(data stored in ACNUC9543 zone)

EMBL: CP000595

ID   CP000595; SV 1; linear; genomic DNA; STD; PLN; 468366 BP.
XX
AC   CP000595;
XX
PR   Project:PRJNA13044;
XX
DT   20-APR-2007 (Rel. 91, Created)
DT   02-OCT-2014 (Rel. 122, Last updated, Version 4)
XX
DE   Ostreococcus lucimarinus CCE9901 chromosome 15, complete sequence.
XX
KW   .
XX
OS   Ostreococcus lucimarinus CCE9901
OC   Eukaryota; Viridiplantae; Chlorophyta; Mamiellophyceae; Mamiellales;
OC   Bathycoccaceae; Ostreococcus; unclassified Ostreococcus.
XX
RN   [1]
RP   1-468366
RX   DOI; 10.1073/pnas.0611046104.
RX   PUBMED; 17460045.
RA   Palenik B., Grimwood J., Aerts A., Rouze P., Salamov A., Putnam N.,
RA   Dupont C., Jorgensen R., Derelle E., Rombauts S., Zhou K., Otillar R.,
RA   Merchant S.S., Podell S., Gaasterland T., Napoli C., Gendler K.,
RA   Manuell A., Tai V., Vallon O., Piganeau G., Jancek S., Heijde M.,
RA   Jabbari K., Bowler C., Lohr M., Robbens S., Werner G., Dubchak I.,
RA   Pazour G.J., Ren Q., Paulsen I., Delwiche C., Schmutz J., Rokhsar D.,
RA   Van de Peer Y., Moreau H., Grigoriev I.V.;
RT   "The tiny eukaryote Ostreococcus provides genomic insights into the paradox
RT   of plankton speciation";
RL   Proc. Natl. Acad. Sci. U.S.A. 104(18):7705-7710(2007).
XX
RN   [2]
RP   1-468366
RG   US DOE Joint Genome Institute
RA   Grigoriev I., Grimwood J., Aerts A., Salamov A., Zhou K., Lou Y.,
RA   Pitluck S., Schmutz J., Myers R.M., Lucas S., Detter J.C.,
RA   Glavina del Rio T., Putnam N., Rokhsar D., Palenik B.;
RT   ;
RL   Submitted (21-FEB-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 2356b4c74975d7ad0b6263eaf2d3e371.
DR   BioSample; SAMN03081420.
DR   EnsemblGenomes-Gn; OSTLU_2524.
DR   EnsemblGenomes-Gn; OSTLU_9603.
DR   EnsemblGenomes-Tr; OSTLU_2524.
DR   EnsemblGenomes-Tr; OSTLU_9603.
XX
CC   URL -- http://www.jgi.doe.gov/ostreococcus
CC   JGI Project ID: 3436080
CC   Source DNA was provided by Brian Palenik (bpalenik@ucsd.edu))
CC   Stock culture is available from CCMP (http://ccmp.bigelow.org/) as
CC   strain number CCMP2514
CC   Contacts: Brian Palenik (bpalenik@ucsd.edu))
CC             Igor Grigoriev (ivgrigoriev@lbl.gov)
CC   Annotation done by JGI-PGF
CC   Manual curation done by the Ostreococcus User Community
CC   Finishing done at Stanford/JGI, Stanford Human Genome Center
CC   (www-shgc.stanford.edu)
CC   The finished chromosome has no gaps. The sequence has less than one
CC   error in 100,000 bp.A
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..468366
FT                   /organism="Ostreococcus lucimarinus CCE9901"
FT                   /chromosome="15"
FT                   /strain="CCE9901"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:436017"
FT   gene            complement(<1418..>4405)
FT                   /locus_tag="OSTLU_40550"
FT   mRNA            complement(join(<1418..2179,2318..>4405))
FT                   /locus_tag="OSTLU_40550"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<1418..2179,2318..4405))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40550"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40550"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99969"
FT                   /db_xref="GOA:A4S803"
FT                   /db_xref="InterPro:IPR026741"
FT                   /db_xref="InterPro:IPR026937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039187"
FT                   /db_xref="UniProtKB/TrEMBL:A4S803"
FT                   /protein_id="ABO99969.1"
FT                   /translation="MIQNRRLTGHILFHRRAQRGRVHPGDIAEAASLASIDLPPAKYPL
FT                   FDAIGDDFVETGKLSKLQLEGVMFACQKHCEFAPDGKRSGFMIGDGAGVGKGRQISGII
FT                   IDNFVRGRRKAVWISSSGDLHRDAERDLSDLGSTIKVINSCPELDRETRAFGLSKEYQE
FT                   GVLFTTYSTLVSKTQKKSRLDQIVNWFGGEDAEGVVIFDECHKAKNFSASSDSGSKVAA
FT                   AVIAFQERCPRARVVYASATGISEVGHMTYLARLGFWGKGTPFKSADTFIESMKSRGVG
FT                   FLEMLAMEMKASGKYVSRGLSFRQAEFEQYTIALSKEQRQMYDDACDLMSLIRNACIEA
FT                   VRRTGSDGKGVWSAYWSVHQRFFKLLCISMKVPAVIAKANEALAREQCVVIGLQTTGES
FT                   QDASANLTFGEDVTEFGFLSTTREMLVNFLNVHFPTEIHGASDGAAAEKSAPSDWSSDW
FT                   RRAGGAEVESEGYTGRFHTNAPAKVDEELVDAKEELINKVIKLRLPPNFLDALIDGLGG
FT                   PTEVAELTGRSGRIVRRGDRLMYESRGTTASRKGTSISGDGDVLGVNIAEKNAFMNGDK
FT                   RVAIISDAASTGISLHASKGAKNVRRRVHVTIELPWSADKAIQQLGRTHRSNQITGPVY
FT                   VMCSTNIGGERRFVAAVARRLQSLGALTRGDRRAATGIDLSDGNLDSSLGRHALKKLYE
FT                   ALLGVQVGLRNDGFSVEEATLLQEIGYGNKDLGDVRKFLNRLLGLPVRTQNIMFAYFAE
FT                   TLDCEIKLAKAEGKYTEGVSDLGGSSIRIEPESKTILKDPYHGQKLVSTKVFIDRGISF
FT                   ERALDILEKSKNHDRDGFYKMKREMYGRAQVVLAITKPGSRNLFMLWRPNTGASLFEME
FT                   YDELRGKYMMCTPDVAKQPWDLVHELTEKHCMHGVNCHVRQTMGACTAGKRTVDCTVIS
FT                   GAVVPCWGELERTLDRNAHK"
FT   gene            <5028..>5177
FT                   /locus_tag="OSTLU_27680"
FT   mRNA            <5028..>5177
FT                   /locus_tag="OSTLU_27680"
FT                   /product="predicted protein"
FT   CDS_pept        5028..5177
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27680"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27680"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99836"
FT                   /db_xref="UniProtKB/TrEMBL:A4S804"
FT                   /protein_id="ABO99836.1"
FT                   /translation="MKACEDIAEAFEKCGRKNVHWNGLPEDAPDCARELKAMRKCVRKN
FT                   WRTA"
FT   gene            <5358..>6869
FT                   /gene="SDG3519"
FT                   /locus_tag="OSTLU_40473"
FT   mRNA            join(<5358..6384,6430..>6869)
FT                   /gene="SDG3519"
FT                   /locus_tag="OSTLU_40473"
FT                   /product="predicted protein"
FT   CDS_pept        join(5358..6384,6430..6869)
FT                   /codon_start=1
FT                   /gene="SDG3519"
FT                   /locus_tag="OSTLU_40473"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40473"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99837"
FT                   /db_xref="GOA:A4S805"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="InterPro:IPR036464"
FT                   /db_xref="UniProtKB/TrEMBL:A4S805"
FT                   /protein_id="ABO99837.1"
FT                   /translation="MSDAPASSTAWWRRRELLATRTTTTTTTTATTTTTAEEERLANDA
FT                   KARVQSGVLATFATWFDHRGGKIHERVRMTYRPNFGWSLEADGDIADGERLVSLPPKLM
FT                   LRCDSDDVSEPLKNVVDRVPNEFWSSKVGLVLLRERVAGAHSAFAPYITLLPAVHEGSP
FT                   TFFPPDAVRALEYAPIVQQINKRARFLGTFAGNALTVDDGESYVDEAHPGRQRVEMTID
FT                   ANALGWATACASSRAFKVGANSAPAMLPVIDICNHSFNPSVSVRAIEEGDNAGGVELIA
FT                   RRALTSGEPIELSYGNLSNDELLLDYGFIVKDNPFDCVKLRWDLKLIELAREIGGLAAA
FT                   PIDTVAKVAPWQATALERIGLVGDDPNVELSVFGAGQVMDKKALAGLRVLYSKSSAEAS
FT                   RAADAPFGEIDADVVSKDTEIKALRTCMSLLALALGNFSTTLEKDEELHDAATSPQVRL
FT                   AIAFRMEKKKVLAKSMARLNESIERLQRDE"
FT   gene            complement(6956..8613)
FT                   /locus_tag="OSTLU_27682"
FT   mRNA            complement(6956..8613)
FT                   /locus_tag="OSTLU_27682"
FT                   /product="predicted protein"
FT   CDS_pept        complement(6982..8403)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27682"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27682"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99970"
FT                   /db_xref="GOA:A4S806"
FT                   /db_xref="InterPro:IPR007042"
FT                   /db_xref="InterPro:IPR021933"
FT                   /db_xref="InterPro:IPR039727"
FT                   /db_xref="UniProtKB/TrEMBL:A4S806"
FT                   /protein_id="ABO99970.1"
FT                   /translation="MDVDQEQYYDDGGGGSRRRGRGRGDRGGDRHHPYGDDGHRGGRGG
FT                   GRGGGGRGRGRRDDGALSFRDFCYKYLRDDTTPAEAERRYEEYKKENQEAFYERYFRDH
FT                   RHDEGERARNDPRVLVETLKRRDELACARAHEFFASKADGSLRIYDEGDAEGKDADMGE
FT                   GEHQGEHQQEKRRSMVPIEAWHPTRLGTDYKQTGRLIAALDAEKGIDNNPLLDGDEDSG
FT                   MDAEAAEDDVAALEALGNEASTPEKLDERLCYLVRVHGVDYYRRISEMQPVTFLEKLPS
FT                   AFAKRDPKPEDTPVSSIAQNPYAVRLFATVDANVKRRIAEGDPQVKKLGTSEIESKLDE
FT                   WIQSCVVKHDEQRFGCTLSTKLFVAEEFVIKHIKTKQAHHVEDMRERLFDEQYRKNVVE
FT                   FLKYDEHRKENKKDHKKRFGGVMMMQVPGSGPDGQFVQVPMGTGGAKMIKGMARYTDLD
FT                   AAVTESRVVIDYGDI"
FT   gene            <9127..>9840
FT                   /locus_tag="OSTLU_18241"
FT   mRNA            <9127..>9840
FT                   /locus_tag="OSTLU_18241"
FT                   /product="predicted protein"
FT   CDS_pept        9127..9840
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18241"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18241"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99838"
FT                   /db_xref="UniProtKB/TrEMBL:A4S807"
FT                   /protein_id="ABO99838.1"
FT                   /translation="MSTQHGTRARALARDRRRKAVEGANALDVKTTGTPRVAARLHTDE
FT                   PTDVATASDAEKNRVSSASAAKASSRSKRAKGELTESPTSPKREGESADAEDARAFEDE
FT                   DNEMDEVSSGGDEGHIESMLATAGSSRGDAMDPDVDFSAVLHEVPIEIRRRLAPNESGF
FT                   TESVTHSEESTFCRGCRRTLSVVLHFGVNNKTCRQCLIRQRLKRKRCATRNSEQFGNGR
FT                   TTEARKDKAMNPTGP"
FT   gene            complement(<10077..>10889)
FT                   /locus_tag="OSTLU_40612"
FT   mRNA            complement(<10077..>10889)
FT                   /locus_tag="OSTLU_40612"
FT                   /product="predicted protein"
FT   CDS_pept        complement(10077..10889)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40612"
FT                   /product="predicted protein"
FT                   /note="GO_component: - membrane; GO_function: -
FT                   pyrophosphatase activity; GO_process: - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40612"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99971"
FT                   /db_xref="GOA:A4S808"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A4S808"
FT                   /protein_id="ABO99971.1"
FT                   /translation="MGSSVRSTPAPSASTARAHQQRRSVQRTRVISAAYANEKVGDFPS
FT                   LEFRCFIKDEAQNTVSAWHGVPLKNADGTFNFLCEIPKETKAKMEVATDEKLTPIKQDT
FT                   KKGKLRDYPYNINWNYGMLPQTWEDPKHEHPTMKVSGDNDPVDVVEIGSSALAMGSVTP
FT                   VKPVGVYAMIDDGELDWKVIAISVNDPKASDINDVADVEKHFPGELEKIRVWFRDYKTP
FT                   DGKPQNKFGLDDKCMDRAYTLGVIEETHHFYNDLVSGKRANDEELSLA"
FT   gene            <11160..>12203
FT                   /locus_tag="OSTLU_18243"
FT   mRNA            <11160..>12203
FT                   /locus_tag="OSTLU_18243"
FT                   /product="predicted protein"
FT   CDS_pept        11160..12203
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18243"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18243"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99839"
FT                   /db_xref="InterPro:IPR024326"
FT                   /db_xref="InterPro:IPR040446"
FT                   /db_xref="UniProtKB/TrEMBL:A4S809"
FT                   /protein_id="ABO99839.1"
FT                   /translation="MASGAQRRKRKRESEKREAWVRFDAAGGDLSAYERSLEEDATAKK
FT                   ARAAAARRAADVEALNDATGSREADERGQDRERASSSLLRDAVGVRVRVRKDSAHALRV
FT                   LCRATSDGDCFFACGQPRSWGRRGIEAVVNALGFGVLEYDEITLSKAPELAACVIRLDA
FT                   DDENASVKRKKKRAGGVGSAVETFLARAEKLVEPIQAPDVSGDEIDRDGGGLNAWVAAH
FT                   RRKRPGSAQAVTASIDAWFEKKEAEEAAAEEAANAVKSDDGWTKVEAKRGRRKTTEEST
FT                   GTTIGSIRAATADRRRKEPKKIAGEQFYRFQSKEKKRNEIIELQAKFEQDKQRIARLKA
FT                   ARKFRPM"
FT   gene            complement(<12268..>13059)
FT                   /locus_tag="OSTLU_27686"
FT   mRNA            complement(<12268..>13059)
FT                   /locus_tag="OSTLU_27686"
FT                   /product="predicted protein"
FT   CDS_pept        complement(12268..13059)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27686"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27686"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99972"
FT                   /db_xref="UniProtKB/TrEMBL:A4S810"
FT                   /protein_id="ABO99972.1"
FT                   /translation="MSAAPTLAFLKVDARRPLDDAAQSLDDASSKGFVKLDATLSPKFA
FT                   ASTTAYDVLIAPRATHVNVMATSFAPGCTIAIDGVIGNMANRPANATIEVTVTASGGEK
FT                   TTYSLTTKATEAMSNDGEVVLKEKPKVDDEEEHTHGHSHDGVPCDGTHHSHGHGHSHAE
FT                   GEKCEHDHGGEECHGHGHGEKKHDHGHGHGHGEKKHDHGHSHADGEKCCSDEKCEAHDH
FT                   GHGHGEKKHDHGHGHGEKKHDHGHGHGEKKHDHGHGHGHGH"
FT   gene            complement(13166..13917)
FT                   /locus_tag="OSTLU_27687"
FT   mRNA            complement(join(13166..13656,13897..13917))
FT                   /locus_tag="OSTLU_27687"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(13238..13656,13897..13903))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27687"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27687"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99973"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:A4S811"
FT                   /protein_id="ABO99973.1"
FT                   /translation="MAELKKLGTGANELKIEVNCCNVKKLDLKFYGIEKPRCKVVLKYK
FT                   DHEYTSEELAGLDPTWEEEFIFCVDDVENDKISAVFYICDQKLGDEQHFALNKLLRKKQ
FT                   TFKGLVVPGGKADFMFTALNFGEEQAAEEDDAFMDFL"
FT   gene            <14385..>14818
FT                   /gene="RPS27"
FT                   /locus_tag="OSTLU_40438"
FT   mRNA            join(<14385..14569,14689..>14818)
FT                   /gene="RPS27"
FT                   /locus_tag="OSTLU_40438"
FT                   /product="Ribosomal protein S27, component of cytosolic 80S
FT                   ribosome and 40S small subunit"
FT   CDS_pept        join(14385..14569,14689..14818)
FT                   /codon_start=1
FT                   /gene="RPS27"
FT                   /locus_tag="OSTLU_40438"
FT                   /product="Ribosomal protein S27, component of cytosolic 80S
FT                   ribosome and 40S small subunit"
FT                   /note="Cytosolic 80S ribosomal protein S27; Cytosolic 40S
FT                   small ribosomal subunit protein S27; GO_component: - small
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40438"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99840"
FT                   /db_xref="GOA:A4S812"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:A4S812"
FT                   /protein_id="ABO99840.1"
FT                   /translation="MFTHARSRTDIARDVARAQVLAQDIDLLNPPAALEAGKHKLKRLV
FT                   QSPNSFFMDVKCQGCFNITTIFSHSQSVVLCGSCSAVLCQPTGGKARLTEGCEWRRKGD
FT                   "
FT   gene            complement(14951..16288)
FT                   /locus_tag="OSTLU_27689"
FT   mRNA            complement(14951..16288)
FT                   /locus_tag="OSTLU_27689"
FT                   /product="DMT family transporter:
FT                   phosphate/phosphoenolpyruvate"
FT   CDS_pept        complement(15044..16120)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27689"
FT                   /product="DMT family transporter:
FT                   phosphate/phosphoenolpyruvate"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27689"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99974"
FT                   /db_xref="GOA:A4S813"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniProtKB/TrEMBL:A4S813"
FT                   /protein_id="ABO99974.1"
FT                   /translation="MASTKSKSVLAEPSATHGGTRARTNDDARANASEQTIARSCLRAY
FT                   FFVAVWMTISMCVIMFNKWILAYSGFRYPVALTMWHMVFCTSLVTVLVRVFKVTKRLKM
FT                   TRKEYTRKVMPIGFFYAASLWLSNSAYLHLSVSFIQMTKALMPGLVYMVGVFFRMEKLT
FT                   ATTSMNMFVIAIGVGIAAYGELNFDTLGVTQQLSALLFEAVRLMLVQILITRQGMAMNP
FT                   LQSLYYVSPACAFFLAFPLMFVEYPAMMADATLVFDWKMLTLNATCAFALNLAVFLLIG
FT                   KTSALTMNIAGVIKDWMLIFASQHFFGNPVTFLNYVGYVIAFLSVFMYNLNKLREKKRE
FT                   QAKKQSIDVSARRASDAA"
FT   gene            <16746..>18617
FT                   /locus_tag="OSTLU_40730"
FT   mRNA            <16746..>18617
FT                   /locus_tag="OSTLU_40730"
FT                   /product="predicted protein"
FT   CDS_pept        16746..18617
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40730"
FT                   /product="predicted protein"
FT                   /note="GO_function: - catalytic activity; GO_process: -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40730"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99841"
FT                   /db_xref="GOA:A4S814"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4S814"
FT                   /protein_id="ABO99841.1"
FT                   /translation="MHQVFKAAKESKLRHTTALVACTGEKWTVKEYYDDCVKTAKSFIH
FT                   LGLERYESVCILGFNSPEWLMANNGAIFAGGFAAGIYTTNEPAACEYIIENSSARVVVV
FT                   DGQKQLDKILEIRSRLPKLKAIVMYREDSFSDPAGAKDASLAKVYTWKDFLKLGDAVSD
FT                   DTLEARMSAQKPGNCCTLIYTSGTTGNPKGVMISHDNCTWTASSNILHNPTITSGPLRV
FT                   VSYLPLSHIAAQIVDIHSPLMCIVDFDKTAAVYFARPDALKGTLKETLIEAKPTVFFAV
FT                   PRVWEKFAEGLQAKGKEITGLKAKISAFMKGKCAGVHAASQVGATVGHPFMGGFAMKFM
FT                   KKKAHAAIGLDQARVCLTGAAPIMKHTLDYFGTIGIHILEVYGMSENTGPQNVCKSDYF
FT                   KAGSCGVPIPGVEIKLDHVKGRDKDGEGEICFRGRHVMMGYLNNLAKTQESIDEDAWLH
FT                   SGDVGAIDPETNMLSITGRIKELIITAGGENIAPVPVEDAIKGYLPAISNVMMVGDKRK
FT                   YNTMLVTLRQVPDGEGFTEKLFGTSLEVNRDVTTVKQAQSDAKWKAYIEEGIAKYNKTA
FT                   VSNAQRIQKFKILDTDFSVPGGELTGTQKLKRNVVTEKYAAVINSMY"
FT   gene            complement(<18662..>20149)
FT                   /locus_tag="OSTLU_93753"
FT   mRNA            complement(<18662..>20149)
FT                   /locus_tag="OSTLU_93753"
FT                   /product="predicted protein"
FT   CDS_pept        complement(18662..20149)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93753"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93753"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99975"
FT                   /db_xref="UniProtKB/TrEMBL:A4S815"
FT                   /protein_id="ABO99975.1"
FT                   /translation="MGDAMGDDAVVVLVATSRDDRESYLDRAAHDALATTTTKARDDDD
FT                   DDDEGAMRRMNATDDAKRIFMATRKRERQRECAQVGGLLTRACLNALERRNGATTASWG
FT                   QFLRSKQRAMQRLPPGTSSGIRVRATRCIAIEHERMTFSKTMRNVGRRRGVFVGINYEE
FT                   CGVERWRLRRRGGDALRMREYLKTHCGYDEDDEVLVLLEDSEASTNDGSINRSCSKKAI
FT                   LKACRWLVDGARAGDSLFFYFSGRGQEVSETATTTTTKDSVAGGGAYKGLNKTALCASD
FT                   TPGDPTARITRQEFREALRVDAVPSNVHLTVFLDIYGGGGENALHDMPYTCVNVTLPDE
FT                   REIKDAKNGKRVSPVTPLWMVPNGEKAVKEFLALAETAAEAYAECAETNKAYDAIKRDA
FT                   PQEKLPQEKPAVEANAEPKPKPKKPSPPMGEPNPERAVAEAEEAPVPETHANEKSSVVP
FT                   APAAVIERNAREERAEMQPRSPQSIDESKQPGCCVIS"
FT   gene            <20200..>20973
FT                   /gene="FBP17-3"
FT                   /locus_tag="OSTLU_27692"
FT   mRNA            <20200..>20973
FT                   /gene="FBP17-3"
FT                   /locus_tag="OSTLU_27692"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT   CDS_pept        20200..20973
FT                   /codon_start=1
FT                   /gene="FBP17-3"
FT                   /locus_tag="OSTLU_27692"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /note="FKBP-type peptidyl-prolyl isomerase, possibly
FT                   anchored on lumen-side of thylakoid membrane (non-cleavable
FT                   TAT signal); GO_process: - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27692"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99842"
FT                   /db_xref="GOA:A4S816"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A4S816"
FT                   /protein_id="ABO99842.1"
FT                   /translation="MRATATRATATATATATRASTRALRRARAATTARRFDASRRAAST
FT                   SNDGDGSDDADASDATPTRAKRDKPLPGSGVNLYDPVATASRFLTRRFGIVGGLGLVAL
FT                   LASVEGGEIVKALLERDVDVSTTAEEFAVEGNANGLRARDVKIGGGASAKRGDFVGVNL
FT                   TVVDAEDGVEYLNTKKAKRPIAFTYEKKPLLAPICEAIEDGVRTMKRGGVRRVFAPSAA
FT                   AFGERGVVLTDGTRIKPNRDLIIDIVLEEVSPSYV"
FT   gene            complement(<21082..>22151)
FT                   /gene="PRPL4"
FT                   /locus_tag="OSTLU_40690"
FT   mRNA            complement(join(<21082..21594,21909..>22151))
FT                   /gene="PRPL4"
FT                   /locus_tag="OSTLU_40690"
FT                   /product="Plastid ribosomal protein L4 large ribosomal
FT                   subunit"
FT                   /note="imported to chloroplast"
FT   CDS_pept        complement(join(21082..21594,21909..22151))
FT                   /codon_start=1
FT                   /gene="PRPL4"
FT                   /locus_tag="OSTLU_40690"
FT                   /product="Plastid ribosomal protein L4 large ribosomal
FT                   subunit"
FT                   /note="Chloroplast ribosomal protein L4; Chloroplast large
FT                   ribosomal subunit protein L4; imported to chloroplast;
FT                   GO_component: - plastid large ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40690"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99976"
FT                   /db_xref="GOA:A4S817"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:A4S817"
FT                   /protein_id="ABO99976.1"
FT                   /translation="MRSSAALQGTTAITSPRPIAGKRGANARVAPVVPRAAAIDAVTFD
FT                   GAKSSAATLELKTARAEVARGLVHKYVVMVRQNARRGTASTLTKSEVRGGGRKPFKQKG
FT                   TGNARAGSSRTPLKPGGGVSFGPKPRDWSIKMNKKERRLAMATALQSAASAMIVVDDIS
FT                   GNISAPGTNAFNKSLMAWGVGASEKAYVITKDANENVAKSARNIERVVQTDVSHLNVYD
FT                   ILNADKVIVEASALAHISSFFGENGAAWE"
FT   gene            complement(<22381..>23106)
FT                   /locus_tag="OSTLU_27694"
FT   mRNA            complement(<22381..>23106)
FT                   /locus_tag="OSTLU_27694"
FT                   /product="predicted protein"
FT   CDS_pept        complement(22381..23106)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27694"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27694"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99977"
FT                   /db_xref="UniProtKB/TrEMBL:A4S818"
FT                   /protein_id="ABO99977.1"
FT                   /translation="MAQRWYAASEARYLSTTDEQPLVEAREDFLDFKRYGDLKECALKH
FT                   PKLRVKGGLNDAGFSKTRGFVVKFNLEGVDKFKASPDYECFASVFDELRLPDANAFVMN
FT                   ILLCELGDYDAYNAEELSVGLHLDTTVGIYSRHMFIAHQVSVLYNSVPNDMVGGELELF
FT                   PYGDGYPDTGAAPEKKIRPKENMLVNFRGDAFHQVRSYKTRSGSERVSLVLEQYVIDDD
FT                   AYGKTMRFFEAFKSNMTMM"
FT   gene            <23472..>24119
FT                   /locus_tag="OSTLU_27695"
FT   mRNA            <23472..>24119
FT                   /locus_tag="OSTLU_27695"
FT                   /product="predicted protein"
FT   CDS_pept        23472..24119
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27695"
FT                   /product="predicted protein"
FT                   /note="GO_function: - DNA binding; GO_process: - regulation
FT                   of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27695"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99843"
FT                   /db_xref="GOA:A4S819"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR024610"
FT                   /db_xref="InterPro:IPR028651"
FT                   /db_xref="UniProtKB/TrEMBL:A4S819"
FT                   /protein_id="ABO99843.1"
FT                   /translation="MATTPSTRALCEATCVVDRAIASWRARDGAIDDAQRRASRACETL
FT                   VAPFVEARATGEDASRDASEAQRAVKALEKHHARLRALADARVKLAQATYDAVDDHITR
FT                   LDKDLATFERERGSAHRAGERTKFDLALAGEHGFEALTNAPSASPGSALASPGNPNEPR
FT                   YCVCRSVSDGKMIGCDNDDCAIEWFHFACVGLNPNAEVKGKWICPPCRRKKR"
FT   gene            <24274..>24897
FT                   /locus_tag="OSTLU_18251"
FT   mRNA            <24274..>24897
FT                   /locus_tag="OSTLU_18251"
FT                   /product="predicted protein"
FT   CDS_pept        24274..24897
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18251"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18251"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99844"
FT                   /db_xref="GOA:A4S820"
FT                   /db_xref="InterPro:IPR006593"
FT                   /db_xref="UniProtKB/TrEMBL:A4S820"
FT                   /protein_id="ABO99844.1"
FT                   /translation="MTSVSTLASSAFAVFAFWMARAYVPAATLFAWHPLCLSAAIGLCG
FT                   AASVIGVRVRAFAPGRERVRALWCHLALNSAGGAAWVIGFWAIYANKNNLGKAHFTSAH
FT                   GKVGAAATMVLVATYALGLFSFNALGLLTRLDMNRRAKDVKATHRVASLVAIFGGILAA
FT                   SMRTGHDSTGFGAAGRAVADVALFAGAGALAFLAATTPAWKIER"
FT   gene            complement(<24998..>26026)
FT                   /locus_tag="OSTLU_40586"
FT   mRNA            complement(<24998..>26026)
FT                   /locus_tag="OSTLU_40586"
FT                   /product="predicted protein"
FT   CDS_pept        complement(24998..26026)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40586"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40586"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99978"
FT                   /db_xref="GOA:A4S821"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR025774"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4S821"
FT                   /protein_id="ABO99978.1"
FT                   /translation="MASIARAPTTASPSARATRRRARRAATTPSASANEERTTSTFELE
FT                   RVVEPLIAETKTLNEGIAKFYDESSRVWEDVWGSEGGDGTHMHHGYYRRGEPVNHAKAQ
FT                   VDMIEESLRWAGVREVKRVLDVGCGIGGSSRHMVRKYGCEAEGVTLSPVQAARANALAK
FT                   EEGVENMAKYRVADALNMPFEDGSFDFVWSMESGEHMPDKKKFVDELARVCAPGGRILI
FT                   VTWCHRTLEPGQSALEPAERVLLDRICDAYYLPAWCSIADYKALAEDAGLVDIETEDWS
FT                   EEVKPFWKGVIKTALTLKGVIGLLKSGAATLRGALVMPLMQTGLATGTIKFNLITMRKP
FT                   PL"
FT   gene            <26135..26553
FT                   /pseudo
FT                   /locus_tag="OSTLU_9603"
FT   CDS_pept        join(<26135..26217,26343..26395,26494..26552)
FT                   /pseudo
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_9603"
FT   gene            <27049..>29976
FT                   /locus_tag="OSTLU_27700"
FT   mRNA            <27049..>29976
FT                   /locus_tag="OSTLU_27700"
FT                   /product="predicted protein"
FT   CDS_pept        27049..29976
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27700"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27700"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99845"
FT                   /db_xref="GOA:A4S822"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040362"
FT                   /db_xref="UniProtKB/TrEMBL:A4S822"
FT                   /protein_id="ABO99845.1"
FT                   /translation="MAPPSAPNDELLSTILFLINNHYWCALYELYVDARRLNVLDADLP
FT                   SLNTLKSFFNDSKRFPDGVFRAVNDAFDSGVSAARVVDAESRAAVAEYELRCAREDLQN
FT                   SRRGAGGGGGEDGGEDASGASVRRGVDADDAFAPTSGDSARSSADDVGLDAKLDAATYE
FT                   YLSRRGYKATALSMRDESSTAAKLMEKDFASDGERSFGALRRMYERARMTETTASALES
FT                   ERARVDDVESELIRARARIDELERENTTTTTLRDALSSKLALAESELSDLKVSAAQWEK
FT                   KATESASEVNRLLSELGAGNEEWSSRDGNGVPRTTIEENDTIDAVLSFICAIAPKVSPA
FT                   ARKELLPMISRACVRAAGDEKRAARSSNLFFELFKAPNAEQRDAIVDAIANVGEIVGMN
FT                   AFEGTFIRGCLGSEAVATMNEERRVLVLDAIAKLGASSWFTLNNFVMDGFKRAAVDPSD
FT                   GVRAECSRAVERYIAANAPSDDNMETIEDVLMTLACDGSDEVADAARATLAPAVASWYL
FT                   GANPRRFTDVFARKVLDKAAEALRSGWTGEGAEREFKGWVSPEDGDRHRWHATSLVKTF
FT                   EAFARPIREALSATKPASIADGVDDALSKDAPDSWPFAQWCVKEASDLIVQVISSTAPD
FT                   VVGQESVRESICAAVASWCGVLGALATRAVLIGKVNDACLVSYDQRRAVMPILLAGVVP
FT                   YTPDGGAVLGDYIKRLIQQASAESCDEIIDAARYLAAFEQHTANLLDALKRCAHPIAEN
FT                   PPTVRLITARLLAATSEILPLKHVLEHVYPALNVLRADPETSVRRETALALAVCACTHY
FT                   ETIEPTTQTMRQLESLIGDSDVGVRVAVVEAMSLGASVPGTSFAVSAASALSAIAQLPS
FT                   EEHEIAHALFAAIRDMLGADGDLFPQISPALVALLASGGLDQGRRAQVETMLRDGGWSP
FT                   DTAPSSITNVTVDAPHAPGRGRSSAFDRMKSVGRSAFGGRGRDAR"
FT   gene            <30606..>31019
FT                   /gene="PRPL12"
FT                   /locus_tag="OSTLU_8310"
FT   mRNA            <30606..>31019
FT                   /gene="PRPL12"
FT                   /locus_tag="OSTLU_8310"
FT                   /product="PRPL12; Chloroplast ribosomal protein L12;
FT                   Chloroplast large ribosomal subunit protein L12"
FT   CDS_pept        <30606..>31019
FT                   /codon_start=1
FT                   /gene="PRPL12"
FT                   /locus_tag="OSTLU_8310"
FT                   /product="PRPL12; Chloroplast ribosomal protein L12"
FT                   /note="GO_component: - plastid large ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_8310"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99846"
FT                   /db_xref="GOA:A4S823"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A4S823"
FT                   /protein_id="ABO99846.1"
FT                   /translation="KVAEIADRVCELTLIEVNELCDVLAERLGLGDMSGMMFGGGVMPA
FT                   GGGGGGGGGGGGGNAAAAPAEEKTSFALKLESFDAAQKIKVIKEVRAITDLGLKEAKEL
FT                   VEGAPAVLKKELKKEEAEALIAKLTAVGAVAALE"
FT   gene            <31735..>32147
FT                   /gene="FTR"
FT                   /locus_tag="OSTLU_18254"
FT   mRNA            join(<31735..31954,32056..>32147)
FT                   /gene="FTR"
FT                   /locus_tag="OSTLU_18254"
FT                   /product="ferredoxin thioredoxin reductase beta chain"
FT   CDS_pept        join(31735..31954,32056..32147)
FT                   /codon_start=1
FT                   /gene="FTR"
FT                   /locus_tag="OSTLU_18254"
FT                   /product="ferredoxin thioredoxin reductase beta chain"
FT                   /note="GO_function: - ferredoxin reductase activity;
FT                   GO_process: - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18254"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99847"
FT                   /db_xref="GOA:A4S824"
FT                   /db_xref="InterPro:IPR004209"
FT                   /db_xref="InterPro:IPR024707"
FT                   /db_xref="InterPro:IPR036644"
FT                   /db_xref="UniProtKB/TrEMBL:A4S824"
FT                   /protein_id="ABO99847.1"
FT                   /translation="MRKFSEQYARGSGTYFCMDKSVTAVVIQGLAEHKDTLGSPLCPCR
FT                   HYDDKEAEVAQGFWNCPCVPMRERKECHCMLFLTEDNDFAGDEQTITMDELVELTEDM"
FT   gene            complement(32238..33889)
FT                   /locus_tag="OSTLU_51545"
FT   mRNA            complement(join(32238..33464,33878..33889))
FT                   /locus_tag="OSTLU_51545"
FT                   /product="predicted protein"
FT   CDS_pept        complement(32318..33451)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_51545"
FT                   /product="predicted protein"
FT                   /note="GO_component: - actin cytoskeleton; GO_function: -
FT                   structural constituent of cytoskeleton"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_51545"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99979"
FT                   /db_xref="GOA:A4S825"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:A4S825"
FT                   /protein_id="ABO99979.1"
FT                   /translation="MADEGEVSALVCDNGSGMVKAGFAGDDAPKAVFPSIVGRPRHHGV
FT                   MVGMGQKDCYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVDPAEHP
FT                   VLLTEAPMNPKANREKMCQIMFETFNVPAMYVSIQAVLSLYASGRTTGIVLDCGDGVSH
FT                   TVPIYEGYALPHAILRLDLAGRDLTDYMVKILTERGHSFTTSAEREIVRDIKEKLAYVA
FT                   VDFDEEMAASQSSSTIEKSYELPDGQMITIGNERFRCPEVLFQPSLIGMETPGIHETTY
FT                   NSIMRCDVDIRRDLYANIVLSGGTTMFPGIADRVSKELTALAPSSMKIKVVAPHERKYS
FT                   VWIGGSILASLSTFQQMWIAKSEYNEAGPSIVHRKCF"
FT   gene            complement(34402..35648)
FT                   /locus_tag="OSTLU_27704"
FT   mRNA            complement(34402..35648)
FT                   /locus_tag="OSTLU_27704"
FT                   /product="predicted protein"
FT   CDS_pept        complement(34594..35634)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27704"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27704"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99980"
FT                   /db_xref="UniProtKB/TrEMBL:A4S826"
FT                   /protein_id="ABO99980.1"
FT                   /translation="MADEGELSALVCDNGSGMVKAGFAGDDQADWWKFRGDDQADRWKF
FT                   RACTHLNTLLLLLLGYLAFHRPQFILGLGHRTRAKTVRFAIVTACSSNHAAENLDMLRS
FT                   LADSRYGGIVSVYYMHKVDALDMAHAEFRLLQKYKLQLKKVKAQIKLQTLVIEEQERLD
FT                   TYCFKPRVVQMFLRVFDDLDAFMWADSSTRFLGNPETWVSHVLEDGVGFAGRLGALGMG
FT                   VNTHPATYAYLNVDRTKFKNFTEIAATYWIANLQSDVYKTVLAPWIACGVHNCLSCMAP
FT                   PGSSRKLTKPRKGPPSTEYIVHRYDQSVLSILLYEWDWQSAGNIQIGNLKYIDVQKVSG
FT                   SKTPLR"
FT   gene            <36722..>37441
FT                   /locus_tag="OSTLU_18257"
FT   mRNA            <36722..>37441
FT                   /locus_tag="OSTLU_18257"
FT                   /product="predicted protein"
FT   CDS_pept        36722..>37441
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18257"
FT                   /product="predicted protein"
FT                   /note="GO_function: - amino acid binding; GO_process: -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18257"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99848"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:A4S827"
FT                   /protein_id="ABO99848.1"
FT                   /translation="MAMTRAMAHTASHTASHTRPTSRTGRGTRRARARAIRNDEASDAE
FT                   AGVERGEDVERATRATHAVYVENPDGGTNTCVRVVGPNRRGGLAKIIAALTNYGLDVQS
FT                   SFTRTTANGSSVDDVFYVTWDPREAGKSFDESHARLASQLEEDRFEDLKRFIVDAMTPT
FT                   ETRERYTSRMPKIYGIAAESEVLAMKRRLDDAIDPSNQEESKIARDPVFMASQLEFVAA
FT                   ELASATARLVQIDRVYAK"
FT   gene            <37574..>39127
FT                   /locus_tag="OSTLU_18258"
FT   mRNA            <37574..>39127
FT                   /locus_tag="OSTLU_18258"
FT                   /product="predicted protein"
FT   CDS_pept        37574..39127
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18258"
FT                   /product="predicted protein"
FT                   /note="GO_function: - alpha-amylase activity; GO_process: -
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18258"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99849"
FT                   /db_xref="GOA:A4S828"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012850"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A4S828"
FT                   /protein_id="ABO99849.1"
FT                   /translation="MEAALAARDRARRGLTTSSDTASGVAVVQRTDEATSTLAKSRQPL
FT                   NENNTTKAKLSKLSTDMAPQTPFASPLSRPLPSTPCGNGRELILQGFNWESCNEKANND
FT                   RSWYQLLNEKVPEIAAAGFTSVWMPPPTKSVSKQGYLPTDLYNLNSFYGSEDELRSCVA
FT                   RMREYNITPVADIVINHRCAEAQDDAGRWNKYTGKIDWDARAITCENPQFGGQGSQSTG
FT                   EDYLPAPNIDHTQQFVRKDLKEWLSWMRDDVGFRGWRFDFVKGYSGVFTGEYVEETRPF
FT                   LSFGEFWDECSYRDGVLEYNQDAHRQRTCDWVDSTGGNTAAFDFTTKGILQEAVARTEY
FT                   WRLIDTKGRPPGFCGMWPSRAVTFIENHDTGSTLQHWPFPRDKILQGYCYILTHPGTPT
FT                   VFYDHWVDPKWSEAIGVMLDIRKRTGLSSNAAAVHIERATAGLYAAHIGHAQEMYTEGL
FT                   SMDVDVKRPSICMKLGVEDWSPNAAKVGNLSWKCTASGDGWAIWEDKNHLEDEEISKAR
FT                   "
FT   gene            complement(39300..40567)
FT                   /gene="lhcp2.1"
FT                   /locus_tag="OSTLU_27706"
FT   mRNA            complement(join(39300..40021,40472..40567))
FT                   /gene="lhcp2.1"
FT                   /locus_tag="OSTLU_27706"
FT                   /product="prasinophyte light harvesting complex,
FT                   chlorophyll binding"
FT   CDS_pept        complement(join(39386..40021,40472..40537))
FT                   /codon_start=1
FT                   /gene="lhcp2.1"
FT                   /locus_tag="OSTLU_27706"
FT                   /product="prasinophyte light harvesting complex,
FT                   chlorophyll binding"
FT                   /note="GO_process: - photosynthesis light harvesting"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99981"
FT                   /db_xref="GOA:A4RUX8"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:A4RUX8"
FT                   /protein_id="ABO99981.1"
FT                   /translation="MSALLASSFVGRVAAFKATKIQAKSVSTTVKADIYPEFGTYPGGG
FT                   ESPIIPFGDEKNAEREVIHGRWAMLGVTGAWAAENGTGIPWFTAGTLCTPDDCTAVADK
FT                   FPGAVAPLAPEGSGYPSFWNVLIIEIVLVGAAEAYRTGISDSPFDDGLTVGDVNPGGRF
FT                   DPLGLAESGDLEELKIKELKHCRLSMFAWLGCIFQALATQEGPIANWQSHVADPVHSNV
FT                   LTNAAKGFGFY"
FT   gene            40830..43615
FT                   /locus_tag="OSTLU_27707"
FT   mRNA            40830..43615
FT                   /locus_tag="OSTLU_27707"
FT                   /product="predicted protein"
FT   CDS_pept        40992..43604
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27707"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27707"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99850"
FT                   /db_xref="GOA:A4S830"
FT                   /db_xref="UniProtKB/TrEMBL:A4S830"
FT                   /protein_id="ABO99850.1"
FT                   /translation="MTREGDDGAAAWPRPSATLVAVGCAALALACLGDGTRVATSGLLG
FT                   GASTTARGDAGRERVLDDVPFEDDHVRLVVPRVERDIAAEELRGEVSWTRAATTGVFDA
FT                   RANGGASATNGTEYRPVATYAALGRRRHHGRKHHRYDDDEEELAYETKGDDFELPELSS
FT                   VEPKDSKKKETETFGGELTASEVESILDKLRAQSQALETGSDATSSLGAKEASTPGEQI
FT                   DELEKTLARGSSNAANEIKTKKSSLLSSIEETSKDLVEELDSVPAQTYKLTFPSPKAPS
FT                   KDDKARDETSTADADAQPEANSEISRQISSMAKGESDAGDAAFLKSLIEDPETSELMSE
FT                   SMSLSSAQPTSKAPTPSNTPLTPSPATDATVLGDNGTTTSPVDIPTKPAILPDVVRATG
FT                   DVAKNTTTYDDASDGSSHEDLEYGEGSEVAPNSKHDDAESKLTETAQTGEPAIEYKKKI
FT                   DTTNDINLYENALRGEAHPERSWAQKGLKPADESVLTEENIKQNELAEDQSLTVDFLNR
FT                   FPVQLPKSERETQNWRRYQKLRTRAGAKSAEEQSEEDRETVERVTAAAVELVRAEKKGE
FT                   DDRKEKSWRDVVFSLYFMGPLGFVAFVSVFYAVVVLVVRKSKKSPSKTGTDPDDDEAFD
FT                   KFLRDVTVTKSKTHTRRESDGGLASFLGFVKKRVDDVDEFAKYASARLQRTVDEDGEDD
FT                   VDEEKVWHQSTVSASGLESTSISGTSTPRASTSASSPNRVNHDPDRVLDKAVVNRSLQS
FT                   IRTRELSSPERIRNVRSRAGTADPSPATTPRETSYLTQQTIDRLEPERPKQRQPQSDQE
FT                   PPQREQRERQSSRAKANKPSPQVYRSLFPREQTEPPPAPPRRPGDAPQIVRSMTTKFY"
FT   gene            44040..45753
FT                   /locus_tag="OSTLU_27708"
FT   mRNA            44040..45753
FT                   /locus_tag="OSTLU_27708"
FT                   /product="predicted protein"
FT   CDS_pept        44065..45648
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27708"
FT                   /product="predicted protein"
FT                   /note="GO_function: - pyruvate kinase activity; GO_process:
FT                   - glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27708"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99851"
FT                   /db_xref="GOA:A4S831"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4S831"
FT                   /protein_id="ABO99851.1"
FT                   /translation="MGLSRGARTGSYVDLSKEATRPGQTGILDNGDAASDGTFKSKIIC
FT                   TLGPVSRTVEILEEMLRAGMSVARFNFSHGSHEYHQETLDNLRAACANTGIHCGVLLDT
FT                   KGPEIRTGMLACGGPVMLEAGKEIVLTTDYEFKGSAEKLAVSYPDLAKDVKPGSKILCA
FT                   DGSVTFTVLECDVAKGEVRCRLENSAKLGERKNMNLPGVNVNLPTITEKDRLDLIEWGV
FT                   KNNVDFIAASFVRKGSDVEYIRSVLGDFANKVSIISKVENMEGLDNYDDIVEKSDGVMV
FT                   ARGDLGMEIRMEQIFLAQKRMIKRCNYAGKPVVTATQMLESMTGAPRPTRAEATDVANA
FT                   ILDGTDAVMLSGETAAGNYAIDAVKCMASICREAEAYVDNVASYHQILEQQPIPMGVEE
FT                   SLASSAVRTAQKVQASIIVCLSRTGTTSRLIAKYRPDAPILSVCYAEEADPASVARRSL
FT                   VSRGIIPVIQPPEWGQGNAIVPQEVMRNAILYARDTLKIVKPGDAVVGVHRLLGEAILK
FT                   VVVCPEGNAF"
FT   gene            complement(<45814..>48580)
FT                   /locus_tag="OSTLU_18262"
FT   mRNA            complement(join(<45814..46919,47266..>48580))
FT                   /locus_tag="OSTLU_18262"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(45814..46919,47266..48580))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18262"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18262"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99982"
FT                   /db_xref="UniProtKB/TrEMBL:A4S832"
FT                   /protein_id="ABO99982.1"
FT                   /translation="MTSQCTFWSVQKTHRHGACARSTSTSARLKIHARHCAHVASRALE
FT                   ANRDWPPSDVWDDFVAAHAGEYAGASATFDPRTGAAVPLPSNYVPDAFKEYGVDVMEWQ
FT                   IVTSGGKTSDGDGLRLETKKLYPEAGCEYGKNDVAFAESHDVCAGGQMAKMFIVQGCYC
FT                   DGPKTLPECVEGAEVGFAFAFAEEEAPRERRRISLRVRAAPGQRRNWELCGIEITHETA
FT                   SECETRAASPATGDILTEDAVSVGEWRATSGVTFIALEALADVPEERETSGEDASTSSP
FT                   IDVGPAQKLAEQKPNDPALARAAEAEREAEERRAKEEIEAAARDPEGMLVVPWWAVKSP
FT                   SSWAMGGEYVLGGNSPLVFLPNHIWVLVESVDDQLVVECGRYDQGPPSAMLDDTERRVV
FT                   ARRYRKGRFASAFFVRERRLDPRERDEEKEEFDIFDDLDDVASDAFDDDELDEIDLAQA
FT                   RVLMRDLPRVLAQLEGETTGSGRAEDGGAAPERDAERDARERDARDSERPWRPWEPSKG
FT                   SALERLRALEDELRELLGERVVDEALQSVVETPTKAASAAALPGVVERAPSPPLNTIET
FT                   RRSDEAEVSTPTPRVALSLTPMPVEDSPEAKANFEPAMTSPKPAGGDDAPWDPYAAFMG
FT                   VGREQALRPRSSAPPTPVSPPKARVLGLPVDASLTHETTLKLVADLEEKVKSKPIEYTR
FT                   APTNLYKDVVATARLEDEVVVEDVEDGDSGDEERRFTHQYTREDAATILELANEDDQID
FT                   SWSNAVAGDDLHPRAPPIVSPMMRGDNSTPSIAGVESMNEFKLMMESVFDEDD"
FT   gene            <48812..>50116
FT                   /locus_tag="OSTLU_93762"
FT   mRNA            <48812..>50116
FT                   /locus_tag="OSTLU_93762"
FT                   /product="predicted protein"
FT   CDS_pept        48812..50116
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93762"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93762"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99852"
FT                   /db_xref="GOA:A4S833"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:A4S833"
FT                   /protein_id="ABO99852.1"
FT                   /translation="MRARRKRFQVIVSACYGSRGDVMPCLTIAAALARRLEGQATVVAM
FT                   ANPVFENAVAANVRFIGVGSRDEYECVQRDHASRRDARVVVRYWLDHLETHAERILEAR
FT                   ADAGRTIVLAHTLDLAVRCVDERANDECLTCYSLVLSPALLRTPNQTIPPFAGERLRCF
FT                   GRSRWAMRAADCLVDIAFAPQLNAFRASLGSTKPVKRVFDEWFLCKAGVFAMYPEYFER
FT                   AADAGSRKVFQIDFPQEGGDVNVTGLNAIRVAREFIDRDDAPTVVFVSASGNPPFASQF
FT                   FATAVKAMRRLAGAKAILLTRHRDRIGELPENAIHIDFLPLHLCRDAGLKIAALVHHGT
FT                   IGCSATALRSAWPQVVVPAAFDQPYNAALLEAMGAAQIIHMTRLTRTRLVKALKIVFKE
FT                   EARAPETAPRRRANDASSPQARVAEIIAKELLQYG"
FT   gene            complement(<50125..>51237)
FT                   /locus_tag="OSTLU_27712"
FT   mRNA            complement(<50125..>51237)
FT                   /locus_tag="OSTLU_27712"
FT                   /product="predicted protein"
FT   CDS_pept        complement(50125..51237)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27712"
FT                   /product="predicted protein"
FT                   /note="GO_component: - intracellular; GO_function: -
FT                   nuclease activity; GO_process: - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27712"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99983"
FT                   /db_xref="GOA:A4S834"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR027520"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A4S834"
FT                   /protein_id="ABO99983.1"
FT                   /translation="MRAPPTRDAPTRRAPARALYACYLVVSLDPSKKGKSYVGFTTNPP
FT                   RRLAQHNGAIANGAKYTMRLRPCDMVLVVSGFSDKVQALQFEWAWQRPASCRATRTLAR
FT                   ERGVSDKTSAPGKKAMVMCGMLNTAPWKHMPLTVHCMSEVGERLIEKYADAIPAHVERR
FT                   RTTTREMDAIVAASANAEEEEMDEEMDDAMRARVMDVGVSGTPSASASASRPGGEALKC
FT                   GVDACGKAIRSDRAVGCATCGARFHPVCLARHFFDRAGDEALSWSSRLIPDHGPCARCG
FT                   KRLTWGAAIGAGAAREPATETTTPRVHASRDCERDGEVVTSTEKIRRLRSAERREVERA
FT                   RVQSWARDVSDVSDDSDDDMHDSDSDVIVE"
FT   gene            complement(51487..>54094)
FT                   /locus_tag="OSTLU_19841"
FT   mRNA            complement(join(<51487..52203,52522..52892,52950..54094))
FT                   /locus_tag="OSTLU_19841"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(51527..52203,52522..52892,52950..54094))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_19841"
FT                   /product="predicted protein"
FT                   /note="GO_function: - oxidoreductase activity, acting on
FT                   the aldehyde or oxo group of donors, disulfide as acceptor;
FT                   GO_process: - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_19841"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99984"
FT                   /db_xref="GOA:A4S835"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:A4S835"
FT                   /protein_id="ABO99984.1"
FT                   /translation="MAHRGRLNVLHNVFGKPLGAICAEIVDDRSSFLVGDVRYHLGARA
FT                   VVDVDVERGAKQVALTLVPNPSHLEMVNAVVSGVVRAKQFKRDSQTEGASARAHVLPLL
FT                   LHGDASFCGLGQNGEVMQLQDLPDYTTGGTVHVVVNNQIGFTTVPRRARSSPHPSDVAK
FT                   AYGAPIIHVNGDDPDAVVSAMRLAADYRAEFQSDVVVNYVCYRRFGHNELDDPSITLPL
FT                   MSRRIEATPRVAENYANACVAEGILSKDELDDLRRGMEKEFAAEGATHQDFIRTTESWL
FT                   ASTRAVSTGVSGREARVTAAGTGMPIDALQKICHSITTPPEDTDFMLHPHVKAMFEARR
FT                   RAMEPDVQVGAGQIDWATAEALAFASLLMHPCEKRWENHVPCGQDCVRGTFNQRHAAVY
FT                   CNRTSHEHVPLDNMNMGPQDKFTAANSPLSEHAVLGFEYGFASEMGKEALVLWEAQFGD
FT                   FANNAQVIIDQYICSGEERWGQRSDIVLLLPHGYEGQGPDHSTARPEPSVMAQANFVMV
FT                   QPSTPAQYFHALRRQISSPHSKPLVVLTPKTLLHHKHCASKLMDFAPKSSFRRVIADGD
FT                   AGDDVTRHENIPLKPNGEIKRVILCTGKIYYSLARQRAAKKIDDVAIIRLEQLFPFPHD
FT                   ALARRLQRYPNAHLVWAQEEPKNMGYWSFVAPRIATTERATRVRASVDEENRRVRFVGR
FT                   PPSAAPATGSLAIHNAENARLIAQALNARDDDDAIA"
FT   gene            complement(<54224..>54943)
FT                   /locus_tag="OSTLU_18265"
FT   mRNA            complement(<54224..>54943)
FT                   /locus_tag="OSTLU_18265"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<54224..54943)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18265"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18265"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99985"
FT                   /db_xref="GOA:A4S836"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="UniProtKB/TrEMBL:A4S836"
FT                   /protein_id="ABO99985.1"
FT                   /translation="MSTRRATSALARALDRARAADAGARGARGNGNPPTLTVIARRASS
FT                   TTASTTASTGANDDGDRFDDVTDALALTELTRAVRARGHLTAALDPLGRSLGPIVRGYE
FT                   TMEATTPKDARDIHALLQGYPDHFYKEDCKTKVSLGEYLGLSESARRAPEKRFHLGEDA
FT                   ATLDPSGARAKTAWRVDELFERLRDVYCGTMSVECNHLTSKERKRWLREQVECGPREAS
FT                   ATERRRTLERLLTADRLE"
FT   gene            complement(<55441..>56202)
FT                   /locus_tag="OSTLU_93763"
FT   mRNA            complement(<55441..>56202)
FT                   /locus_tag="OSTLU_93763"
FT                   /product="predicted protein"
FT   CDS_pept        complement(55441..>56202)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93763"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93763"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99986"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A4S837"
FT                   /protein_id="ABO99986.1"
FT                   /translation="LLSARGSVGWFTARAIDDALRALEDESLGGGHGACVTACAAFLGD
FT                   LELVRMARECGHEWDAYTCQFAAKYGELECLKYAHEHGCPWDEGTCRCAAYSGHLECLK
FT                   YAHEHGCPWDEWTCSFAAMHGHLECLKYAHEHGCPWNEETCACAAYTGRLGCLKYAQDH
FT                   SAPESARYVVGWQRICACTTDLIVQIALSRQRDGYVSLRELTPAVNHFLRAWPELDLPE
FT                   DVIRWILFDADLKPMTSRARFSRMIALYATK"
FT   gene            <56385..>56999
FT                   /gene="RPL23"
FT                   /locus_tag="OSTLU_18267"
FT   mRNA            join(<56385..56397,56590..>56999)
FT                   /gene="RPL23"
FT                   /locus_tag="OSTLU_18267"
FT                   /product="Ribosomal protein L23, component of cytosolic 80S
FT                   ribosome and 60S large subunit"
FT   CDS_pept        join(56385..56397,56590..56999)
FT                   /codon_start=1
FT                   /gene="RPL23"
FT                   /locus_tag="OSTLU_18267"
FT                   /product="Ribosomal protein L23, component of cytosolic 80S
FT                   ribosome and 60S large subunit"
FT                   /note="Cytosolic 80S ribosomal protein L23; Cytosolic 60S
FT                   large ribosomal subunit protein L23; GO_component: - large
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18267"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99853"
FT                   /db_xref="GOA:A4S838"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:A4S838"
FT                   /protein_id="ABO99853.1"
FT                   /translation="MSKRGGGNASGTKYKMSYGVPVGAVVNCADNTGAKNLYLIAVKRW
FT                   GSRQNRLPAANPGSMVMATVKKGKPDLRKKVFPAIIVRQRKPIRRKEGLIIYFEDNAGV
FT                   ICNPKGEMKGSAIAGPVAKECADLWPRVASAASSII"
FT   gene            complement(<58168..>58599)
FT                   /locus_tag="OSTLU_40610"
FT   mRNA            complement(<58168..>58599)
FT                   /locus_tag="OSTLU_40610"
FT                   /product="predicted protein"
FT   CDS_pept        complement(58168..58599)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40610"
FT                   /product="predicted protein"
FT                   /note="GO_component: - clathrin vesicle coat; GO_process: -
FT                   intracellular protein transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40610"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99987"
FT                   /db_xref="GOA:A4S839"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniProtKB/TrEMBL:A4S839"
FT                   /protein_id="ABO99987.1"
FT                   /translation="MIRFILLQNRQGKTRLAKYYVPFADDEKRKLESEVHRLVVNRDPK
FT                   HTNFVEFRNYKVIYRRYAGLFFSLCVDLNDNELTHLESIHLFVEMLDHFFANVCELDLV
FT                   FNFQKVYLLVDEFLLGGEVQDTSKRAIMERLAELERIKD"
FT   gene            complement(<58761..>60479)
FT                   /locus_tag="OSTLU_40662"
FT   mRNA            complement(<58761..>60479)
FT                   /locus_tag="OSTLU_40662"
FT                   /product="predicted protein"
FT   CDS_pept        complement(58761..60479)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40662"
FT                   /product="predicted protein"
FT                   /note="GO_function: - pyruvate kinase activity; GO_process:
FT                   - glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40662"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99988"
FT                   /db_xref="GOA:A4S840"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4S840"
FT                   /protein_id="ABO99988.1"
FT                   /translation="MGLNARNSSVDPIVHDDARGDEKRRRTVALAGLSSQRALSALASK
FT                   GSVGDWRAAHVLENGGEASEDYAFNDSEAAFRAKDSQRIGFKSKIICTLGPVSRTVEIL
FT                   EEMLRAGMSVARFNFSHGSHEYHQETLDNLRAACANTGVDCGVLLDTKGPEIRTGMLAC
FT                   GGPVMLEAGKEIVLTTDYEFKGSAEKLAVSYPDLAKDVKPGSKILCADGSVTFTVLECD
FT                   VAKGEVRCRLENSAKLGERKNMNLPGVNVNLPTITEKDRHDLIEWGVKNNVDFIAASFV
FT                   RKGSDVEYIRSVLGDFANKVSIISKVENMEGLDNFNDIVEKSDGVMVARGDLGMEIRME
FT                   QIFLAQKRMIKRCNLAGKPVVTATQMLESMTGAPRPTRAEATDVANAILDGTDAVMLSG
FT                   ETAAGNYAIDAVKCMASICREAEAYVDDVASYFQILEQQVIPLGITEALASSAVRTAQK
FT                   VNAALIVTLSRTGHTAQMIAKYRPETRIVNVCIEEPDHQGRALDVVHRSLITRGLVPLL
FT                   ENPAWRGESGHPQEVMRNAIVHCRDILGLVKPGDAIVGVHRIMGEAVLKVIIVPE"
FT   gene            <61000..>61902
FT                   /locus_tag="OSTLU_40454"
FT   mRNA            <61000..>61902
FT                   /locus_tag="OSTLU_40454"
FT                   /product="predicted protein"
FT   CDS_pept        61000..61902
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40454"
FT                   /product="predicted protein"
FT                   /note="GO_function: - dihydrodipicolinate reductase
FT                   activity; GO_process: - lysine biosynthesis via
FT                   diaminopimelate"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40454"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99854"
FT                   /db_xref="GOA:A4S841"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR011859"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4S841"
FT                   /protein_id="ABO99854.1"
FT                   /translation="MRARGRAIVATRASADGATTRVMVNGVSGKMGHATACGVVKRAGF
FT                   ELVPYALTKRATAATTDVLGTEVRGVDVGEEDAGETLERAKREYPGFIVVDYTQPDSVN
FT                   SNAALYVKHGVPFVMGTTGGDRERMLREVKESGNYAVIAPQMGKQVVAFQAAMKLMAEQ
FT                   FPGAFEGYTLTVTESHQSSKKDTSGTAKAIVASFNDLGCGFDLNDIELVRDVESQTGKM
FT                   GVPEEHLLGHAFHTYRLTSADGTVSFEFQHNVCGRSIYAEGTVDAVGFLKRKVDAKDPK
FT                   TLYDMIDVLKEGAMGEWVK"
FT   gene            complement(<61950..>63014)
FT                   /locus_tag="OSTLU_18270"
FT   mRNA            complement(<61950..>63014)
FT                   /locus_tag="OSTLU_18270"
FT                   /product="predicted protein"
FT   CDS_pept        complement(61950..63014)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18270"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18270"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99989"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A4S842"
FT                   /protein_id="ABO99989.1"
FT                   /translation="MMPRRTFALSCASASALATRRDASASDTLRAQYADAFEALRRNAA
FT                   TTTVPMTLERGGAYAVEWTLGDAARTLRGVVDTGSPFLTSQRRGCDASGAGAGWGCVEA
FT                   EDVRFEAYDATFETYGLQADGRTSWYAGKRATLGSLEFEDLVFGVTDDVRGRDAAPFVG
FT                   LVKYTNRERGIRPSFLQQTDIASFALDFERETLTLSRDSLVDESEIGVLRTVDLRSIGA
FT                   PVYHYATPCDELWINGERFETSKPIYVVFDSGTTGMLVDRQLYEDSDFHLGTYQTHMKF
FT                   TDTNGETKYCGSSLRTCKLSEDCLFVVTPIDVPWPGCGDDFHIVFAGLSVLRNQGALVV
FT                   DAERGLVRLGRLVA"
FT   gene            <63759..>64727
FT                   /locus_tag="OSTLU_5621"
FT   mRNA            <63759..>64727
FT                   /locus_tag="OSTLU_5621"
FT                   /product="predicted protein"
FT   CDS_pept        <63759..>64727
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_5621"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_5621"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99855"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR026894"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A4S843"
FT                   /protein_id="ABO99855.1"
FT                   /translation="RETEYYDALEVSPTATSAEIRRKYYLLARKMHPDKNPNDPTAKAR
FT                   FQEIGEAYQVLSDESLRRKYDARGKDALGDVPIVNPAAFFGMLFGSEQMEGFVGRLQLA
FT                   SLAMAGTDLTGDEQDLLQKRREARLAIKLAAMCDVYVDIDSKMGTEKERAAQFVETMRP
FT                   VAQTLANASFGQIMVQKIGWVYAMEAEKFLHDPLAGTGTWLDLGLRSTGVTMQQKASKW
FT                   KNKFSALKAGVNIFSTVQSSEAEVQKATNEQQANELRAKQQRDVLPHVLDALWSTSSVD
FT                   IESTLRHVCSKVLHDASVAQSRRAGRAKALLYLGKMFQETKS"
FT   gene            complement(64879..66564)
FT                   /gene="AOX5"
FT                   /locus_tag="OSTLU_47627"
FT   mRNA            complement(64879..66564)
FT                   /gene="AOX5"
FT                   /locus_tag="OSTLU_47627"
FT                   /product="Amine oxidase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(64905..66563)
FT                   /codon_start=1
FT                   /gene="AOX5"
FT                   /locus_tag="OSTLU_47627"
FT                   /product="Amine oxidase"
FT                   /note="GO_function: - oxidoreductase activity; GO_process:
FT                   - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_47627"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99990"
FT                   /db_xref="GOA:A4S844"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014102"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4S844"
FT                   /protein_id="ABO99990.1"
FT                   /translation="MRAALAPRPIPLSRASGARARTATPRTRCADYPKPDLDVKSNANF
FT                   QEAKAKSARLATFRARVRRDDAPEKPTVLVIGGGLAGLSCGKYLADAGCAPTVIERGKA
FT                   LGGKVSAWRDDDGDWIETGLHIFFGAYPNVMNLFRELDIEDRLQWKEHAMTFAMKDYPG
FT                   EFTKFYFPPALPAPLNMGYAILSNDKMLTWSEKLRTGAPLVPMLVGGQDYIDAQDELSC
FT                   EEWMKKNFMPKRVRDELFIAMGKALDFIDADKLSMTVILTAMNRFINETHGSKTAFLDG
FT                   NQPDRLCAPMAEHIERVGGGKVITDAPMQEILVDADGNVEGVKMRDGQIMTADHYVSAM
FT                   PVDALKLKLPDVWKAMPFFRQLNELEGIPVINVHLWFDRKLRPYDGLVFSRSPLLSVYA
FT                   DMSECCAEYKDDDRSMLELVFAPCDKRAGSDVNWIGASDEDIVAATMKELETLFPDELG
FT                   AGKDGASGAKLRKFAVVKTPRSVYAAIPGRNKFRPSQHTPIKNFTLAGDYTSQKFLGSM
FT                   EGAVLSGKLAAEVVAETFAGVEPTTRVKPVHESVA"
FT   gene            complement(<68938..>69816)
FT                   /locus_tag="OSTLU_40725"
FT   mRNA            complement(<68938..>69816)
FT                   /locus_tag="OSTLU_40725"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<68938..69816)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40725"
FT                   /product="predicted protein"
FT                   /note="GO_function: - protein kinase activity; ATP binding;
FT                   GO_process: - protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40725"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99991"
FT                   /db_xref="GOA:A4S845"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A4S845"
FT                   /protein_id="ABO99991.1"
FT                   /translation="MENPTTAASPTTLRERNGDANAPGRAPLRSKTTLDDYVILRPVGE
FT                   GSFGKVFQARQRYSGRACAMKFIPKHGKSERDLVSLRSEIDIMKTLDHPNVIKMLDAFE
FT                   TNMEFVVVMEFAQGVLYDVLEHDARLPEKEVRMIARQLVDALYYLHSNRVIHRDLKPQN
FT                   ILIGTDRCVKVCDFGLARSMSKSSLVMTSIKGTPLYMAPELVQEQPYDHAVDLWSVGVI
FT                   LYELFVGQPPFYTTSIYTLIQKIVKEDVKWPDTMSPSFKSFLQGLLNKKPQQRLNWPSV
FT                   LDHPFVRKDGDE"
FT   gene            complement(<70153..>72090)
FT                   /locus_tag="OSTLU_89243"
FT   mRNA            complement(<70153..>72090)
FT                   /locus_tag="OSTLU_89243"
FT                   /product="predicted protein"
FT   CDS_pept        complement(70153..>72090)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_89243"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_89243"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99992"
FT                   /db_xref="GOA:A4S846"
FT                   /db_xref="InterPro:IPR012920"
FT                   /db_xref="InterPro:IPR024576"
FT                   /db_xref="UniProtKB/TrEMBL:A4S846"
FT                   /protein_id="ABO99992.1"
FT                   /translation="LEPPEEGWMDLDNHPTTTDEIRSLMSDLGVLGKADFKLLLRWRMT
FT                   IRKQAGLEKKKHARKGGKRGEDDDEDSSDESSGEEEEAGDSDDENAGDEKDQLLDEMSE
FT                   LKNSMDAQARRDKKKRAKIKAKERLRVARGLASSGEAIVEQEMDLFSLARIKTKGALDV
FT                   VSKAPTPGIDAARDSDEEPEDDSDADSDTEEDERRLDKEVDDMWDMYKARRQKKGEKFT
FT                   EASKGRDRRTELGAGELDDEDSSDEDGDDDDASDPADDEFKSDSDELEWDDADEDEDAP
FT                   KGKKSKSKKDANPLVVDLGTKQKKNAVKAADMWFSNDLFASGKKAKAAPAEALDSDEDE
FT                   EEVPVKSSKKEKKKKKQATEDEEENFDDLRAKAKEKKAKSEAKTKGSGRGGKGAARDDT
FT                   YDDESDEDTTRQKRRKAVDGGDFEVVTAEAEPPTDSDSDAEGYGYDSEVDELSDDTRAR
FT                   ILALGKKMIRKKDREELIEDAYNRYAFDDDDVPDWFAEDERRFMKPIPQYTAAELAEAK
FT                   AQLAAVNTRPIKKVAEAKWRKKKRAEAKISQARVRASAIIEQDDVPDVSKAKEIERVFA
FT                   KARRATSGAIKKPRKVVVARKYHRGNAGGPSVDKRQLADARGERASAKRAGKGGRGGKG
FT                   GRGGRGRGKR"
FT   gene            complement(<72282..>73412)
FT                   /locus_tag="OSTLU_89244"
FT   mRNA            complement(<72282..>73412)
FT                   /locus_tag="OSTLU_89244"
FT                   /product="predicted protein"
FT   CDS_pept        complement(72282..73412)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_89244"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_89244"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99993"
FT                   /db_xref="GOA:A4S847"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR024576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4S847"
FT                   /protein_id="ABO99993.1"
FT                   /translation="MTFCQSIPGVASHSAPRASRRRRHGQTRQGEASIRYDVVRRARAA
FT                   RDARAAREPRASCAAAAAAANRIDAASTRASARLTRERARCARSIADKYYYLAKEQGFR
FT                   SRAAFKLVQLNRKYDFLSKARACMDLCAAPGGWLQVAQKYMPMSSTIVGVDLAPIRPIR
FT                   GVTTLVEDITTQSCRAALKRVTPQGLKYDVVIHDGAPNVGGNFAKESYTQAALTLDSLR
FT                   LATEFLGPGGWFVTKVFRSVEYHALLYAFQQLFKKVESTKPVASRGTSAEIYVVCSGYL
FT                   APTKIDPRLLDARHLFADTEAEIQPLDVTKDNGKRKRNRSGYEDGVSTLYKECTAEEFI
FT                   VNEKPGEMLGSHHTFILDGKVRRQERDVFLAAIESL"
FT   gene            complement(<73491..>74738)
FT                   /locus_tag="OSTLU_18275"
FT   mRNA            complement(<73491..>74738)
FT                   /locus_tag="OSTLU_18275"
FT                   /product="predicted protein"
FT   CDS_pept        complement(73491..74738)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18275"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18275"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99994"
FT                   /db_xref="GOA:A4S848"
FT                   /db_xref="InterPro:IPR008676"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR026541"
FT                   /db_xref="InterPro:IPR038217"
FT                   /db_xref="UniProtKB/TrEMBL:A4S848"
FT                   /protein_id="ABO99994.1"
FT                   /translation="MLAAAEAAALAATRAVPDVAARARPARTPRATSKAISGFELGAKA
FT                   IRLEGDDAVNATIVGARARDDGRGEYLVRYGGYHHPRRDDEWVDAAALRPLDATEAREK
FT                   RKRARANGAVEQARGGKRRKAPAATPNETEAEARERRRLWKNEQSHVSKRRMRERRLAE
FT                   TAKASIAPKHRKEGRVGGAKTTAATAARASSNAAPRGASARRGDAARAVAKRAVGKSAE
FT                   ARGAAKAQPSAADPELTEEERVARTIRVNVPTALRKALLRDYEDSRGVDPRAYVAPRVN
FT                   VANILDRFVADRADPARTKTSTQRVTAARTRAIVRGFEESFNAALDASLLYKDEWHNPV
FT                   YARPSEAYGATHLLRMLNRLSTMFPPESFADADAAVAVEARANDLLRFVAQRAEEFGVV
FT                   APDAPPAPGTPDNVDA"
FT   gene            <75269..>76474
FT                   /locus_tag="OSTLU_18276"
FT   mRNA            <75269..>76474
FT                   /locus_tag="OSTLU_18276"
FT                   /product="predicted protein"
FT   CDS_pept        75269..76474
