcgcggcg tggcgaagga cttcgagacg    305400
     cgcgagaacg acgcgacgct ggtcgagctg atcacgtcga ggaagcactt ggaagcgagc    305460
     gacgagcgag ggctgaaact gtggcggttg agcgaggcgc tggcgccgac ggcggaggcg    305520
     cgagcgctgg cgaacgcgca cgggttgcgc gcgcagctgg acgcgctgga cgcgagggcg    305580
     cgaggatggt acgtcgcgga cgtgacgcga gaggagttga tcgcgctgcg acgagaggcg    305640
     ggagagatga cggcgaagac ggcggaagag acgacgcgaa acgcgaagcg gagcgcggtg    305700
     tcgatgggag ggaatctgcc gccggcgctc gaggcgctgg cggtgacggc gttcggaagg    305760
     gcgtcggagg gcgatcccgc gaggctgttc gcgcggttga gctgttggtt cgtgccgtgt    305820
     ccggaggcgc atttgttgct gctcgattgg gtgtgggcgg gcgggcgtcc gtccgaggtc    305880
     ttgggcgcga tggtggactg ttgcgcgtcg ggtgatttag aatccgcgcg tcgcttggcg    305940
     ttcgcgcaga tgatcgtgag cgcgcaagcc gaggggccgg cgggcggcgg ttcgaccgag    306000
     cccgttttgg tcgcccgacg caacgacgtc gcgatggacg gggtgaacaa ggcgttcaag    306060
     gcgcccgaaa tcgacaccgt caacctgttg tacggcggtt tgcacgtccc gggactcgtg    306120
     cggtgcgccc gcgagcgttt agacatggaa gtcgtcgacg tggcgtggcg agacgcctgg    306180
     cgcgtgcaac cgccggagaa cgcgtcgcct ctcagatacg ccatagtgcc gctcattctc    306240
     ggcatcgacg gcacggattg ggcgcaaacg cttcacgacg ccgtcgcgct cggcgcgagc    306300
     gccggtattc tttccacgtt tctctacatc gttcgtcacg gcgcgctgta ttacgccctc    306360
     ggcaagtggc ttctcgagtg gaatcgccaa ctcttcgacg ccgacgtcgg tccgtcgccg    306420
     gagaatgtaa aatatcgtta atcgcctagc caacgacttc gtcgtccgtc gtcgcgcgtc    306480
     gacgccacac catgcctcgc cccacccccg cgccgccgcc gccgccggcg gcgcgcgacg    306540
     tcgacgtcga gcgcgacgcg ctcaccgcga tgcgcaaaga cggcacgctc gacgccctgc    306600
     gcgcgcgcgc ggtcgagcgc gttcgcgcgg acccagagat gaaaaccttc acggaattcg    306660
     cggcgcgcgc gtcgcagacg ctgcgcgacc cgcgagcgag gcgcgcgtcg aggaaagatc    306720
     tcgtcgacgc gctgtttcac gagtgcggcg gacagatttt gaagcaggcg gaccagaagg    306780
     tgtgggaggc gctgacggat acgcgcgacg aactcggccg cgcggcgtac gaggcgacgt    306840
     tcgcggcgat ggaggacgcg cgtcgcgcga gatagatacc gatagataat agattgataa    306900
     tacatagatc tgatgtagct gatgccgccg ccgtcgcgtc ggacggatcg cctcggtcgc    306960
     cttcggttcg cttctcggcg gcggccgccg acgcggacgc cgccgcgcgt cgcggtcgtc    307020
     atgcgcgcgg ttgtgcggcg acgatttatt ttacgccgcg cgacgggcga gcgacgccgg    307080
     cgaatcgagc gacgctgaat gcccgtacgc tggaatcgcg cgcgaacgct gacgcgacga    307140
     ttcgtccgag tgggtggtta ggcgcgcgcg gcggcggcgg cggcgatgcc gtcgcccaac    307200
     gcccagctcg cctcgacgtc tcgacgccgg taacgaatct tgtcgagcgc gcgaatcgtc    307260
     tcgtcgtccg cggcgccgtg accgacggtg aggagggcgt acacgtagac gaggtcgagg    307320
     cagaggtagt tgacgtcgac ggcgtcgcgc gcggcgacgg ggaagcgagc ctcgagctcg    307380
     gcggcgggcg tggagcacgc gcgaagggcg gctcgcttca cgtcgcgcgg tgtcatggtc    307440
     gcgatatcgg tcgggcgcct cggcggcggc accgcgccgc cttgaatcgc gcgttcgacg    307500
     atgaaggaca tgacgaagag gggcgttttg cgcggcgtcg tccaagcgcc ggcgaacgaa    307560
     cacggtgctt tcgcgcaatt tccctcgagc gcctgcgtcg tggcgagcag acaccgtgta    307620
     aagtcgctgc cgtcgctgga tccgatggcg gcgtacgtct ccccaggctc gagcccgtag    307680
     caatcttttt cgcacgaatc cgcgaacgcg ttcggtaagc acggatgcga accgtcttta    307740
     ttcttcccca cgctaaatat cttcggccgt acggcgacga taccgtagcc cttaaacgaa    307800
     tgcacgtatg tcctatacgt cgtcgacgcc gcctcgatgt cgcgcacgta ccctttcggc    307860
     gcgtccttcg ccgcgccccc gcccaccgcg tacgcgattt gcgtactccc gccgcctaaa    307920
     tctaccaccg tcacagtctt ctccggcgcc ccgccgagat tccctagcaa ataatttaca    307980
     ctcacccacg cgtgcgcgcc ctcgtcttcg ccgtccatga tgctcacgaa cgacgccgac    308040
     gacggatgaa atcccgcgtt cgcgattttt cgtcgcaccg cctccacgat ggcgtccgcc    308100
     gcctcccgcc cttcgggcat cagtctcaat cccgccgtcg cgcgcacact aaacggtgtt    308160
     tctcgtctcg cgctctccgg cacgactcct ttcgccacgt cgatcagcgc ctcgatcgac    308220
     gtcgccgccg cctcggcgtc gccgccgtag ctcttcagtc ccggttcgat cgagcgaaac    308280
     gtctcgtctc gcagcgcctc gccgccgctc gcgaacgccg atcgagagaa cgtgaacacg    308340
     tgcacgcgcg tgcccgtgga gccggcgtcg atgacgacgg cgtagcgtgt tttcgccgcg    308400
     cgcgtgctct caaagccggt gacatcggcg agcgcgctga gcgcgacgag cgcgacgacg    308460
     aggacggtga aggcgacgac gagggcgagc tggcggaacg ttctcgcgcg cgcgtactcc    308520
     tgggtctggg ggtacgattg cgcgcgggga agaggcatcg cgacgcgatg taaccgcgct    308580
     cgacgcaggc gagcgggacg cgcgagcggg acgcgagaac gccgcggatc gatcggcgtg    308640
     tcgcgcgaag gacgaccagt agtacacgta ttttacattg acgatgtccg ttacgtggga    308700
     caacgagccg cgagcggcgc gcgggcgagg ccgaggacga gggcgacggc gccggcgatg    308760
     agtgcgagcg ccgcgaaaaa gccactcggg gagtcaaagg atgggtacgt ggagccgagc    308820
     acgccgctga aatagttgcc gaagaagtat gagccgaacc ataaaccgat tatggcgctg    308880
     agtaaaccat ccggagcgat tttggaaatg taagaaagcg ccacggggaa ggtgaagagc    308940
     tcgccggccg tgaggaaaat ctgattgagg acgatccaaa acacgctcac gcgagtcggc    309000
     gaggcgtgcg agtcgatcgg taaagcaccg aacatcagca ccgcgaatga tgaagacaga    309060
     agcgcacacc cgatggcaat tttcgacatc tggtgcggct ccgcaccgcg tcgcgcttgc    309120
     caatcccaaa gcgccgtcac cgccggcgtc agcgagagga cgagcaacgg attcaacgct    309180
     gcgacgaact cggtcggcat cccgtgtaaa tcgacgtgct cgtccgagaa caacatcagg    309240
     gtgcttcctg attgttcata aaccatgcta aatccgatcc cagccacgca aacgatggcg    309300
     acggcgaaca tggcgttcga gttttcgcgt atcaatcgcg ccatgtcgtt gagactcttg    309360
     cgtgattcgc cgtttgaacg cccgttttct tcttcaaaat cttgttcgtt cgatcccatc    309420
     cgacgcagcg ggcttctgga ctcctcgtca ttgtcgttcg ccgacgctgg aatcatggcg    309480
     tccacgacgt gcctgcggtt caaggcgtaa attgccaacg cgcaccacat tcccacggcg    309540
     gcgctcgcga acgcggcgcc gtaaccaaag tacacgcgca ccgtcccagc gatcaagggc    309600
     gaaaagaacg ccccaacatt gatacaacaa taaaaaatac tgaatcccgc gtcgcgtttc    309660
     ggatcatcct tggcgtacaa cgcgctcaac tgcgtgctaa tcgaaggctt aaacgccccg    309720
     tttccgacgc acaccaacgc caacccgatc aaaaacgccc actcgctcgc catggcgccg    309780
     taccctaacg ccatcaccac cgcccccacc actgcgcttc gatgcgcccc caaaaccgcg    309840
     tcggcgacga tcccaccgaa cactggcgtc aggtacgcca aacacgcgaa cgcgccgtac    309900
     gtcttcgcgc tcgtcgcctc cgccgctcgc gtcctctcca tcatccccac cgcatcgctc    309960
     gcgttcaccg ccatcgcgaa atcataattc gagaacgttt tccccaccgt tcgcagtccc    310020
     aacacgcgct cgacgtcgaa cgtcggatcg cgcaatacct tcgtcacgta cagcgccaac    310080
     agcgcgcgcg cggcgtagta cccgaaccgc tcccacatct ccgtcgcgcc caggacgacg    310140
     agtccgagcg ggtgcgcgcc gcgcatgatc gtcgcgcgcg cgcgagctcc cgcgtcccgc    310200
     gcgcgcggct ccagcagcgg tcgcgcgtcg ttttcgtcgt ccgagggcgc gctcgaggtg    310260
     ccttcgccgc gtcgatcgcg cgtcgtcgcg tcgtcgcgcg acgccatcgc gcgcgcgcgt    310320
     cggcgacgac gattcgcgcg cgcgcggtcg tcgctcgacg acgcggcgtc gcggcgcggt    310380
     gtggcgacgg cgccctcacc gacgacggtt tgaaatccga gtcgtcactc ctcgaagcga    310440
     cgccgacgtc gcgagcgcgc gcgcgcgatg gcgtcgagcg cggtcgcggc gcggtgtgga    310500
     acgctcgcgg cgccgacgcg cggcgcgcgg gacggcgcgc gcgcgcgaaa gactcgcgcg    310560
     agggcgatga agatgacgtt gatgccgctg gcgccgggcg atcgcgcgac gccgcgacgc    310620
     gcgagggcgt cgtcgtcgtc cgcggggggc gcggaaagtg agaacgcgac gacgacgtcg    310680
     tcgagcgggc gagagacgcg cgcgaacggt ggcttggcgg cggtgacggc ggacgtcgag    310740
     cgtcgcgtca acgaggcgct catcggcgtc gcggtgacgg tgatcgataa tctttacggt    310800
     ggacgctcgt acgcgcgatt tcacgcgctg gagacggtgg cgagagtgcc gtattttagc    310860
     tttatgtccg tgcttcacct gtacgagacg ttcgggtggt ggcgaaaggc ggattatctc    310920
     aaggtgcact ttgcggagac gatgaacgag tatcatcact tgctcatcat ggaatctctg    310980
     ggcggggcgg agctttggaa ggatcggttc gtggcgcaac acatcgcggt ggcgtattac    311040
     tggatttgcg tcgcgcagta cttggtgtcg ccgagatggg cgtacaactt gctcgagcag    311100
     gtggaatcgc acgcgtacgc gacgtacgac ggatttttaa acgccaacga ggaggtgctg    311160
     aaggcgacgc cgccgccgag cgtggcggtg cagtactaca ccaagggtga tttgtacttg    311220
     tttgacgaat ttcaaaccgt cgatcggggc gagagacgac cgaagattga caatctgtac    311280
     gacgtcttcg tcaacgtacg aaacgacgaa gccgaacaca tgaagacgat ggaattttgc    311340
     cagcgtcctg gcaacggctt acgctcgccg tcgagcaagg aggcgatggt attgctcagt    311400
     aaagacgctt gcgaggtgga cgaggacttc caagtcgatg aagattgtga gaaggcgtcc    311460
     atcgcggcga gcgccgagga cgagcgcgtg tgcgaaggct tggtcgactg cgtcgtcaac    311520
     tttggcacgg gcgcgatgag ttacgagccc gaggtcgatc gcgagtgatt tcaatccggt    311580
     cgtcgatttt accgtcgcgc gcgcgacgac gccgacacac tacccatagt acaacaatta    311640
     cgagcgacga atttctagat tttaacgacg cgcgtcgccg cgtttcacac ccgtcgcgtc    311700
     actccgcgcg aacgacgcgc gacaccacca tctcaaacgt gtcctcgacc accgcgcgct    311760
     taatctcttc cctcaccgcg gactctccca ccacctcgca ctcctcgtcg acgtccgtcg    311820
     tcgacgtcgc tcgccacccc tccggcgcgt cctcgctcgt cgcctccgcg acgatctcaa    311880
     actccacccg tccctccctc gccgtcgcca gtcgcgcctt ccgcgcgcct tcgtccgcga    311940
     cgaacacaaa cttcgtcgcc gtcgccgcca gcgcgtctct cgcgtccctc ttccgcgccg    312000
     cgctcggcgt ctcgccgccg cgcgcgtcca cccgcgcgtc gaaccggtac gcgtcgaacg    312060
     ccgcgttcgc gcgtcgaaac acgacgccga cggacgcgca ccgtcctcgc gcgacgtctc    312120
     gtcgcaggct cgcgaatatt tcgtcgcagt acgcgccgac gtcggcgcga tggcgctttc    312180
     cgacggtggc gagcttgacg ccgaagaggt cggacttggc gcttgaagcg tcgtcgtaga    312240
     cgccgtaccg cgcgacggcg tgctgcgcga gggcgttgat gaactcgagg aggacgtccg    312300
     cgatcgcgat cgcggcgtcg tcgctcgagt cgggcatgcg cggcgacgtg cggcggatga    312360
     tgatgatgta cagcgttaca gcgcggctcg acgacgaacg aagacgacga cgcggcgcgg    312420
     aatcacacga cctcggcgtc gagtaaacgc cactcgttcg ccacgcgcgg actggaatgg    312480
     tcgatgggag gtaaaaccat cggcgccgcg acctcgcgcg ccttatccgc gccgaagagc    312540
     ttctccgcga gcgccaacgc gaactcgagc gcggtgcccg gaccgcgcga ggtgacgacg    312600
     tcgccgtcga cgacgacgcg accgttcgcg ctcgcgtccg agggtaaatc cttcacgaac    312660
     gcgggatgcg cggtgcacgc caaaccgtcg agcatgccgc gcggcgccaa cacgacgccc    312720