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18276"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18276"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99856"
FT                   /db_xref="UniProtKB/TrEMBL:A4S849"
FT                   /protein_id="ABO99856.1"
FT                   /translation="MEATEAEAYATLRDAERAALEVEVPCAMAEVEHEFRAVSAARALE
FT                   TRRAMVRLRALLPVRIDEERGSREAPRGVRACEWRVPDAIDDRGFDAHELAAGLGALMH
FT                   FSALASRYLDAPRLHRGSHAASQSYVWAPTSAWDDVDSSVWENKGTVHVRDFAGVNSER
FT                   LELFLPRAVVEGSCDPASVRESRLRLKRAIRLLTRSVSVMCAHQSRECGVIAPPNWGPF
FT                   SQLCALTSAVAKGEETTTTAPQRAPARRQTPPQILRTSTNDRRRESVESFESRDMVQPV
FT                   TDGAHRGDVVKRAVSSTIAEISRNHWFSAHASTPRESNAIVDDDELLFETLNAGDFFID
FT                   HDSVDDIGGWEAIHGNRLRPAAVEDAVAPVSNRGLVLPPPPSAVDDIEHWERAMLVDNA
FT                   GG"
FT   gene            complement(<76556..>77276)
FT                   /locus_tag="OSTLU_40654"
FT   mRNA            complement(join(<76556..77050,77166..>77276))
FT                   /locus_tag="OSTLU_40654"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(76556..77050,77166..77276))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40654"
FT                   /product="predicted protein"
FT                   /note="GO_function: - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40654"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99995"
FT                   /db_xref="GOA:A4S850"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4S850"
FT                   /protein_id="ABO99995.1"
FT                   /translation="MSRSTTRLGLTGSIGMGKSTVAAMFRDLGVAVMDADAVVYDLYAP
FT                   DGAAVAVVAEMFGDGVLDAATGAIDRAKLGAIVIGDDAKMRALESAVHPLVERAREAFV
FT                   EAHANDDVVVFDIPLLYEKEYEASVDAVCVVSTGDEATQRARVLKRDGMTEEKFNGIAA
FT                   RQIPDAEKRAKADYVIDTSCSLAQTRARVEEILSLVKS"
FT   gene            complement(<77479..>77868)
FT                   /gene="psbW"
FT                   /locus_tag="OSTLU_40772"
FT   mRNA            complement(<77479..>77868)
FT                   /gene="psbW"
FT                   /locus_tag="OSTLU_40772"
FT                   /product="psbW, PSII-W, photosystem II polypeptide"
FT   CDS_pept        complement(77479..77868)
FT                   /codon_start=1
FT                   /gene="psbW"
FT                   /locus_tag="OSTLU_40772"
FT                   /product="psbW, PSII-W, photosystem II polypeptide"
FT                   /note="GO_component: - photosystem II; GO_process: -
FT                   photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40772"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99996"
FT                   /db_xref="GOA:A4S851"
FT                   /db_xref="InterPro:IPR005610"
FT                   /db_xref="InterPro:IPR038676"
FT                   /db_xref="UniProtKB/TrEMBL:A4S851"
FT                   /protein_id="ABO99996.1"
FT                   /translation="MNRGVARATRASRAVTRAGTTSIQFVKGQNETSVPEVKLTRSKDG
FT                   SNGTAFFIFAEPDVFENGQGDITGMFLNDEEGEMSTVDVNAKFINGKPSGIEARYVMKT
FT                   ERDWDRFMRFMARYAEDNGLGFAKK"
FT   gene            complement(<78228..>79355)
FT                   /gene="VDE"
FT                   /locus_tag="OSTLU_27727"
FT   mRNA            complement(<78228..>79355)
FT                   /gene="VDE"
FT                   /locus_tag="OSTLU_27727"
FT                   /product="violaxanthin de-epoxidase, chloroplast precursor"
FT   CDS_pept        complement(78228..79355)
FT                   /codon_start=1
FT                   /gene="VDE"
FT                   /locus_tag="OSTLU_27727"
FT                   /product="violaxanthin de-epoxidase, chloroplast precursor"
FT                   /note="violaxanthin de-epoxidase precursor, putative
FT                   precursor of plastid localized enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27727"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99997"
FT                   /db_xref="GOA:A4S852"
FT                   /db_xref="InterPro:IPR010788"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="UniProtKB/TrEMBL:A4S852"
FT                   /protein_id="ABO99997.1"
FT                   /translation="MTVAPGSALAVSAAKQAEMKDTGACLLQNCGKELAKCVTDEKCLE
FT                   DLVCLQGCFGQPDEGDCQIRCGDLYASQAVGTFNTCAVTEKSCVAQRKDDGTYPVPPFD
FT                   ALADGFTIDTMVKEKRWYIVAGLNKDFDTFDCQEHFFDKGDDGKMYIKINWRVNRPNGQ
FT                   FYERNDVQRFYQEPDGKAILHNNGNVMLHYQDDWYIPAYKEGEWVYIYYRGTNDAWDGY
FT                   GGATVYATTPDLKPEWIPDLEAASKKVGVKWSDFVITDNSCKPAPELKLTKPTDLDTLV
FT                   DDAEVIEKDIEKDVKRIESFFTTEAVTLEEKLRRLESGLVNSGPGRPAGFVTKDDKNST
FT                   LTKKEQRQLEKVAKRLDKLQDNFRDDAGVVDGRND"
FT   gene            <80050..>81336
FT                   /gene="ZEP"
FT                   /locus_tag="OSTLU_1611"
FT   mRNA            <80050..>81336
FT                   /gene="ZEP"
FT                   /locus_tag="OSTLU_1611"
FT                   /product="zeaxanthin epoxidase (ABA1) (NPQ2)"
FT   CDS_pept        <80050..>81336
FT                   /codon_start=1
FT                   /gene="ZEP"
FT                   /locus_tag="OSTLU_1611"
FT                   /product="zeaxanthin epoxidase (ABA1) (NPQ2)"
FT                   /note="zeaxanthin epoxidase, chloroplast precursor;
FT                   GO_component: - chloroplast; GO_function: - oxidoreductase
FT                   activity; monooxygenase activity; GO_process: - carotenoid
FT                   biosynthesis; xanthophyll biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_1611"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99857"
FT                   /db_xref="GOA:A4S853"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4S853"
FT                   /protein_id="ABO99857.1"
FT                   /translation="KPKVLVAGGGIAGLVAAAACRRKGMEVRVFEKVKKYEPFGGPIQL
FT                   QCNAQGALDSIDPAMAEAVTAKGTITGDRVNGLLDGVSGEWFYRFDTRKPCHDNGLPLT
FT                   LVLSRFELLDILSNGVGAENIEMGTVVERYEHRGEKVVATLTDGREFEGDVLIGADGIR
FT                   SKLRAQMRGADPEKPPLAYAGYAVYTAVCKYSQPHREPQHTDPNKVGYQVFLGPKQYFV
FT                   SSDVGNGEQQYYAFLEVPPGGDDEFAKCEKWENYREMLMDRFSGWAPAVMERLECTRPE
FT                   DVERRDVNDILPDPRWVDGRMALLGDSAHAVQPNLGQGGGQAIESAYVLADELSKCEGG
FT                   KGVQNALMAYASRRFLRTASIHGLSRFSSLMNTFYRRHLGDEPYDWYPEPVKNMWNTVA
FT                   KAKIPHPGSVIGQIALIGTMPIILEYVGAG"
FT   gene            81730..82881
FT                   /locus_tag="OSTLU_27729"
FT   mRNA            81730..82881
FT                   /locus_tag="OSTLU_27729"
FT                   /product="predicted protein"
FT   CDS_pept        81746..82831
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27729"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27729"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99858"
FT                   /db_xref="UniProtKB/TrEMBL:A4S854"
FT                   /protein_id="ABO99858.1"
FT                   /translation="MPPLPRRRAARARVRARARASARAFVLALLSRARPSASSARTSKI
FT                   GALRECVDASRSQRRLCGASAAVVLGQNVYVASSRADAVTVIDASDPEAMRVAGSAASF
FT                   GGMRRPTDLHLHASQSYVAVLATGDVQTKKSSVVVVDVSASRWSADGTTITPTMAASGH
FT                   NCTATEKGGRTFYDGYLCGATAFAIVGNLAYVACGDTNRLTVMSLPSDVSKTALEPVAV
FT                   VGTIQSEELTNAEAIMVANNKAYVRSDGVCGSCVAVVDVTSASSMSMLATKDISEISSD
FT                   VPTWRWSTGYLARGAHRDNASYPYDWVVDPVSSSVTSVARECVNVALAIGDTPAACVGR
FT                   NEFAYDADAETSAFNFDLLTS"
FT   gene            complement(<82899..>83816)
FT                   /locus_tag="OSTLU_93767"
FT   mRNA            complement(<82899..>83816)
FT                   /locus_tag="OSTLU_93767"
FT                   /product="predicted protein"
FT   CDS_pept        complement(82899..83816)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93767"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93767"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99998"
FT                   /db_xref="GOA:A4S855"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR025999"
FT                   /db_xref="InterPro:IPR037912"
FT                   /db_xref="UniProtKB/TrEMBL:A4S855"
FT                   /protein_id="ABO99998.1"
FT                   /translation="MPDPDLSRWPAIDDYLLKLACESGVALESLVGADSCVKFASVRTL
FT                   DDVRARWNSMLRDDAFARACVRRLAEVRDDEIERAIAQRVAPRGATLREVLERAGLGTS
FT                   RRRDGGAETEPESDDGAPPRFSRAEQAILRSDLVERTEAGRAAETKAKAKREVGRGANA
FT                   TTLKKIKALERSAQAATARLATAKGALAELVGANVTFEIAKRDCVIGRSTEDLKVDVDL
FT                   GSEGNASKISRQQAFLKLRWNGEFALRNVGRRPIWCNNSPLTTGQRCILAPHTLIEVGG
FT                   MRLLFLPNPTLIRAASPELLEKIA"
FT   gene            complement(<83884..>85365)
FT                   /locus_tag="OSTLU_40506"
FT   mRNA            complement(join(<83884..85002,85069..>85365))
FT                   /locus_tag="OSTLU_40506"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(83884..85002,85069..85365))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40506"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40506"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99999"
FT                   /db_xref="GOA:A4S856"
FT                   /db_xref="InterPro:IPR010678"
FT                   /db_xref="UniProtKB/TrEMBL:A4S856"
FT                   /protein_id="ABO99999.1"
FT                   /translation="MLIPDQGPAGQQLNDETLDAVCLHVIDHVTRTRNRVMKNNESLAK
FT                   KAKAGVKVIEDDLPRDQGFVRPTVLFLTPMRNIAGRAIMRLLELCPAAHGRNDAVEDEH
FT                   GNKKKKYKPFVPDDHKALFKGNTDDHFRLGLKLTKASVRLYVDFFGADIIFASPLGIVT
FT                   ALQDEKSAADFLSAIEILVIDHAHVIQMQNWAHVATLVDATNALPKDTRDCDIQRVHES
FT                   HLNGHARHLRQTILLSAFQTPEINALFNRRCVNFEGKVRFRAPQRGVLGKLAVKTRQQF
FT                   ERVAMKASDVVDADDIRFKYFTKKVLPRIRENPEPGVVIFVSSYFDFVRVRNLLVAEDV
FT                   SFAVNSEYTEPREAARARTLFADGRKRVLLLSERAHFYFRRRIKGAREICFYSLPEHRD
FT                   FYPELVSYLAGSSAAASARATDAVAGAPVVGHVAGVVALFSKLDALKLERIVGCARARK
FT                   MIDDDERPMFLFV"
FT   gene            <86231..>87589
FT                   /locus_tag="OSTLU_89248"
FT   mRNA            <86231..>87589
FT                   /locus_tag="OSTLU_89248"
FT                   /product="predicted protein"
FT   CDS_pept        86231..87589
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_89248"
FT                   /product="predicted protein"
FT                   /note="GO_function: - transaminase activity; GO_process: -
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_89248"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99859"
FT                   /db_xref="GOA:A4S857"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4S857"
FT                   /protein_id="ABO99859.1"
FT                   /translation="MSRALAFGVAVGGRPASRAIRTRRATRGRAPRARETRAKVDQTLN
FT                   ERVANLQPSKTVALTDLARAMRDAGEDVIGLAAGEPDFATPRAVGDAGKAAIDAGKTKY
FT                   SPNDGDAKLRNAIARKLEEENGLTYDGKTEIVLSNGAKQSVAQCVMATCGPGDEVLVPA
FT                   PYWVSYPEMVRLSGAESVIVRTTADEGFLVTPEQLRKAITPRSRLLILCSPSNPSGAVY
FT                   PKETLEELAKIVVEHPRLMVLSDEIYEHIVYAPAEHHSIAAMDGMWERTMVVNGFSKSF
FT                   AMTGWRLGYVAAPKHFARAMSMIQSQITSGPNSISQEAALAALELGYKGGEDVAAMVRA
FT                   FEQRRDFVSARLNAIQGVKLPKVDGAFYVFPDVSAFFGGNASAEGFGPVADVDELCRYI
FT                   LEKGQVALVPGSAFGVPECLRISYAASNATLEEALSRIERCLSLDVFTRNSRR"
FT   gene            <87776..>88600
FT                   /locus_tag="OSTLU_18283"
FT   mRNA            <87776..>88600
FT                   /locus_tag="OSTLU_18283"
FT                   /product="predicted protein"
FT   CDS_pept        87776..88600
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18283"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18283"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99860"
FT                   /db_xref="InterPro:IPR019265"
FT                   /db_xref="UniProtKB/TrEMBL:A4S858"
FT                   /protein_id="ABO99860.1"
FT                   /translation="MSRARPRATLDDALRARALTVLGAPASALECSTSASALAALAEFL
FT                   EDTVIRALPADQRDGLRRARTADARGVRDALTAYGEHLEPAIEALGEGALDAVADELLE
FT                   RATALKHADASPSAARDDVEAIERSSKRLKLFSRDADEVSGALASDAGWEALTRLATAL
FT                   GAETNGTGGGRDPLDACVLLERCVVAQERFVTAFASASGRETARNPPKLEDMPSGVGLN
FT                   GDAEVERAVAVARLLHVNDLRRLQSEVDAFLVAMQEYTADPKTDSRIGKVGR"
FT   gene            89703..>91118
FT                   /locus_tag="OSTLU_51525"
FT   mRNA            join(89703..90315,90409..>91118)
FT                   /locus_tag="OSTLU_51525"
FT                   /product="predicted protein"
FT   CDS_pept        join(89739..90315,90409..91118)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_51525"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_51525"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99861"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR035297"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040134"
FT                   /db_xref="InterPro:IPR040896"
FT                   /db_xref="UniProtKB/TrEMBL:A4S859"
FT                   /protein_id="ABO99861.1"
FT                   /translation="MLALEKTYRLAADFVATPRLCVAIVDVLRACEDWDGLREHVAALT
FT                   KRRAQLKQAIAAMVRRCMEFIDEAPGAEQRLKLIETLCDATSGKIFVEVEKSRLTRALA
FT                   KMHEDEGRVAEACGVMQEVAIETYGALTRHEKLFFIEEQVRLCLAKKDYLRALILSRKI
FT                   NPKVFDELIEKEKKDAEKAALAAKSATELSIPSLEALKLRYYELMVEYYSHSDEYLEQC
FT                   RCYQNILECAEVKHDVARWGPTLKKVVWLVCLSKHEPMQQSILHGVKGNLKLSDLPAHE
FT                   ALIKQFCTKEIIHWTTLQERYAGEIAAETELFGGEKGAKRVEDLKLRVIEHNMLVIAAY
FT                   YSRMSLSRLSELLCLSPEETEKHLSSCVVDKSVAAKIDRPAGLVNFSAAKSSDFLLNKW
FT                   VSNIDSLLTCLDKASHLIQKESQQFKVAL"
FT   gene            <92361..>93566
FT                   /locus_tag="OSTLU_27735"
FT   mRNA            <92361..>93566
FT                   /locus_tag="OSTLU_27735"
FT                   /product="predicted protein"
FT   CDS_pept        92361..93566
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27735"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27735"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99862"
FT                   /db_xref="UniProtKB/TrEMBL:A4S860"
FT                   /protein_id="ABO99862.1"
FT                   /translation="MPMRAANDGWNRFGARSTYIAGLIETEDGDFDDEEFPTDYRAELE
FT                   IRLSQIARLEDALKDANARAAVARREENVEAQMSKFRTHLQNVQRELENVKRERDAYKM
FT                   KWHASSGPAEAKTREARRANQRTMATQTTFDDDEKKKDAEVAPSKKEIRAAEEKWMEQA
FT                   RLFEQKFERQMEISNEYDRKLRDERTRLMRSEARYEARIEELTTKQAELIAELSVRGVG
FT                   TAPTSEQTVDFSRNQFAEYAKIGAEAATTRAFPDASPIATLHPPSPPMEMFESPSANFD
FT                   DAETKSDVEVEKISPAKFESAKKLNFAAALDDFSSSDDEDVNRRPMPPPQIPTTNNMQA
FT                   PTPPLARTSSARKPLRLTVAVAKIVMLGYSQRDAIEALKHVDGNDVHDALAWLERRART
FT                   AA"
FT   gene            <93920..>94153
FT                   /locus_tag="OSTLU_40601"
FT   mRNA            <93920..>94153
FT                   /locus_tag="OSTLU_40601"
FT                   /product="predicted protein"
FT   CDS_pept        93920..94153
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40601"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40601"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99863"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038738"
FT                   /db_xref="UniProtKB/TrEMBL:A4S861"
FT                   /protein_id="ABO99863.1"
FT                   /translation="MIKVKTLTGKEIEIDIEPTDSVERIKERVEEKEGIPPVQQRLIFG
FT                   GKQMNDEKIAKDYNIEGGSVLHLVLALRGGRK"
FT   gene            complement(<94243..>94653)
FT                   /gene="PRPS6"
FT                   /locus_tag="OSTLU_93770"
FT   mRNA            complement(<94243..>94653)
FT                   /gene="PRPS6"
FT                   /locus_tag="OSTLU_93770"
FT                   /product="Plastid ribosomal protein S6 small ribosomal
FT                   subunit"
FT                   /note="imported to chloroplast"
FT   CDS_pept        complement(94243..94653)
FT                   /codon_start=1
FT                   /gene="PRPS6"
FT                   /locus_tag="OSTLU_93770"
FT                   /product="Plastid ribosomal protein S6 small ribosomal
FT                   subunit"
FT                   /note="Chloroplast ribosomal protein S6; Chloroplast small
FT                   ribosomal subunit protein S6; imported to chloroplast;
FT                   GO_component: - small ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93770"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00001"
FT                   /db_xref="GOA:A4S862"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:A4S862"
FT                   /protein_id="ABP00001.1"
FT                   /translation="MRVCECTVTSGVRAPTRVTSTTRRGECQKTRAVAKKNEPNSYEGV
FT                   MLLRPDCDDATRATTMDDFKAMFGEGLVAWEQTEHGLKPNSYEIKGYPDAYQVVVNFTC
FT                   APAVFKAASEELARPAVGSEEVVLRTMFMKTA"
FT   gene            complement(<95216..>96646)
FT                   /locus_tag="OSTLU_93771"
FT   mRNA            complement(<95216..>96646)
FT                   /locus_tag="OSTLU_93771"
FT                   /product="predicted protein"
FT   CDS_pept        complement(95216..96646)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93771"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93771"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00002"
FT                   /db_xref="UniProtKB/TrEMBL:A4S863"
FT                   /protein_id="ABP00002.1"
FT                   /translation="MATTWTTARDGAGRGRGAARASTRRALDDARATRGIATRAVRSGG
FT                   TGEVGEASRAAVEGSAVETVETVEADLDLGSAAANATTATRAEASADLARGAVSGAWRS
FT                   DVVPEVAYVVTWCCGNSVAHLTKRFDGLAATTLGLVFAAKTPESACDALTDDLRAMTWM
FT                   CAEMPNSQAREVDAMAWFLRETYVGDAPKIFIFAHDDRPFWPSLRAFVEELRTGERDGT
FT                   VTRVVDARARKMEKEFSVARDGKAPTDFDGDTFIAYSVAREPLVGTYMYTNAFALLLRT
FT                   FFDVVKDVEDPASELADAPDRNASERPGWRVSSRYLGERLDWPISAIFAVTRDMAKHRS
FT                   QKFYEALSLLVACDGKLTSAVDFEYFAALEWAHTLERAWLPIVFNPALRERAEGVPECL
FT                   LDAEARCYEVLDWNAGVRDVVRYDPARHADVPWSFPQGADSRGLSVATEPRDVVDKCGA
FT                   RTWHDHPIAMGGGKNLEI"
FT   gene            <98449..>100092
FT                   /locus_tag="OSTLU_40626"
FT   mRNA            <98449..>100092
FT                   /locus_tag="OSTLU_40626"
FT                   /product="predicted protein"
FT   CDS_pept        98449..100092
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40626"
FT                   /product="predicted protein"
FT                   /note="GO_function: - ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40626"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99864"
FT                   /db_xref="GOA:A4S864"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A4S864"
FT                   /protein_id="ABO99864.1"
FT                   /translation="MASTFFYLAGTVCKGVIQADKDPEVKKRRALRQKMKNERAALAGQ
FT                   MGKSKAKLVKKNQSKVRFKDVAGQDMVVNEFQTIIDVMKGNPKYKGRYVEPPKGILLEG
FT                   PPGTGKTLLAKAVAGEAGLPFFYANGSEFVEMFVGVAASRMRNLFKRARENAPSIIFID
FT                   ELDTIGRARNAGEQRDSSTSEREQGLMQMLVEMDGFDNKESGCEILVIGATNLATQLDP
FT                   ALLRSGRFDRTYHIGVPPTSEARMPILQVHARNLNIDRGGDDKYESDAFLHRVADLTTG
FT                   FSGAELANVLNEAAILSVREGKDSIDINDIEAVLEKQAVGLISAPLDDGWGKEHLAIIE
FT                   AAKAVIYSARPELGPELLQVSIRPRGTQMSGLILTERSSEAEAEIRTRIGPDTLGLYID
FT                   ALAVTLTGRCAELHFFGPDGVSIRTNEEVSAAAEMAFDIVTTSGLYPDSKFAPHFDMAM
FT                   VHQLRIPRENMEKGTLDVILRAHTKGMELIKEYAPLIERVANELMENERLYGSTVRAMV
FT                   KKYQQEELGGNFTRTPSFYERAAMNSASSN"
FT   gene            complement(<100163..>103378)
FT                   /locus_tag="OSTLU_27740"
FT   mRNA            complement(<100163..>103378)
FT                   /locus_tag="OSTLU_27740"
FT                   /product="predicted protein"
FT   CDS_pept        complement(100163..103378)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27740"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27740"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00003"
FT                   /db_xref="UniProtKB/TrEMBL:A4S865"
FT                   /protein_id="ABP00003.1"
FT                   /translation="MFGYAQTDGGASAGAEAAAREEFDDGAMEFIAASSARGRARGEEG
FT                   DADARGRALACSVSGFGASGSARAAKVENFIAARRRATKRLAPWYEGSRARIHAMAHSR
FT                   DGESLLCCTSAGGVYVVPILELTRDAEASPAMRVLASRGPKPASALWWYRALEPEREDP
FT                   VVGICVGVDGEVRAWDVKEGSPLGACVVGAKCASAELARGATKQFLVINGVQGEVWTLM
FT                   LEKMSRVVKTSTSEKGKVETTTKAESLPDAAGSHGFAAHLLKDEYGVREGRQVTLSVQE
FT                   TGESDGYSLIAALIDRRTLELYDVDRATEPKSTHALPNHTVAVHVTEDLIFALVREPVF
FT                   GEEDLADLTSFTASVHVLARRFGTDGSKSFTLQTFHVPRSAGVPKKFLAAELPETYVRR
FT                   RETLCGCMLWTSYGVYEIKSKVDIASTLRSFMSPNAVVASTRRDAWAPIERDEFGDNAL
FT                   SVDLDQDERLKLVAHVLDEDHMPVFVEAARQELKRQNFSRARDLFGKTGKPLKDFISLS
FT                   LEAWEASQALTNFHGKSVEAYGGQANLSWLKTAAAAHAHLHAWCEASNAVAYNAAAHDL
FT                   GESIQAKLQKLNLKEERSPEQAVKDLLRVIGEGIEATKDAGVQRDVACSASAAVVAFEA
FT                   ANAVSTSVISSCAANEYSDRIKTLFTMLLSSSSTVESLHMLGGVTANLMTQAAEHSGGT
FT                   VRTWESKPLVFWDPNVTYYVIATQTMENLYDIVHVLGLDSDTTDTCEASPLELVYDMLT
FT                   RDELRSLADMAREAKNLGVTGAAEIELTILLYLDDENALAERIEVMLEDDPKLFGWIAS
FT                   KCLDKRKFRITELAASQMEDFATAAMCHVAAVQKLAAVGETSPSTLQAELELGVETYVA
FT                   RVVDTRAQVKSIEDVARCWQRNGLPIDELERLFLDVLVSQGHAEAMQVVLQSDLGFQFS
FT                   GQFILAVATKRVAEDESKYSSKDGATIESVWLKIKQDLASRLDSPEFVQTRAFDAMELD
FT                   SLTSVDGAQCWAFTCGHRYGSEELQREVNDAKARLKILDLPLSSMLLESDYKLQKCAVA
FT                   CPNCVSYAVEHYVEVRRNTRGAA"
FT   gene            <103667..>104710
FT                   /locus_tag="OSTLU_27741"
FT   mRNA            <103667..>104710
FT                   /locus_tag="OSTLU_27741"
FT                   /product="predicted protein"
FT   CDS_pept        103667..104710
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27741"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27741"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99865"
FT                   /db_xref="GOA:A4S866"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4S866"
FT                   /protein_id="ABO99865.1"
FT                   /translation="MRDALDRLASDALVVLNDLGDAVDAPSAYGDAHGTRLSAADANLL
FT                   KKLFRAFAARDGGAPWRRASDADGARVYRRASASAASRAHQVLGVTETRASADEVFAFF
FT                   SEASAFDEHFKILDDMFKGGDVLSYRLYDDMVKTTGGEGGAVERAGAGGGEGAKTRRRA
FT                   RGLWNRGANFGELFERLERSAKAKARDAKARGTGRASEGNRSAMETIESVPPERPDASN
FT                   PLGCRPGHAILRGTFRLPSIIRDRDFVWEQLTMKMPNGAVVVAAQSIENGVVNAVAPPL
FT                   EGHVRGAILVSGYYAVPNRETGGSTLFYVVQADPKGVLPMWVVNLVAPDQAQNVARLRN
FT                   HLDGPKK"
FT   gene            complement(<104800..>106329)
FT                   /locus_tag="OSTLU_93774"
FT   mRNA            complement(<104800..>106329)
FT                   /locus_tag="OSTLU_93774"
FT                   /product="predicted protein"
FT   CDS_pept        complement(104800..106329)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93774"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93774"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00004"
FT                   /db_xref="UniProtKB/TrEMBL:A4S867"
FT                   /protein_id="ABP00004.1"
FT                   /translation="MRPRGARSRSAVVLERAADDYVDRPARRVSIGVSNADGDASSDDE
FT                   GATRFECHALATSRGVVACAGCAPSAPGDGVVYFAPRGRGRGVWRRARGARGCASAAAT
FT                   RDDADEFAVGMTDGSVWVYRCARERGMEASKVATLTPPGWDAGWGRARDASATRCARLV
FT                   VVGRARRAGTLVARHGSGGASLAVWDVETLSPSTASGEAKGFASMAKSTWLGTTSAYAA
FT                   LGGDGFVATSMDQKSVAAVEVNDLGRARLIWRSRREPGRGVFLAGAAVIDRGGTLSSRA
FT                   ATCSCEEMVHGTTYAAPDSSVKLVILDAEDGAEVNRFSIEGLGASNVFIDCGSLCSVGG
FT                   SLFLAHRDGAIWVINPGNGALITSLHPAQHFHDTSGHRRTLPSLLAITPARDEMYGATC
FT                   DGGVAHCWRVGNPTRWSRASHKNFPAAFRESVRTLLLCVHAHVNPTRAMMRVKLAPRNV
FT                   ADDDDVDVDGHERLRHVEGFIDAAAREPALLEMIVGRMARALFGCEVDDAF"
FT   gene            <106407..>107456
FT                   /locus_tag="OSTLU_18290"
FT   mRNA            join(<106407..106825,106958..>107456)
FT                   /locus_tag="OSTLU_18290"
FT                   /product="predicted protein"
FT   CDS_pept        join(106407..106825,106958..107456)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18290"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18290"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99866"
FT                   /db_xref="GOA:A4S868"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027517"
FT                   /db_xref="UniProtKB/TrEMBL:A4S868"
FT                   /protein_id="ABO99866.1"
FT                   /translation="MPEDAATTDAVARATATLGDARAPTPARFSALFQLRALATPDAVD
FT                   ALVERLRASRSDSALVRHECAFALGQMRARRAIDALMETLRDGDDDGMVRHECAEALGA
FT                   IASDDGRCATALREAAGDARREVAETAALALRKLEIVDPIPAMPTETPFERLKAVVLDD
FT                   AHEMWERYAAMFALRNKSCADRESSDACADVLGEVLSASGSALLKHEVCYVLGQLQSAS
FT                   PGARDALIRCLEDSREHPMVRHEAAEALGSIAHPSTRGYLESFASDPEPIIAESCEVAL
FT                   EIMRREREGEIVTADGAVVAVKRD"
FT   gene            <107624..>107992
FT                   /locus_tag="OSTLU_27744"
FT   mRNA            <107624..>107992
FT                   /locus_tag="OSTLU_27744"
FT                   /product="predicted protein"
FT   CDS_pept        107624..107992
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27744"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27744"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99867"
FT                   /db_xref="GOA:A4S869"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034150"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A4S869"
FT                   /protein_id="ABO99867.1"
FT                   /translation="MTANLASRPLARLPPEVNRTLYVRNLPFNVSSEDMHEIFGKYGAL
FT                   RQIRLGTTKATKGTAYVVYEDIHDAKQACEHLSGFNVANRYLIVLYHQSGKATQSVERR
FT                   AAETARLQREHGVSGTQT"
FT   gene            <108140..110901
FT                   /locus_tag="OSTLU_27745"
FT   mRNA            join(<108140..108286,108489..110901)
FT                   /locus_tag="OSTLU_27745"
FT                   /product="predicted protein"
FT   CDS_pept        join(108140..108286,108489..110894)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27745"
FT                   /product="predicted protein"
FT                   /note="GO_function: - inositol or phosphatidylinositol
FT                   phosphatase activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27745"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99868"
FT                   /db_xref="GOA:A4S870"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:A4S870"
FT                   /protein_id="ABO99868.1"
FT                   /translation="MRSSARPYVAGALILWAVALQAHVWSIPDAELRRLRGDSRVSFVP
FT                   SARGIRRVQKARDEAASDDESAFVVTRKVASDPRSALTEADVAAQSAIVSALRARWPTV
FT                   KIVGEEDENDDAAPMSPKRGAPLREDLCAAIETCDDARLRTMRVKSEDVTVFIDPVDGT
FT                   REFVESRLRAVQCLIGIAVRGRAVAGAIGLPFPDGDVASSEACVVYGAVAPGAKRGAVG
FT                   AHGERGAALEIRFDAENAQVRSVTGDSKNAALIAAKEILRETATKSGATYAHGSIGGAG
FT                   NKLLAVAEGRAEYALMHFGTSLWDTCAPEAIVRACGGKVTDLYGAPLMHYEDSPGGLVN
FT                   QLGVVGSSAACEGAISHDAVCSEMRGNEDLKKMLNRFTGGDSSLAFGGDEIQASDVARC
FT                   LGGGPLSARDVGDRVARAVGAEGDVSLSGYSAPERDAVRGLMSDACRIYFKWSTDDDGR
FT                   LPRSAFYKKVDMGNLEYMRTKQVTQPLKIARDSKSYAVEASFLASDACKALEEAGIGVP
FT                   ICYAADLRPVHDDPIESKFSLLLEDFHPSDGWEQAKMLRPDQAKCALRALARMHAFFLP
FT                   GSRFRKSSKAANEDLLATVWSSGGYWQPNMQPDDQMDVVASAWEQHMSSFGAAIEAEPT
FT                   IDIAVARTVGARLQSHARRIGAETHPFSGCPGADDALRHGGERLAALQTVIHGDPKSGN
FT                   IFERRAGESDEWEIGLIDFQWTGIGLGGTDVGHFMCASVAPEGLSADGAAENALVDVYY
FT                   DAFCEAAAEFGAVSSKENAGEELLTREELQVQYENGVLDTMRCVFGYQWLRVKASPESL
FT                   AKNAQSIGRNSYNKSLPNALWMIRTADLYLKAREARAH"
FT   gene            complement(<110928..>111749)
FT                   /locus_tag="OSTLU_27746"
FT   mRNA            complement(<110928..>111749)
FT                   /locus_tag="OSTLU_27746"
FT                   /product="predicted protein"
FT   CDS_pept        complement(110928..111749)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27746"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27746"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00005"
FT                   /db_xref="InterPro:IPR033253"
FT                   /db_xref="UniProtKB/TrEMBL:A4S871"
FT                   /protein_id="ABP00005.1"
FT                   /translation="MEQERRERESRKRVEDIERAFEEDAADKQRKRVAALKLLDEINAE
FT                   NEEQIKRKAEAERAERAEDERVMEYLRLKAERDAAKAAEEEAQRRARELETARLRSMQE
FT                   KYIDGRAEQDFIRAQKLQDEYDRQTREKERAERAKRRQMLEDLAAARVAQHEEKVRLQR
FT                   IEKENEKENAERLKREYEAQLLAERQREEARREAAAAHKRDLIHQMQSNEEAKRRAEAR
FT                   AAEEAEEARRRERQTHVLLEQIRERKVKEMERDAIPDKYTVELRSKKSVCA"
FT   gene            <112817..>113767
FT                   /locus_tag="OSTLU_27747"
FT   mRNA            <112817..>113767
FT                   /locus_tag="OSTLU_27747"
FT                   /product="predicted protein"
FT   CDS_pept        112817..113767
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27747"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27747"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99869"
FT                   /db_xref="GOA:A4S872"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="UniProtKB/TrEMBL:A4S872"
FT                   /protein_id="ABO99869.1"
FT                   /translation="MFAWLGLIHVDVAVTALAVWTLPSAMAVTALATLVAAAAIPRTVA
FT                   TPRWGARLARAVTRTATAYFPTRLEFEDEEAYLRAVRNEEACVIGLEPHGVLPLSVISF
FT                   AEYFMHDEEGARRRGLTPAARRGARALASAAIFKVPLVKHLWTWLGLDPISKACMLRML
FT                   RAGKTAVIIPGGVAECMAMERGVETLYLRKRYGFVKIAIVTGAKLIPAYTFGQSRTYGY
FT                   WRLGPPIVPKFVADWIGKTFSFAPIIFWGKFCTPIPYATALNTVVGKPIEVEKNPDPSK
FT                   EEVQAKLDEFIDAMRSLYDSHKARFGYEDVRLVIC"
FT   gene            complement(<113879..>114523)
FT                   /locus_tag="OSTLU_27748"
FT   mRNA            complement(<113879..>114523)
FT                   /locus_tag="OSTLU_27748"
FT                   /product="predicted protein"
FT   CDS_pept        complement(113879..114523)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27748"
FT                   /product="predicted protein"
FT                   /note="GO_function: - calcium ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27748"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00006"
FT                   /db_xref="GOA:A4S873"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:A4S873"
FT                   /protein_id="ABP00006.1"
FT                   /translation="MGCVASGPVDEERERQRLADQTHFRPGQIRVLRDVFSKVSRSHDA
FT                   DGAIDADEFQLALFGREVNGGKTRDLFSERIFACFDSARDGQLTFEEFVKGLSVFHPQA
FT                   TRNEKTEFAFRVYDLRGTGAIEREDVREMLEAVLRQSKAMTLTKEMMEAVLNKTFEDCD
FT                   LTKDGVISMKEFKTLVEKNEKIIANMTMPSLERLTKVYPDFLFTQRVGSVR"
FT   gene            complement(<114832..>115551)
FT                   /locus_tag="OSTLU_10319"
FT   mRNA            complement(<114832..>115551)
FT                   /locus_tag="OSTLU_10319"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<114832..>115551)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_10319"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_10319"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00007"
FT                   /db_xref="GOA:A4S874"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="InterPro:IPR038659"