     ggcgacgcgc acatcgccgc gacgagcgcg cccggcgtct ccatctgcct cgtcagcgcg    312780
     cgcgtcaacc gttcagattt cgccagattc gccgcgccgg gcatccctcc cggcagcgcg    312840
     atcagatccc acgccctcgt ctccacgcgc gcgagatctc gcaggcgcgc gtccgggacg    312900
     attcgcaccc ctctcgagca ctccaccgcg tcgtcgcgtc tcgcggcgtc gtcgtcgtcg    312960
     tctcgccgcg tctcgtcgtc gtccccaggt tcgatcgacg ccaccgtcac gtccgcgccc    313020
     gcgcgtcgca ggacgtcgac gatgatcacc gtctccatct cctcgctgcc gcgcgcgatc    313080
     ggcaccagca ccgtcggcgc cgtcgcgcgt tggcgcgcgt tcgattgcga ttgcgttcgc    313140
     gattgcgttc gcgattgcgt tcgcgttcgc gttcgcgcgc gcatcgcgcg tcgcgcgcgc    313200
     gtcggtcgtc ccgtcggtcg tcccgccgat cgtcccgcgc cgagcgcgcg cgcgcgcatg    313260
     gccgccgcgg tgcgccgtcg tcggcggcgg cgtcgcgtcg gcgtcgcgga cgcgagtccc    313320
     ctccgatcga cgagtgctga cccacgaaca cgtatttaag ccacaaaacg ccactgtaat    313380
     cgaaccgcgc gacgcgagtc ccctccgatc gacgagtgct gacccataaa cacgtattta    313440
     agccacaaaa cgcccgcgta atcgaaccgc gcgacgcgag tcccctccga tcgacgagtg    313500
     ctgacccacg aacacgtatt taagtcacaa aacgcccgtg taatcgaacc gcgcgacgcc    313560
     gaccccaccc gcgcgcgcga cgcggcgcgc cattcgacgc cgctcgaggt gcgcgacgcg    313620
     acgcgacgcg acggcgcgac gcgcgaaacc cgacgaacga tggcgacgat cgacgcgacg    313680
     gctcgcggcg cgggcgcgcg cgacgacggc gcgacgcgac ggcgaacgat gactgacgcg    313740
     aggcgatcac gccgtttgcg cagagacgga aatcgcgcac gcgcgcgcga acgacatggc    313800
     gaagtactac ggcgacatcg cgaaatcggc gaagggtgcg tgggagatcg acgacgacgg    313860
     cggggggggg gagacgcgag ggcgcgagga tggattgagg gaggatcggg gggacgcgcg    313920
     cgagggcgac gacgcgcgcg gggcgaggac gacgaaggac tgacgatgcg atcgatcgcg    313980
     cgcgcgcaga cttgctcacg ggcgggttca attatgacac gaaggtttcc gtcgatacta    314040
     agtcggccgg gacggtgcgt gaggcgcgga agcgcgaggc gaggcgacgg cggagagacg    314100
     cgaggcgagc ggcggacgac ggacgacgac ggcgcgaggg ggtccgcgcg cgcggtcgag    314160
     cgctcgagcg cggcgcgcgg gagggcggtc gatggggata tattttgcgt cgtcgagcgg    314220
     cgcgcgcgcg cgaggttcgc gggactgact ttcggaatgg gtgcgttttt cgacgtcgca    314280
     gggcgtgtcc gcctccgtcg ttcaaaaggg cgaggcggtg agcggcgact tgaaggtgaa    314340
     cgcgaacgtt gtcgatcaag tgatcgacat cgagttgaac caagatgcca aggcgaaggt    314400
     gactgcgtct ttcccgtctc tcatccccaa cggaaagctt tccgtcggcg gtacggtgca    314460
     agatctcgaa accgtcaagg tttccgcttc ggtgctcgcc ggtcccctcg gcgtcaaggc    314520
     tgacgtcgcc aactacgcgg cgccgaaggc cgatgcgagc ttgtgctatg ccatcggtgg    314580
     tggcttcgcg gtcggcgcca tggcgacgat caagagctcc tccgcgttgg cgtacacggt    314640
     cgcggcgcaa tccaagcaag gcgacgtcac gtacgcgttg acggcggcgg atcaattcaa    314700
     gacgttcaag gccagcgtgg tgaccgcgtt ggacagcaag caaacccttg gtgccgaagt    314760
     ggtttacaag aaggcggcga cggcgacgat cggctactcc aagaagatgg atggccactc    314820
     tttcaaagcc gtcgtcgcca acccggtgag cgccgagttc aacccgacgc tctccgtgca    314880
     cgcgagcctc gggagcttga tcccgaagac gaccgccacg atcagctgcc aagtggacaa    314940
     aacggtacgt acgacgacat tttcttctcg gagtcggaat cgacgatgct ctcgacgacg    315000
     cgacccttct tcacggcgcc tattgtcaaa caatcgccgt tccgcccgtg ttcggatggt    315060
     tgccgcgggt tgccaacatc aacaatgctc gaagatggtg cccgcgcttc tccgtgcgcg    315120
     gtgcgccata aatagtatta atatttcgcg tcacaaattc tcgatcgtgt cactgaccgc    315180
     gcgcgacggt ttctcccttt cgaaacaaca gatgaagtac aagtacggct tccagttcgc    315240
     gaccaagctt tgatcgagac ggctcggaca gcttccgtta gaacactagc acgccgaccc    315300
     cgttcgccga atcgctcgtc atttcttcct cgagcgaggt ggtgactttt aaagtataca    315360
     atacaatatc acgacggaac gagcgccgcg tcccgagcgg cgctcgcctc ccgagccgtc    315420
     cgcgtcgcgc gtcgacgttc ctctaacact aatccaccat attcaccgac gatcgtcgat    315480
     cgtcacacac cgtcgcgcac ccacgatggc ggtgccgccg ggaacgggaa atcgacagtt    315540
     tgtcgatgac gcgcaggtgc gtaaacggac cgcacgcgcg cgcgtcgcgc gttacgtgtc    315600
     gcgcaagcgt cgcgaattcg tcacgcgatc gtcgagacgc gatgaatcgt gcgcgcggaa    315660
     cgcaccgtgt ggaagcgcga agaaggggtt gaacgacccg aattcgcgtc tcgcgggcgt    315720
     ggtcgcggga tgcgcgctcg atgcgcgcgc gcgcgccgtc tgaacgacgc gaaagacgcg    315780
     atgaagacgc gttcgcgctc gacgagcgcg agagccagag gactgacgcg acgccgcgac    315840
     gttttccaac ccgtagatcg cggaggagca gcgcgagctc gacaccaagc tgcgatcgac    315900
     gaatacgcgg gataaactcg atgcgctgaa gaggctgatc gcgctcatgg cgacgggacg    315960
     agacgtgagc gtgttttttc cctccgtcgt ggtgaacatc gtgagcgaat cgttcgaggt    316020
     gaaggtgttg gtgtacatgt tcttggtgcg aacggcggat cagaagcccg aggaggcgct    316080
     tttatcgatc aattcgtttc agaaggatct ggcgcacccg aacccgagag tgcgggcgtt    316140
     agcgcttcga gtgatgtcaa gcattcgcat ccaggtcatc gtgccggtgg ttatattggc    316200
     ggcgcgaaag tgcgcggttg atccgagtcc gtacgtgcgc aaatcggcgg cgcatgcgat    316260
     cccaaaaatt tacagaatgg ataacacgcg aaaggaagag ctcatcgaaa tcatcgaaac    316320
     gatgttgcgc gacagtacgc cctttgtgtt gtcgtccgcg gtggcggcgt tcaccgaggt    316380
     gtgcccggac aggatcgatt tgttgcatcg acactaccgc aagatttgcc gcatgttggt    316440
     agacatggac gagtggggac agattttgtt gagcgagctc ctgctcaggt acgcgcgatc    316500
     gcagtttttg gcccccgacg cgcacacgcg cgagctcggc ggcgtttcgg gtaaagggga    316560
     aaagaagctc gaactcgcgc ttccttcgac aaacgaagcc tcttaccacg aatccaacaa    316620
     cgccgggatc cagtcgatcg tggcgagtgg cgcggcgttc tattccgatt ccgatgagga    316680
     ggaggaagac tccgacgatg acagcgacga tagcgacgga ggcaaggcga agaaggcggg    316740
     caagtcgagc ggcggcgcca cggctgagtc tcgcggtcca ggttggatgg acgaagacca    316800
     tcgtcttttg ttgcgttgca cgcgtccgtt actgcagtct caaaacgctg gcgtcgttat    316860
     ggctgttgcg gcgctgcact tttacctgag cccagctgcg gacttgccca aggttgttcg    316920
     agcgttggtt ttcacagcgc acggcaggcc cgaggtgcga catgtcgtca tcaagaacat    316980
     ttgtaccatg gtcaccacgc agccgatatt gttccagtcg cacttcaatg cgttcttcgt    317040
     cactccacga gatccgttgc aagtccgcgc tctgaaactc gaaatcttga cgcacatcgt    317100
     cacgagcgaa aacgcgccca cgctgttgag agagcttcaa gcttacttgc gctcatcaaa    317160
     ccacgatttt gtggcgctga cgattcgagc catcggaagg tgcgcggcca taatgccgca    317220
     aatcgcatca gtgtgcatcc gctctttgct cgaactttcg cttcatcctt cgccaaaggt    317280
     tgcgtctgaa gcagtcgtcg tcattcgcgc cttggtgcaa caaaatccga aggagcacat    317340
     cgtcgtggtg atgcgcttga tgcgtcgatt ggactcattg atcgcccccg aagcgcgctc    317400
     agcggtgatt tggctcgcgg gtggtgagat ctttgatggc gacgcggaga acatcaaggc    317460
     gtctgataag gaactccgtg aaaagttctt tgaactcgca gtgcaaatga tgcgtcgcgt    317520
     cgtcaagagc ttcccagatg aacacgagat gacgaagcag caaatcgtga acacatcgtg    317580
     caagatgtac atccaagatc ccatccgcat cgcgccaatg ctcaaagtcg tatttgcgct    317640
     cgctgctgcg gatccttcgg tggacatgcg cgatcgaatt cgcgtcttcc gcgccctctt    317700
     ccccgtggac gggaagccga gcgcggtcaa gcacttcgga gacgccgtcg tgctgtgcgc    317760
     caaacctgag cccaaactcc cgtcacccgc gatgcaaacg tgcgagcacg cgctcggttc    317820
     tctgtcgcat ttcatggatc acatggcgcc agggtacacg ccgctcgcga agcatccgac    317880
     ggtgcaaccg ccgacgaatg ttcgcgagca atacttcgcc gggggatcgg gcagagaagg    317940
     ctcctcagcc attgcggtgc acaacggcaa atccaacggc ctcggtgcga gtggattcta    318000
     cagctctagc gatgacagcg atgatagcga cagtgattcg agtagttaca cggggagcga    318060
     cgattcagac gatagctcgg atgactctgg tgattcctca gacgacgacg aagacgaaga    318120
     cgaagacgac gaatcggacg attcctcgtc gtcgaacgac tcggattagc taccaatgac    318180
     gaaacaatgt aaaacaaatc gcgtgtctat attaaagcta ttattaagcc gctcggtgaa    318240
     tgaatgaatg aatgaatgac gcgtcacacg tcgaaaccgt tttcgcgcgc gcgtttgaga    318300
     aactcgagtt gttcgtcgga cccctcctcg agcgcttgaa acatgaagat tgatttatcc    318360
     ccgatatcgt ccttgatcgg ctgcgaatac ttgcgcaacg caagaacgac tagaagtgcg    318420
     agcacgacgt tcgcctccac cccgcacacg tctgcgctcg cgccgaaaag atgactcaaa    318480
     cacatcgccg gcacggcgaa gaataaaagc gccgcctccg gcttaccgta acacatcccc    318540
     tccttaaacg ccagccctgt caacgcggcg aacatcggac cgacgagcaa aacgctcatc    318600
     ggatgttccc agacgtacac cggcagcggc tcctgcgcgc tcatcgcgat cgccgcgctt    318660
     cccaaaaacc ccaccgacca gagcgcgcgc atcgccgcgc gaatctcgcc gacgtacatg    318720
     tgcaccatca gcagcgcccc ccccagcccc aatccgccca agaagtacgc tttttccgcg    318780
     tccacgtaat ccccggcgtg acacaacccc gcggtgagcg cggcgccgag cgacatcgcg    318840
     ctcaacgacc ctcgatacgc gaacacctcc gcgcggtccg cggcgtccac cgtccagtct    318900
     gcgtaggcgc cgcggtacac gcgcggatcc accgactgtt ccgccgcgaa ccgcggtccc    318960
     gcgcgaagcg gtttcagaat atcgaacctc gcgcgcgttc gcaccgtcgc gcgcgccctc    319020
     gcgcgccctc gtcggcccgt cgtcggcgcc gaacgcgtcg cgatgacgtc ctcgatgcct    319080
     cgcgcgccga ccatgtttcc tcccctcgcg cttcgctcgc gccgcctcgg cgccgcgcgt    319140
     ccgcgcgtcc gcgcgtccgc gcgtctctcc gcctaccgcg cgcgcctcgt cgcgatcgag    319200
     cgccgcgacg cgtcgcgacg cgacgatttg tgccgccgcg gtgcgccgac gatcggcgat    319260
     cggccgcggc ggcgcgcgac gatcgcgcgc acaccgcgac gcaccgcgag acggacgcga    319320
     ggcgcgcgcg atgggtaaat ggatggacga tgacgcgccc ggtgggccgc agggcgcgcg    319380
     ctcgtacgcc ccgtacgcgg gcgcgcaggc gaacgatgcg tgtcggaatt gcggccagct    319440
     cggacactac gcgagaaact gcgcgcagaa cgccggactg aacggcggcc gcggcgccga    319500
     tcgatgcaat cgatgcggac agatcggaca ctgggcgagc gagtgctcgc tgccgtactc    319560
     gggcggcgcg ggcgcgggag ggttccgagg ggcggtcggc ggcggcggcg cgcggccggg    319620
     cgatcggtgc tctaggtgcg gaggactcgg acactacgcg cgcgcgtgcc cgtcgccggc    319680
     catggcggcg ttcgcgggag gtgcgggagg cgcgccgaag acgtgccata actgtggacg    319740
     cgtgggacac atcgcgcggg actgccgaca aggcggcggc gcgcgagggt acgataacgc    319800
     cagagcgccg aagcaacgca agggtgcggg tccggacgat gtgtgtaatc gctgcggcga    319860
     aaagggacac tgggcgagct cgtgctcgca accggacacg cgaacggagg ccgagcgcac    319920
     gagacaagcc aagccggacg ataagtgcca ccgatgcggc gagctcgggc acttcgccaa    319980
     ggattgctcg ttgcccccgg acaacacgtg cagaatttgc aagcaagagg gacacttcgc    320040