FT                   /db_xref="UniProtKB/TrEMBL:A4S874"
FT                   /protein_id="ABP00007.1"
FT                   /translation="RAKMDALRLDADAIWARERARPEISAPWILKVPYVALCVMLDKLF
FT                   DETQPVQRFWFLETVARMPYFSYTSMLTFYEILGWWRRSSELRKVHFAEEWNEYHHLLV
FT                   MESLGGDACWRDRFLGQHAAIVYYFVLVALWLISPALAYNFSELIEGHAVDTYGQFVDQ
FT                   NAELLKSMPAPRIAVEYYEAADLYLFDEFQTAREVRLRRPQIRSLFDVFSNIRDDEGEH
FT                   VNTMNACQREDSDISSPN"
FT   gene            116121..>117305
FT                   /locus_tag="OSTLU_27750"
FT   mRNA            116121..>117305
FT                   /locus_tag="OSTLU_27750"
FT                   /product="predicted protein"
FT   CDS_pept        116604..117305
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27750"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27750"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99870"
FT                   /db_xref="GOA:A4S875"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A4S875"
FT                   /protein_id="ABO99870.1"
FT                   /translation="MARKREARSEARAANPNAANPNAASAKVKAKPLRVVDFGCGEGYY
FT                   SSVVLERARARDDVELELAALDASKDAADLCAAAIGRFARVAVADATRDLPLDDDSVDV
FT                   AMSVFAPRSPTELARVLRKGGRAVVASPDDDHMVELRDAFRDDDKITVLGVEPNKSTRV
FT                   DEAFLAAGFDVVFRRAIRDVVPLPADAVADLVFMGPSGFHNPESAIRDAVGDAPRVVTI
FT                   SFNVVVYALLR"
FT   gene            complement(117403..>119199)
FT                   /locus_tag="OSTLU_25591"
FT   mRNA            complement(join(117403..117539,117580..>119199))
FT                   /locus_tag="OSTLU_25591"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(117486..117539,117580..119199))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25591"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25591"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00008"
FT                   /db_xref="UniProtKB/TrEMBL:A4S876"
FT                   /protein_id="ABP00008.1"
FT                   /translation="MARDDDDGDGDAHYAGLFLDADARRKVWALAHRLLGMSCAPPGAK
FT                   SSADHVTLAHAPDRDATTRVLELARRRRSRAVTVTMTHACVRPRAMVMAVSIEMDRELT
FT                   GLETPATPHVSVFAPETMEWRTLGDVVAEDLARDEGLDLRALGASDEALRLECRLGVKM
FT                   RDGSVDFGFGGETSDSGRHSGSSSAIPGLASPTKNKHSLGRTSEAAPRATSTRPEYMTK
FT                   KQIAAAKAKAKAREEARPLTAEEMAERAVAEAKKQALKEEKRRNNIRREYLSLCEMFEE
FT                   HHPEFVKTTFIRFGYDMEATAQDLLASIAPDIEDMYDNDEYYSEYDTEDDEYGSESEYD
FT                   SEPESEDNSSKKEGISKGLSKKIRRAQAKAQRRKARDEETTRRLQAAGLGTDRREVTIT
FT                   SGTTWVSKPPPSSTPNWEVSGARAEIINAAKHLAFLQGPKAKTQRLSVNLSDRNAARLE
FT                   ELSEEMSRLRVQRDRGDTRAAALLGEKAKLKQALESIDTEVVAPSTADNDNRGFNRVID
FT                   FHGYDRLDAIRRLERELLKIAPMGITAAADALFTATSCAG"
FT   gene            <119821..>123648
FT                   /locus_tag="OSTLU_18298"
FT   mRNA            <119821..>123648
FT                   /locus_tag="OSTLU_18298"
FT                   /product="predicted protein"
FT   CDS_pept        119821..123648
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18298"
FT                   /product="predicted protein"
FT                   /note="GO_function: - catalytic activity; nutrient
FT                   reservoir activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18298"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99871"
FT                   /db_xref="GOA:A4S877"
FT                   /db_xref="InterPro:IPR001423"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A4S877"
FT                   /protein_id="ABO99871.1"
FT                   /translation="MPHQPRRMRQAVRIWRAWRVQTKLKAKLKDIRGDGLSVLHKTEED
FT                   LREAMSAHGLATMPPSGGAMHLDPTLEALKACSACRGMSESALATLRSRAKTVVVRPKE
FT                   RVGESVARDELTVLVDGEVDLRGQIEIDVSVRGDVEQKAMTTLCSRPGTCLNSFMDILE
FT                   HIPAPAEANEGEDAARALSSPSVDGLGEESTPAMSLKSHDESGERVRVRLTFGSDHELH
FT                   RRDRVRVSARAANRGCVLAVFRMSDYHECAGTVIGTQGVALRLASGFAAVCKYVGMMGD
FT                   MRSLWVHDRGADEPQPSDSDEEALVCTHALSRMLDAKVVSLIDTSGVIATLERHGYRKR
FT                   SSGAASKSGGFFARRKEKKNAEPEPEPTSEVSVETKVFPPGAIVLQQGASAAALIVERG
FT                   SLEALVEAVPSSRREKPPLPNSSPRIRQASETPIFTANVGDIVGSHLLLTGQRSGLTIR
FT                   AGSSGAVVVLLPLSTLARLGRTRAAITHKMVVSLARRVRDAPSSLIWDRCGAEMETLEA
FT                   GEALNARAGGVHIVVTGCLREQMEEPHGLSRANSSQNLFKRRKSQSGKSTAAYVPSGPG
FT                   YVVSPGEATGEDSVLMETTASRPMAATPRSRRQSLMAPAARFTARAVRDSQVLWISSAG
FT                   LDTLAFAAPTAFVRLARGLGLRQANRTAALSGTAHTAPLIPGLVLSQKASNAPKTVSVI
FT                   PVTEGAAVHLDEFCYSLAFALSKICRARTVDSACRLGELGQAAIGPLAQEATANWLSQL
FT                   ESAYDVVILKGDPFPSPWCAQCARHSDTILLVANANDQAPTHEEGQTLQDRLLHGLGET
FT                   KFQRVLLAQRELVLLHQDADVTPKDTKSWLTAFSVQRHHHVAMQASSGLVPSHAARLAR
FT                   SLRELSVGLVMGGGGARGLAHVGVLAAMEEEGVPIDAVGGTSIGAMVGGMYARDPSALL
FT                   VRIMVTKFAKEMSSAWGRVIDLTLPVVSYFTGWGMNRALGINLGETKIEDCWLPFFCCT
FT                   LDLISCMPIVHRNGTLWRYVRASMALVGFLPPVCDTEQGQQKNMHVLVDGGYVNNLPTD
FT                   VMRALGAHYVIAVDVAGEGLDGQSLTPWGDGISGTWLLLRRLLPRWLGGGHSIPTMADM
FT                   QGQLPFVTDTVKHQTRLEDIDVYIRPNVSSIGILEFNKYSAIIRHGYDIGIKMAREWKS
FT                   ENPDVALLLEQGRNIRRGLTTMRSARSGNPSATNSRESIASDSGSDATSAYGSAEDLHN
FT                   HRHTLKPLSEGLLSEFSDDDDVHVRSLLRTNSSFASWTPAPKQKRPPDMF"
FT   gene            complement(<123709..>124122)
FT                   /locus_tag="OSTLU_93776"
FT   mRNA            complement(<123709..>124122)
FT                   /locus_tag="OSTLU_93776"
FT                   /product="predicted protein"
FT   CDS_pept        complement(123709..>124122)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93776"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93776"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00009"
FT                   /db_xref="GOA:A4S878"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A4S878"
FT                   /protein_id="ABP00009.1"
FT                   /translation="LGKSSVGARGAPIPAGSRADGEGKDAPGTFKNELERRLAKRADRP
FT                   RCEVCQMDFTSDAQYAEHARGKKHLSNVRSAAGGGGASGVGGRRYVKPPPGPHCELCRK
FT                   VFTSEAQRAEHVQGKWHRQRVSGELPRSNKPYS"
FT   gene            <124750..>125829
FT                   /locus_tag="OSTLU_27754"
FT   mRNA            <124750..>125829
FT                   /locus_tag="OSTLU_27754"
FT                   /product="predicted protein"
FT   CDS_pept        124750..125829
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27754"
FT                   /product="predicted protein"
FT                   /note="GO_function: - RNA binding; pseudouridine synthase
FT                   activity; GO_process: - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27754"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99872"
FT                   /db_xref="GOA:A4S879"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A4S879"
FT                   /protein_id="ABO99872.1"
FT                   /translation="MPRGGEATEEMWTEMGVEHLDEFVPAGTLLEIERCVHERCVADAM
FT                   PEIVFECEKTGLVVVEKPAGVPVLAGAAPGWQGYGNLAALTSALRRRRAAKDDAADETR
FT                   RTKRARATGDAGKVWAVNRIDAPVSGIWLAATSPKLAAKANVWMSKTSLGKTYLALVRG
FT                   AQIECGVRIDSPLAKDKESSLAVVSEKDGKPCATRVVVLQRRESEDVALVACRLESHGR
FT                   YHQIRAHLSSIGHPIVFDSAYGDEDPESSYAGRAYADDAETRVVARKLAERRDAACAEC
FT                   DALIALTASDDATTKPLAAKRIHLHALRYQFSIRDVNYDLRSLRLPEFALDALGAAVSV
FT                   DDVVARVDARVDEIESSRE"
FT   gene            <126032..>127552
FT                   /locus_tag="OSTLU_3943"
FT   mRNA            <126032..>127552
FT                   /locus_tag="OSTLU_3943"
FT                   /product="predicted protein"
FT   CDS_pept        <126032..>127552
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_3943"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_3943"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99873"
FT                   /db_xref="GOA:A4S880"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:A4S880"
FT                   /protein_id="ABO99873.1"
FT                   /translation="SVLCCLCAIPMHPNPSGMCVECVRTQVDITEGISKNCVVTYCSQC
FT                   ERYLQPPKHWIRADLESKELLTFCIKRIKGLQKVKLVDAGFVWTEPHSKRLKTKLTIQK
FT                   EVLNGAILQQTFVTEFVVEWRMCDACARSAANSDQWNACVQVRQKVEHKRTFLFLEQMI
FT                   LKHGMERDAIGIKSQPDGLDFYYGHRSHGLRFVDFLGSVVATRSRGDKQLVSHDANSNT
FT                   YNYRFTFFVEIVPVCKEDLVVIPFKLSKEFGSVGPVMLCTRVSNSLQFTDPVTMRQIWI
FT                   DQEKYWRQPFRAAATAKQMIEYVILDVEVDQSTRQGKLCMADVEVARSSDFGVNDTTFF
FT                   VKTHLGNILQAGDTALGYDLTNLQIVDPEMEKYSGKHQGVVPDVFLVKKSYAESRRRRR
FT                   ERGVARNWRLQRMQVEEDEETQQRSRGSADRMAQDEELFYQELEEDEETRAQVQIFKDE
FT                   NAINANVTAAAGDDDDDDDDAPEVPIEELLDELTLLQRQADDEDDENDL"
FT   gene            complement(<127661..>129103)
FT                   /locus_tag="OSTLU_27756"
FT   mRNA            complement(<127661..>129103)
FT                   /locus_tag="OSTLU_27756"
FT                   /product="predicted protein"
FT   CDS_pept        complement(127661..129103)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27756"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27756"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00010"
FT                   /db_xref="UniProtKB/TrEMBL:A4S881"
FT                   /protein_id="ABP00010.1"
FT                   /translation="MFFSLGCATALPIDSIEISAISVRGNLGRVRVYAKNVHLKTFDDA
FT                   LPPVDVSERYGHYSANDANVADLMDAEAWGEPAYDEEHRPSYDELVALKLNAPITLRVG
FT                   EKVQVYVHTDARSDKGLVYDDERDVLGRPKCDGVLQIYPGYAHLSHEPFGKAAPWYAED
FT                   ETMVSSLRKDRRFVGMVSYGVRWMLWQPEREIHARFPSEFQEVVRTMLRGMRDPGSILS
FT                   VLDENVMMYTLNKYVGWEWFGRTLKAREYPPFAESSGSPRVDVVLEALFLEHVKEGNEQ
FT                   PPYDDTHSMEFVATAMVRTIVSRSPELRMMLHGCTLRHRVEALLHMLRSCYEKVVQAKS
FT                   DRKTQGSQIVGIKQKYLLPEYNAQAIANDLDTVRNVTNIICTHVSHLEGWRPDVRSNTH
FT                   RMSPDEHKSDETDLSTVQEVLEDHIRSLRMPLKSFMNMNSPRPYGDVFDDLDDDDDDFD
FT                   DDDDEDDWEADEGDWIDYTSTE"
FT   gene            complement(129296..130675)
FT                   /locus_tag="OSTLU_27757"
FT   mRNA            complement(129296..130675)
FT                   /locus_tag="OSTLU_27757"
FT                   /product="predicted protein"
FT   CDS_pept        complement(129310..130356)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27757"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27757"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00011"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4S882"
FT                   /protein_id="ABP00011.1"
FT                   /translation="MSANFVLGVVSAPYEDGEDDQFAGKALMIVHGKPAFARAAESMKR
FT                   CARLDRVVVATDDYRIVETAKEYGIETVLVAQDARRTASTYARQAAKLTGGGWDFVVTL
FT                   KVDECLIDADSVDACVMEMEANADEWCVASTCVAATDPARFESETRPRCVFDKQGFALY
FT                   LTRAVIPAIGSKPRETMTGELDLTPTKRETKNRLDAAAMHWHVLGCSCYDAMYLRTLVD
FT                   DSNDTTPLQRMENIEALNTLENGYKIKVCPVNNQTPALRAPEDVAVLEEVLRARVVQNA
FT                   ASAVKKKRASPKSALPRHVKRDKSRAARVRAEPSASEVSDAPSPSAGSPSATDDVPSPR
FT                   AGDRTAAS"
FT   gene            <130972..>132396
FT                   /locus_tag="OSTLU_1811"
FT   mRNA            <130972..>132396
FT                   /locus_tag="OSTLU_1811"
FT                   /product="predicted protein"
FT   CDS_pept        <130972..>132396
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_1811"
FT                   /product="predicted protein"
FT                   /note="GO_component: - membrane; GO_function: -
FT                   mannosyl-oligosaccharide 1,2-alpha-mannosidase activity;
FT                   calcium ion binding; GO_process: - N-linked glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_1811"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99874"
FT                   /db_xref="GOA:A4S883"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR036026"
FT                   /db_xref="UniProtKB/TrEMBL:A4S883"
FT                   /protein_id="ABO99874.1"
FT                   /translation="DAGRRDEVKAAMREAFGAYRTHALGHDELAPRARTGRDDFGGIGA
FT                   TLIDSLDTLHIMGLRAEFDEALRYLKKPGSAFRDLVQGETDRDVSVFETNIRVLGGLLA
FT                   AHDLSGDADVLELAESIAARLSAAFDTPSGVPHSFVNVKTGNSFGLPWTKGASILADFG
FT                   SMHLEWATLSARTKNPVYEAHTNHVFETVSSLGRRGKSGASTKGLFSAHFNVDTGEFAG
FT                   GDVTFGALGDSFYEYLIKCWRSLGDLKDAETWREMFDEAMLGMKTSLLRDWKTDEATGE
FT                   KYSYVSPIGGSGAGSMEHLACFVPGMLVLGAAEAPTPTTADEYVQIAKDIARTCVEMYS
FT                   SQPCGLSADHVRFDSGSKTISNINGKNIQRPETVESLFYLYRKTGDEIYRTQAWKIFQS
FT                   MKSAYRVPESGGWQGVLDVSKTPTAGDDKMQSFFLAETLKYLYLIFTDSDTMHLDEWVF
FT                   NTEAHPLRITKARERLN"
FT   gene            complement(<132705..>133679)
FT                   /locus_tag="OSTLU_27759"
FT   mRNA            complement(<132705..>133679)
FT                   /locus_tag="OSTLU_27759"
FT                   /product="predicted protein"
FT   CDS_pept        complement(132705..133679)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27759"
FT                   /product="predicted protein"
FT                   /note="GO_function: - protein kinase activity; ATP binding;
FT                   GO_process: - protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27759"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00012"
FT                   /db_xref="GOA:A4S884"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4S884"
FT                   /protein_id="ABP00012.1"
FT                   /translation="MAVQAKREMWTFQRISSSSVNARFDRNGDVEGWSSLTARGALGVD
FT                   PTAAEDDEETESAPTYEGLVRCFGFGYDAVKNEVSITLELMHFGSLEDVVRLRGSMRFA
FT                   PRAAMCAARCVANGLAYLHDTLEIVHRDVKPSNVLINECGECKLSDFGLCTPFTGGDVE
FT                   DDAHDSLGTIMYMSPERLESSAARCGPEADVWGMGLTVLESVMGKHVFDIEDGGPLGLV
FT                   IQIMDDDIDVAGAVDGEDAVSNALRALLSACLRKDHTKRITASELIDASPTSTYRELKL
FT                   NSYTCADMRQYLYPPRRGESKVTKVVVEERTTSRESTPFRFDE"
FT   gene            <134499..>135006
FT                   /gene="HTA3504"
FT                   /locus_tag="OSTLU_13304"
FT   mRNA            join(<134499..134660,134779..>135006)
FT                   /gene="HTA3504"
FT                   /locus_tag="OSTLU_13304"
FT                   /product="predicted protein"
FT   CDS_pept        join(134499..134660,134779..135006)
FT                   /codon_start=1
FT                   /gene="HTA3504"
FT                   /locus_tag="OSTLU_13304"
FT                   /product="predicted protein"
FT                   /note="GO_function: - DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_13304"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99875"
FT                   /db_xref="GOA:A4S885"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:A4S885"
FT                   /protein_id="ABO99875.1"
FT                   /translation="MSGRGKGKSGKKATSRSAKAGLQFPVGRVARYLKAGKYATRVGAG
FT                   APVYLAAVMEYLCAEVLELAGNAARDNKKSRVVPRHIQLAIRNDEELSKLLGTVTIAAG
FT                   GVLPNIHSVLLPKKSKKSGSASQEY"
FT   gene            complement(<135155..>138052)
FT                   /locus_tag="OSTLU_27761"
FT   mRNA            complement(<135155..>138052)
FT                   /locus_tag="OSTLU_27761"
FT                   /product="predicted protein"
FT   CDS_pept        complement(135155..138052)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27761"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27761"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00013"
FT                   /db_xref="GOA:A4S886"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="InterPro:IPR040855"
FT                   /db_xref="UniProtKB/TrEMBL:A4S886"
FT                   /protein_id="ABP00013.1"
FT                   /translation="MTSRAKRVDASTRAAPDAREIGAFKTNDGLKSGVFVLKSARAAPR
FT                   GDEASRLNAFEPVLRDETRGARERRAAACARAWEALDGHCQRVADEANAEAFARVRRFV
FT                   REQGATRVERARETEEKNNGGDRRVPVGVVLAGGVNSDDHEETFAALTKSLRKSGDAHV
FT                   ALLRSRDLKARAGAGTGGLGVAFGVIMRQLDRTGGHWGGKSMRALRRWHEETSGARRDG
FT                   LIAASTVPSPIGNALTVYNGGDSRASGEGDDVRARGGKKRAATDSRATSPARRSKRRAR
FT                   DDVERAGDDERTLYPVIQGRDCPVVIVVEDTESFDVRVLDSFIRSVSEFVSSVPVVVLL
FT                   GLATSVSSLQGMLPAATASLMNAQAFQLWAPGQMMEAVQERVLLSPERVPAFGSEVLNV
FT                   LHTRFKEHDFSLAAVRRALHLLTITHFMTEPLSAVLPLLAKDSSEPCADGDESDDEYGD
FT                   AIDQFVRDLDPNAVEYARIKHGFGAKSMRDGDGDSASSTTHTKSELSAALKDVYRLRRR
FT                   WALSLRCIQVACAATEKKFKKSVTTMADLLLDASRKGYFGGAGEFNPKSQGGTLLNVAF
FT                   SRIRDEFTTAEIGDLVKSMLKFLDDDEVMRSAEGSELRFLLSNIEDGSFDAEDARRREA
FT                   AILASTPTNEGGDERRGLVIAASNANATAEKLAHDETNAEDQRLAMEAILNARKRRGNG
FT                   AAFATSLTPAPRTSTRDEDAAANDGLVLPKSPPRGRSAPARSEANALALVTTTVATAAK
FT                   PERPRLDSAKSAAANEFCDILRAIARKYGSHPPESIDASGIFVVTDVECVRAALQASPR
FT                   LSLENTLTDPSELLRCACCRHDDYALANGRRVPETLPDTAAAYRLLARFGERAPIYDWF
FT                   QSFCESKAGSEMKRGDAAAAARGKGTFGLPREKLWQLQARFTRAVAELEFLGIARPYQK
FT                   GRKGVEYMVRTAFPLDKLARDSRSNVVERLAIQPA"
FT   gene            <138239..>138763
FT                   /locus_tag="OSTLU_27762"
FT   mRNA            <138239..>138763
FT                   /locus_tag="OSTLU_27762"
FT                   /product="predicted protein"
FT   CDS_pept        138239..138763
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27762"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27762"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99876"
FT                   /db_xref="UniProtKB/TrEMBL:A4S887"
FT                   /protein_id="ABO99876.1"
FT                   /translation="MAPKKPAQKSAKAQIKEQRDQIRQQIKTIRDESASTHVLDSLYDA
FT                   ALGLELWLRTNSSAFPSAAVKQKTERLGEIATQATRGTLDADAAYWELAGLYTIIHREC
FT                   QKEDLGLVFPSFVFPDGGMPALGEGDALTLADVREAIGCELTAEALDAKIAELEEIERA
FT                   KAALEAMDADA"
FT   gene            complement(<139812..>140117)
FT                   /locus_tag="OSTLU_40769"
FT   mRNA            complement(<139812..>140117)
FT                   /locus_tag="OSTLU_40769"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<139812..140117)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40769"
FT                   /product="predicted protein"
FT                   /note="GO_component: - nucleus; GO_function: - DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40769"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00014"
FT                   /db_xref="GOA:A4S888"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:A4S888"
FT                   /protein_id="ABP00014.1"
FT                   /translation="MTQQWTVREDKELLQLIDKYGAKRWSYIASLMRHRRGKQCRDRYL
FT                   NHLRPGIKTGEWSKEEELILVEGHKVLGTKWAALAKLLTGRPENAIKNHWHATLRCK"
FT   gene            complement(<141440..>142975)
FT                   /locus_tag="OSTLU_10071"
FT   mRNA            complement(<141440..>142975)
FT                   /locus_tag="OSTLU_10071"
FT                   /product="ABC(ATP-binding) family transporter (Uup-like
FT                   protein/duplicated ATPase)"
FT   CDS_pept        complement(<141440..>142975)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_10071"
FT                   /product="ABC(ATP-binding) family transporter (Uup-like
FT                   protein/duplicated ATPase)"
FT                   /note="GO_component: - membrane; GO_function: - ATP
FT                   binding; GO_process: - transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_10071"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00015"
FT                   /db_xref="GOA:A4S889"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A4S889"
FT                   /protein_id="ABP00015.1"
FT                   /translation="VEPGEICGVVGANGCGKTTLVRALLGERDANGVGFGVAMGVTVGA
FT                   LEQTATSGSKLMVFEEATSRMTHVRDAEAAVERATRALAADEAGAAARLADARERYDAV
FT                   GGATAEKRASSVLKGLGFSEAVMRARCDTLSGGWQMRVALARTLLSPAGDSREAGVKGG
FT                   LLLLDEPSNHLDGDARAWLVNWIKSYAGTVVLVSHDEELLACVDRIVEVRGGKLGNFKG
FT                   DYARFLKEREARRAQALSSLEKEGQKAAKLNEFITKFGAKATKASAAKSKAKALDKVQE
FT                   KIEDLTELAGEGDLGEGPGDAKKVVLRLPNPPQGAREILIAKDLAVGYAAVGSTLVTDV
FT                   NVTVTKGDRLLVIGPNGAGKSTFLKTIGGELPEMSGTVERGEGCVVGYFSQDLAQQLPA
FT                   EVDALTHVLDVARKVDKSITMERARGVLGALGITGSAAVDRTIGSLSGGEKARVALAAF
FT                   VLKPVNVLLLDEASNHLDGTAIEALCDGLRGWEGAVIAITHNPAFAAALNPTIV"
FT   gene            complement(<143252..>144115)
FT                   /locus_tag="OSTLU_27765"
FT   mRNA            complement(<143252..>144115)
FT                   /locus_tag="OSTLU_27765"
FT                   /product="predicted protein"
FT   CDS_pept        complement(143252..144115)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27765"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nucleotidyltransferase activity;
FT                   GO_process: - biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27765"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00016"
FT                   /db_xref="GOA:A4S890"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4S890"
FT                   /protein_id="ABP00016.1"
FT                   /translation="MFARVAPAPIEVRWRREDELGSALALARACGGDASRGVAVRSSDD
FT                   FATARALWKVYDVVSAIDPRREVYPVFEGRGGGDDVGTRGDAREDEEEDEETRDDDADA
FT                   EVERAVRARVASWSAPNATTRDDGSDGTMDKVSVGGTFDRLHAGHRLLLASASRAVAGG
FT                   GVLYVGVTSAELLANKAYGALVESYADRTANARAFLALCDPESSIEVRVGPLDASPPLA
FT                   ATVRDMSGLVVSRETVAGAEALNDMRSSGGLAPLRVVVVDLVRGGEGEELKLSSTRLRE
FT                   RDAAEG"
FT   gene            <144384..>145127
FT                   /locus_tag="OSTLU_40512"
FT   mRNA            <144384..>145127
FT                   /locus_tag="OSTLU_40512"
FT                   /product="predicted protein"
FT   CDS_pept        144384..145127
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40512"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40512"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99877"
FT                   /db_xref="InterPro:IPR002800"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A4S891"
FT                   /protein_id="ABO99877.1"
FT                   /translation="MRALRATSARATTRDGAKRASRARRSSRVARNASSATHEPWELGL
FT                   GELHFSTRDVDALAGASARDDALGALSPTWRMLLLSDGSVTRHLSVLGRAERTEVEVTR
FT                   RSARDDGTRARGRPSRPSDVEAMLRGPIVRREVYLRAGEVRGADGRPAVYAASWWNEDA
FT                   LAAYLPDEDASMWANLRTRHVELHREIREVYYGESEGLEAAFGERGPFWGRHYIFWSGG
FT                   APITVVYEVFNPAAFERALGPLKAA"
FT   gene            complement(<145215..>146663)
FT                   /locus_tag="OSTLU_1672"
FT   mRNA            complement(join(<145215..146103,146254..>146663))
FT                   /locus_tag="OSTLU_1672"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<145215..146103,146254..>146663))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_1672"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_1672"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00017"
FT                   /db_xref="GOA:A4S892"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR027193"
FT                   /db_xref="UniProtKB/TrEMBL:A4S892"
FT                   /protein_id="ABP00017.1"
FT                   /translation="GDDDARDAYLAWFAKHRRVFVERCVGCVVDGELDERARCLALGVI
FT                   MECARCETPGKFSNELYEDALRRATRAKSWSEALLGTLKARYLTRVDVRYHTYGAMRKL
FT                   AEELKTYAPGEGEAAAVDVARNVYDVLNATPRAVIDLEAAKKKRKTSGGGKPKWTEGAR
FT                   HRRAFSDAWLALLRADFPEDIYRKILMRLHVDVMPHMVNPQLLSDFCVDSIDVGGLTGM
FT                   LALNGLFILMTQHGLEYPTFYNRLYELLDASCFHANHRRGFFSLMDVFLKSPALPAYLV
FT                   ASFIKRFARLALSAPPAGAMVCVGFIHNLLRRHKSCVVLVHRERVEGEAAKLIDADPFD
FT                   ADERDPAKTNALKSSLWEVETLRAHYFPQIPKMVALLERDLTDRVKTKELEMGDLCGAS
FT                   YGSLTAEELDARVKKVPLASRAEPFTSIFTTSEM"
FT   gene            <147110..>147841
FT                   /locus_tag="OSTLU_13306"
FT   mRNA            <147110..>147841
FT                   /locus_tag="OSTLU_13306"
FT                   /product="predicted protein"
FT   CDS_pept        147110..147841
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_13306"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nucleic acid binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_13306"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99878"
FT                   /db_xref="GOA:A4S893"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A4S893"
FT                   /protein_id="ABO99878.1"
FT                   /translation="MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPTASQT
FT                   ILLTNLYRPDVEVAADPRAATSGAASRAGRGQEGFEAFVEDVFEELDECGEIEGVNVCD
FT                   NVTDHMMGNVYVKFVEEEAAGRAVEKLRGRYYDGRPIAAEFSPVTDFRESTCRQYEENS
FT                   CTRGGYCNFMHLKPIGRGMRKRLYGRYLGGGRRERREGERSPGRKRERDDGEDDGRVTA
FT                   KGMSDDARRAMFASWNDADDE"
FT   gene            complement(<147996..149563)
FT                   /locus_tag="OSTLU_27769"
FT   mRNA            complement(<147996..149563)
FT                   /locus_tag="OSTLU_27769"
FT                   /product="predicted protein"
FT   CDS_pept        complement(147996..149450)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27769"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27769"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00018"
FT                   /db_xref="GOA:A4S894"
FT                   /db_xref="InterPro:IPR019542"
FT                   /db_xref="InterPro:IPR024943"
FT                   /db_xref="UniProtKB/TrEMBL:A4S894"
FT                   /protein_id="ABP00018.1"
FT                   /translation="MATRQTSFRARPIDITSQLALLRDPDAIKDEQVVQREVTHAHKAL
FT                   DKENEEVLTKETTTGVSEIPIPEILNVSSYESDYPTNYKQPDYYLRSKLTCGLPPTETT
FT                   SYVEYDLDNEDEDWLENYNDGSEVLSAEKFEEMLWKLELACAEANEKIMKANTAMAAAR
FT                   GQVISYQEKVDALGVVTNLPKDKALELLQEISGKQAILTAVYEYWTDRRQRLKKPLLRR
FT                   LQPPPAPNDSNPFNVFRPREKISRPQTRRRRENDVTSYDKLRQLRKSLDISIGVLELVV
FT                   KREKRKSELLTVEQELQKLQIKLRHEPKASLEAIEQKVMEADKKRFKTETPEIPPNKNI
FT                   VLAGGAVELIKKPDGQYVVLGDDMGDLAGRKRRRELGLAALGGYAPRPRVQIPVLPYQP
FT                   PPEIPDIEMLFTKSPSMAAVRTFLLPLGVNLKQCRPRYGRSGRIIFDRKDPITREAFSV
FT                   DSDDEMDSDDDGNNPFLIRSAFAVAH"
FT   gene            complement(<150671..>152962)
FT                   /locus_tag="OSTLU_40695"
FT   mRNA            complement(join(<150671..151972,152018..>152962))
FT                   /locus_tag="OSTLU_40695"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<150671..151972,152018..152962))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40695"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40695"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00019"
FT                   /db_xref="GOA:A4S895"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR013020"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4S895"
FT                   /protein_id="ABP00019.1"
FT                   /translation="MHSYTITVPADGVKIAHKRAFTVDFPFEAYDNQLVFMEKALLAMC
FT                   RGEHALLESPTGTGKTLCLLASALAFVRSEGRARKRKFREEVRDGRGGAGDADDVAGTS
FT                   GREFVDDVEKKERTRAPVIVYATRTHSQVDQVVRELKLFDSTTRATTLASRRHACARDD
FT                   VRALNGTEQKNRCAKLVQQQKCGAKVTLDRALQGRDGRFDLFSDGVQDIEDLVSKAKAR
FT                   GPCPFYLARTKCAEAEIIFMPYNYLLDESVRKGLEIAWENAVIIVDEAHNLESSASDSM
FT                   SYSLTAAKLAKAIKESERAYETKLTLEDTSGEGIDAAAFKGEDFKMLTGVLVQLEGLLD
FT                   SICREAAKAPNAKHEGGLGERIGDGAFIYVILAELNITADTYEHITKLIKSASRTVQLG
FT                   SDFMAQPTQNETPLMEIGNFIERIFVHRYEQYFVTRLGPDMEKFKTSNRARAGPTLSYW
FT                   CFFPGLCLKALIDKGVGTFLLASGTLSPMESFASELALDFPVRLENPHVIKRNQVWGGV
FT                   VTHGPNNGVLNSSFRFRDTREYKTEIGSVILSTARIVPDGLLVFFPSYGVMHSCVNHWR
FT                   STGLWNQLETNKTCLVEPSNADEFHACYDSYNKALEEDSRRGAAFFAVCRGKLSEGIDF
FT                   ADKACRGVILTGIPYAGAKDPLVMHKRTYLDKRKADNGGAYSGNEWYSQTAMRAVNQAL
FT                   GRVIRHKDDFGAVILADERFANENARNQLSLWLRPSVQVHSVFHSAVHGLKEFFQ"
FT   gene            complement(<153158..>154249)
FT                   /locus_tag="OSTLU_27771"
FT   mRNA            complement(<153158..>154249)
FT                   /locus_tag="OSTLU_27771"
FT                   /product="predicted protein"
FT   CDS_pept        complement(153158..154249)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27771"
FT                   /product="predicted protein"
FT                   /note="GO_component: - nucleus; GO_function: -
FT                   transcription regulator activity; GO_process: - regulation
FT                   of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27771"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00020"
FT                   /db_xref="GOA:A4S896"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR038635"
FT                   /db_xref="InterPro:IPR040168"
FT                   /db_xref="UniProtKB/TrEMBL:A4S896"
FT                   /protein_id="ABP00020.1"
FT                   /translation="MEYRENNDVDDAVTAKIEDAMRECAADIGWFESVLAADATKDGDG
FT                   DDEAGAEASEADVERLETPGKDGAMRAAVDEASTSGTSTPSTPAEAQAKKPKRSEDGGD
FT                   EGAAVNRLQAKFEATSPKKSSASTSRAKVTTGMHPDACIFDLPGNGLLSLDELSRGGHA
FT                   YGEISPESGGAMALEHADIPSGVSIRGVVINDRHVSHRLLEIACAKLPREGLSADANWR
FT                   LSSEKNAKKSASAPQKSKIATPSSYPRSPRDIPPGCQLDNPALFKRLDSDALFFTFYYG
FT                   RDRLKLLAANELHASSWRFHKILGTWFARLDRPKIINEKEEFETGSVIYFDNNIVVNPS
FT                   DSSSSGWCQRSKSDFTSRYADFL"
FT   gene            complement(<154944..>155207)
FT                   /locus_tag="OSTLU_27772"
FT   mRNA            complement(<154944..>155207)
FT                   /locus_tag="OSTLU_27772"
FT                   /product="predicted protein"
FT   CDS_pept        complement(154944..155207)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27772"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27772"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00021"
FT                   /db_xref="UniProtKB/TrEMBL:A4S897"
FT                   /protein_id="ABP00021.1"
FT                   /translation="MVDGNDARVVGDAGPRPGAFEVVVCDSLDDGSGEADLEGARAKDA
FT                   AFSALSRGRPPSALEIIEALERELSADDLGLTGDASSGAGCG"
FT   gene            <155529..>156500
FT                   /gene="HDA3502"
FT                   /locus_tag="OSTLU_40681"
FT   mRNA            <155529..>156500
FT                   /gene="HDA3502"
FT                   /locus_tag="OSTLU_40681"
FT                   /product="predicted protein"
FT   CDS_pept        155529..156500
FT                   /codon_start=1
FT                   /gene="HDA3502"
FT                   /locus_tag="OSTLU_40681"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40681"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99879"
FT                   /db_xref="GOA:A4S898"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A4S898"
FT                   /protein_id="ABO99879.1"
FT                   /translation="MVHHSATRHAPGANGAVPVVHHASYSKPVMPRGHRFPMTVFQRVH
FT                   DILREEGVIARGQTNCFVPGRAPSVDELCRAHDEDYVRDVRASALDAKREREIGLPWSD
FT                   ALVERTLMEVSGTMLTVDLAMKVGLCVNTAGGTHHAHRDRGSGFCIVNDLAVSALRAID
FT                   SGAVSRVMIIDLDVHQGDGTAAILANEPGVFTFSAHAKSNFPARKQQSTRDVELPRGMT
FT                   DDAYMAVVAAAMRESLEDFRPELVIYDAGVDVTSNDTLGHLDLTVEGLYRRERMVMDTV
FT                   LGAGIPLAGVVGGGYSPDIDELASRHAVLHRVAREMFVDHGL"
FT   gene            complement(<156522..>157403)
FT                   /locus_tag="OSTLU_27774"
FT   mRNA            complement(<156522..>157403)