     cagagagtgc ccgaacaagg acaccgcggc ggcagcgaac atggatgcgg accttgataa    320100
     ctacatgaag gagggcgcgg agaagaagga aagcggcgag gcgtaatata tcgaacgcgc    320160
     gctcctcgcg acgcttcttc aataaatccg acgccgcggt cgttcgccgc gccgtctcca    320220
     tcaccacgaa ccagacgacg atgaaacgac acgattacgc gtcgaactca tcgtctcgtc    320280
     ccggcgcgtg tgtttcacca tcacatacca cgtagtgttg tctttgtaat ggccttctaa    320340
     aaatcaatct cacaaacccg tctcggagcg cgccacgact cgcctctcct gaatcatgtc    320400
     gaaaaagttc ttgaacgccc ccgacgacgt cgtgagcgaa atgctcgacg gcgtgtgcct    320460
     cgccacgccc tcgatcgcgc gcatcgccga tcagaacgtg ctcgtgcacg ttcgcgaggg    320520
     cgaggacaag gtggttgtga tttcaggcgg cggaagcggc cacgaaccag ccatggcggg    320580
     gtatctcggt cgaggcatgc tcgacgccgc ggtgtgtggg aacgtctacg ccagcccgag    320640
     cgtggaggcg gtgctgagcg cgattcgcgc gacgacgacc gacgcggggg cggcgctcgt    320700
     ggtgatgaac tacaccgggg acagattaaa ctttggattg gccgccgaac gcgcgaaact    320760
     cgaaggtttc gacgtggaga tggtgatcgt gaatgacgat tgcgcgctgg cgagcgatcg    320820
     agtcgggatc gccggcaggc gcgggcttgc ggggacgctc ttcgcgcata aagtcgccgg    320880
     cgcggcggcg gacgccggta agtctctgaa ggaagtgtgc gcggaagcga gggcgtgcgt    320940
     cgaggccacg gggacgatgg gggtagcgtt acaagcgtgc acgcttccgg gatcgtctgg    321000
     cgtcgcgaga gagattgcgg aagggacgat ggagctcgga ctcgggattc acggcgaacc    321060
     gggagcgcac acggctaaga cgacgagcgc cgatgaagtc gtagagacgc tcatgacgag    321120
     tattttcgcg cagaatgaaa agattgggaa actgagcgaa ggttcaaacg tagcgctcat    321180
     ggtgaactcg ctcggggcga caccgttgat ggagttgtac gtcgccgccc gcgccgcgtt    321240
     ctcgtggctt gcgggcgtga agaaaataaa cgtcacgcac gcatacgtcg gcacgttcat    321300
     gagtgcgatc gatatgaacg gttttagcgt caccgtatgt gcgctcgatg atgacactag    321360
     agtgcagcgc ctcgaggcgc cgtgttcatg ctccgcgtgg ccgaagacgg caaaactcac    321420
     tcctgcgaag ctcttgtcgg tgtcagcgcc ggcttccgat agaaacgaaa ccatcgcgag    321480
     cgggccaccg acgactcccg agggtgtcat ggcgttgaaa gctatcaagc gcgtcgcaaa    321540
     ggatctcatc gcagtggagg atactctcac aaagtacgac accgcggtcg gcgacggcga    321600
     ttgcggcacc acgattcgca agggcgctga ggctttaatg aaagctgcgg atacttaccc    321660
     gattgacgat gtctcggcgc ttatgcgtgc tatcggggac acaatccgtc agaacatggg    321720
     cggtacgagc ggcgtattgt acgatatctt tttcaccgcc gcggcggata aactcgcaaa    321780
     ggttgccaag ggcaaagcgc cgagcgtcga catcgtcctt cttgcgttct caacgggcgt    321840
     gcaggcgatg tgccagtacg gtggcgctcg cgctggtgat cgcacgatgc tagacgcgct    321900
     cgttcctgcg ttaacaatgg cgacgacgac gtatatgtcg aaaaagtctg tcatcgaagt    321960
     tgcgtccgaa gccgcaaagg cggctgcgaa cggcgccgaa gacacaaaga gcatgaaggc    322020
     aaacgccgga cgttcaagct atgtcaacca agacgtgttg aaggaaacac ctgaccccgg    322080
     tgcagtcgcg gcggcgacgt ggattaacgc aatctttgct gcagtgtctg aaagttgatt    322140
     taatgctacg taatgctatt tctaaagtca ctctggaggt cgcggcgcgc ggcgaaattc    322200
     tcgcggaacc ttcgtcgtgc cgtacctagg agctgtgaac gttggtcgct cattgagcgc    322260
     tgcaatgttt gaactcacga ctacttcgct tgcctcgtta tttgcgcttt ctatcgaccg    322320
     ttgacgtcgg aagttttctc caccgtacca acgatcggaa gccgcctctc gtttagcgag    322380
     tcgatcggca tggagcgcac ttctcgccct gcgctgtcgt tcgagtcttt ccgtcggtgg    322440
     tggtggcggc ggatgacgca caatcttcgg agtcgcctga tccgggaccc tcttaaatcc    322500
     tgtggtgcct ttcaccatcg tcatacgacc tccgatgggt ggggccggcc ccttgctcgg    322560
     atcggaatcg cgttcgattt ctactctacc gcctcgcgtt gactttgcct ggcggtgcga    322620
     gtttcctgaa tgttcccttt ccttcatttt acgccagaac tcgttcaatc gaagcttgga    322680
     tatcgtctca tccttctggc gttgcctctc gacagagctg tgaatgattg cactcacgtt    322740
     gtgcagcgtc tcgcgcgagg gggccgcgcc acgtacatct cgcacatcgc tactttcgtc    322800
     gtaaagcgtg attgccgtga gagctgaatc gtccgacaat agcgctcgca tatcacttat    322860
     gccgcgctcg gccgccgcgc gaacgccggc gttgtcgtcg gtgtttacga ttttcaagag    322920
     cacggcgata agcttgtcgg tgtctttttg tagcccttgt actttgatat cgccgtatag    322980
     acgccgatac atcgtctttg acatcaacgc tcccccgggc attttgcgct ttgccgcgtc    323040
     cacgaacctc tcgaatgcag catccgtgta cgaccccgtt acgggtacct caaagtcata    323100
     aaaattgccc tcggttcccc atacgaagag agtaatcaaa tccaccaagg cgtgtatcga    323160
     gagttcacgc gtctcagctt catcgtcgat cagcataccg tacaacgcat cgtgcacaaa    323220
     ctgcgccgcc gacatagaaa tgaaagcttt gtaagatttt tttgatacct cgccttcgtc    323280
     agattttgta ttcatcactc ggtaaactgc gctcatctcc agtttaatcg attgatgaag    323340
     aagctcgatg gcgtgaattt tctctcgttc tttaccgggc tccatactaa cgatcaagtg    323400
     agagagagcg ctcaaaaact cagatctgca cgcatctgcg ttcgtcagcg cgtaaaggat    323460
     ttcagagaca aacgtctcct tggacgatcc agcgtgcgct tccatacatt caaagagaac    323520
     tttcaatcca tcgacggcaa acacgctcgg tcccgcgtca ccaactcgaa ctaaagtcgc    323580
     gagagtccga atggaataga atgatatctg cttgtccgtg cttagtgagg cgtcgagcag    323640
     cgtcttcatg aaatcatgcg cgagctcaag tctttcttca tccgcctcgt tttgcaacct    323700
     cccgacggcg gcataataac ccagagaact gaaccaattc aattcaggtc tattcttcgc    323760
     tttgacttct tgacgtagcc agctacgcgc gacgtaagtc acgcgctcag ccttgtctag    323820
     tctgcggacc tcatccgtgt ccggatccct cacgtgcgta atggcttgag tgagcttttt    323880
     cgcaatcggt ctcggtggaa tctcgaacgc atcgtcaatt atttgacgaa acattctcgc    323940
     agatacgacg taatcttcgc catacatatc caaatcaatg tcatgagctt taaacaagag    324000
     cgtcgacatg aggtttgcga agtcaaaaga ctgaatgcac tccatcgata ccgtcgccac    324060
     ggtcgcttga aacgttttac tctccccacc cttgatgcag tctttaaccg tggagacaat    324120
     cgatttgacc gcctcccatg tcgacgctgg actatcatcg tcgcaccaaa gtgcgatctc    324180
     taccgttccc tggacatacg catgtatcac gcttctgatg aatccttcgc cggctacttg    324240
     gagaaattct tggtctggat catcgatgat acaatgcatg atgataccga gctcctcaaa    324300
     agcgtcacta gctgtatccc acgcgtctcc aacgtcttca ttctcgccgt ctttcgtctg    324360
     cgaggccctt ggcatgttcg tcttcttcac caagggagag agcaattgag tgcgttgctc    324420
     tgtgctgaga aggttataaa acgccacgag cgcgacgacg cgatctcttc tattctctgc    324480
     ctcaacttgt tctttgataa actccggcgt catgatcttc tcaacctttt ccacttgctc    324540
     tggatcgctc aatttttcaa gctctgagcg aatgcacttg tgatctccaa gactatgatt    324600
     gaagacacgc accatcacca tcgcgatcaa cgtcatgatg atgccaatca caactcccgg    324660
     gcgcgtccag tttgaaccac ccgtgtgtgg aactaagcca tgagacatcc aaggtggatt    324720
     attgaaaatt ctcgagaaat aggtgacgac ggcgaacata aacgcgccac cgaaagcacc    324780
     agctctcgat tcattccgct tttgcccgaa cccgcgcaaa gactgaatat tcatgtgcgc    324840
     cacgagtaaa acgaggcaga ctactactgg catgatattt cgcaacgagt tcagactttc    324900
     gagtcgcgcc acggaatcaa gtgcagggac gccatgaccc ggaagttcac cttccatgta    324960
     cgccgcgatc gtagccaagg agaccttcaa aaagatgctt aacatctcaa aaattgggac    325020
     ggggcgtaag ttgggttcaa gcgtctccga taccacagcc atcttcatcg atactgcaat    325080
     cgcgccgagg ccaacgaaga gtgaaatcat caagttatcg ccgaaactcg cgctggggtc    325140
     cttcgacacg tgaatccaag gcgtcggtgt gaacgacgtc gtcaccatga gaaagccgag    325200
     cgaagcaaaa accatcggaa cgagagcgac tcgcaggatt aacacgcgaa gtacgaaccc    325260
     gacagctttc acacggtctc taaagtcgcc cacgcgtttc gagtatgtcc tgcgcctcaa    325320
     cgcgtactcc gccatgagct ccattctctc agcagcttcg cgaggtatca agcgcaaatt    325380
     gagcggcgaa gtcgtctcca agcgcacggt tcggagtata gcttcatcgc taccgttctc    325440
     ccacgcgacg tcgggaacaa ctttgaaacg ctgtttttcg cgatcgcgca ctggagtgaa    325500
     atcatctcgc atcgcaactg gttgaagaag aacacgtcgc atcgtcttgc tcatcatcgc    325560
     gtgcactttg gccaacttgt tcacttgcac agtctcttcg tcgacttgcg caccgccacc    325620
     tgattcggcg tctgggtcgt ccgagtattg cgttaatgtt ttatcgccgc caagctctac    325680
     gtactccgcg aatgcccaca tgcattgatc aaaatggtct cggacacgtc cacaaaactt    325740
     gacgactaca gggcaaatga caacgccgaa caaaagcacg acgaaccagt tcgtgagctc    325800
     cgtcttggca ccacgctccg tcatatccgg gccgaataaa ccagggtaga agaacacgtc    325860
     cgctatcgca tcgcgataca tttcgtttga atgactcgag cggcgccatg caaacgccgt    325920
     aaatgcaaag aactcgatgt acagctggaa tcgaagaaga ttgtggctcc aatactcctt    325980
     gtccaagacc ttggccaact tgtaacgaaa cattagtgca aacgtagcgc tccttagtcg    326040
     cacggtgtac ttcacccacg ccataagttt cgatgcggtc gcgacaagtt gctcgccaac    326100
     catacttcga cgccgctcgg cgcgctccgt tgcgtacaaa ttcttctgaa actgttcctc    326160
     agcttcgttc cacagtcccg cctctttggc cgctcgttct cgcgccgact ttttcttgtc    326220
     gacgagtata tttttcaaat ctcgatctaa atcaatcttc gtgacgtacg tgatgtgctc    326280
     gctcttaatc tcctgcgtca attcatccag ctctcgcttg tactcgtcat ccaactctgc    326340
     gtcggcttca ccgctcccaa tcatcttata agacgccccg acgtctaaaa taacgtttct    326400
     cttatcctcg aaatcggaag attcaagatt tcgaccgaac gagtacgcac aaaacgcggc    326460
     gaacgcgatg aacgccgccg ccacagcggt attcgtcgac gtctcgcaag tccacgaaac    326520
     ctccacctcg agcgtctgac tcgcgtaaca accgttcgta tccaccaatg ctgcagaata    326580
     cttcccctcg acgtccggtc gcagcgtcgc ccgcgcgctt ccatcgacgt caaacgtcgc    326640
     gttcgcgaac gacgtcgcgt tcgtcagcgc gctcgtcgcc ggccacgaca tcagcaccca    326700
     ccgccgcgtc gcatcactcg cgctctcgaa cacgtaatca tcaaagcatc gtttcttagt    326760
     cgcgtccagc gtcgtggcgt cgtagggatc gccaccgcga ccggcgattt cgagcgtcgt    326820
     cgccttggcg ccgtcgtccg cgcgcgccgt caccgccgcc atcgacgcgc tcgacaccga    326880
     gcactgcggc agcgcgtcca ccgcgcgcgc gagcgcgagc gcaccgatca ccgcgagcgt    326940
     caacgctcgc gcggcgccgt tcgcgcgcgc gcgcgttcgc cgcgcgcctc gtcgtccccg    327000
     cggcatggat tcgctcgcct cggacgcgcg cgcgcgcgcc cgcgcgctcg cgcgcccgcg    327060
     cgcgccgccc gcgcgcgcgg cgccgagcga tgacatcgcg ctacgcctcg cgcatgctcg    327120
     cgagacgacg gatcgcgggc gacgccgtgc gtcgcggttt accgtcgcgc tgcaaacggt    327180
     cgatgactcc gtcagaacgc gacgacgacg aagacgacga cgaagacgac gaagacgcgc    327240
     gcgcgcgcgc gacggaggcg cggcgaaacg cgcgtcggcg tcgcgacgac tgcgcggcgc    327300
     gaacgcgcgc gtgacggcga tggacgacgt tgcgaatgat tccgggcacc gtctcggaac    327360