FT                   /locus_tag="OSTLU_27774"
FT                   /product="predicted protein"
FT   CDS_pept        complement(156522..157403)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27774"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27774"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00022"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A4S899"
FT                   /protein_id="ABP00022.1"
FT                   /translation="MSEVQARLRAALVAIAEENVDWLYRNTIEDAIATLDDGIRPEEDA
FT                   QGTVSGACAAVGRLDLLVEARALGYPWNAKTCANAARYGHLECLKYAHERGCPWDVWTC
FT                   RDAASNGQLECLKYAHKRGCPWDEETCWYAAKNGHLECLKYAHEQGCPWNVWTCWYAAN
FT                   YGHLECLKYAHEHGCPWDAKTYFCAMSNGNMEVILFLIEREHPHAQSLRLTWEKVAMPI
FT                   LPDADAVIGLEIALSRHRHRHDADGGHVSLREILPFWREHRRLYDEAHRAARVDALLPE
FT                   IDEERRRVTDAG"
FT   gene            complement(<157573..>158697)
FT                   /locus_tag="OSTLU_27775"
FT   mRNA            complement(<157573..>158697)
FT                   /locus_tag="OSTLU_27775"
FT                   /product="predicted protein"
FT   CDS_pept        complement(157573..158697)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27775"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27775"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00023"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8A0"
FT                   /protein_id="ABP00023.1"
FT                   /translation="MSEVQARLRAALVAIAEEDVNALYEEEIEDAIATLDDGIRPEEDA
FT                   EGTVSGACAAVGRLDLLVEARVLGYPWNAKTCANAASSGYFRILKYAHEHGCPWDEKTC
FT                   MDAADGGHLDCLKYAHENGCPWNTSTCSFAANNGHLECLKYAHERGCPWDVWTCAHAAS
FT                   NGQLECLKYAHKRGCPWDVWTCRDAASNGQLECLKYAHKRGCPWDEETCWYAAKNGHLE
FT                   CLKYAHEQGCPWDAKTCWYAAKYGHLECLKYAHERGCPWDAKTYFCAMSNGNMEVILFL
FT                   IEREHPHAQSLRLTWEKVAMPILPDADAVIGLEIALSRHRHRHDADGGHVSLREILPFW
FT                   REHRRLYDEAHRAARVDASLPEIDEERRRVTDAG"
FT   gene            complement(<158888..>159559)
FT                   /locus_tag="OSTLU_27776"
FT   mRNA            complement(<158888..>159559)
FT                   /locus_tag="OSTLU_27776"
FT                   /product="predicted protein"
FT   CDS_pept        complement(158888..159559)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27776"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27776"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00024"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8A1"
FT                   /protein_id="ABP00024.1"
FT                   /translation="MDACSVIYGAAKPGEDEWGRRAREVDEDGDASAAAASGDSDVDDE
FT                   DDERDDDEDAVIADEEFKAGVRALKRGDLNEALRRFVYAESCCPRSMTEAKEKLLKTIA
FT                   QTRALLEQEDEDEGDDDEFVSRDDDEFDDSRDFDDAGDEFHDAEGADSETGWSDTDASL
FT                   ADDAYRTAVWLLKSAADERKPADTEKIRDLLERARQFCPPAASEALHRIDDLLARLDVE
FT                   V"
FT   gene            159879..161048
FT                   /locus_tag="OSTLU_27777"
FT   mRNA            join(159879..160408,160574..161048)
FT                   /locus_tag="OSTLU_27777"
FT                   /product="predicted protein"
FT   CDS_pept        join(160006..160408,160574..160938)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27777"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27777"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99880"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8A2"
FT                   /protein_id="ABO99880.1"
FT                   /translation="MRGLALGRRAARVGARGVGTTTRASQAESQTATSEQQQGEQSQQG
FT                   GLQRQQEQKRALARSPLSSMMAFPSLMSGMTPFGLSRSMQREMANMMNLMDDMMTGGAL
FT                   APFETLDPFKITMHADHTQGVPQQILNFPMDVIQKKDKYIVKADLPGLSMKDVSVEVDE
FT                   KNRILHVTAKREHRAEEQDETVDKGAKWVAYERFYGKMDRSFGLPEDAVAEKDAINCRL
FT                   VNGELTVSIKRNPPQEEEAEKQAPRTKIPIMDH"
FT   gene            complement(161051..162782)
FT                   /locus_tag="OSTLU_27778"
FT   mRNA            complement(161051..162782)
FT                   /locus_tag="OSTLU_27778"
FT                   /product="predicted protein"
FT   CDS_pept        complement(161137..162780)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27778"
FT                   /product="predicted protein"
FT                   /note="GO_function: - catalytic activity; GMP synthase
FT                   (glutamine-hydrolyzing) activity; ATP binding; GO_process:
FT                   - purine nucleotide biosynthesis; GMP biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27778"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00025"
FT                   /db_xref="GOA:A4S8A3"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8A3"
FT                   /protein_id="ABP00025.1"
FT                   /translation="MAPSPTCAKKRKTATDGVDACVVLDYGSQYTQLITRRVRELGVYS
FT                   ILLPGDADLKRIESHAPRVIVLSGGPNSVHVDDAPSVPEGFFEYCARESIPVLGICYGM
FT                   QLLVQRLGGVVEAARGKGEYGRMPVVYESSDSVLYGQGSKAGEREQVWMSHGDEATKLP
FT                   EGFACVGKSEAGAVVAIEDPKRKLFGLQYHPEVTHSEKGLDTLRRFLFDVAGVSAGWSM
FT                   ANVLEEQIAIVKEKVGPDAHVICALSGGVDSAVAATLVHKAIGDRLHCVFVDNGLLRYK
FT                   EQERVMEMFRDNLHLPVDCVDHSEQMLTRLKGVTDPEKKRKIIGAEFIECFKNFKGEIE
FT                   KRTGVRPTFLVQGTLYPDVIESCPPPGSDQKHSHTIKSHHNVGGLPKELGFELVEPLRM
FT                   LFKDEVRKLGAIMDVPRAFLARHPFPGPGLAVRILGDVTADNALDILRRADEIYINTIR
FT                   EFGIYDDIWQAFAVFLPIRTVGVQGDQRTHSFVIGLRAVTSADGMTADWFPFETDFLKE
FT                   VSTRITNQVKEVNRVVLDVSSKPPSTIEWC"
FT   gene            <163226..>164548
FT                   /locus_tag="OSTLU_18317"
FT   mRNA            <163226..>164548
FT                   /locus_tag="OSTLU_18317"
FT                   /product="predicted protein"
FT   CDS_pept        163226..164548
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18317"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18317"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99881"
FT                   /db_xref="GOA:A4S8A4"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8A4"
FT                   /protein_id="ABO99881.1"
FT                   /translation="MASATTKATRRRLSWRDALDETRTYDDDDGDGAKDGWARRGGAAD
FT                   EENATARRAKGQKTSASPRRALAAVDANATMTSPTTRCNTFLAGSTPGAMSAKHASRVR
FT                   ALVEVDEPEEEAEVAEISFDFEDESAMMSPASVDDAELESDSTGDVTVVMSSKRGRLSR
FT                   VNETFNVFKSLAQLAISPSELDVSKRRAPTPMNTPATTLTFDDDVDSPVVQARTEADLR
FT                   DTVEKIASSLVDVEDVMSSYTTRVRAHRVAKALGAAIFMLAISARLYFAWNVAIAAFRP
FT                   RYAIDGTAFAYRWFWRSRTNWNVPFAFAGYASYGEFMIQRALDVESRRAMTRAAAFRAA
FT                   VSATRRVAVVLAYISGVFGIFGVVAKASEDPHPGETTKRGATSPFVFVPKVMMMMTTTT
FT                   DPERPRRPSFGASAVLDTSDRTSSTHREMDGEADEFAVVRV"
FT   gene            complement(<165199..>166914)
FT                   /locus_tag="OSTLU_40572"
FT   mRNA            complement(<165199..>166914)
FT                   /locus_tag="OSTLU_40572"
FT                   /product="predicted protein"
FT   CDS_pept        complement(165199..166914)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40572"
FT                   /product="predicted protein"
FT                   /note="GO_function: - intramolecular transferase activity,
FT                   phosphotransferases; GO_process: - carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40572"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00026"
FT                   /db_xref="GOA:A4S8A5"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR016657"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8A5"
FT                   /protein_id="ABP00026.1"
FT                   /translation="MSADAAREPWARSYAEATVKHAKPRREDDGDRSAPTRFAYGTAGF
FT                   RTTATALRSTCFRAGAFAAARAMAHGGKTTGMVVTASHNPASDNGVKLVEPSGGTLPMA
FT                   LEGVAEMLANAEDGDAETQVRALREAMATAAPADAASANASARVFVARDTRESGRALAD
FT                   ATLAGVHAMGVEAVDRGIATTPQLHYYVYCANVGADDSERAYYDRLSAGYAALTERDED
FT                   EDEDDDHGATVVIDCADGVGGVKLSSLGEAVAPYGLAFDLRNRGDEPTSSLNDGVGSDF
FT                   VQKGKTIPTRGGFENLPAGTRCVSIDGDADRLVYFQTTAAGGVDLVDGDQLAVLIACWM
FT                   NARVKEAAPYLNDITVGVVQTAYANGASTEFLTRELGAAPACVPTGVKHLHHRAEEFDI
FT                   GVYFESNGHGTALFSPSASKAIEDATVEALVARDMPAVKALLALTNAQRVINPSVGDAM
FT                   SGILLVEAILRRTVKAPRLGSFYKDLPSRQTKVVVADRTKIQTFDAERRVAEPEGLQDA
FT                   IDAIVRASNDARCRAFVRPSGTEDCVRVYVEASEETRVEETTRAIVRAVEAHCG"
FT   gene            <167798..>171615
FT                   /locus_tag="OSTLU_13310"
FT   mRNA            join(<167798..167935,168072..168097,168256..169165,
FT                   171526..>171615)
FT                   /locus_tag="OSTLU_13310"
FT                   /product="predicted protein"
FT   CDS_pept        join(167798..167935,168072..168097,168256..169165,
FT                   171526..171615)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_13310"
FT                   /product="predicted protein"
FT                   /note="GO_component: - intracellular; ribosome;
FT                   GO_function: - structural constituent of ribosome;
FT                   GO_process: - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_13310"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99882"
FT                   /db_xref="GOA:A4S8A6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013000"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="InterPro:IPR025755"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8A6"
FT                   /protein_id="ABO99882.1"
FT                   /translation="MPAALPVVSVQGGNGATSALPEVFLSPIRPDIVNAVHTGLNKNNR
FT                   QAYAVYNRAGHQTAAESWGTGRAVSRIPRVPGGGTHRAGQGAFGNMCRGGRMFAPTKVW
FT                   RRWHRRVNLKEKRYAVCSALAASAVPALLLARGHRVEGVPEVPLVVDDSASSIKKTAKA
FT                   VELLKQLGAYADVEKVKASRNIRSGKGKMRNRRYVQRRGPLVVYSEDNGVTRAFRNIPG
FT                   VELCSVDRLGLLTLAPGGHVGRFIIWTKSAFDKLDSIFGTASKKSASKKGWKPPTNIMA
FT                   QTDLARLINSDEVQSAVNAPKVGATRAHAPLKRNPLKNKSAMERLNPYAKVAREMQARA
FT                   QEERSKAKAKKSATARSALASRAQRNGQRRGAAGDRVRRKRQPRAQR"
FT   gene            complement(<171723..>173622)
FT                   /locus_tag="OSTLU_18320"
FT   mRNA            complement(<171723..>173622)
FT                   /locus_tag="OSTLU_18320"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<171723..173622)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18320"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18320"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00027"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8A7"
FT                   /protein_id="ABP00027.1"
FT                   /translation="MVRRTAFGKSVEDVLSRGPAVSWDEDDFDDDDDDDENEAHDHASS
FT                   PVRESESPGVVVVGEVEASPARRRRAVPPSEAVSPTVLLVRDNSTGRRTQTFGEINKSA
FT                   LARDNSTQPRITTVFTKAAAPWKFDHRVFGDRAPTTTADNTTLAAFERSNDDDLEWTAA
FT                   VEEAKVEGLRVLEKAMKDFVSRRSVGRVGASARTPGDSNEMTLDEIDGWGHAMALLERA
FT                   DGLWTGLRETLPKLVEAERETIRKAAKLERDTLLDDSSHARSLEVAWELTFIAAKLWYS
FT                   KGYQLEHAVGTDWATQAWAVVGWLLDESRVASFPVEPKSGIVPPTHFSQEEYTQAICER
FT                   IAELVAWWPRCTADRHPVRVLWKLVHGASVNSGAAQDWRLTARKSAACCQACMPLVWRP
FT                   YDESFKAANARFVTGTACEALYRALGDHLAKCACEHKVLRRELGKWLPDARLSKITDEV
FT                   CAYKNSDNEFRALGGHTFPLSPAALRLQHRASVHIELFRACAQSSLDDQAMLCLKQIFT
FT                   SLASQINCRDDPAPRCILLRAVTTCLGIWLARGATSSEWGRAKPAEEAVRAMTTLADCQ
FT                   KMTGALEPSIPGTTHAFADGAVIAEASAAWATAFAVLGCAATECRNEGLETLGALDK"
FT   gene            complement(<176758..>178323)
FT                   /locus_tag="OSTLU_27784"
FT   mRNA            complement(<176758..>178323)
FT                   /locus_tag="OSTLU_27784"
FT                   /product="predicted protein"
FT   CDS_pept        complement(176758..178323)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27784"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27784"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00028"
FT                   /db_xref="GOA:A4S8A8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8A8"
FT                   /protein_id="ABP00028.1"
FT                   /translation="MPTAMLARVGDILRAGARVAFVASDSSRSEGLVEAVGALGPTYAK
FT                   FGQALSSRGDIVGEDLARALRGLCDDMPAFSDERAVEIVREDLGAEGEAVAEAVRAAGA
FT                   PRAAASLAQVYKATLDGETVAIKVQRPEIREMVDADAALLRLGASAVERTGKVKARALD
FT                   AVNEFCSRLYEEMDFRREAANLMQFNALYGENGSAAKSLPKPGIVVPRLIDKYGVGERV
FT                   IVMEWIEGEKLTAGRTGAVNADDLHYVKLGISCTLSQLIETGVMHADPHGGNILKLPNG
FT                   GLAYLDFGLVSTVPQQVRDGLVAAVALLIFSRNYAAVGRLFGELMLIPPEVLEDESEMR
FT                   ALESALEDAANATLKFPEGGGVPNVRFDQLLGALVALVPRFKFVLPPYFLNNARALGTL
FT                   EGMAKSADANFNILAEVYPYSMKKLLANPEGSPVIRKVIRQLATDERTRSLSIHMLFAM
FT                   LQDVSLLASTPRFRVALDALREREGRVLLFEVLACELRNALNRAKSNFMRLFSRRSSDF
FT                   VALA"
FT   gene            <179269..>180183
FT                   /locus_tag="OSTLU_18322"
FT   mRNA            <179269..>180183
FT                   /locus_tag="OSTLU_18322"
FT                   /product="predicted protein"
FT   CDS_pept        179269..180183
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18322"
FT                   /product="predicted protein"
FT                   /note="GO_process: - nucleoside metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18322"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99883"
FT                   /db_xref="GOA:A4S8A9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8A9"
FT                   /protein_id="ABO99883.1"
FT                   /translation="MEPLARKVAEESDHMVELGQIDWRTFPDGFPDLFINDAYDVRDRH
FT                   VAFLGSFHTPEVIFEQLSIIYSLPKMFVASFTLVLPFFPTGTAERVVREGEVATAVTLA
FT                   RILSNIPPSRGGPTSTIIFDIHALQERFYFGDSILPCFESGIPLLLDRLNELEDSNNVV
FT                   IAYPDEGAYKRFNSFFAAAGYECIVCTKVREGTKRIVKLKEGEPIGRHVVIVDDLVQSG
FT                   STLIECQKLLHRLGAAKVSAYATHGVFPNASWKRFTSTGAGGQGFSNFWITDSCPQTVE
FT                   AVRDAEPFEVLSLARAIADALEV"
FT   gene            <180432..>181409
FT                   /locus_tag="OSTLU_93786"
FT   mRNA            <180432..>181409
FT                   /locus_tag="OSTLU_93786"
FT                   /product="predicted protein"
FT   CDS_pept        180432..181409
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93786"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93786"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99884"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8B0"
FT                   /protein_id="ABO99884.1"
FT                   /translation="MRATAARIEPSRTSSRVANRARAPRRRRARAAAASTIGDANESTD
FT                   AATAYDVLGVRENATKDEIRRAFLRMSKTHHPDVRQTSGDDDGMMAKVNSSYAALFDDD
FT                   ARRKYDAKLRESRKGDAKMKRASDGVTATYEGLVGPIVNDEMASLDVCKIEECAVDAAA
FT                   EMIDSIRQWARTLAFTSELPLPLPVSVDDLPTGARLAFMRYDSSQGLREAGALRLEVLE
FT                   TSEGTKVSVSRSFAKASRAAKFEIPGEGRVMSAFMQEFKFLLGEDEKRTRKVDEASDDD
FT                   FVSAFKSAFAAFILPGLPMFGATKSAPGGAYNAYNLKHDAKHID"
FT   gene            complement(<181486..>181665)
FT                   /locus_tag="OSTLU_27787"
FT   mRNA            complement(<181486..>181665)
FT                   /locus_tag="OSTLU_27787"
FT                   /product="predicted protein"
FT   CDS_pept        complement(181486..181665)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27787"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27787"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00029"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8B1"
FT                   /protein_id="ABP00029.1"
FT                   /translation="MLARVVYVGDRCAFLGFGGYFWGPVPTRKRLKEAASTALDKYGEY
FT                   KDVVADVVQMTTRG"
FT   gene            complement(<182221..>183261)
FT                   /locus_tag="OSTLU_93787"
FT   mRNA            complement(<182221..>183261)
FT                   /locus_tag="OSTLU_93787"
FT                   /product="predicted protein"
FT   CDS_pept        complement(182221..183261)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93787"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93787"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00030"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041127"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8B2"
FT                   /protein_id="ABP00030.1"
FT                   /translation="MGTNANEDASATSAAVDYALPGPYRVRVLPQLEHTCAKCFPSCTG
FT                   LSCLSRIKVYVPRVEVSPDALFPLGEVERGATRSRAEDDAMEAPYPVAIITPGFLIDGD
FT                   AYASIARRLCSWGYVVVTYTKTESVAGGSLDDELSTAILDDLISWVGSDVLISPYADAE
FT                   AVYLIGHSRGGKISMLQATRDKRIKAICLLDPVDNTVYAPLGVGYPSALAAMKVNPSAV
FT                   PPVAIVGGANGGECAPAESNFAEFFAASPSGAVARDHPPWGISCGAGHFDFVDEATFVQ
FT                   KVICPEGTIDASATRDLSAAVAVAHGERVFRPSAAPDDDILERTLASLRSQWTDRGVEF
FT                   SSVKRL"
FT   gene            <183729..>184583
FT                   /locus_tag="OSTLU_40543"
FT   mRNA            <183729..>184583
FT                   /locus_tag="OSTLU_40543"
FT                   /product="predicted protein"
FT   CDS_pept        183729..184583
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40543"
FT                   /product="predicted protein"
FT                   /note="GO_function: - methyltransferase activity;
FT                   GO_process: - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40543"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99885"
FT                   /db_xref="GOA:A4S8B3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8B3"
FT                   /protein_id="ABO99885.1"
FT                   /translation="MLYLIGLGLGNERDVTLRGLDAIKRCSKVYLEAYTSVLGVDVRAM
FT                   EALYEKPVRTCDRAFVEQGVDAVLDEALSEDVAFCVVGDAFAATTHSDLVLRAIERGVA
FT                   VRPVYNASIMNAVAGTGLSLYNFGKAVSICFFTQTWRPDSFYDLIRDNRKSGAHTLCLL
FT                   DIRVKEPTVRALCKGIEEYEPARFMTAATAAKQMLEVEESRGEGVYGEDTMCVAVARIG
FT                   QDDEKIRACTLGEMRRVDMGAPLHSLVLVGDVMEIESAMLATHAVKPEDFYDGDAPCQM
FT                   LDG"
FT   gene            complement(<184802..>185176)
FT                   /locus_tag="OSTLU_27790"
FT   mRNA            complement(<184802..>185176)
FT                   /locus_tag="OSTLU_27790"
FT                   /product="predicted protein"
FT   CDS_pept        complement(184802..185176)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27790"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27790"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00031"
FT                   /db_xref="InterPro:IPR038934"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8B4"
FT                   /protein_id="ABP00031.1"
FT                   /translation="MVQLALIAAPIGAATAVAVATKTFLNTRQNSQKELRRGVVDENEV
FT                   SFACERVCASDRLMAKLGGLGKAELMHTCVTTCGMSATDACVDACARVACTAGHGVPGW
FT                   NEKCLRRCASECARGRTSTP"
FT   gene            complement(<185351..>186349)
FT                   /locus_tag="OSTLU_40667"
FT   mRNA            complement(<185351..>186349)
FT                   /locus_tag="OSTLU_40667"
FT                   /product="predicted protein"
FT   CDS_pept        complement(185351..186349)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40667"
FT                   /product="predicted protein"
FT                   /note="GO_function: - phosphotransferase activity, alcohol
FT                   group as acceptor"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40667"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00032"
FT                   /db_xref="GOA:A4S8B5"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8B5"
FT                   /protein_id="ABP00032.1"
FT                   /translation="MAAQVNRTSWAPEKDAFDVTSLPTATGVGAALTSSPHKRSAGGLG
FT                   ELWADKRERIRHSSPYGNLPGWGLKPIIIKAGDNCRQELLALQLVRTFAEIYRTAGVRC
FT                   WIRDFDILTTNTHSALIEAVTDAPSVHALKSRSQRGTTLREHFERKFGVGTPEFRKAQN
FT                   NFVESLAGYSILTYLLQVKDRHNGNILLHDDGHLIHIDFNFMLSTSPGGINFESSPFKL
FT                   TKEYLEVMDSDVEGSRSDAFDAYKALCIQGYLAVREHAERIVLLVEMMGASGCPCFNAG
FT                   PKVIKQLRRRFNLALSEEQCVETVLGMISDSIDAWSTRQYDFYQRILNGIL"
FT   gene            complement(<186908..>187597)
FT                   /locus_tag="OSTLU_18327"
FT   mRNA            complement(<186908..>187597)
FT                   /locus_tag="OSTLU_18327"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<186908..187597)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18327"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18327"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00033"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8B6"
FT                   /protein_id="ABP00033.1"
FT                   /translation="MMVMTSRRSLRLATKICWLLAAAAGDSAESKAVLDFRDECAREAV
FT                   KNGTWPAPFEERVPMGGESAGTEAATATTERGGSPPRNGRTGAPAESTPEPVTPPRRIF
FT                   GMAKSPGRRSSDGFDGKRVESPPAAGGFLAGVSRALSFRSSPSGSRKDSGKKNRDHHKD
FT                   KEKSPGKTKDAGLRSPSGGLSSLFGVCGTKGLPAEDGAKALNLRRKTFDATMKLTDDLC
FT                   ELSLKLSK"
FT   gene            complement(188273..189083)
FT                   /locus_tag="OSTLU_27792"
FT   mRNA            complement(join(188273..188815,188920..189083))
FT                   /locus_tag="OSTLU_27792"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(188336..188815,188920..189057))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27792"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27792"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00034"
FT                   /db_xref="GOA:A4S8B7"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4S8B7"
FT                   /protein_id="ABP00034.1"
FT                   /translation="MDDAPGASDEAREPLLKRVGASVEGTSLMNHRLMKNPKFRALLVE
FT                   SLMALTTFSFMAKQTEGLAGPELSTLNDCGEAGCGFTKFYQFKGVVGVYAGFWAYTVIL
FT                   IAMYVIRKAPPPGTEFASYALFTAAMATFVVMSITECASVVLSSDYYVCKNADYSLVSL
FT                   IFAAATIVLNCLTCAFAWRQWGELKFVGLPKTLSALTETYPG"
FT   gene            189298..190873
FT                   /locus_tag="OSTLU_27793"
FT   mRNA            join(189298..189743,189910..190873)
FT                   /locus_tag="OSTLU_27793"
FT                   /product="predicted protein"
FT   CDS_pept        join(189414..189743,189910..190587)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27793"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27793"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99886"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8B8"
FT                   /protein_id="ABO99886.1"
FT                   /translation="MPPSTTLLRARDLERALAEPWPNARCATALDDAMIDALKNRFAIM
FT                   TPFARRGAVCAAMLASKRATSARAIATWRDVAAGDADEWVRAMARAMDESGERFDCDRF
FT                   ATDVPVVNTAVRAIKETIANAGEDGMTRRPRADAYLTMKEPTAHGHFTLRERREPKKRP
FT                   MSAGSRGATIAGDGSSQVNRAQANIFAPSRKPTASGGASFLRDTGRSGSVGAARSRVGG
FT                   GIPRPGAKTMVIDVAEAAQLGATSQIDDPLRAQAQEERDRKRQREKEAKEQRMQRLMQE
FT                   IEAKKQRELTRKRERDEEILEKKKAYRAEIEAKRANKRVASIATPSPTDEPATW"
FT   gene            <190962..>191774
FT                   /locus_tag="OSTLU_89274"
FT   mRNA            <190962..>191774
FT                   /locus_tag="OSTLU_89274"
FT                   /product="predicted protein"
FT   CDS_pept        190962..191774
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_89274"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_89274"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99887"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8B9"
FT                   /protein_id="ABO99887.1"
FT                   /translation="MFRAALRRASTHASLNARVRGAFRALATSATQKTGGIYEVRTYDI
FT                   EPSRLDEYLAMCADSANERKKVTNEGFVGFFVTELGGDAHEVTHVYRYDDYDARDDARN
FT                   AMKRSETWTAFLKASKPMVRRQKSEIFLEATKATASAGMEANDVLRRAREGNGGRADGV
FT                   FEWRRYQLELGYNPIPKLVDALAKGLPSKLASDRDGRGELVWMGYSDVGKLNQFVELWR
FT                   YDCYQDHIKAREAARSADAWRAAINEIAPMVQMFDTQLMRPAAASPIK"
FT   gene            <192056..>192691
FT                   /locus_tag="OSTLU_7521"
FT   mRNA            <192056..>192691
FT                   /locus_tag="OSTLU_7521"
FT                   /product="predicted protein"
FT   CDS_pept        <192056..>192691
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_7521"
FT                   /product="predicted protein"
FT                   /note="GO_function: - catalytic activity; GO_process: -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_7521"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99888"
FT                   /db_xref="GOA:A4S8C0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8C0"
FT                   /protein_id="ABO99888.1"
FT                   /translation="RVIFFDCDDCLYKNDWRTANVLTAKIESYTTQRLGLRDGDAYALY
FT                   KKYGTCLKGLMEEKYLDTQEHLDEFLHYAHDIPLDIERDEKLRAMLLKIKTPKWVFTAS
FT                   VAAHARRCLEKLGIDDLFEGIIDVRAVGWETKHSPRAYEAAMRIAGVDDPSDCLFLDDS
FT                   VSNMRTAREVGWTNVLVGTHARDGGELITCDHADHIIATVHEFEALMPE"
FT   gene            <193144..>193545
FT                   /locus_tag="OSTLU_7707"
FT   mRNA            <193144..>193545
FT                   /locus_tag="OSTLU_7707"
FT                   /product="predicted protein"
FT   CDS_pept        <193144..>193545
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_7707"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_7707"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99889"
FT                   /db_xref="GOA:A4S8C1"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8C1"
FT                   /protein_id="ABO99889.1"
FT                   /translation="GVVVVDHGSRRAASNEQLERFAALYATATGRAVVEPAHMELAPPT
FT                   IADAFERCVERGANVVVVAPFFLSPGRHWQEDIPRLVDEAAAAHPGVKYLISAPIGLHP
FT                   LMAEVIDSRLRHCLAHVNEGGPECDVCAGS"
FT   gene            complement(<193681..>195723)
FT                   /locus_tag="OSTLU_40458"
FT   mRNA            complement(<193681..>195723)
FT                   /locus_tag="OSTLU_40458"
FT                   /product="predicted protein"
FT   CDS_pept        complement(193681..195723)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40458"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40458"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00035"
FT                   /db_xref="GOA:A4S8C2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR005085"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8C2"
FT                   /protein_id="ABP00035.1"
FT                   /translation="MEKSTGADDTFIATVDVPATAAVMDFVFSDGGAIYDNADRADFHA
FT                   PVRNASQKLEIARMSSVLQRFQEITTARHAKEKADKIKKDKRDKAKAEAKAKAQAVTLK
FT                   QQEHVLFTEPGQLEAGKIMKLFYNPNNTSLKGSERVFIVGSWNRWSHEKTFKLPMTEVL
FT                   VKGEKRMEVELNIPTDAYMMDFVFSNGNHEGAHYDNRNNMDYHIPVIGGKDEKGVAVVE
FT                   KPLHVVSVSVEMAPIAKVGGLGDVVTSLGLAVQAEGHKVEVVLPKYDVLKYDLIEDLKE
FT                   EEGFQWGGCYNHVFSGTVEGVKTYFIDPDNGMFKVGMIYGTDYLEIPLTDAERFGYFSR
FT                   AALEWMLQSGRQPDIIHCHDWQTAPVAKVYWEDYHNYGLGNPRVVFTIHNLDFGQSLIR
FT                   EAMDYSQIGTTVSRSYAQEISGHDSISHQLQKFHGVVNGIDPDIWDPANDKCLPVSYEI
FT                   DTVAEGKAACRAALCSRSNISNKSDVPLIGVVTRLTHQKGIHLIKHAIFKALERGCQVV
FT                   LLGSAPDPNVQREFEDMANALKQNHFNDAALHLYFDEPLSHLIYAGSDMILVPSMFEPC
FT                   GLSQLIAMRYGTVPVVRRTGGLADTVFDYDHDHAKAEWEGMTPNGFQFDGTEAHDIDYA
FT                   LNRAIDLFYNDIEKFHALQANCMSCDFSWNRPALDYIELYHAARK"
FT   gene            <198427..>199452
FT                   /locus_tag="OSTLU_27798"
FT   mRNA            <198427..>199452
FT                   /locus_tag="OSTLU_27798"
FT                   /product="predicted protein"
FT   CDS_pept        198427..199452
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27798"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27798"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99890"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="InterPro:IPR036464"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8C3"
FT                   /protein_id="ABO99890.1"
FT                   /translation="MRERAKGGVSAYAPFVESLYEHTPARAVETSRAARARLEGHAAAE
FT                   TMREYERDAEDGWRAARRTFETFPSIFSVHEFTRAAFEEALAIVRANSFEARSEDGTRA
FT                   RALVPMAHLLLHDTGSEVPCVKIVDGVFVINVDEHEEGDELSCSHGDYSDAETFARFGV
FT                   SAFYSAEKNARNKIKFAFPSEIYSMKSLDRCGSVENIAFTDAGATEEFMCALRLASANE
FT                   TEWAAISKSKASVRALRKKPLSEESEIAVYEALFATLTELLNSYPSSDNEDERLLQSRT
FT                   LQSAPDEERAVTIRLREKRLALSSLNAVQYAGRQQLGGLLFDKHFADVLPSPVNVRQTN
FT                   G"
FT   gene            complement(<199516..>200862)
FT                   /gene="CCS1"
FT                   /locus_tag="OSTLU_27799"
FT   mRNA            complement(<199516..>200862)
FT                   /gene="CCS1"
FT                   /locus_tag="OSTLU_27799"
FT                   /product="chloroplast cytochrome c biogenesis protein,
FT                   Ccs1-like protein"
FT   CDS_pept        complement(199516..200862)
FT                   /codon_start=1
FT                   /gene="CCS1"
FT                   /locus_tag="OSTLU_27799"
FT                   /product="chloroplast cytochrome c biogenesis protein,
FT                   Ccs1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27799"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00036"
FT                   /db_xref="GOA:A4S8C4"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="InterPro:IPR023494"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8C4"
FT                   /protein_id="ABP00036.1"
FT                   /translation="MGKKTLKSLSSLPLAIGELLVIAGFSALGTVIEQNKSFAWYVENY
FT                   PTENKSLGFIDFPLILDLGLDHIYTTWYFLGLLGLLGASLTACTVTRQWPVWKVSAKWK
FT                   FLDRRATLLAMEEAESVPRARLSDFSDLLADRGYQVFIKGKKMYAFKGLIGRLAPIGVH
FT                   AALLFTLGGAAYSGLGGLSGSVMVPDGSSFEIASGLTRGSLLSSMPGIAKSSVQVNDFT
FT                   IDYLPNGQVSQFYSDLSVVDPNGKEMSRKTISVNVPLRAGGVTMYQTDWALSSMQVTVA
FT                   KPGADGETETENTYVLPMASLEGKGGFQGRIWGTFLPLSFDDDQRRGISLVARDFQSVA
FT                   IYDSKGAFAGVRRPESKKPIVVDGIKLMLGDVKGSTGLELKTDPGVPLVYAGFAGLMVT
FT                   SFLSLLSHSQIWAIQEETAIVVGGKTNRAKEEFRTELDEVLNSVPEYVD"
FT   gene            complement(<201376..>202932)
FT                   /locus_tag="OSTLU_27800"
FT   mRNA            complement(<201376..>202932)
FT                   /locus_tag="OSTLU_27800"
FT                   /product="predicted protein"
FT   CDS_pept        complement(201376..202932)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27800"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27800"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00037"
FT                   /db_xref="InterPro:IPR034750"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8C5"
FT                   /protein_id="ABP00037.1"
FT                   /translation="MDAAPPCAFVEATSALAGLVPGERIEAPTESATWLWRRRSAARRT
FT                   RELVAYARDGVEQGWGLEGTRETTTPEDAFRDGSLDDGDDGAVRRRSTGLVVFALDASN
FT                   ATGVTEEGHEPARGATFGCVGTLCQWIHRTPCFVEFRALNIVWCEFPDDFDTTKARENA
FT                   FNSMHDMSLFPPVALDDVFAPSGINVYTLGVHKRDNRVHDSRKLMGKILDYLSESKREF
FT                   TDAVAWKEEALRQVVEESLPVGARHPSEFSFWCLHAIPSIALDTQFRWLVLSIDDAYSR
FT                   LSLILSRLQLEAVMPPNHVPVTHRCGFVLTTTRMMRQFSNIDGFRTDSVELRDTVPTAV
FT                   RSKIFFNPGGWYDRYAVFARNAVDLSTVENESLRELWSTSPYELLDRTTDVVLDTDEPH
FT                   PEFSWFEGYAWLPILCPRCGAHCGFEFFPDAGRDSSYWSGEDWPPNGAPPPGEAFFALT
FT                   GIDAVWGGRHDDEGSRCLATFLLGGDTAVDRPPFRREALAAWARMYHTPHTRSHVERAR
FT                   R"
FT   gene            203283..>204683
FT                   /locus_tag="OSTLU_25601"
FT   mRNA            203283..>204683
FT                   /locus_tag="OSTLU_25601"
FT                   /product="predicted protein"
FT   CDS_pept        203310..204683
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25601"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25601"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99891"
FT                   /db_xref="GOA:A4S8C6"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8C6"
FT                   /protein_id="ABO99891.1"
FT                   /translation="MGARARWARAMAAVTMVTLATSIAAAERVEREDAVRMYYVNARGA
FT                   TTKRLEMERAVVALDARARRIERVDAKRRSTLLMTYETATCGRGRFAPSAHAERRERFG
FT                   EEYLNALGTSLSHLEAVYAAYDDGASVALIMEDDARWDLLPTWSSDLEKFVERLPEDWT
FT                   VTQLSALGDYAETTKLFYDWQRERKNAPGQSLTTLPKGSRRLSGTQAYLISRKGMSRLV
FT                   KAYRSPAGKTDVCSMTCVELEECVLADGVHLDEKYRVATPPLFVERSPSSDFLDSSRNM
FT                   ILSWAVSLSLTQGKAANLRMDGDMIRDVLAEGLKVPEHLKPNTFMEHFNYHCKLNHGGG
FT                   SKCSIKKAYLVNQKPPRMEEPALAEEAPVDAEENFRGHNASALGRVVMSRRDLAPKETS
FT                   IWSEYSKSTPFISMFVFGALTTFVLAASFVFAKTRPESSRDELQTILPIDPQTEEYYS"
FT   gene            complement(<204724..>205269)
FT                   /locus_tag="OSTLU_40563"
FT   mRNA            complement(<204724..>205269)
FT                   /locus_tag="OSTLU_40563"
FT                   /product="predicted protein"
FT   CDS_pept        complement(204724..205269)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40563"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40563"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00038"
FT                   /db_xref="GOA:A4S8C7"
FT                   /db_xref="InterPro:IPR007853"
FT                   /db_xref="InterPro:IPR024158"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8C7"
FT                   /protein_id="ABP00038.1"
FT                   /translation="MSFALTLARPGRVSPFARARERSTTSACTPSSSRVARRSRAASVV
FT                   LARAPSLSTRLFARRRDDVPLARARSVARVNVLGDGGTSSSDDEGEEEGRASVQLPRTR
FT                   RRVQMTFTCNKCEGRTMRMINPEVLERGTMWVQCGECEVWHQIVDNLGLIFDFTGDYTE
FT                   LKDKIINAKRMQPPESDE"
FT   gene            complement(<205456..>206789)
FT                   /gene="psbQ"
FT                   /locus_tag="OSTLU_27803"
FT   mRNA            complement(join(<205456..205725,205830..205937,
FT                   206202..206327,206679..>206789))
FT                   /gene="psbQ"
FT                   /locus_tag="OSTLU_27803"
FT                   /product="psbQ, PSII-Q, OEE3, photosystem II polypeptide,
FT                   oxygen evolving enhancer 3"
FT   CDS_pept        complement(join(205456..205725,205830..205937,
FT                   206202..206327,206679..206789))
FT                   /codon_start=1
FT                   /gene="psbQ"
FT                   /locus_tag="OSTLU_27803"
FT                   /product="psbQ, PSII-Q, OEE3, photosystem II polypeptide,
FT                   oxygen evolving enhancer 3"
FT                   /note="GO_component: - photosystem II; thylakoid membrane;
FT                   GO_process: - photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27803"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00039"
FT                   /db_xref="GOA:A4S8C8"
FT                   /db_xref="InterPro:IPR008797"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8C8"
FT                   /protein_id="ABP00039.1"
FT                   /translation="MSVAASTSAFTGKAIAQKITTSKSVKANTVVKASANKAVSLAAVT
FT                   AVVLSATPAAFAATGIELTDKRVENQTGLQLIYEARDLELDQKPRSDGPSRFSFQKLSQ
FT                   KETAARATESVTRINKDVGEYVGKKYWTQASNELRRQVGTLRFDINNLVEIKGADAAQA
FT                   KAFYKKLENLDFSIRQKDQEAATALLADVQETASALLASLA"
FT   gene            complement(<206962..>209745)
FT                   /locus_tag="OSTLU_18337"
FT   mRNA            complement(<206962..>209745)
FT                   /locus_tag="OSTLU_18337"
FT                   /product="predicted protein"
FT   CDS_pept        complement(206962..209745)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18337"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18337"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00040"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8C9"
FT                   /protein_id="ABP00040.1"
FT                   /translation="MWHHATKRRRRPARWKPPCYSIAFVCVLTVALTRTSPRRETIAVR
FT                   ALKLADGVADADYADADVRKDSDDERGADTNHKRTRASFETCSSCSTCVPHSELGEDDV
FT                   VDSRGWCERCDCDVKVERIDAGNPGRYVGKSEAMVLRGVTSEGKKVSVKAWCGIRGQFR
FT                   QHANATPVDETCGGFHSQRDRSPERISAIHRLIETMGFGRLVSPTEAKTLKFFTPRDTR
FT                   SLGGKQNTHVLVTDWAKGIAPTDINGARPGQNMMTKELFLVVSRLKREDVIGMTLMDFL
FT                   LGNHDRNIFNIFIDEAKGSLMLIDNEDMLKREDETSTVSIPGTRHHWHYVAGYVIYEKE
FT                   KTLPWMERCHAKSANETKPACIVELENGNWSPTIGAILDYRCWVEGGAIHRTFPSTFSA
FT                   FLAEVTDATIEELMEKYSIAEEDVAFLKDRATLLNRYGFEGALKTTLLQAESQYDINAP
FT                   CCDPLNCPWPVEESLKARREMKTSHFGPYVRNHKELNAIAQSFIGPNDAQSVTSFLESL
FT                   VRIQDDQANLGRGERVEDHQRNKRAPTVEAPQHDDIPLLLSSSDPSFQWNNIERVDAST
FT                   LSIDAFERKYVKEGQPVVIENANLATVLRSVVTRELILDLCGDAFADLGSKIVPLFQSM
FT                   TKTTHQKLLRDLSERLETTRGLTLNETLDFLEGKGKIKTLRDFFDSELMGESKIARKRG
FT                   VDFLHPADNLWPPSVHSWHIIEQCPALAERVKAAVETKLRGDWSYISKILFRERPTEFK
FT                   KFMLFASGDGVRAYHAHHHAKPAHVMVLVVQGSKRAVVWDRADEENLYPLSARVGGEEL
FT                   YNPVYLGNAFNVDLDKQPKIARSRGFGAVVEAGDILFMPCGWIHSFENVGETIQLVWSP
FT                   SISYDAGEQSVVPISDDGVAKYCPNENGRDGFTRESADRDRDRDRDRDRDRGGTPV"
FT   gene            complement(<209880..>219379)
FT                   /locus_tag="OSTLU_27805"
FT   mRNA            complement(join(<209880..213578,213641..213731,
FT                   213791..214086,214163..>219379))
FT                   /locus_tag="OSTLU_27805"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(209880..213578,213641..213731,
FT                   213791..214086,214163..219379))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27805"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27805"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00041"
FT                   /db_xref="GOA:A4S8D0"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8D0"
FT                   /protein_id="ABP00041.1"
FT                   /translation="MGGNGRTSSRRGFRALVTVALVVVIASLAHSCQGLTFNRCERGCS
FT                   ASAGQGRCGLDGVCACEAGWAGLACDVPTPSVVKESRLDGTAGYEYDTAGTAYDEKYVE
FT                   DVMVDTRKNVIYVYAQDANGTRVIEVDPRYPETFTSNAVTARGWGQTNGPRRETTGAVP
FT                   LSITPLPNFCGIGISSGCAAKHPRAYGHVDPQKSRGWYGVYAKMAADLSTALTGVVVPV
FT                   NMWHQTTANQFRFSLFKYVGTTCSSDSSQWANCVLSSLTNGQASATFSKEQYILDAMGT
FT                   DPANGMIVYKATHEDGLSRSVIGHVDGSLNDKGINFLAPGLLSTKCPTCSLAPDAMRLE
FT                   TSVAHTQTGVNYVIFAGSALLDDSDGKTFYPTLFKVNTNSGTRDGDGVEMYLDSTNVKV
FT                   LEACEGQLDSKQGRFSTFTAITKHNGYGYVGTSGRDGDCPGCKNRAACIFMFDLNFAEG
FT                   DSPLAVIALDAALGERDALSATVQTGATAGEKDFMYWAVGSRESGKSRIVKIEIGGTDT
FT                   SSACISGCFKRVGTFEESHTIGGISAVPGERSVFAVSSAASTTYTKYSTVIVSGIEPTH
FT                   ISALTSGTPIKIHGSGFYSPTLASGMSHSISCRFGHTYDANNGFSKTSWSPATYVSATE
FT                   LSCMAPSASNSNSSTIGYSEVQISFDGLPTDSSDPTSIWTNSLWNSGQIYLRYHDPAVI
FT                   ISTKIGSDDAKVLLTGEDADLAPVLLRILGGPFLNSPDLKCKFNDNTTSVTSAVFVSSS
FT                   EIKCPVCNVVNGRCANPVGSPLPWLTNGQPQDAQVAVALNGIDYVSGGILKLHGPPVGV
FT                   KLLSGPDSHQARVAATDFSLGTFKVGLVDIDGTEINYDRGQGGTKGYTISASISGPSEV
FT                   AITEATSSVQTSDGIATFTPQLSSIPTAGEYVITFTATDCTNDDGACSDDLGVLAHAYL
FT                   SVTPGSSGGLKVTPGAATENSMISSATLFPTDVVVLDAARNVSIGHLTVDIVDIGGSML
FT                   QTLSLDDVTVQASLVTGTLNSNEDYRERSIGAQLTGTLNKTTNDGRVSFSDLRLVAMPP
FT                   SGSRAVGSTDDITYSDATRGDFGEASKYIVQFTTTLNGVRYRAHSIMQMEIGEPSYLRI
FT                   NGTYSKRTVYAEAPKQSVGEIIIGAYDGGNNFVGAAEITPRTVTVHASAGITLDGTLQV
FT                   KRDDSGVWRFSDLKVVGPVVGEFGLTFSSGDLTPVLQVVNVLAGDAGYELASSQSILSS
FT                   VTADQSVGLGSFTVYVQDMLGNSMGTADRHSTTDAVAPNRTIQVTCETLKLSGTTAMFT
FT                   NGNGQVSFTGLIANSPKVGTHTLNVIETGAEVSGELRVGKLQSTVLTVSVLIGAVSGFK
FT                   VTSPKVLEFSPSFTESIQLSEATAYSAGHSVPLDDFVVVPVDGAGNESPTGTLPNGVTL
FT                   TAMMNDTNVEIHPFILGANATTIARTSVLTVYTDTSLYPRTGSLVETTSSAGTATFSGL
FT                   HLVKPQKGTYNLTFVSSDSSLRSASVDLEITAGRSNHLGLLPYCATVDGACQTNVNCTC
FT                   HQYRAASDVAMYPVVVTILDGAFNPVDDLETKACETCPSRRVHLSPQNVTLCRRTGEGN
FT                   ACECAGLASTSSTLHGVSCTSVATFEANTESGGSYFDGLHIAKPYIGTYAVDIHSPGLL
FT                   GAQYYFSVTLGNAAQLILDETQGSGTFKSKLETSIANASSPLVGRLYDGGGNFISASPT
FT                   GAQIFVVCQTAELAAYPQGINPLIGGETFAISCGSTTTCATQGGTPGVVEFKNLVLLAP
FT                   TAQQHDIVFYLNGKAVATYAVTVALGDPAKLVVANSPQGSYPATASTTLGPFEIAIADD
FT                   AGNRFGSLNTHEYSIIASIVGQRHTFATSGRNGVIAAGTDSTLLRDTVINAPEIGDYVI
FT                   SFNCDNCTALGLSVAPATRTFTITIGTASALFISPVRLTYFFFFMQNINGGLIVQTFTS
FT                   PASGAAIALQTAYSTAKKVKLSMIQIRVVDAGLNALNLNYEVSVKAERVVVSACNFETN
FT                   VSYTPQTIVAGTAVFDDIVFYRPCTGTYSLTFSTAGLDSVSTQLTYSAGYPAALDTCTG
FT                   NSFTRVDRGLCRDPAQYIAAQTLDLRDFVVQMTDPGGYHVGSMWDTEARNITVELFSFV
FT                   PAEDQPRASVLPTLQAEWDGSLLAVNGGVGWCKDSLDSSPRTVVSSNPTTGAYTYRVVY
FT                   TNPAPSYCREAGYSGIAPDTHYNVGLHIQNALAGTYRLRFASSCGSSRCPGALYPVLET
FT                   DMLEFTVVPGAPTALAVVTAPPFINENDFALSPAPVIAAIDSVGNVCVDINTTLTVSVS
FT                   PAVASISGTEAAMVNGLAKFDSITIIGERANAYELNFSASTLNVSIVPSTPTTVMNCST
FT                   VKPNSVLRSGVCECIPGFTADISGGTGYTEDIDTIYVETNITLYKTATSGSSRWLDALH
FT                   PYGMCVPCKNGFYKVAHGDGACTSCPISMDTSRVDGRLRQTYQAQSGVQLLGALGHVSK
FT                   SSCHCISQTSVPFESYYRQLPLDDYKCMACPKGAKCYGDELENVEALPGFSRFDRQTLK
FT                   FRACPYPDACLGGVNSTCLDAGYTGAMCAACANGYAYHAIREAYPPKCYDCSAGAYRVL
FT                   NFPIVVVNFLWILLLVWLIRVVNQRRSSQVVGMIKSFVTYLQMTALAKNLDLAWPDSMK
FT                   AFLLIAEKLSLPDIRSASAKCAIGWKFYGNLLFHELLPLGLMIFLFIIFTVIKYVEELR
FT                   EATAQARVEATKKTKANDSAEDEETNAIDSGNTNKVNKHDVGLEEVRNIRAYDIVISWL
FT                   VATLWLLYPTLVQYLAEFTQCTGTSGDSDRHFVSDYSVQCRGTAYSLYLFMVIVWAILY
FT                   IVGIPYGLLQLARGEDIVGEHDSAMVQYRLGLLFKGINVKSAWWWEWVIFARKFILIFI
FT                   VIVSRRSAVIGGYTVNCMLQLFFVFHIVAKPYAGEKYAKIETHGLLATMATFTGGLIFK
FT                   QSGEQGGQGSTFVDLITALLFILHAWAWYDFARTLVRQFREEGEEGLIKRAIRDLEFEE
FT                   AIVDEFDAKRDEEIIHQEKMAKESERIQLRSMTGQRLPFADDDLLETIKADSTITIRQQ
FT                   HGALSSQLQDLRERWKARTHRRGERLIALDERHLTAHSTNSRESPK"
FT   gene            complement(<219921..>220835)
FT                   /locus_tag="OSTLU_27806"
FT   mRNA            complement(<219921..>220835)
FT                   /locus_tag="OSTLU_27806"
FT                   /product="predicted protein"
FT   CDS_pept        complement(219921..220835)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27806"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27806"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00042"
FT                   /db_xref="GOA:A4S8D1"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8D1"
FT                   /protein_id="ABP00042.1"
FT                   /translation="MRKRRARELTKRWLLLVLVCGSFLFAFLYPLPETKSSVHTVVILT
FT                   VGNDRKLDDLHRLARDTVFSNTRSARISAQVLVYEGKFRPWFNTSTADDATVVQASREV
FT                   ERLRYGSHSFELFSGIYGASVKPRALRWLTQPDQAWIDFGWIIEPDVVFTGSWQTLFEK
FT                   YESDSSDLIAFNTTFRYSNKTAWNHWPSCTYCRGLPNWCKQSALLPAFRISRNFAAAAV
FT                   AHLSTSTRSSGHHEAFLPTFLTVNSDTFSFRDLGPDVAYMRWRPAFDFDAVPRLAPIRR
FT                   DALYHPVKSLEMYRNLSQASLEA"
FT   gene            complement(<221014..>223326)
FT                   /locus_tag="OSTLU_27807"
FT   mRNA            complement(<221014..>223326)
FT                   /locus_tag="OSTLU_27807"
FT                   /product="predicted protein"
FT   CDS_pept        complement(221014..223326)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27807"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27807"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00043"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8D2"
FT                   /protein_id="ABP00043.1"
FT                   /translation="MADEDVRELATYGTALGTPERIESLERFVNLRALRAHACEITSMD
FT                   CEAFAVLTRLEELDLSSNAIAEARGLEKLTRLRTLNLASNALESTRGFERASTTLERVN
FT                   ISNNKIKSLSGFARSDGAEWGIRALDARGNALESFQAARALSELTRLESLRLKMEEGSV
FT                   IGKETNGMCDVPSYRITMASLVPWLTHLDGVVLSVETCTKAMTKTLDASATTAPGRSSM
FT                   TPPHAEQFSRTPQRGDRSGEKRQTAFQAADESVKSRGVQVNGDAAKRAIDFDQQVVRRV
FT                   REESSQTEAPLMKDVETQKSAMSNVTIDDASERRLREEVETLRRELTKASQAIERASRN
FT                   EEAAQLRVSELETILQEVRTESAENLANLKAMYMDEQNALLNDRVNEARKESTVYAQAI
FT                   EENARLKERISSMEREQHAHEEAAIASNEKIAAQEAGLSEMRELLRVACAERAEAETLN
FT                   EELAQVVESQRDQLEGYAKTREMVVLMEEELERARGAVIDRESTHATIKSAKVAALKAE
FT                   RSAAAREEKAREREELAERLIRDVEALQLKLESADESTKIKNDMLQHQNQLIKSLKDEA
FT                   VRLREQKAESLRTHDARMVEAEARMNAMSEECRSLVQQVESMEMNITELENALADSEVD
FT                   HASYEHAISKANNAVAERDRIIVHMESQIKRLTQTLETSDSIEKAKSKELQHQLEELSE
FT                   QLAIARDKASMYETRAIAIREESDAIVREAYERVDDVEHEMRSLLLDMATEKKANRDRM
FT                   AQIGRLLQEGDIPLALD"
FT   gene            <224421..>224765
FT                   /locus_tag="OSTLU_10581"
FT   mRNA            <224421..>224765
FT                   /locus_tag="OSTLU_10581"
FT                   /product="predicted protein"
FT   CDS_pept        <224421..>224765
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_10581"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_10581"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99892"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8D3"
FT                   /protein_id="ABO99892.1"
FT                   /translation="LNNLAELNRIEARWEDSQAMFEEALEILRRKYGENHPAVGTALHN
FT                   LAGCRLAQDDVDGAYDLYAKSLARKEATLGTNHPEYATTLYHMAEVLCRSDRKEDAIVL
FT                   LERSIKVSEEI"
FT   gene            complement(<225489..>225686)
FT                   /locus_tag="OSTLU_9930"
FT   mRNA            complement(<225489..>225686)
FT                   /locus_tag="OSTLU_9930"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<225489..>225686)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_9930"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_9930"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00044"
FT                   /db_xref="GOA:A4S8D4"
FT                   /db_xref="InterPro:IPR007872"
FT                   /db_xref="InterPro:IPR036671"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8D4"
FT                   /protein_id="ABP00044.1"
FT                   /translation="AYDEVDLEDMEWRDDLKAYTYQCPCGDFFQITLEELRAGEDVAHC
FT                   PSCSLVLLVIYDPEDLPELDE"
FT   gene            226465..>226977
FT                   /gene="RPL21"
FT                   /locus_tag="OSTLU_27810"
FT   mRNA            226465..>226977
FT                   /gene="RPL21"
FT                   /locus_tag="OSTLU_27810"
FT                   /product="Ribosomal protein L21, component of cytosolic 80S
FT                   ribosome and 60S large subunit"
FT   CDS_pept        226471..226977
FT                   /codon_start=1
FT                   /gene="RPL21"
FT                   /locus_tag="OSTLU_27810"
FT                   /product="Ribosomal protein L21, component of cytosolic 80S
FT                   ribosome and 60S large subunit"
FT                   /note="Cytosolic 80S ribosomal protein L21; Cytosolic 60S
FT                   large ribosomal subunit protein L21; GO_component: - large
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27810"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99893"
FT                   /db_xref="GOA:A4S8D5"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8D5"
FT                   /protein_id="ABO99893.1"
FT                   /translation="MGNQRARSRGLRHGTRNLFSRGHREHGTLNTTTYLRTFRVGDYVD
FT                   IKVNSAQQKGMPYLQYQGKTGIVWNVTPRAVGVEINKTIGGRIARKRIHVRVEHVQHSR
FT                   CREDFIARRAANDKAHHEAKLAGKKIVTKRPVTGAPRTGFALENVKSELLTPIPYDILR
FT                   EGMKY"
FT   gene            <227103..>228314
FT                   /gene="TPR1a"
FT                   /locus_tag="OSTLU_27811"
FT   mRNA            <227103..>228314
FT                   /gene="TPR1a"
FT                   /locus_tag="OSTLU_27811"
FT                   /product="TRP-containing protein"
FT   CDS_pept        227103..228314
FT                   /codon_start=1
FT                   /gene="TPR1a"
FT                   /locus_tag="OSTLU_27811"
FT                   /product="TRP-containing protein"
FT                   /note="contains a tetratrichopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27811"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99894"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8D6"
FT                   /protein_id="ABO99894.1"
FT                   /translation="MSLPPELLDFCVCKGPGDTISEQQLADAGVKRAVIHGDAALDTKN
FT                   ALAVTSLCKVRLKWKFDDEECWKQDEFVVYDGTVPSGVELAIMNLHEGESVAFNARGEA
FT                   ALTDFEPLPKADISQVFRSGQAEVLDVKLERKDKFDMSASDKIAFGEKMNEIGKKLFAN
FT                   GRLARAAEVWKRAAEVFAVLEPEDEDVNPNGMKNNEACHEVARKVYLNMALVMYKLENF
FT                   TECELYCCDVLDTRVDEPTYSQIKSKALFRRGCARLKLRKVSLGSRITADTAEADFFLA
FT                   SELDSSIDVAAHFDACTELREQLLASGVEIPSDDVETPNVEDEMNHYPTDIEHALRQIR
FT                   RENLHDGLAFEHPQKRAAILEERMRVYRRLMDETPWSALRGTMFDADSEELQKTATTAR
FT                   EVDT"
FT   gene            complement(<228340..>229086)
FT                   /locus_tag="OSTLU_13316"
FT   mRNA            complement(<228340..>229086)
FT                   /locus_tag="OSTLU_13316"
FT                   /product="predicted protein"
FT   CDS_pept        complement(228340..229086)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_13316"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_13316"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00045"
FT                   /db_xref="GOA:A4S8D7"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8D7"
FT                   /protein_id="ABP00045.1"
FT                   /translation="MERVRDNDACAKALADAVETASREAIEKRGTFAVALAGGSLAKAL
FT                   GALREETRRVEWDKWRVFWVDERCVKWDDEESNFGGAMRALFGDVSVKRERLYAVDETL
FT                   CERNEGAAKPCAEAYERDLRALTPDVIELNEDGLPVFDMLLLGFGPDGHICSLFPNHAL
FT                   LRETEGWILPIADSPKPPPERVTFSLPLVNAARAKVFVASGAGKAEMTARILEEAPQDG
FT                   SVPAALVTGDVRWIVDDAAASKMRNS"
FT   gene            <229396..>229996
FT                   /gene="CPN10"
FT                   /locus_tag="OSTLU_27813"
FT   mRNA            join(<229396..229482,229672..229741,229872..>229996)
FT                   /gene="CPN10"
FT                   /locus_tag="OSTLU_27813"
FT                   /product="co-chaperonin 10, mitochondrial"
FT   CDS_pept        join(229396..229482,229672..229741,229872..229996)
FT                   /codon_start=1
FT                   /gene="CPN10"
FT                   /locus_tag="OSTLU_27813"
FT                   /product="co-chaperonin 10, mitochondrial"
FT                   /note="co-chaperonin 10, precursor of mitochondrial
FT                   protein(Rubisco-binding protein); co-chaperonin/groES
FT                   family; combines with CPN60C to chaperone protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27813"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99895"
FT                   /db_xref="GOA:A4S8D8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8D8"
FT                   /protein_id="ABO99895.1"
FT                   /translation="MDRVLVERIAPATKSVGGVLLPESMTGNTMNEAKVIAAGPGRRTM
FT                   SGELVPLEIKVGDVVALPEFGGAAVNAGDGSGKEYFIYREEEIVGVVE"
FT   gene            <230618..>235258
FT                   /locus_tag="OSTLU_27814"
FT   mRNA            <230618..>235258
FT                   /locus_tag="OSTLU_27814"
FT                   /product="predicted protein"
FT   CDS_pept        230618..235258
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27814"
FT                   /product="predicted protein"
FT                   /note="GO_function: - protein binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27814"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99896"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8D9"
FT                   /protein_id="ABO99896.1"
FT                   /translation="MRAVGEALRECPCTEKDWESVGAMESAQGEGESDAWESEKIWLHK
FT                   MSRIAFYDSQPLSETNAWPFASRTKKDATKSTVALFKASVSAFIAAKNTQRLAEVDWKL
FT                   QENKLINSWKELLMTHTPRPGGLADVSCEFNVHVTALEQELAKRQNEGDKSDEFGRRIK
FT                   HIKIMIQVLQSIKASFQYCATALYDTVFAPLRAFSSASITSENFESGVEFVSWASRSVM
FT                   IASELCQTKDSYHVRMTRYTKHEFLNWSRKLLDFFYHHLSSVRGSHIVETLGSGSDCAE
FT                   LMQLIKCLPTMRLTLPCKGTSRRATYLSDTRFSDKFQRKLTRFALTVIGAAKSQLSQHT
FT                   QTHKLGKFLFPEWIEHLVDTIEHNKSYTVKELAREILLSLDIANLLATRVEVLSVKSLI
FT                   KLSDDELSVDDELSVDYDDDVKELKELLSWLRSILSVHPSKLRNVADLAKDLISVFGFC
FT                   RLRRETHGDKVQKSGHDHSLESDICSIFACLAVSRDHDLDDEEKLKSCPCEMVKLRSED
FT                   ARKMIQQLVMHEDHLDDVEAVILNMLTLDRTSMSASDTTIPSALAALTMLVRKNCVLRE
FT                   RFFKSGDTTNTLLEILECKNANVARITSACILSFEEHHRLVTSLYKPNVITDKKGEQVT
FT                   EISGWDVDTIRQSLRAISALVKDSTVSSIGFDSAILEVICTDRRMLVLTNKIKATIEKK
FT                   INKSMDYPNSRLCFPEALLEEWVFDLLCMRSDLLTQMATAVTNGGGDPWKNFKPKHEEF
FT                   ASFISREFEVANTDATIPPEAHAEWFQEVVTLVTTVQEKLKKDEEISDVCSILMDGDTD
FT                   GPSSRVGIVVPILTLLHKCRILQEHNLISELEVEGISDIEKEACYVIGLLASKQGIQDR
FT                   IASSFLIEGKNGIEQLIPLLQRYQPSAKNAANASVARRASDAITNLAHENSRIKTMVRN
FT                   ANGIPPLVNLLESQEKKVQKAAASALRTLAFKNGENKNQIVECGALPKLIFMARSEDVM
FT                   IHKEAIGVIGNLVHSSPHIKRRALDEGALQPVIELLKSQCSETQREAALLLGQFAARLE
FT                   PAAPGDPDYRTKIVQRGAVEPLIKMLGGQFVYREPGLREMAAFALGRLAQHGDNQVGIC
FT                   HSDGLRPLLTLLESEIEDIAEGLRHHSASGKSDHEIDLDAKRFAENLQHNAAFALYGLA
FT                   AHQDNVPKMLKENAFMRLKFSHLIAEQSKQCVNKTLKRLEDGVSRRDVLTYLGFVISTG
FT                   KPVERQRVTLALAWLIRKENQDYLKDMRAVFIDKGGLDVLSGALLDTPAEPIDFSGHTS
FT                   GLAGGKRIVNVIMEALREIKDKLVSQVVVESHMMPPPSTPTAEEHMPANFNDPELSDVT
FT                   FIARDDEGEKREFNAHRIAFTHASDAFLSTLEAGKADVDVYPATYKVDLEDVCWNVLEA
FT                   MMDFIYTGTVGPMSSLRDQAFLQHRCEDVLSATTRFDLPGLKYLTEKLFIDNVKMDTFT
FT                   FARTCALYRAAVEHDAVAIQDHVLGYVLDNYDKPWIDDDVTMNCLTSYKARVKDIVECF
FT                   GKGLVKYLDKLLRRERVAVVADAQDE"
FT   gene            235360..>236938
FT                   /gene="RPS21"
FT                   /locus_tag="OSTLU_27816"
FT   mRNA            join(235360..235645,235826..236573,236873..>236938)
FT                   /gene="RPS21"
FT                   /locus_tag="OSTLU_27816"
FT                   /product="Ribosomal protein S21, component of cytosolic 80S
FT                   ribosome and 40S small subunit"
FT                   /note="Has EST support. CTZ69_B07.x1d_t, sort of, see model
FT                   notes"
FT   CDS_pept        join(236391..236573,236873..236938)
FT                   /codon_start=1
FT                   /gene="RPS21"
FT                   /locus_tag="OSTLU_27816"
FT                   /product="Ribosomal protein S21, component of cytosolic 80S
FT                   ribosome and 40S small subunit"
FT                   /note="Cytosolic 80S ribosomal protein S21; Cytosolic 40S
FT                   small ribosomal subunit protein S21; GO_component: - small
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27816"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99897"
FT                   /db_xref="GOA:A4S8E0"
FT                   /db_xref="InterPro:IPR001931"
FT                   /db_xref="InterPro:IPR038579"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8E0"
FT                   /protein_id="ABO99897.1"
FT                   /translation="MINADGENVDLYIPRKCSWTNRLITAKDKASVQLNVGHLDANGVY
FT                   DGRYTTVALAGYVRSKGESDSAIDLLWQKKKAAINQA"
FT   gene            complement(236945..>237771)
FT                   /locus_tag="OSTLU_27817"
FT   mRNA            complement(236945..>237771)
FT                   /locus_tag="OSTLU_27817"
FT                   /product="predicted protein"
FT   CDS_pept        complement(237334..237771)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27817"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27817"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00046"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8E1"
FT                   /protein_id="ABP00046.1"
FT                   /translation="MNFRNVDQYATAMQHYFTLFGVTLFLNPDKFWSATAGVMPLRYFN
FT                   AVGAATTQSGFFARMTGLGFLILVLGKRLGTSNAVFAKQCNAFHAFTLKMFYDCARVTY
FT                   ARRQTVEFVAQTWKLQVAVNVALLLWGTSTTGGLKNMLKRD"
FT   gene            complement(<238577..>239665)
FT                   /locus_tag="OSTLU_5620"
FT   mRNA            complement(join(<238577..238938,239029..>239665))
FT                   /locus_tag="OSTLU_5620"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<238577..238938,239029..239665))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_5620"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nuclease activity; GO_process: - DNA
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_5620"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00047"
FT                   /db_xref="GOA:A4S8E2"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR032641"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8E2"
FT                   /protein_id="ABP00047.1"
FT                   /translation="MGIKGLPAVLEPYCERVHVGEYAPGTRCAVDAYSWLHKGAFGCVD
FT                   ALAPGGDRAWERRPGATAPYVKYAVHRANMLRHHGIEPVIVFDGDRAPAKRGEERARRE
FT                   RRAALLERGERARAAGDKEGAFRAFSGAIDVTPEMARELIVALKREKFEFVVAPYEADA
FT                   TIASLALTAKERGGVDLVFTEDSDLVAYGCPRVVFKLEKSGDAKELRLATNKPKSKGPP
FT                   PLDFTGWDYELFLSLCVLSGCDFLDNIRGLGIKKMYNILNKHRCVDAVFAELRANEKIK
FT                   DLIAEGYEVEWRKARMIFKHALVWDPHAGALRHLTPVPEHCEFANDLSFLGP"
FT   gene            <239972..>241313
FT                   /locus_tag="OSTLU_40469"
FT   mRNA            join(<239972..240127,240237..>241313)
FT                   /locus_tag="OSTLU_40469"
FT                   /product="predicted protein"
FT   CDS_pept        join(239972..240127,240237..241313)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40469"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40469"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99898"
FT                   /db_xref="GOA:A4S8E3"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8E3"
FT                   /protein_id="ABO99898.1"
FT                   /translation="MAKTRRRKRRTHVDADAGGGSKGKDADAPRTFVFTRGRMADAVKD
FT                   LSEDLRKVMEPHTARNLKESKSNKLKDFVQVSGPLGISHFLMLSSSDASKYFKICRTPR
FT                   GPTLTFKIHSFSLSNEVAATQKNPRNPAKAFLSPPLVILNNFGDEAHQKLATITFQNMF
FT                   PPINVRKVKLSTCQRAVLVDYDAKTKRFQFRHYSINAAPVGANKKLKKLLQSRNAPDLG
FT                   DTQDVSEFFDKRVGDASDSEGSDDESRRVHLTQDFNRVAHADSTSKIILNEIGPRMELE
FT                   LVKVEEGMCDGRVLYHAYVKKTAEEVKTLEQKKVEREKLRKRRRVEQEANVKRKAREKE
FT                   IKADAERARQGKSKKKSSAVDEFGNVRDVEGEAEDDAKWAAAFEREEKEWREGDVYDER
FT                   SGKTKRKRHGD"
FT   gene            <241969..>242283
FT                   /gene="RPP1"
FT                   /locus_tag="OSTLU_40742"
FT   mRNA            <241969..>242283
FT                   /gene="RPP1"
FT                   /locus_tag="OSTLU_40742"
FT                   /product="Cytolic 80S ribosomal protein P1; Cytosolic 60S
FT                   large ribosomal subunit protein P1"
FT   CDS_pept        241969..242283
FT                   /codon_start=1
FT                   /gene="RPP1"
FT                   /locus_tag="OSTLU_40742"
FT                   /product="Cytolic 80S ribosomal protein P1; Cytosolic 60S
FT                   large ribosomal subunit protein P1"
FT                   /note="Acidic ribosomal protein P1, component of cytosolic
FT                   80S ribosome and 60S large subunit; GO_component: - large
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40742"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99899"
FT                   /db_xref="GOA:A4S8E4"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8E4"
FT                   /protein_id="ABO99899.1"
FT                   /translation="MSGDLACTYAALILHDDGQEVTADKISAVVSASGLELEPYWSGLF
FT                   AKFLEQKSVGDLISNVGAGGGGGGGGGAAAGGDAGGDAAAAAPEEEEEEEAEMDFDLFD
FT                   "
FT   gene            complement(<242502..>243221)
FT                   /locus_tag="OSTLU_13319"
FT   mRNA            complement(<242502..>243221)
FT                   /locus_tag="OSTLU_13319"
FT                   /product="predicted protein"
FT   CDS_pept        complement(242502..243221)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_13319"
FT                   /product="predicted protein"
FT                   /note="GO_process: - amino acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_13319"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00048"
FT                   /db_xref="GOA:A4S8E5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8E5"
FT                   /protein_id="ABP00048.1"
FT                   /translation="MLKVSGEALAGEDGFGISPDVVKSIASEVAQAAMSGIEVAVVVGG
FT                   GNFFRGAEKEGNGLDRASADYMGMLATVMNSLNLQAAIESKGVPTRVMSALEIKEVAEP
FT                   YIRRRAIRHLEKGRVVIFGAGTGNPFFTTDTGAALRAAEINAQCVLKATKVDGVFDSDP
FT                   KKNANAKLYKTLTYETVRRLGLGVMDQTAITLCEENDIPVVVFNIAHDGNIVNALRGCS
FT                   VGTCVGSSDKCSDTCEE"
FT   gene            <243984..>244952
FT                   /locus_tag="OSTLU_40647"
FT   mRNA            <243984..>244952
FT                   /locus_tag="OSTLU_40647"
FT                   /product="MC family transporter"
FT   CDS_pept        243984..244952
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40647"
FT                   /product="MC family transporter"
FT                   /note="GO_component: - membrane; GO_function: - binding;
FT                   GO_process: - transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40647"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99900"
FT                   /db_xref="GOA:A4S8E6"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8E6"
FT                   /protein_id="ABO99900.1"
FT                   /translation="MTCYRLAAERDNPIACATHLVKPAVAMFLAGGVAGALAKTCTAPL
FT                   DRLKIIMQTSGASRASAASVAAADKGLLAAFVAIGKTEGVAGYWRGNVPQVVRILPYSS
FT                   AMLYSYEAYKKKLTNKETGELAVPARLLAGAGAACTATIVTYPLDIIRLRLSVDTSAKS
FT                   MGDVARTILANEGPLGFFKGLRATCISIAPYSALNFCAFDLFKKALPEEIRNEAQGIAT
FT                   ASLMATALATGSMYPLDTIRRQMQLQGSTYANMLDAGRGIVAANGVGGLFRGFIPNAMK
FT                   NMPNKSIQLTTFDVLKKGIRRSEVEYAKEVAILAAENKKIK"
FT   gene            complement(<245190..>245548)
FT                   /locus_tag="OSTLU_27824"
FT   mRNA            complement(join(<245190..245389,245515..>245548))
FT                   /locus_tag="OSTLU_27824"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(245190..245389,245515..245548))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27824"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27824"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00049"
FT                   /db_xref="GOA:A4S8E7"
FT                   /db_xref="InterPro:IPR001349"
FT                   /db_xref="InterPro:IPR036418"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8E7"
FT                   /protein_id="ABP00049.1"