     gcgcgacggc ggcgacgacg acgacgacga cgcggaagag gacggcgcgc ggttgacgag    327420
     cgaaccttcg acgtcgggcg cgtcgctgag atacgccacc gcgcgcgacg tgccgtttcg    327480
     aaagctgtgc ggcgcgttcg aggcgttgca gaacgaacgc ggtcggtcca aggcgacgag    327540
     cgcgcggcgg tatcgagtgc tcgatacact gcacgatcga tgtctcgtga gcgcgcgcga    327600
     tggaacccgc gtcgacgcgt tcgacgcgta tcggttgata ctgccggcgt tggacaagga    327660
     acgaggggcg tatttcttga aacacgacgc gttggccaag gtggtggtgt cggcgttcga    327720
     catgtctcga gcgagcgagg acgcgaaaaa gttggaggat tggaaacgaa agggtggcgg    327780
     taactttccg caagttgttc gagacgtttt ggcgggtgga catctcgcgg atcgtgagaa    327840
     agatgaagac gcgcgcacgt tgaccatcgg agacgtgaac gaggcgttgg acgcattggc    327900
     ggcgtgcgat aacaaggatc agcgcgcgtc gacgctgcgg gcgctgtttt caaagatgga    327960
     tgcgacgcaa gtgaaatgga cgtgcgcaat catattaaag gaaacaaaaa tttcaatggg    328020
     agagaaggcg atattgcgtc attatcactc cgaagcgaat gacttgtggg attggactag    328080
     cgatttgcga agagtttgtg aagacttacc gcggcgagac ttccggatga agcgcgagga    328140
     catcgatgtg ggcgtaggtt taattaatcc tcagatggcg agaaggcaaa acagcatcga    328200
     tgccgtgtac cgcgcgttga aaggtacgca gtttgtcatc gaaaccaaat tcgacggcga    328260
     gcgcattcaa attcacaaag acggcgacat catcaactac tggacgagaa acatgaacga    328320
     ttttggccct cgtggctacg atgtgatgaa tgctctcttt cgtcatttgc caaagcgatg    328380
     cattctcgac ggcgaactca tggtttggaa caagcttcgc gatcagtcgt acccgttcgg    328440
     cgcgttgaag aatctcatca aggctgcaaa tatgcgcaag gccaaggatg aattgtttcc    328500
     actcaaggca cacctcgaaa accgtgatgg tggtgatagc gacggtgagg aggatctcat    328560
     gagctccaag tatgcgtggt acgccgagaa cgtaaagaaa ctcacgtatg gagacttgga    328620
     attggtctac gttccgtttg atatattgta tgccgtcgat cgaagtgtga agactcataa    328680
     gctgagagag cggcatgaac ttttgaaaga gcatgtgcgt gaagtatcag tcatgtgtgg    328740
     gaatattcgt gctagaattc ttctcgcgac gcccgattgc gcgttctcac gtgtaggctc    328800
     aacgaaggag gatatcgagc gcgcgctgtt agaagcgatg gataacggag aggagggatt    328860
     ggtaatcaaa gatctcgacg gtccatggat accaggtgat cgtagcaata actggatgaa    328920
     aatcaaacca gactacttat cgagtgaaga tttggacgtc gttctcatcg gcggctatta    328980
     cggcgccggt gagttgcgcg ggggcaaaat ttcgcagttc ctctgtggca ttgtggaggc    329040
     aacgaacgat ccgattagca ccgcttcaga tggagtcaaa atcatgagct tttgcaaggt    329100
     aggtactggt atcagcgcca tgcagctcga cgatttgaga agtcggctag gcgacttcat    329160
     gcacagagaa aagcctcaag acatgaacta caacgtcacg gatgcttaca acgaaaagcc    329220
     ggacgtttgg atctggcctc ctcagcgatc attggttgtg acggtgaaag gtgacattcg    329280
     tgcgattcgc acgacaactt tcgcaactgg ttacagcctg cgtttccccc gcgtcaccgg    329340
     tattcgatat gacaaaaaat ggtccgacat cttgacactc tgcgatctct taaagacgat    329400
     tgaagaggaa gtaccgacat tgaaagtgaa tatcgacgat acacgaggcg gtacgaatgc    329460
     ccgaaagcgt tcgcgcacga cgggacccgc gacgctacta cctgcacatc tcatgccggt    329520
     tgacgtttcg ggcgtcgtgc aggaatctga aatcttcaaa aacatgcaag tgcacatcgc    329580
     gaactgtgaa agtcgagaac aaaagcagga gctgttcaaa gctgtcatcg cacgtagtgg    329640
     tactacgagt gagttgtggc acaagcatgt gacgcacagc gttgcgttga accgcgacgg    329700
     ctcaaagttc aggacggcga gtcgggaagg cgatgtgtac acgattgcct ggctccaaga    329760
     gtgcattcac gaaggacgtg tggtaccgcc gaaacctcga catcgcttac atctctcagc    329820
     gacgacgtgg tatggtacgg atgccatgga tcgatacgga gatgatcatt tctcggactg    329880
     caatttggcc gacgtacacg cgctcgtgca tcaagttggc gatcaaacta agcgttggaa    329940
     aactgccgaa gttccagcat tggtggagct cgatcgcgag tatccatcgg tgtgtgctga    330000
     tgtgaaactt ttgacgttta ggggttgtgt gttcgagatt gacgattctc tcggcaaaga    330060
     tgcgcgtgtt gatgagcaga gtagtatgtt tccaagtgtg ctggcgggcg aacgtcgaaa    330120
     cgtcgaacag attcttcgga tttatggtgg aaagctcgca cctgaaggca gaatggggac    330180
     acatattgtg cgcatgtacg atgactccgt tgtctttgaa gatatggatg atggaagaaa    330240
     gcaagtttcg ctctcttggg tgaaacgttg catcgaccgg tcgacaacgg ctgatgtagt    330300
     ctaaatttag cggctggtgt tcgcgtcccc tgaatgattg acgcgatacg atgcgcacgt    330360
     cacaggactt ggctctttta gaaccatttg ttccgaaggc ggcgaaatgg ctctcgtcgc    330420
     acgcagctga tggatgtctc tccatttcac gccgccgcgg gagagccgcc ttgctctttg    330480
     tggatatgaa tgactttgta aaagttagta atggtgcggt tcgcgagcac gcattggctg    330540
     ccgcatcttt caaccacatt cgcccgtcta tatacggtaa acggcgcaac ctcgaggcct    330600
     ccgctcgatg tgcagcgtgc ttacgagacg tgctcgctga atacttttct atactcgcag    330660
     acatcgtgag cgcgtacgac ggcgaggtgt tggcattcat aggggacgcc atgcttgctg    330720
     cgtggttcgt acgcggcgac atggatgacg atgaagagat gcggtgcgcc acaaaacggg    330780
     ctcggctctg cgcgcagggc attctcacga atgttcacgg gcgtgccttg aaagaaattg    330840
     tcaccatcac gctgaaagcg atgatctctg caggcccagt cgtcgccatt cccaccaagt    330900
     ttcccaatca tgcacgcggt gtggtggtaa tcggtgacgc gtttgatgac ttaagagcga    330960
     tgaagggatt aatgcaatcg gggaaggtcg ttttcaatgc gttaagttgc gcactcctcg    331020