FT                   /translation="MSSGASVEEEIAEMNKWRAVSMLVIPACAGFGVYTLSNAAHGHGH
FT                   ENPAYSYLRIRNREQFPWGGDCGLFEYRDDCK"
FT   gene            complement(<245807..>246940)
FT                   /locus_tag="OSTLU_27825"
FT   mRNA            complement(join(<245807..246545,246714..>246940))
FT                   /locus_tag="OSTLU_27825"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(245807..246545,246714..246940))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27825"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27825"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00050"
FT                   /db_xref="GOA:A4S8E8"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8E8"
FT                   /protein_id="ABP00050.1"
FT                   /translation="MPRAAPDRAELEEDDIDFDDLRIRKPPPQWTTTATITSVVAWGAL
FT                   AAHNVIAMPKIDGVANVSFERVSSSSRFVPKAALFALRMGTFAFGVFFFCYHMVYEHSM
FT                   QVRKTDGFDYLSDWTILLLFVLEGALGMNMYRTEREEGELDGLTNVLVIAYGVAWTTNV
FT                   LSSAGAWYSFFAFPMCRALEGVDNYPDCYLEWYRLVEHAGNMVVLLLEFLLGALPMRRR
FT                   DFGWSILFVQAYVFFCWYRFYATGKAVYVMFDFAKSFESLAWHNLVFFATTLIFFVCLK
FT                   FHQHKGYRTAAHVRAAGPFVIARVRGDDVDVAERASLVQK"
FT   gene            complement(<247101..>248165)
FT                   /locus_tag="OSTLU_27826"
FT   mRNA            complement(<247101..>248165)
FT                   /locus_tag="OSTLU_27826"
FT                   /product="predicted protein"
FT   CDS_pept        complement(247101..248165)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27826"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27826"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00051"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8E9"
FT                   /protein_id="ABP00051.1"
FT                   /translation="MRASDALSSTARTAFSPLRARASSKPPLARLAPLGLGQSLDAAKA
FT                   SRSDAFLTLTRASADVIDVSDASSDDTRVRASASANPIVVLSGFGNCSSDYEDALGNDE
FT                   ASLAKSLRSRGFSVHVAEVERKDWFVGILRGIFTKGFWMNACTTRESYGWYLERVDACV
FT                   KEALRANPEATSVDIVAHSAGGWLARAFIGGALAMNASEVECSGDFLKRDERVRRLICL
FT                   GTPHAQDAKSDPTRGASKWVNDTWPGAYFEPDVQYVCVTGRAVVGNASAEPKTIGKYAA
FT                   GSYAVVAGGDGDGVEGDAVVPNCAALALEGAEMIVIDACWHSMSTVGTFDEPSKFHWYG
FT                   SDAVVDRWLKVLRA"
FT   gene            complement(<248242..>249282)
FT                   /locus_tag="OSTLU_89287"
FT   mRNA            complement(<248242..>249282)
FT                   /locus_tag="OSTLU_89287"
FT                   /product="predicted protein"
FT   CDS_pept        complement(248242..249282)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_89287"
FT                   /product="predicted protein"
FT                   /note="GO_process: - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_89287"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00052"
FT                   /db_xref="GOA:A4S8F0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8F0"
FT                   /protein_id="ABP00052.1"
FT                   /translation="MASTSAGASGMNAYEILGVQSAATTDEIKRAYKKLALQLHPDKVS
FT                   RTTKTDAERDEARVRFRNVANAYEVLKDEVSRAAYDQKCELNGAKRDDVLVNVSFKESV
FT                   TGTTKLAMIPFKLLCSSCQGVGMACLKCEGCANRGGTAVGSQGTCGTCDGRGFGKPETC
FT                   RKCGGDGVKDDFFHGRVHVPAGVLDGSRLPISGRTQHVRVRILPSKVFSRDGLNVTSTL
FT                   RLSAKDALEGGFFEVETVHGVETMYFDEETKSGDTKTLDGKGIKDGKKIGNHIVRVEVE
FT                   REQTPEAVESDEDVEEAEEPEASEADEPATKKQKESIEDQEEVIDLERLLAEKKAKLLA
FT                   QLNAQS"
FT   gene            <249852..>252651
FT                   /locus_tag="OSTLU_18354"
FT   mRNA            join(<249852..250218,250451..>252651)
FT                   /locus_tag="OSTLU_18354"
FT                   /product="predicted protein"
FT   CDS_pept        join(249852..250218,250451..252651)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18354"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18354"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99901"
FT                   /db_xref="GOA:A4S8F1"
FT                   /db_xref="InterPro:IPR005011"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8F1"
FT                   /protein_id="ABO99901.1"
FT                   /translation="MDFMKRVGGVDLVVNFAQQVAADDEKFDALIREGAFEVFTHALLA
FT                   DEDEVTVRGLIGLACALPRRRALRVKLAEDGECVRRLATLMGSSTDESLKGFAGGLFRA
FT                   LALDPETKGLVEKALREGEARDAINNAAVASSARAPAEMRQDDAQNEKEGGGAVESMSI
FT                   EATNAMRLKLGLAPLREGASKKTHDADALRRDEAKAAETAALAEKIAARKRQREIEKLN
FT                   AATTKLGDADDEEEDAGAWLAKSKTKMATKAQELERAKAAKVAAMFAERDEDAEASASE
FT                   EEDEGAKKSKSAAYTSKDLRGLKVRHTADEINEGQEVVLTLKDTSVLDDEDDELENVLI
FT                   AERKSRKKARKESTKKSDDPFGEGKDVEAKKTVLGKYDAHDEDAAMELDGEGGLDAAEE
FT                   KRKAEIKARLAAELSGLKGKAETAEVVKGEQADFHTQEEMQAKFVKREKKKKMRKKLRK
FT                   KHIDAAELEQDALAPESSDLGSRRSRGESSAEAKATTNEKDAKFANALQKAREVTDKKI
FT                   LAELAGEAEEEEDDELARALARSRKMANISNKAARSAPADVVAQVAARRQADEAKAREN
FT                   AANVADESLVFTDMSEFVQGINTQDGALDEVYDEDADTEEMPDVPPPPPPGGEDEPMDD
FT                   EMPDVPPPPPQEEVDAHVNMPVLAEKHVVQKGLASTLALLKDKAQLDDAQNTRWSGRAN
FT                   DMKDRFDRQHVLEAHAIEEKAVDGYKFGFKLDKLDEFGRKLTPKEAFRELCHRFHGIEP
FT                   GKMKREKRLRQFQEEQQRLKASSVMDDRIKDVQRDQATPYVVLSGHVRAGQARNADPVA
FT                   TMKREQESARATPAAASRGPSSASGLKASNATKVSFAMKPSKK"
FT   gene            complement(<253336..>254142)
FT                   /locus_tag="OSTLU_40450"
FT   mRNA            complement(<253336..>254142)
FT                   /locus_tag="OSTLU_40450"
FT                   /product="predicted protein"
FT   CDS_pept        complement(253336..254142)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40450"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40450"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00053"
FT                   /db_xref="InterPro:IPR007402"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011197"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8F2"
FT                   /protein_id="ABP00053.1"
FT                   /translation="MTAETHRWWFGDDDDATTTTSYAREDTQNVVDDPVREISRVVDPG
FT                   QTRRIGNGGTAQSRSAILHSLASIESWAMLLAWDAIQRFGVARNMPKEFYDDFVELAAD
FT                   EGRHFALLSRRLDECGVVRFGELEAHDGLWRTAKETAHSLEARLAVEHCVHEARGLDVL
FT                   PQTIGKFRRNGDEASATLLETVIYPEEITHCASGLRWFKYLHAREVDGGDVGEETEESG
FT                   VVKAFHEIVREYFHGALKPPFNDEARAKAGFTPVWYEPLATKVHAQ"
FT   gene            254312..255618
FT                   /locus_tag="OSTLU_27831"
FT   mRNA            254312..255618
FT                   /locus_tag="OSTLU_27831"
FT                   /product="predicted protein"
FT   CDS_pept        254340..255548
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27831"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27831"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99902"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8F3"
FT                   /protein_id="ABO99902.1"
FT                   /translation="MPPRVKKIKREYADADAGDADYDAVSSGEDDAAEITMKITKKKRA
FT                   PKKVKTDDGDAEGGARVKAKDENAPQKIGFDITAGPIQDEGLHAKYNAMNLDELKQYMK
FT                   MNRMPSSEVGQKNKRIVYKKADLVAHCVDGEKWGRYPLCPNCGKRGTTTLRVTYADENH
FT                   GGQGTWKCVGYYDTVLQSVTRCSFNYKEDKDAPRERLPWRKPGDEMSDDEQDDVQAGMD
FT                   KPVVFPDDMHAMAPMEMSKKMVEICREHGLQLPKAENEALRECYTKLQASMNYDDEYDI
FT                   KTAFNLLKEAYPPLTKEQQAGGADAKNPANTKLCQALEAIFQAAKTSPEEPMKSASYRK
FT                   AAQSIREIDFEVTSGIAISKGKLKVPNVGPSLGAQIEFWIKNGYFERMEYYERGEIPPS
FT                   SKK"
FT   gene            complement(<255643..>255996)
FT                   /locus_tag="OSTLU_27832"
FT   mRNA            complement(<255643..>255996)
FT                   /locus_tag="OSTLU_27832"
FT                   /product="predicted protein"
FT   CDS_pept        complement(255643..255996)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27832"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27832"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00054"
FT                   /db_xref="InterPro:IPR003435"
FT                   /db_xref="InterPro:IPR038052"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8F4"
FT                   /protein_id="ABP00054.1"
FT                   /translation="MISRLHTLVGVRIVMAQLDGQGNECSEDVNQSSVTAAMLKQMETT
FT                   PLVGTGSEFIESLMRSEDADVRLAATRVIEVRREFGDEFDWDEMKKSLLVDLSQYRLEM
FT                   LRTHAAKSFDGGA"
FT   gene            <256164..>256976
FT                   /locus_tag="OSTLU_18357"
FT   mRNA            <256164..>256976
FT                   /locus_tag="OSTLU_18357"
FT                   /product="predicted protein"
FT   CDS_pept        256164..256976
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18357"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18357"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99903"
FT                   /db_xref="InterPro:IPR014955"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8F5"
FT                   /protein_id="ABO99903.1"
FT                   /translation="MSRACASSRVALARASRAPTRKRALDRSTRSRAVATRDDARADVE
FT                   SDASALSRALESIRDADVNVVVVERDDARKRFVERESLVEALRASAAFERAVTFRKAPT
FT                   VEETARALAVADNALARDIATCVRAFVNVVPGADRGVKVTLSLLRSTLCSRLHVDHTSA
FT                   RMMVTFYGRGTEICDARTSAAIAKANADGGNFVTDALKTLAEKFAPPREISTCDVALLK
FT                   GERWTYADGSTSKGKAIVHRSPLIDENEWRLTLKVDVVNFGCECEEEH"
FT   gene            complement(<257021..>258073)
FT                   /gene="HDA3508"
FT                   /locus_tag="OSTLU_40492"
FT   mRNA            complement(<257021..>258073)
FT                   /gene="HDA3508"
FT                   /locus_tag="OSTLU_40492"
FT                   /product="predicted protein"
FT   CDS_pept        complement(257021..258073)
FT                   /codon_start=1
FT                   /gene="HDA3508"
FT                   /locus_tag="OSTLU_40492"
FT                   /product="predicted protein"
FT                   /note="GO_component: - histone deacetylase complex;
FT                   nucleus; GO_function: - histone deacetylase activity;
FT                   GO_process: - chromatin modification"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40492"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00055"
FT                   /db_xref="GOA:A4S8F6"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8F6"
FT                   /protein_id="ABP00055.1"
FT                   /translation="MRPAPLFPRGQALAASLHRAVSTAASASPSTRASPPRPLSVFFAD
FT                   WARVDLPDGHRFPMDKYARTREALRRDAALVNKITLLESPKVDIESELLLTHCPEYVQR
FT                   VLTLTLREDEVRKIGFPMAQQNVERSLASTGGTVACMREVMSGARASAQIAGGTHHAYR
FT                   DRGEGFCVFNDVAVAINVARREFADSLRDRKILVIDLDVHQGNGTAKIFEGDAQVVTFS
FT                   MHGEKNYPIKTREKSTHDVELPDDCEDEEYLSLLEQWLPKLFDDYDPAIVFFQAGIDAL
FT                   KEDSFGRLAMSREGLLRRNNAVYSMCIAREVPLVITMGGGYSKPIEPSLDAHVDVFRSA
FT                   ALRFTAPQFF"
FT   gene            complement(<258119..>259600)
FT                   /locus_tag="OSTLU_89290"
FT   mRNA            complement(<258119..>259600)
FT                   /locus_tag="OSTLU_89290"
FT                   /product="predicted protein"
FT   CDS_pept        complement(258119..259600)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_89290"
FT                   /product="predicted protein"
FT                   /note="GO_function: - ATP binding; kinase activity;
FT                   GO_process: - phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_89290"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00056"
FT                   /db_xref="GOA:A4S8F7"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8F7"
FT                   /protein_id="ABP00056.1"
FT                   /translation="MGGIADYSGATVAQLGLGGRRTECRARFRDAASGTSGTFRARTVT
FT                   IGTRGAEEEDARCFEARFDEVFDAETFDAGKTREYFERTPSAANERWAAYVAGAMGEFL
FT                   RAISSDADASNKRARAWVKKLARCDCEIEIRSDVPQGKGVASSAAVEIAVARAVAASAL
FT                   RAGVVSEDDAARRFSAHVAMIPLYCQTAENDVVGAPCGFMDQYACFHSVDSASRGNFIA
FT                   IDCDLANTSHDGAEDIYRLVPLPRKLRVWGIDSGVRHSNSGGSDYARVRCGTFMGKKIL
FT                   INEMNARLNRDVVPSKVDLCGVITARQWDEGSAGSPMSWSQHVDEEMTGKSFLARYISH
FT                   DDEPNTTIDADSTYTLRATVSHAVREHARVREFLSILEDWPSDDVCADDDVRQLGRRLG
FT                   DLMFASHSSYSSVGLGSTATDDLVRLVREVDVERNALFGAKITGGGSGGVVCVLGEDSP
FT                   SARAAIDAVRREYAKKHSLTNLPDLLHASHVTDVD"
FT   gene            <260190..>261509
FT                   /locus_tag="OSTLU_18359"
FT   mRNA            <260190..>261509
FT                   /locus_tag="OSTLU_18359"
FT                   /product="predicted protein"
FT   CDS_pept        260190..261509
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18359"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18359"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99904"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8F8"
FT                   /protein_id="ABO99904.1"
FT                   /translation="MATTTTTADAARAAAGAARRLQETYFAATSKAIAPERWYPYWWAL
FT                   PLAPYGSKATALAEAVPGEVWTFDQLQGLLDVLVNVRMTVARLEGGGLWVHNPVAPTKE
FT                   LVGMVKELEKRYGAVKHIVVGSAAIEHKIYSGPFSKAFPNADVWLPPKNWTFPVDVPLE
FT                   TYVPFYPQGSPKTLPMQSIGGEQNVPWANEIEHAVLQVGGSSLRGFKDPWFVDTAFYLK
FT                   RTKTVVLTDVMEKVSQQAPPVCQINPQPLLVRAMDEPDKVPANTSQARSDGWGKTVLFG
FT                   LLFNPNAVEFEFSGDIANDLLDGFKWDPSWRADFDALVAKPMFVPPILAVLAFPRRRDE
FT                   VKRWSNIVTSWDFTSIIPSHLDGPFNATPDEFTAAMDFALTATPYEQFGANAQSLIDVD
FT                   KLSVDLKSLEVPKPLSPELITPPKPAQEAVEIVLDAASEQ"
FT   gene            <261786..>262640
FT                   /gene="CMK"
FT                   /locus_tag="OSTLU_4287"
FT   mRNA            <261786..>262640
FT                   /gene="CMK"
FT                   /locus_tag="OSTLU_4287"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase, putative chloroplast precursor (CMK)
FT                   (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)
FT                   (CDPMEK) (ISPE)"
FT   CDS_pept        <261786..>262640
FT                   /codon_start=1
FT                   /gene="CMK"
FT                   /locus_tag="OSTLU_4287"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase, putative chloroplast precursor (CMK)
FT                   (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)
FT                   (CDPMEK) (ISPE)"
FT                   /note="GO_component: - chloroplast; GO_function: - kinase
FT                   activity; transferase activity; 4-(cytidine
FT                   5'-diphospho)-2-C-methyl-D-erythritol kinase activity; ATP
FT                   binding; GO_process: - terpenoid biosynthesis;
FT                   phosphorylation; isoprenoid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_4287"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99905"
FT                   /db_xref="GOA:A4S8F9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8F9"
FT                   /protein_id="ABO99905.1"
FT                   /translation="FSPSKINLFLRITARRPDGFHDLASLFHVIDLGDDMTFAKSSSET
FT                   KDTLICNDPTIPTDSSNLVIKALDLFRAKTGVRQYFWIELDKKVPHGAGLGGGSGNAAT
FT                   TLFAANKLCGSPATEAELLEWSGEIGSDISVFFSKGAAYCTGRGEIVEDVEPPLDLATK
FT                   MLLVKPPMGCSTPAIFKALDLDGRSKADPLELLKRIGVDGCSETVCINDLEAPAFTVLP
FT                   ELAELKERLKAATADKKTVVFMSGSGSTIVIVGDDDVPAFVARDDALFKAPTRLITRKP
FT                   GEWY"
FT   gene            complement(<262714..>263529)
FT                   /gene="PSBP4"
FT                   /locus_tag="OSTLU_89292"
FT   mRNA            complement(<262714..>263529)
FT                   /gene="PSBP4"
FT                   /locus_tag="OSTLU_89292"
FT                   /product="lumenal PsbP-like protein"
FT   CDS_pept        complement(262714..263529)
FT                   /codon_start=1
FT                   /gene="PSBP4"
FT                   /locus_tag="OSTLU_89292"
FT                   /product="lumenal PsbP-like protein"
FT                   /note="shows similarity to PSBP (OEE2, oxygen-evolving
FT                   enhancer protein 2 of photosystem II, OE23, 23 kDa subunit
FT                   of oxygen evolving complex : PMID: 3468511); orthologous to
FT                   At4g15510; targeted to thylakoid lumen by TAT pathway ||
FT                   similar to psbP, possible thylakoid membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_89292"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00057"
FT                   /db_xref="GOA:A4S8G0"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8G0"
FT                   /protein_id="ABP00057.1"
FT                   /translation="MARASSIATHRATPASTPRRAPAIQRAVVARCDARSRSTTTTTTT
FT                   RRDAMRAALSAVALARVAIATPARAFERPPIGFARYTDAIDGYGFDRPSAWVEVRGSGN
FT                   DVFFRDASEVETNAFVAVSSPSSSAYESVEDLGTAEDAAKRVLEQYVGELMSTRLGVRR
FT                   EKEILNARRRTKSDGKVYYDVEVRISSYSARNQYGLTAEDRPQTLEWDRTLRSALGTEN
FT                   GKLYELRLQSPTASYEKNSKIFDVMVDSFRQFEADTPSVSSYIGLRIGQ"
FT   gene            <263751..>264968
FT                   /locus_tag="OSTLU_4127"
FT   mRNA            join(<263751..263846,263895..>264968)
FT                   /locus_tag="OSTLU_4127"
FT                   /product="predicted protein"
FT   CDS_pept        join(<263751..263846,263895..>264968)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_4127"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_4127"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99906"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8G1"
FT                   /protein_id="ABO99906.1"
FT                   /translation="ALFAWGCGEDGQLGLDDARSTARERCAASPRRATPRAPACGSRNS
FT                   MCATTTGELYAWGWNSHRALSFGWQECDALFVDAPRRSRLEVGEGGRRLEVAAAASGGW
FT                   HALCVDADGAVWGWGGNEYAQAGRADAEAEARSAAIPDRDWAPARALISPARMIPLPFA
FT                   VSAVSCGGMSSFALLRDGRVFEWGLTSEEEEPREEPAHLPTLDKHVVEIAAGSFHLLMR
FT                   TRNGEVLSYGNGMYGQLGLGAFSAADKPRVIETFGRVGVAKIAAGGWHSAAVTAGGLLY
FT                   TWGRGEYGRLGHGDDCKDKVVPQLVDLGEDESNFIADVALGGSHSCAITCEGHVLSWGR
FT                   NTLGRLGRVVSDPSPSCGHPGRVVFPPLPGGRFWRVDKISCGGRHTLAVA"
FT   gene            <265484..268001
FT                   /locus_tag="OSTLU_27841"
FT   mRNA            <265484..268001
FT                   /locus_tag="OSTLU_27841"
FT                   /product="RND family transporter: Niemann-Pick type C1
FT                   disease protein-like protein"
FT   CDS_pept        265484..267910
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27841"
FT                   /product="RND family transporter: Niemann-Pick type C1
FT                   disease protein-like protein"
FT                   /note="GO_component: - membrane; GO_function: - hedgehog
FT                   receptor activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27841"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99907"
FT                   /db_xref="GOA:A4S8G2"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8G2"
FT                   /protein_id="ABO99907.1"
FT                   /translation="MLCSMLFCILCAVGLGAPGLKNEKRGDKLWVPTDTPAQGDKNYVD
FT                   ANFGSETRFAQVILRSTTNGANVLTPTGLAALENVAARVRNANIAWEGATYTYAQHCYK
FT                   MGATCYEKSVLNAFANATAYGSQSLIDAALSASPLTSENPNDGSTVLLKNVAGGITMTG
FT                   AVPSASAISLTYLFKNNDVLRNGDYVDEKGDAFDSVVLDIFANPPSGFSASYVTERSFS
FT                   DEFGSTIQSDLQKLQIALFLILAYAALTLSKWNMGCVGSRVGVTLAGIVSIGMAIASAY
FT                   GIGAYCGLFFSPLMNVLPFLLLGIGVDDMFVIVNSYDNTEARVDPVERMGRSLRVAGMS
FT                   ITVTSATDVIAFLIGSSTSLPALKNFCFYAALGIFFDYLYQITFFTAFLSIDERRKSEN
FT                   KADCFFCLDCPPEACCVCCTPKKMPKSLLQIALGDGLGKQLGKKPVKIFVLAFFSAITV
FT                   GGIIGSTKMQVDADVNNFIPDGSYLKNWFADTDAYFTEYGDAVEIYSKSTLDLTTEDSI
FT                   LRAATAAFTANPYVINESVRSWVDDFYTYHTTTNGVTVTSLNYIPSLKTWLSTAAGSQY
FT                   KNDVVFDDETSPTAIVSTRIHGNHIKTDKSNVNVQAMDTLRAAINAVSGNNGRIFAFGS
FT                   QWLNYEQYKSITSEAIRNISITLAACFVIIAMLVIEIKTVVSVSLALTMIFVNIVGYMH
FT                   FWGLTIDSVTVIMLVIALGLAVDYSAHIGRAYLEKTGTPDERIVRTLQDMGVAVWNGAM
FT                   STFMAVLILGSSDSYVFQTFFKQLFLCIVLGLMHGLIFLPVVLSMLRPAAYAEAT"
FT   gene            <268487..>270169
FT                   /locus_tag="OSTLU_18363"
FT   mRNA            <268487..>270169
FT                   /locus_tag="OSTLU_18363"
FT                   /product="predicted protein"
FT   CDS_pept        268487..270169
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18363"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18363"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99908"
FT                   /db_xref="GOA:A4S8G3"
FT                   /db_xref="InterPro:IPR007941"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8G3"
FT                   /protein_id="ABO99908.1"
FT                   /translation="MREWPDEGLTVERLVETLVSRGALRADERAALRQRAKRVGEDWTR
FT                   YAQAEDRAVLKLRRKLVKGEDIRANALKLPKIDSTSIKDWTKSDWERFFKVVLASVIGG
FT                   AALFASGGTATPALVAAMHGLGLGAEAFSAFGGLQCMLGVTGASLCAQKMANRTKTELE
FT                   NFDLIPLRGAHKSYAMHIFVPGFTRDDHDLLGAWGATNNQYVSVVPESRSVVPDLGIEF
FT                   TSGADGSIIVQAKDDSIAKRHGVVSGSTLLSYRSVKKPGEPSVVLSELVDMPTSDELSR
FT                   VPRPIEIRLQLPDRDDELKKEMSELANEIKSQVGNHSKEEHLPTAEAAIRPEQRRWGNR
FT                   TGEQLVLNWEPSTLNELGACMTSWNETCTVNFYLTPAALAKTALGGIADAIAWPATLLS
FT                   SAGFIDDPWALVKLRGKIAGEELAQSLLDGQHGHRPVTFVAYSAGAYVVQSCLQKLYEA
FT                   GDRGKNIVDRAIFISAPISTSKDVWQPMREVVSGRLVNVHCHTDWILLLMWRFNMLDPM
FT                   TRLAGLSIVKRVPSVENYNIKNLRHAHLPDEISRVLEEIDLQE"
FT   gene            <270664..>271485
FT                   /locus_tag="OSTLU_18364"
FT   mRNA            <270664..>271485
FT                   /locus_tag="OSTLU_18364"
FT                   /product="predicted protein"
FT   CDS_pept        270664..271485
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18364"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18364"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99909"
FT                   /db_xref="GOA:A4S8G4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8G4"
FT                   /protein_id="ABO99909.1"
FT                   /translation="MAYEGDDASDAEGENGIIGSARCVCLVDDRGQRTMRTYLGASAKT
FT                   RADDLPSEALRSADVLHAEGYALYKPDVLARACALAKENGALVSLDLASFEVVRHCRDA
FT                   LRETLESGVVDVIFCNEDEARELVRGIDDDGCARAQESHPQLNGRDVERPSEETELAAL
FT                   AYLLRYVKLAVCSRGKRGCVAMNAEGERSESRAEGVEAIDTTGAGDTFTSGFLHAYLAG
FT                   GSLRQCGDAGCAAGAEVVQVRGAEMDDDRWRRVREKIAIILGKERSPSATM"
FT   gene            complement(271549..272702)
FT                   /locus_tag="OSTLU_27844"
FT   mRNA            complement(271549..272702)
FT                   /locus_tag="OSTLU_27844"
FT                   /product="predicted protein"
FT   CDS_pept        complement(271572..272654)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27844"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27844"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00058"
FT                   /db_xref="GOA:A4S8G5"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8G5"
FT                   /protein_id="ABP00058.1"
FT                   /translation="MSRRATRERSLVASVRAPSDDRARVQATTRETTARLGSLDARPGR
FT                   ATGTPRKRPAATAEGARGTPGQRTEKRAPPATDGRACETCGAEKTSRWRRMDDGGGDAT
FT                   RFRCKACFQRERRKRNATTEHVVDGVVRACVECGETKCRGEWVRVAADDPARGTAATGR
FT                   EGGALGTRCAKCYERARKERRKNEGALTRCEKCGNSANGMLLVSDPSEDAAAGGKCCHK
FT                   CYHRTKNRMRKLRDERTCADCRKAKRTEPDVRWYRSKETGPEGEPVWTCHQCFSDRANH
FT                   PDLNAAGAPRKRMPPHKNGGKKAQKPSSAPPRHCPSCDRTKQSSQWRKSGEHTVCTACY
FT                   QRHLRARKYRQREPVGTFAI"
FT   gene            <273775..>275385
FT                   /locus_tag="OSTLU_27845"
FT   mRNA            <273775..>275385
FT                   /locus_tag="OSTLU_27845"
FT                   /product="predicted protein"
FT   CDS_pept        273775..275385
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27845"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27845"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99910"
FT                   /db_xref="GOA:A4S8G6"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8G6"
FT                   /protein_id="ABO99910.1"
FT                   /translation="MECLRRAAELGDAAAHDELGFTYASGWDGTPRDGAKSVLHYYFAA
FT                   NAGSVRAMMALGYRHKHGIDVPESCETAVLYYHEAAKIVVEEAAKRTPGVLPFQIEKHR
FT                   LSAEMSGSNLAARRERDLVQYYRYSADMGNVDAQVTMGRLYSLGARGLRKDVGAARKYL
FT                   TDAANAGDATAMANLGNMYANGFGVDVDNATALHWFRKAAKKGNAMGRYGLGYMTLAGH
FT                   GVAQDHALAVQYLNQAAEQGLSDARYFLGVLHLRGIGVKQDFTKAYHHFNIASHVGHEV
FT                   ATYNLAMMQLNGMGFPSSCASASALLKQLAERGHWATPMEHAYAAYMRRDYRGALLRYM
FT                   KMAEMGIEIAQANAAFLLEQRLGDEGRFREDTQVNPEAPSTATRALHYHRLAATQGNVK
FT                   SLLRIGDAYYCGKGANVSLTKSIAAYRQASEQRNPHAMFNLAHMHEHGIGMQKDLHLAK
FT                   RYYDMILNNAPDATIIVHLALKKLVLHQWIIDNKDTILRVAKEIHASPTAQFVDFVVVV
FT                   GAAALLCFVLLLRVGLARG"
FT   gene            <275532..>275750
FT                   /locus_tag="OSTLU_40704"
FT   mRNA            <275532..>275750
FT                   /locus_tag="OSTLU_40704"
FT                   /product="predicted protein"
FT   CDS_pept        275532..275750
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40704"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40704"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99911"
FT                   /db_xref="InterPro:IPR009653"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8G7"
FT                   /protein_id="ABO99911.1"
FT                   /translation="MSALFDFKSFLTTLLLFICACTYVKLRAPGLLDSHRTGFRGVFWK
FT                   AARVGERLSPWVSVACAYMSVQTLFGW"
FT   gene            <275850..>279911
FT                   /locus_tag="OSTLU_27846"
FT   mRNA            <275850..>279911
FT                   /locus_tag="OSTLU_27846"
FT                   /product="predicted protein"
FT   CDS_pept        275850..279911
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27846"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27846"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99912"
FT                   /db_xref="GOA:A4S8G8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039226"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8G8"
FT                   /protein_id="ABO99912.1"
FT                   /translation="MSAKASLMKTLKAANEALKAGDAASARGLAKEAIEADGDAYEAWV
FT                   MDGKAANALGALDDAVKSYERAIEIRSEHPAAYQGLNETFAAKGDVVGRLRALRALVDA
FT                   HRASGKVDKLVEFLKQACACAWENAQWSRVIEFCGEMGEFRTGEVDEVTRVESVKRACD
FT                   GALALRDARAAEAGEAAVQMLRSKTIASKAEEEAVRKLGARASHAVDDEDLATTLRAWL
FT                   SEDVANASYDSRTHAAELDRLDARLAAALSGSVDCDFDVRACAREALTEATVLIDRWGE
FT                   VVIDLVEPLCVEIVAALELGLDCEEEGWDDNEVEDEDEAKVIRLLERVLALRANTIASG
FT                   WLALRDSRRSGAFTHSCRPATPPREDARGLLTPELRDEIVTTLNRDDESKVSHASAAIG
FT                   WLALAESMLVGGERADVHALQAATTAMKIMREDITTDALPKMSRRVLMVHAEAMLRVGM
FT                   FQEARAAFVVLEGPRAARGLATYAFNAHPPDYERALQLLSDAAETYPNVRRVGVELGWL
FT                   MTIAGSSERRAEGLETLERACGVKSGEPLSTTTPADASARLGIARWRAQVSAAKGPGSA
FT                   HEALLIGAAGDSAHRAAAFAHLGLSCGASGDDARAQKCHARALALDAADPTSGPVAFTN
FT                   ALDANDDAKATSICRAALAVDSRCSWAANRLAPMCARIGDHSGAIGALQVVLRVSPRNA
FT                   SAWEALGASYNSLGRHSAALKAFERAMELSDEAGEGVRSYAASQTGHIYLALGSSADAI
FT                   EAYDKALSDGVDHLAALFGSASAHSYYAKGALRWGAPGRAAVSLKAATKAGKRAVEIMG
FT                   DGATATVWKLLGDIHHLAAQVNDPALGKDFTSMLAARTTEARSAVEAYGKALNLKPDRP
FT                   GRWRDVVAALRLQTEIHKLSGDVAAAEASAAKAWERAAGYLRVAPGDPFAWFAAAAIDD
FT                   PAVISDAVRTERKITALSRAVALNPTFAQAWCALGRLYLSSGDVGEATLSLDSARIADP
FT                   SSGDAWTATAALHIATGKLAEGRGAFRMAAALGAGAEADLGCALTACASGLTYAKDAYA
FT                   AARRASESLPVDSTAAIALALCAECRGLFEEAEDAAAHAVASLENVPALGGDPNVIRTV
FT                   AEECRARVSQRRLDDSDSTASTSVDGDFENTLERAKLLVHARPGDLKMQDALTRVASCA
FT                   PDHQTVVSALSACPPSSPNGDYRVQSSLARAAAACALNASTVVGDAEGSARANRFVARA
FT                   TMLDPSSTESLELLNIVLDRRKGIVREATQSEAHELHAALKSALTQSAAGDSASAEAAA
FT                   RAVVNREPITDAAQAAARLILASFLIERSRRDGDAKPAKEAIKVLAKIPSEAGARVADL
FT                   AAALADAVSG"
FT   gene            <280348..>283438
FT                   /locus_tag="OSTLU_40728"
FT   mRNA            join(<280348..281172,281483..>283438)
FT                   /locus_tag="OSTLU_40728"
FT                   /product="P-ATPase family transporter: calcium ion"
FT   CDS_pept        join(280348..281172,281483..283438)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40728"
FT                   /product="P-ATPase family transporter: calcium ion"
FT                   /note="GO_component: - membrane; GO_function: - ATP
FT                   binding; hydrolase activity, acting on acid anhydrides,
FT                   catalyzing transmembrane movement of substances; ATPase
FT                   activity, coupled to transmembrane movement of ions,
FT                   phosphorylative mechanism; catalytic activity; GO_process:
FT                   - cation transport; metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40728"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99913"
FT                   /db_xref="GOA:A4S8G9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8G9"
FT                   /protein_id="ABO99913.1"
FT                   /translation="MGDVETNRRVWGANTTRPYPTKSIWDFAFEALEDVTLRVLVISGA
FT                   LSLVLETSIGGDDSEYSWANGAAILLAVCIIVVVECVNNNEKQRSFVNLNARSEQTNVA
FT                   SILRGGNRELLRKSEVVVGDVVELQAGDVAPCDGLVIESAAFLVDQSHITGESDDIEKN
FT                   RQSIIFAGSKVTSGRGSILSIGVGENSSSGQIAEMINVGAEEFTPLQLQLQALAVKIGR
FT                   WGISAALVVGFILSFTLVFDAIQGTGPPIEALGLDFLHIVIIAITIVVVSVPEGLPLAV
FT                   TLALAFSVRRMLELSMLVRVLGSAETTGEVTALLIDKTGTVTENDQRVNRAWIAGVDIG
FT                   PLTSKSVTWASEIANKTRNEPTLDPRVVKLLSILLAMNSTITYDAKGQILRGAKAEIAL
FT                   LRFVNSMNNDELFVATIRKYFPLVKLFPFNTSRKRMCTLFTLRDGINDDEMGDVIVRAV
FT                   TKGASQDMLNLCSSVMDENGAHHPLDAATKDQLSKKFLEWQDDAERVLLVAYKDIERDL
FT                   ITTHEATNICSRMSASDAESDLTLVAAIGMCDPLRPESTKSVRLCRRSGVAVKMVTGDS
FT                   LSTATAVARRCGILDEKDMSTEATMTGEAFREAIRGEEGQEIDQSKLDAIWPNLRVLAR
FT                   ASPQDKFILTDGIRNTKLSGRKEVVGVVGDGTNDAPALRRANVGFALGSGTECARDASD
FT                   IVLLQDDFSSVVDAIRYGRNVFESIEKFITFQLTANCTTIILSTGCALVYAKSPLNAIE
FT                   LLFVNLVIDSLASLALATDEPSDDVMRQPPSDASNLITSTMRLNIFTQVSYQLAVMAYL
FT                   LNEFGPEDTQIYCCFVLLQLANQINCRKVTTEVNVFKGATKNKLFVSLLTSEILLHVAI
FT                   VQAGGAVFHTSPLNAGEWLRCTAFALGAIPLRALFVTFFVSLFAAFREEDALHHH"
FT   gene            complement(<283463..>284785)
FT                   /locus_tag="OSTLU_18368"
FT   mRNA            complement(join(<283463..284099,284163..>284785))
FT                   /locus_tag="OSTLU_18368"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(283463..284099,284163..284785))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18368"
FT                   /product="predicted protein"
FT                   /note="GO_process: - biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18368"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00059"
FT                   /db_xref="GOA:A4S8H0"
FT                   /db_xref="InterPro:IPR026051"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8H0"
FT                   /protein_id="ABP00059.1"