     catcgggtgg aaacagagac acggcgagcg caacgacatc gattttcacg acactgccac    331080
     gcgcgcgtgt caaggaattc atcccgtcgc acgttttcaa cgcatttgca gatggtttga    331140
     tcgggttcga cgataaaaca ccttccttga gcgaggtgtg taccgtcgcc tttgtgcgat    331200
     tcaatcccaa aggagacgac tgtgtagtcg aatgcatcgg cgtcgtgcat cgcgtggttt    331260
     cgcaatatca gggcgttgtt ttgcaaagta tcgtagatga caacgggcct tcgtgcttgt    331320
     gcgcgttcgg cgttcccgga acccccaagc gcggcgcgac gacgagagga ttgcgattcg    331380
     cgcgagatct cttgaaaaca ctagacggtg cgctgacgca cgcgcggtgt gggttgtcca    331440
     caggcgtcgt gaacataggt gccgcgtgtg aggtgaactc taagtcgcat tccgagttct    331500
     cgctcgtcgg tgtcccagtg atactggccg cccgactagc tgatgcggtg aaacctggcg    331560
     tcgcggcgat ggatgaagag acgcgtgttt gggcggcttc agcgctcaac aataatgcgc    331620
     gtacgtctcg cattgaatta tgtttaaaag gtttcccgcg agcgatgaca acgtttatca    331680
     tagagtagct gcaactaact gattctttct attcaatatc accaagtcct gtcctagttc    331740
     tgtcgtcttc gtctcttgat tgtgcggcgc accgcgtgtc ggcgagcgcc ttgggtaatt    331800
     tgtaagccca ctcacacgag catgttattg gatctttcaa tacctctgtc acgacgcctc    331860
     gagtggcgag acgagattgc tctccctccg cgatgccgca gtgccgctcc acaactcgcg    331920
     gctcgtactc ttttccatcc tttcccccgc cgctgcgagg tcgaccttgc ttgtcgtacg    331980
     cttcgttgaa gcagaagtac tggtcgtggt tgagcgcgtt gttgatcgcc gtatcaaatg    332040
     cctcgtcctt ttgtttatca tcgaaaccgc aaaatgagcc ttcatcgagt tggtcgatca    332100
     tgatgacgcc gtgatcgtta tacgattcca gcgcctcgac ggcgtcactc gctgagaaac    332160
     cgcgctcgat gacgacatca gccatgtttt tgtcgtcttt cgcgccaatt ttaacgtgaa    332220
     tgacatcttc tcgaacgttc cctttaagtc gcatgtcttc gaggaaccct gcttcgcgaa    332280
     aatcaacgcc caagtcatgc aagccttcga ggttgtagat gtgatccatc gggcacgcgt    332340
     acggcaaatg cgccgtctcg gcgccgagcg cgcgacatcc ggcgagcgtg ttccatattt    332400
     tatcgcagta acatcgcgcg ggtggtagca caaagattcg tccgagcgct ttcgccaggg    332460
     cgaagccgtt tcgaatcgtc gttcttcgca atctgtcctc ttcaaagtgt cgcgtgatgg    332520
     cggttaaata cgcatcgttt tccatgccga tggcccgaga accattgaac ttcatctgcg    332580
     accctttggt ggagatggtc aagtacttct ttggcttcca ataatctgtg tcatcgtctg    332640
     cataccataa accatgctgt cgcagtcttt gacgcttgcc gtacgcgtac cgcgcagaat    332700
     cgccgtattg gtacgtcgtg tgcaccgcgt acggctcacc gtcctcgggg tggtacaagt    332760
     ggtgctcttg cacgaagaaa gtatgaccgt tggagaattg cgcgatgggc aaaacgccca    332820
     tgcgaatcgt gctgtttgct gcgaagacga tcgagcgata ccccggtaat ccgcgcttgt    332880
     catcgggaac cgccaccgcg ggcgcgagcg cgggagatcc ttcgcgcacg agcaaattca    332940
     gcgccggctg gtcgcgcatc cacgcgatct cgctcgtcgc tactttttgc ttccactttt    333000
     ccacgaacgc cttcgccggc tccgtgggcc gaatgtgcac gatgcccgtg ttaaagttga    333060
     cgttgcgaca gttggcgttg tcggcgcgat cgttcacggt gtcgatgcaa tcgctcgata    333120
     tcagcacgtc cgcgtatgcg taagtgccgt tgttgaatag ctcgcgcgga tcgcgcatcc    333180
     aaaccacgtc cgcgtcgctc agaatcggcg ctatcccaag ctcgagcaaa tcttgaataa    333240
     acttcgtctt caccgtgccc atctttttaa acgtcttgct cttttgcgtg atgaactctt    333300
     gatccctatt atccaacact gaccgccccg tgagcagcat ggatggtatc ccagccttaa    333360
     cacatagtgt gtgcatctct tcgtctaaag cgccgacgaa tatcggctct aaactcaact    333420
     ttttcgccgc cgccgcccaa ttgaagacga aatcctgcac gctcgccgtg ccaaacgtca    333480
     cgaacatctc ccccccagcc ttagcgccga cccgccgcaa ctcctccggc acgtgttcca    333540
     tcttctttcc aagctccatt ttcgccgcat catcgagcgc atccgcggaa acgtccttcc    333600
     acgcctgtcg catccacttc ggctcgtcgt cgtcgatcgc cagccccgcg aacgtcgtcg    333660
     ccggcggttc caacagcgcg aaatccatcc cccgatccct cggcctcgat cccgtcgacg    333720
     ccgcgtcatc gcgtcggttc aattccaccc gtcctttttc tccctcgtcc gtcgtcgtcg    333780
     tcgtcgtcgt cgccgacgcg aaccgatttc tccgcgtcgc cgacgcgttc gcgttcgcgt    333840
     tcgcgttcgc gttcgccgcc gcgttcgcgt tcgcgtccgc gtccaccgcc gcctccacgg    333900
     ccgcgtcgct ccgcgcgcgc gccgtcgcgt cgtacatcga cgccgacgcg tcgtcgcccg    333960
     ccctccgcgc cgtcgcgtcg tcgatcgcgt cgccgtcgcc gtcgccgtcg ccgtcgccca    334020
     tcgccatcgc gcgcgcgttc gcctcgcgcg ccgtcgtcgc ggcgtccgcg atcgcgccgt    334080
     cgcgcgcgcc gccgcgcgcg ccctcgcgca tcaccatcgc gcacgccgcg acgacggcga    334140
     cgcacgcgag gcggcgcgcg aggcggccgc gacgcatcgc gtcgcctcgc gtcccgcact    334200
     gacgcgcgcg gcaccgacgc gcctcgcgtc gacgagcgag cgagcgatgg acgcggtgcg    334260
     cgacgcgacg cgacgcgacg cgagacgcga gacgcgcgcg cgaggcgacg cgacgcgcgc    334320
     gacgagagag ggcgacgcgc gcgcgaggcg atgatgattc gacgccaacc gacgacgatc    334380
     ggatcggcgc gagaacggac gcgcgaagac gcgcggcgcg aggacggacg cgcgcgacga    334440
     cgcgaccgtg gacgcgcgaa cgatcgacgc gcgcggacgc gacgcgcggc gacggagaag    334500
     aggaaacgaa gacgatgaga cgattggagc gattgtttga ctgacggcga cgacggcgcg    334560
     gcgacgacga ttcgaatagg cgatcgaaaa atggtgcgcc gagatgggca cgacgcccga    334620
     aaaggtggtg acgatgtact tggatgaaaa gtttaagtcg gcgacggtcg agggggaact    334680
     tttggccaag tgtgaa