FT                   /translation="MTKRRTALVVLGDFGRSPRMQYHALSLARDADRAVDVVCYSGTPP
FT                   IDALSREDAVTMRYVVGCRWRWLTRVPLALALGTRVAAQCAHLFWILMTMQRCEEMLIQ
FT                   NPPCVPTFLVCGIVCRARRTRLVVDWHNFAYTLFGMKRGDASATTRMLKWYERTQGKMW
FT                   GDAHVCVTKAMGNFLEKEWKIEGARVVEDRAAERFREAAREATTPEDALDRFLRGTHEN
FT                   MTKNKPRFIVSSTSWTPDEDFGVLLDAAVAYDARKRAKGDHASKSYPDIVIIITGQGPR
FT                   KTMYEKKINELALEHVAFRTVWLDAADYPRALANAHLGVSLHTSSSGLDLPMKIVDMFG
FT                   ASLPVAAMRYAVIGELVQEGVNGVLFADATELAAMFAKLLRGDERLTLRALKHGAAKWG
FT                   EQTWDDHWKRCALPVFADAA"
FT   gene            complement(<284952..>285764)
FT                   /locus_tag="OSTLU_27849"
FT   mRNA            complement(<284952..>285764)
FT                   /locus_tag="OSTLU_27849"
FT                   /product="predicted protein"
FT   CDS_pept        complement(284952..285764)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27849"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27849"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00060"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8H1"
FT                   /protein_id="ABP00060.1"
FT                   /translation="MELFQLRVPAGAGRAFTPSRGSMVVLTHVALTCEGPKRASKDERI
FT                   TVQVATRGGGGDGKTDAIALGSVSDAPGREQFAIGGSGLCFGDGERVVVSHNGREAEVC
FT                   LTGRVEATTASLGGDDSSDESEENSESNGEEDGESDDSESESDGEEDMMVKAKAMAKAA
FT                   AAARRAEASDEDEDEGEDESESESESESEDSEQDDSDEEESESDDASDDDSSDDSSDDS
FT                   DALPGSKRKANAKEAKFEDARDARRGGRGGGRGGGRGGGRGKGKFARR"
FT   gene            complement(<285821..287124)
FT                   /locus_tag="OSTLU_27850"
FT   mRNA            complement(join(<285821..286839,287032..287124))
FT                   /locus_tag="OSTLU_27850"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(285821..286839,287032..287083))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27850"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27850"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00061"
FT                   /db_xref="GOA:A4S8H2"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8H2"
FT                   /protein_id="ABP00061.1"
FT                   /translation="MTLVDALKDTSRPVFLFGVTPPLEGSSADAIADAADNFVQKSRGL
FT                   ACDGYIVYDIQEEAGRTADARPFPFRKLDDPGAFAAALRKASGGTESVVYKCVAETKSE
FT                   GEFQSWLDEATRETSAYNLVGGASSSQEYAGPTIQRAAEMLRKTKRGCAFGGVTIAERH
FT                   AKKGNEHETLCAKTDAGAEWFISQAIYDADMTIKLVNDYGAECERRGIQPKRIVLTFAP
FT                   CGREKTMKFIKWLGCSVPEAVEAEILGADNPAQKSVEILVAMCERIIAETKQSKVPLGV
FT                   SVESVSIFKNEKEAARDLFRLTQAVMLDAYGVQWSMRYAIDASSSKRAGKDDKIKRIAT
FT                   VVAAFLAGAVARTKFA"
FT   gene            complement(<287841..>289289)
FT                   /locus_tag="OSTLU_40532"
FT   mRNA            complement(join(<287841..288118,288191..>289289))
FT                   /locus_tag="OSTLU_40532"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<287841..288118,288191..289289))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40532"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40532"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00062"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8H3"
FT                   /protein_id="ABP00062.1"
FT                   /translation="MLDIGAYFSKSPTELAGRMAEVLSVIGRVYATWQYEERMGIPLER
FT                   RTRGKKLRDGIARLGPVFIKMAQTLSTRPDIIGEEAADNLMVLQDQVGPFSTEEAHAII
FT                   KRELSWDGAVCERDASKPGPAYSLYKELSPEPIAAASIGQVYAGRLHDGSKVAVKVQRP
FT                   GMARRIALDLHIIRLGFGWVEESGLNGSEDLDKIVDQVGAGIFQELDYTIEARNADEFR
FT                   KSLRFLDYLFVPRHHANMTTKKVLTQQWIQGRPMKSLSLEEQKLMVQMGVECSSAQLFR
FT                   TGLVHADPHEGNMLFTDDGKLALLDFGLICRVDDDQQEAMANCILNILNSQWGELIDNL
FT                   RIMDMLPQEPQMWIDENGNQADYTQGEGNPKVRANFTELVLDLTKISTAYRFNLPPYMV
FT                   FVIRSLTTLDFAAARTNCNMYEVAAPTAIFRALSPRTDRGKKALEQMLLDKDGDVNWSK
FT                   L"
FT   gene            complement(<289954..>290757)
FT                   /locus_tag="OSTLU_4304"
FT   mRNA            complement(join(<289954..290448,290518..>290757))
FT                   /locus_tag="OSTLU_4304"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<289954..290448,290518..>290757))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_4304"
FT                   /product="predicted protein"
FT                   /note="GO_process: - base-excision repair"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_4304"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00063"
FT                   /db_xref="GOA:A4S8H4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8H4"
FT                   /protein_id="ABP00063.1"
FT                   /translation="PRWESATDDRRVMREYFNADVSLERLYEEFAAKDGRFRALAAHVD
FT                   GARMLRQDPSECLFSFICSSNNHISRIHGMVNKMCNGGEETAAAAEAEKFYAFPSVAQI
FT                   LDGATEEELRALGFGYRAKFIVGSAAALGEAGDAVGSSPDEFLRALRDETPYVDAHAAL
FT                   MTLPGIGPKVSACVCLFSLNKHEAIPVDTHVWQFAVEHYMPELRDAKSVTPRVMRSIEV
FT                   KMKEIFGPYCGWAHNALFIAELK"
FT   gene            <291405..>291872
FT                   /locus_tag="OSTLU_27853"
FT   mRNA            join(<291405..291425,291552..>291872)
FT                   /locus_tag="OSTLU_27853"
FT                   /product="predicted protein"
FT   CDS_pept        join(291405..291425,291552..291872)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27853"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27853"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99914"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8H5"
FT                   /protein_id="ABO99914.1"
FT                   /translation="MPVAQIKMIHAGPWGKSGSIIHVNVEHDDFKSDIKRRVSNATGIP
FT                   VPELKLIMASPTQIAAGSKRCPGLAYGNCGVVDKVGLAVVQAESGENPFVPKLSPNRVD
FT                   NKGNWTSVD"
FT   gene            complement(<291935..>292321)
FT                   /locus_tag="OSTLU_40633"
FT   mRNA            complement(<291935..>292321)
FT                   /locus_tag="OSTLU_40633"
FT                   /product="predicted protein"
FT   CDS_pept        complement(291935..292321)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40633"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40633"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00064"
FT                   /db_xref="InterPro:IPR022042"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8H6"
FT                   /protein_id="ABP00064.1"
FT                   /translation="MNNEGKGFTARDMEGVKFSQVPLTIGRPYVMTHQGKCEHKWRVRD
FT                   VRMPHSDDETRNEMFPLVIREGRVYRRGCSVCGVFDSSHVTYGDKLAAESPSFFCKLCF
FT                   DAVHCDVDGKLMYNDFEDYQYDHE"
FT   gene            <293533..>294315
FT                   /locus_tag="OSTLU_18371"
FT   mRNA            <293533..>294315
FT                   /locus_tag="OSTLU_18371"
FT                   /product="predicted protein"
FT   CDS_pept        293533..294315
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18371"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18371"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99915"
FT                   /db_xref="GOA:A4S8H7"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR008568"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8H7"
FT                   /protein_id="ABO99915.1"
FT                   /translation="MDASVVRLDAAIRAWVLLPITLAMFLVGALRHHAMRLTRDGGAAD
FT                   VVALREANVARRAERCRQFAGYLRPGAFAARRTFYCAADGGALRKKSEKASPHAAMLSD
FT                   PTVMTKMMTKNAMMMAPNMLTAAWVNFFFAGFVVGRTPFPLTQRFRGMLQRGVALQSLD
FT                   VTYVSSLSWYFLNFFGLGGVFQLVLGDNELDDAAAMQNAFASGLNADKAFAHALEGLEA
FT                   LKHEYMMHIADARATAMLRALNEGKSPREARLAAAAAR"
FT   gene            <294952..>297270
FT                   /locus_tag="OSTLU_27856"
FT   mRNA            <294952..>297270
FT                   /locus_tag="OSTLU_27856"
FT                   /product="predicted protein"
FT   CDS_pept        294952..297270
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27856"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27856"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99916"
FT                   /db_xref="GOA:A4S8H8"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8H8"
FT                   /protein_id="ABO99916.1"
FT                   /translation="MRTTHARGVTCAALERDYGARGRGRGGVAYGDDRGGVYVRVSTLL
FT                   GHKTLTLSAAGGSDRGAARAMEWSSRGVLAWACDEGVKLYDVGRDEKVALVERPRGSPA
FT                   AGMYAPHLTWNETSDMGKTLLVGWADCVKVVRIQKQDAPDSSVAAKLLRDKPTRGATRE
FT                   ITRADSFANGGSSEGDNASASEASSARVYVARVTSMFQTEYYVAGIQPFGDLLAILGWS
FT                   TDGDRKTGAHPELHLVTHANVTQNIDVIATRDDPTTLGCNAYGLACAQPMLDNGSFDRC
FT                   KHVGDHRWWKIGLEPRFYVYSPKDLIVAKATGARESIDWLSKQEDYVKLLDVCELASRY
FT                   GHIDGSVRDIGHSVLQRTFDERDYAQTAALCSKLLRKDAAAWETWIEKFMLARKLAELQ
FT                   PYIPTDDPTLSVHTYEVVLNAFLAEAEHHSRFLASVKAWPARLYSPQFLIPVVKSKLAS
FT                   LNTNAGSPSVASSVSSVVLKEALAELYLNDGQRERALNLYLDIGRPSVLSFIARHDLLS
FT                   FVARNKLSLLAQLDIDAAMSLFVQKRESLPPRVVIPELLGQGGFGARELTHAYMSALFD
FT                   EDPTCFEEFHDKLYELHLEFNPKALMNFLKKSASYDVARACALLTGNKALIFERVFLLS
FT                   KLGSHEEAVRVLVTDAKDLSGAIKLASELDNPVELWNVIIKVSTDSKDFMATLLAHAKN
FT                   LAGDPNAIALIHALREGVSIDNLKSRLVDLMDENIALTRSLRTSYASESKRARESYERK
FT                   TKVETRALRRHQIHVSRKR"
FT   gene            <297915..>298664
FT                   /locus_tag="OSTLU_27857"
FT   mRNA            <297915..>298664
FT                   /locus_tag="OSTLU_27857"
FT                   /product="predicted protein"
FT   CDS_pept        297915..298664
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27857"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27857"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99917"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8H9"
FT                   /protein_id="ABO99917.1"
FT                   /translation="MNARAPQKKLKASPLATASMNASLQKSVKKKPSAASPEKSKRSKN
FT                   SADLCAHITDLTADERLLVETGKGRRGEPMPTPLGWAYWTATSHETLRTIGNKIGLEPL
FT                   TLYSMNRWHHKLKNYDIDQEFTANSKLSLPVPPFEDWETEYIAADRTKIFTRLLDRIDE
FT                   VWPEVLRNAEPLRSLKREQLKTYPDSGTLYRQLRETLDNAEAAAKKFNDGDETLRDVQQ
FT                   CRKQLVTRWHRDGFLLPDEIAFKADDQ"
FT   gene            <299185..>300312
FT                   /gene="SDG3516"
FT                   /locus_tag="OSTLU_18374"
FT   mRNA            <299185..>300312
FT                   /gene="SDG3516"
FT                   /locus_tag="OSTLU_18374"
FT                   /product="predicted protein"
FT   CDS_pept        299185..300312
FT                   /codon_start=1
FT                   /gene="SDG3516"
FT                   /locus_tag="OSTLU_18374"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18374"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99918"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8I0"
FT                   /protein_id="ABO99918.1"
FT                   /translation="MTIPDAAVVNWNTAAAHPTLGSTFESLLRRGVVDERLAVMCFFMI
FT                   ERRRGEESAWKEYIDSLPRAYDAPLSFSDEELERELSGTTVYAPVKAQKAHVKKMFEEC
FT                   VRPAMRELTQADNAAGSSLHMLPDVSEKEFAWAFQTFWSRALAIPVGAGGSVTVDSVVP
FT                   GVDMVNHAPRARANARWEHVEDSSRPDGGYVALVSAPPNRTMKDGEEIFINYGDKSNEE
FT                   LLFTYGFALKDNAVEERMVFFPPWAGDAEHSEDVTRRIELLRAKGLPQHVVLPTTPPKR
FT                   GFRDMDATVQETLRIWCADVKDLDSRRRVDDATRRKIHNVLRASIGAQSHALRDVEREV
FT                   DHSIASAREIACDVYRRDIRRLYDNYIEAAARWES"
FT   gene            <300838..302711
FT                   /locus_tag="OSTLU_51596"
FT   mRNA            <300838..302711
FT                   /locus_tag="OSTLU_51596"
FT                   /product="predicted protein"
FT   CDS_pept        300838..302670
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_51596"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_51596"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99919"
FT                   /db_xref="GOA:A4S8I1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8I1"
FT                   /protein_id="ABO99919.1"
FT                   /translation="MTAYASKRPRGQFASRFADDEPRKGSDILVEALEREGVDCVFAYP
FT                   GGASMEIHQSLTKSATGIRNVLCRHEQGEVFAAEGYAKATGKVGVCIATSGPGATNLVT
FT                   GLADALLDSVPMVAITGQVPRPMIGTDAFQETPIVEITRQITKHNYLVMNVEEIPRIVR
FT                   EAFFLAASGRPGPVLIDIPKDVQQQLAVPYWEPKVSLNGYLSRLPAPPTSPQLQQVLDL
FT                   IKDSKRPVVYAGGGCLDADLELVEFCRATGIPVTNTLMGLGTFPQSDDLSLSMLGMHGA
FT                   VYANYAIDSADLLLAFGVRFDDRVTGKLAEFAKRAAIVHIDIDPAELGKNKKPFCSIFS
FT                   NIKPALKTLNKLIALEKDMPDFSEWRAAIDVQRKKFPFPIPEQVGDVIAPQAAIELLCK
FT                   MTEGKAIISTGVGQHQMWAAQHYKFDEPRNWLTSGGLGSMGFGLPAAIGAAAARPGDLV
FT                   VDIDGDGSFVMNIQELATLHAENLPVKCFILNNQYLGMVVQWEDRFYKANRGHTYLGSP
FT                   NDDFQVSKEEAHIFPDFVTISQGFRVPAERVMRMSDLEGAIKRMIEADGPYLLDVMVPH
FT                   VEHVLPMVPGGGTFADTITTGDGRSPEEKDMKTL"
FT   gene            complement(302753..>304034)
FT                   /locus_tag="OSTLU_27860"
FT   mRNA            complement(302753..>304034)
FT                   /locus_tag="OSTLU_27860"
FT                   /product="predicted protein"
FT   CDS_pept        complement(302805..304034)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27860"
FT                   /product="predicted protein"
FT                   /note="GO_component: - peroxisomal membrane; integral to
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27860"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00065"
FT                   /db_xref="GOA:A4S8I2"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8I2"
FT                   /protein_id="ABP00065.1"
FT                   /translation="MRRRGSATGAVARHARSYARQKPLGACRRQARAREGGTAREEAPR
FT                   GVSRVDALRHAGATWYEVFKQREARDEIASAFVAGAKIGTRFPRAPGRAARRAWATLKR
FT                   WRREAPVTPSAALRHAGGSWLDVLTHPEFKTQLGKTLARPFQPVWLRQGAIDAAEARAK
FT                   AKARDVIDPFGSLRHAGASRFAALTHEKVREYYWARVVAAYVRTVVRHPFSTAMFSSVT
FT                   KCVSSDIFVQMVLEEKSFFELDWNRVASFFVLGVTYVGAFQYRLYNHWLKPLNDVWRPK
FT                   YGLALSTGAVVAIDQAFVQPFLYLPTFLGIRVVSEGGTRLLDLPSEIFAKWKQTGPETM
FT                   TALWLVWVPAQAINFAVVPKHLTIPWMNAIGIAWNGVLSWMTGRYAAAEAAKRKVVDEE
FT                   VIERGEETAP"
FT   gene            complement(304205..>306239)
FT                   /locus_tag="OSTLU_27861"
FT   mRNA            complement(304205..>306239)
FT                   /locus_tag="OSTLU_27861"
FT                   /product="predicted protein"
FT   CDS_pept        complement(304242..306239)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27861"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27861"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00066"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8I3"
FT                   /protein_id="ABP00066.1"
FT                   /translation="MGVGVAFGVAALALVGGDGATGRAALGAFTDVPVACLEACRNATP
FT                   TLVSALEAEPMDCAAIQTTEEQQCVFTEPACGPGDTRVVEAIQHHCPDALEADPASASS
FT                   AALGRENVVEPGPTSLGTYRLAPRRVARSEETAALNPVNRSAYRSPGVGRLGKWDYSVA
FT                   RLPSRRERREERRFTLHTSCIDAKIRNKWPEIFGPDETLTHAYVVHHNMHDNDPNHGFF
FT                   ELHEGEEMINGAVNFLKCVSTKLGLVCPTSDGIFEVTTRGLNYEFGFVVKSENGKALYE
FT                   IGGNGAPLFERKCHDTQQFGAFWNRIVTLERNAKDISYVFGGCAASCPIPEFWCPEGSW
FT                   YLGGTCSLACPPGYGGSGSTPTTRRCTQCPTNCNKCLNGQCTECTNRKFLHNGECLAAC
FT                   PSGFRSGGSKRLVNVQPSDFDEFDTSEDALSRYSQPVFENGYPMIYFGHGYGVTGTAAA
FT                   EDVFHPALDDANDWNEAWIGATMDDRCQLDRYSAGRYCTFDRVNGDGAGSCCTAYGKTV
FT                   YISIVVEDSSSPEAADLVANAGFRTQVGYRSANGQWMNANSWLGSAGSPYGRYAWRNVT
FT                   FTLRVRRTGDTSLWIGHSLKTHGEPTRAADFTGNLPAAFGVEGANMGRFKALQVSKTGG
FT                   WAEGGAVASEISGAVKTERNWFTGRTCVAA"
FT   gene            <306616..>309624
FT                   /locus_tag="OSTLU_27862"
FT   mRNA            <306616..>309624
FT                   /locus_tag="OSTLU_27862"
FT                   /product="predicted protein"
FT   CDS_pept        306616..309624
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27862"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27862"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99920"
FT                   /db_xref="GOA:A4S8I4"
FT                   /db_xref="InterPro:IPR002719"
FT                   /db_xref="InterPro:IPR002720"
FT                   /db_xref="InterPro:IPR024599"
FT                   /db_xref="InterPro:IPR028309"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8I4"
FT                   /protein_id="ABO99920.1"
FT                   /translation="MSTIDPTARLDARGTHARADEVRALAKDLTETATRTRGASADADA
FT                   DAVNRAARACGTFAALGLVDAEDVVRDGKRGGAVDAAARGAGDVTAILEEHETTLVAVL
FT                   DALPEFLNAAARALAMRLRSHAPAGSSTVAEVERVLKIRELRSAFAFNKVIAKKFHEFM
FT                   RVHFDADSPAGVAVAKLGWALYVCAKCESLPTFPDLYSCYHLLVAVEAFLLINAPRESL
FT                   RTSLKNMVSMTAKDETTKLPDPLASLSLASKAKKDTVRAMSDAVLKVVKASFPEATMDA
FT                   SKHFDDVAPSDMCAQGVFDGERDVSASVVERYSRVASETFGRLAVDETLYLYTEMTSAE
FT                   SRGRKIIGDLADCKTTTTYGSMATPARRKRVAPFSPIRPKKIPIHGVPPSPMHSLRGIM
FT                   ASGVGGVAATPISQAMASASWLQDVVCGSSDLETKTAELQRFVPDNPEIVQALKKKVTN
FT                   FGQRIGQAIREDALVTTMRTDISPHSTVMDELVKQRTSEVSHVFFYFLNRILKDELERI
FT                   AGDKKDVNFTTLLASDRFTKSLVTCCMEVVVSTYKTSTLAFPATTHLMGIHPFDLATII
FT                   EPFVRADMSMPREIQRHFNSLEEKTLERLAWCKGSTLFEFLKTFHESARGSGGASTALP
FT                   GRTAPRSPQAPKRVSTPVLNVASVAEVAAIGGTEREGSSGDDADLVMAQCQSPVRRAPT
FT                   SAFSAFSSPLRGATTPRRRVSRGEPLPVRFAAVRNHTVEQPSGCDVCAFKALRMFFAKV
FT                   MHLAARRLGDLASRLNLSTDVTRDIYALIEHVVYEQTNLVYNRHIDQIILVSVYGVCKA
FT                   SAGISSNSLQFKDIIYQYSKQPQSSEEIFWAVVLEQNDPELEVVNRGDIISFYNKVFVG
FT                   RVKEFLLTLRERPARDTTNLDTDGGEQGNTVSVDDALPFGLSSPRRRLPIDNQNIYVSP
FT                   MRPERVASMLHEGAPPTPRTRSLFATIGESVYAYTSPSSDFEAINRKLLMDKPKPPKGR
FT                   FAPNVPKFGEHDR"
FT   gene            <309856..>310461
FT                   /locus_tag="OSTLU_27863"
FT   mRNA            <309856..>310461
FT                   /locus_tag="OSTLU_27863"
FT                   /product="predicted protein"
FT   CDS_pept        309856..310461
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27863"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27863"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99921"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8I5"
FT                   /protein_id="ABO99921.1"
FT                   /translation="MATSAIGAEMRGTTASSARRLLQQAETNDADADSQARIDRINWLG
FT                   RAVVENGAFQFWTKNASGYYTAVNDYYVKSFELESDADVVGKTDVQLIVLVAGDRTIED
FT                   FEDAKPDETLDSIASAYREHDMMVQETGKATRFNERVIADDRVYDVVAIKAPFEGGTVG
FT                   IAIPRNADDDINVVVTSESDDDESDDDESDDDESDDDD"
FT   gene            <311072..>311359
FT                   /locus_tag="OSTLU_27864"
FT   mRNA            <311072..>311359
FT                   /locus_tag="OSTLU_27864"
FT                   /product="predicted protein"
FT   CDS_pept        311072..311359
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27864"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27864"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99922"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8I6"
FT                   /protein_id="ABO99922.1"
FT                   /translation="MELERFLDAVSREAGEEVDLVTLSHWDVGAVEAWLAESADCEIRL
FT                   EPLRTGSAEDAQGMCQTTHRNSAWRAKGAARRSRAGFALTELGAKLERRR"
FT   gene            complement(<311411..>313438)
FT                   /locus_tag="OSTLU_18379"
FT   mRNA            complement(<311411..>313438)
FT                   /locus_tag="OSTLU_18379"
FT                   /product="predicted protein"
FT   CDS_pept        complement(311411..313438)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18379"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18379"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00067"
FT                   /db_xref="GOA:A4S8I7"
FT                   /db_xref="InterPro:IPR028386"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8I7"
FT                   /protein_id="ABP00067.1"
FT                   /translation="MDDRGEVAPTVDLKTARGETRAKDGAENDATDATGRDEREERGLT
FT                   KTLARGDGAVGTTTRLAQLRAARAAAAAAAAAGGKPAGAYAPRASRRERLRLRRGTGRE
FT                   VRARPFVIRVNIPGIMKQKSSSDMDVSNGSGGEAFSAPNGVSIVEIGEDSHASAGSGSG
FT                   SGGSNVNPFTVNTGSMDGPRPMFRPSTHILHDAAATPNGSKSKAGRLSSAGTPNAAEAL
FT                   AMMMHAEYPEGLPEEMQGVSHFANSQRDEPPLADFYGEEDMDLGYDDVAAYDDDGFPEP
FT                   PAPRKRTTAGVPHKRLRAEMERRKSLALAGLQATEGGVRRSTRQRSKPLEYWRGETKVY
FT                   QRVHNSLPTVTQIERRTANPIWPRKTPGGPSQPFRVSRLRPAEALRDLGGSLPDPSPLD
FT                   RRGVRYGLMPPPPPASWAERYGINPLSTSIAPAPGRGVPLMREEDVDEDALRGGAKKQK
FT                   KRGRKPKAIKEAEERAANEAFVASTVANIMSNVIAANRSPEEIAEDEAQASKDVIEAEV
FT                   VVATEELDDDEVERQAEREADEAVAEVERELAAELAAEAAAEAEEEGARSIEEERVVEE
FT                   APLDVSELEDVVELNTDFTRVHDAAEATTTTTTTSQVVEEPATVAAPVELDAREETPLQ
FT                   ELEMNDDPMDVDAPPSVLKATPSKTAADENVEPEAAEEEA"
FT   gene            complement(313848..>323439)
FT                   /locus_tag="OSTLU_27866"
FT   mRNA            complement(313848..>323439)
FT                   /locus_tag="OSTLU_27866"
FT                   /product="predicted protein"
FT   CDS_pept        complement(313891..323439)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27866"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27866"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00068"
FT                   /db_xref="GOA:A4S8I8"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011641"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8I8"
FT                   /protein_id="ABP00068.1"
FT                   /translation="MRVGDRARDARLRTLVRVALALFALAPSPRSSASAPGSEAAGARG
FT                   ARARDARRALGVRTTEAAHDDALTAWNASDESIVSPLRCQRRAVFGECVQEVGCGWCDS
FT                   RDVDGHNPTCYSLLDAALCVSHLPPVMNAPRVVNAVTNEIEIPCDPRCAAIGNAEHCAK
FT                   ADGCGWCAASSTCMSGSVYNGPCRTCAYNWTYSAPTPTCVGAMTGDGCATCGCENNGVC
FT                   AATSKECICPDAFTGSLCQFNTTTNNGRDACNGHGTWDATAKDCVCDRGWVGVGDNRCK
FT                   FSCSPSVDCNGNGYCSERDGTCVCDLGFAGESCSCLSQSLVSYPYPDALLNTNKTGCCP
FT                   YSYIECPSGSLNAGQCVIAPADTTKCPVESRDDGFLVFLGLLLFFLGMYLSAAIIAAIS
FT                   GHPDPTCTVVVRLPTIVRLRDSLFMRNIDDVNEMQTISLTCKLTDNFQKVKRMVCRRLK
FT                   HQPDPDSVDLFYLGCLVDPGWRLGDGINVAQTCHVHLKLRGNHETHKYTSKKKALKRLR
FT                   YIFSDNVIIFCLYFFFILSLSLCASTWSWDRKNDSGIPSPPPPPSPTPFSPPPFPPPPS
FT                   PPPSPAYPPPPPAAWIDLLNAQNTVNTNATFGTDSTFIGADQVGHIPTDILALESITVT
FT                   YATQLAVTSNSSGNVVNFYTYEDGPLWQRELPLFTSRSGIPFVANIFTVCDPRKAVEAT
FT                   FQVEMNAGYGVVSYQPKPNENGVDVFTFRGTVEYTVAQALGLDTDGTVDCSPAVLALYD
FT                   NSCTTDIKEARVDIAKRNDAPVAAGGEQILSYESTADIIPMRTQVDATATGSKLSRPMT
FT                   ATDIDGDRLTWTIRQQPAHGTLELPAGPVAYSSTFEYIPDINFTGYDYFIYSVDDSLDN
FT                   TPDTTLYDVASVVVAVGSATGKPVGVVSHYWVDEDTTMTGRFGRTIMASEYAGTLTYTV
FT                   TNAGVQNGTVTKLCNDVEVQYWWNCSVNTDDGNLNFQYFNYTPSANFTGTDSIEFSIVS
FT                   SYDSTLAASASVNVTIRPVNDPPFLANMEVNAVMNRDRAADDLGDADLTPITFSPYDVD
FT                   AGPYFRLFLTWKPIVTQSDWATRRRGRWYKSIDRFGRPVDEITAATLDQVGLLNNGTSI
FT                   TLYYLAPPLLYGFFPSTTLVRQNPLEKYAIRVVDDGSLVSAEATLNIHVGCALGYTTES
FT                   ASAVGDASNAKTYGTCTICPLGQVTDAINSHTCRACPVGMAGGTVQRGFCTRCSNGYYS
FT                   DTPGLETCISCPAGSTSVQGATSRDQCFCNIGWYGVPGYCFPCPEYSDSYGAPERWTYC
FT                   AETNLTVPYPQPGFYVVSPETRSYKQPISMRQCFPHKACPGVKGIAGSAQVDAIAAGGS
FT                   SADAVQCAEGYVHDACETCVTGYYRLNGQCLKCGSALGHTLYGAGVGLVMLSAILMPWL
FT                   IDEQSFRYIVYCRILSLVVFLQEVGIIGRYNLGWNDYPGLTLLLQLCYILQLNPEVIGL
FT                   ECLTEYDFVARWNSLMAMPAIGLALMYGIAQLYAYIWGKFYIKTQPSVEVVRNGQRRWV
FT                   LMLRSILNVIQITYVAVIIATFDFFIFHRSVTDKFGYIRAQPNLRFGYFSSTTGSTKWQ
FT                   QLFPLALIALLLYPIGFFAIMYWVIKYAMGGWEKLWKRDLIGFATFQFTDDYVWYRVNE
FT                   MARILALCLIQLLGYELRNGNGVVQALTALLVISVSFATVILRPFKTSEAKRYLGLHLL
FT                   AMVLVLMLSVISIAPVSYIINQRTKDNARNAVWQTIAVAVFVFCAGIFYEAYSSAEWFK
FT                   RADWHLRRAYKNFIARVISIVVSEHRSSQWLRERKWVEWKPTLSLLNPSAGAILQLESA
FT                   EGDQGLYFSGNFDMHLRMEFARGIRSLWRHKTVETILGTHDDRAKSFYKMLSRPVRQSL
FT                   IRAAAVDNRDMNRQVQLFIENKMIQKRYNFYRKFYRQAQKDLRGVSGAHNPSVERFLLR
FT                   DSTLARAKSHATQEKEKEDEEKQLAEYEVLQQADNVRRAFQTDVNDAADLDQEELFFQT
FT                   SEVSGRTHFVRFQGYFGDIHPDWDAYDESLAKAKAEAQDEDGDVLPWHLDLDDVYDDFC
FT                   CLCECEPGERCARHGNLYVVIQQDDEEVSRIKQERERHFRTRETIIIQEEDPDRSRDLG
FT                   WNVYVPVRLKEEVSSVHTKLATELRDMRDRGEFAGEDELPAVTGSKFDISHKGKLLDTH
FT                   NTVKLENLQWKAEVQLENRRGNLAKTTAWLILQDDPEEARDPDEDERMYARPDIEEGPV
FT                   LAQPVLQSNLVHENPEMTVLDLRRMLADSNSKPLERTILRYRNNGKELIQDAAPLTRKG
FT                   ISKPNHVLTSFEPEDGNYYVWSEIRNHWTFLEGLFKTYASIPSGPSDNETRVGADDHLL
FT                   MSYRQFMYLISSCKIEDKLPNSQYNQLSAVVRSVFDTVKAPELLAKCLTLDRETGSVEG
FT                   SLCPSEGPRLELRIKHAWGMHLDEFLTSLVFMAWIIYGHRVPLTDRGVARATRWLIERI
FT                   LRPKAHHIVEAYEAQARFATAMKKQGKSSDEDIRAVSTVYKAFTDKDGMGVMEFKAATM
FT                   WAVGAESPLNKFGELVFRTYSDFSTSTPDWVYHGARHGWVHAIDEKPDGYLCCQGSRLD
FT                   AKKFMLAFGDFCFRANPTVKPSEALQAQFKQAQERKPLAESPSVHAVLEEPSDELARKN
FT                   LVMPDSRCSICGMTDHEAPNCPRKKDVNCPNCGITVEPPNKIVIGPDDLEYCNECLRED
FT                   VPEDEPFVCPNCETPCEPEEVAISDVDGKKHCPRCAPEPFVCPNCETPCEPEEVAISDV
FT                   DGKKHCPRCAPEPFVCPNCETPCEPEEVAISDVDGKKHCPRCAPEPFVCPNCETPCEPE
FT                   EVAISDVDGKKHCPRCAPEPFVCPNCETPCEPEEVAISDVDGKKHCPRCAPEPFVCPNC
FT                   ETPCEPEEVAISDVDGKKHCPRCAPEPFVCPNCETPCEPEEVAISDVDGKKHCPRCAPE
FT                   PFVCPNCETPCEPEDVIKVDGGQFCPKCWSPQRKRSIPTCPNCDAPCTLNDIITGPGGK
FT                   DYCPRCVPEEEPEMDEAPRQASSKAPAPFECPNCSREMEPEDVMPGPDGNVYCAECFPD
FT                   EALDDDIDDEDYPSAPAFTKPKIEKAQRQRVARVRKVTKRRVDDDAPIAKPRAFTPSSP
FT                   PPPKPERERIARVRKVTTTVVDDESVARPRAFARAPSRADRERAEAASSASRLGKFFGF
FT                   GGASSSTARE"
FT   gene            <325182..>325967
FT                   /locus_tag="OSTLU_40737"
FT   mRNA            join(<325182..325298,325356..325457,325671..>325967)
FT                   /locus_tag="OSTLU_40737"
FT                   /product="predicted protein"
FT   CDS_pept        join(325182..325298,325356..325457,325671..>325967)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40737"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40737"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99923"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8I9"
FT                   /protein_id="ABO99923.1"
FT                   /translation="MCPGGASNPCSRNGLCDSASGSCFCNPGYVGSRCNAATIQRVCSG
FT                   RLDSSGSCVCLEGWSGVNCTVACAGTLTCKCGDHGRCNALSGECECDAGYAGELCERLI
FT                   EPQPTCANGGTWNAALKRCECAGGYTGTLCDAACTTNPCNDLCSGHGTVNVDGTSCTCF
FT                   TGFSGSTCN"
FT   gene            <346903..>349977
FT                   /locus_tag="OSTLU_27868"
FT   mRNA            <346903..>349977
FT                   /locus_tag="OSTLU_27868"
FT                   /product="predicted protein"
FT   CDS_pept        346903..349977
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27868"
FT                   /product="predicted protein"
FT                   /note="GO_function: - catalytic activity; GO_process: -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27868"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99924"
FT                   /db_xref="GOA:A4S8J0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8J0"
FT                   /protein_id="ABO99924.1"
FT                   /translation="MSPPTLDAALRRNARERPSAIACVLVPNAREKNRKCFFTWDELHG
FT                   VVDALARVLRADRHPRVLSFCRDGVEAFVALHACARARKSLVNVDAATPASRIRDVARD
FT                   ANATTCLCANDGDEDSVKSVLGEDGVAVRVWEVINAGAEAIEAEEDETREDDEIWIAYT
FT                   SGTTGKCKGAAATHRRAMAYARAKCEVEEIDACSRVCLASNATFDLWHGDACAAAAAGA
FT                   AVVVASRATFQHDFARVLREGEVTHVCCTPTMFSLARLPRGIVDAPKLRCVSLAGERMR
FT                   ESTIALWADDVALYNVYGATETTVVQTYARMRNAEDESTNRAGKAYEGFASVFVVDEMR
FT                   EGELAVQSFAQRRGVEGEVAIGGICVADGYLNDPERTARAFVHSPFGTVYLTGDRGYID
FT                   DAGDLYLRGRLDRQVKIRGHRVELDEIEAALRSCPALCDDAVVFYDANEGVLTSHARAA
FT                   SPTFDASSDADLYAFALERVVELRLPRHMVPRRHVFIEHARWPLTSSGKTNRQILLQWF
FT                   ASGETKAFRPKREKPQAGLETVVANAWAVALGHGDASDIGALDAFDALGGTSLNVLAVS
FT                   KALASDDGIVRSRDTARGEIVREARIGLRDGEAAALLNDGEEPAACAFDVIDGPFAPCE
FT                   IFARPVLRDYVDYLRAQGIDADVNAPASTAVEPQRDTSANRRMLAACGRGVAPVVRALL
FT                   ATGVEASGEHLRAAAASLADEAVDVVQTLLAAGADASSSSATAGTLATHVAAARGNSEM
FT                   LEMLLAAGAPAGAKDADKQTICHLAVRSGDVSTVRVAANACKHLKTRKGGLESWDRWKR
FT                   TPAAWALVAGSSEILAELRDAGANLTSLETDVSNAWVHGSLSAKSEVQLAHRPVRKRGA
FT                   AAEVLSALAARLDAANVESERIEAATAIRELVCANAENREKARTIGLVPKLCELARDRH
FT                   CVEAIGALRNLATNTSAAGAAGDAGAMEILGDVIRARAKLKDSELSADDRRVVYAAASA
FT                   MRALAVKHDANAARLRASRDVADVVSRLCEGMRLE"
FT   gene            complement(<350015..>352507)
FT                   /locus_tag="OSTLU_25613"
FT   mRNA            complement(join(<350015..351126,351334..>352507))
FT                   /locus_tag="OSTLU_25613"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(350015..351126,351334..352507))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25613"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25613"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00069"
FT                   /db_xref="GOA:A4S8J1"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8J1"
FT                   /protein_id="ABP00069.1"
FT                   /translation="MASKQERLAGRIAHAATTAPDATSRGLMRASLAFLPRGGGNGDDI
FT                   RMGILNIMRTHGIKEGHRPGIEDPFIAQWHQKLHSNTTPDDVKICEAYLHFLHTGNWDD
FT                   FWAHLWDNAGLTREDLAGMKAGWRSDGIHGPAFHMPQMIDSFKHYLWVLKTTHSGGDVD
FT                   SAMNFARNGLPGDLAWEVDDLLQNRDAWWVPGKIIEVRKKLLGVWQHDSPNRDVVMLDA
FT                   TLEKFFRTKVEAVDYGAMSSDDLLSLLELSLTNVALTNESTRIGEGLKFLQVAMGDGHG
FT                   ERWGADWSKTMDAALDFCALAMESDMDFLCRATQNAADIIASKSTKADPKYLINFGEEN
FT                   VRSHSLFVVSQLISTLRPAVRAAAGRSPWQIVSVGDASLETYAGMAKVQTLKMAGENVR
FT                   FSIAGEDVQIDKANVSDATTTASAKATTKVSIAPYKPSDAWLITPDAYSSDIVGGKSNS
FT                   LSEMAKELAAMNIANVDVPGSYALPFGTFERALEEDVDTRTALEAAVAAIETATTAEDR
FT                   RAALADAREIIATRLVCPQGLESALDEAAAKLSPSVDLPRLWDAVCGVWASKWTERAWL
FT                   SRKSCGIDDKDLNVAVLLMELVDAEFAFVVHTANPVTGDADEIFGEICVGLGETLVGND
FT                   AGSALGFTVSKTTGEVTLRSLPSKLCGHFAPSGGTVIARSDSNGEDLENFAGAGLYDSI
FT                   TAEPTEERVVDYTASSIVWNSLAREAMIRRISDIAKSVESYRGSPQDIEGAVVGDRIVL
FT                   LQTRAQIC"
FT   gene            <354537..>355241
FT                   /locus_tag="OSTLU_27870"
FT   mRNA            <354537..>355241
FT                   /locus_tag="OSTLU_27870"
FT                   /product="predicted protein"
FT   CDS_pept        354537..355241
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27870"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27870"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99925"
FT                   /db_xref="GOA:A4S8J2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8J2"
FT                   /protein_id="ABO99925.1"
FT                   /translation="MKLRVLKNVCIREARKDANTGVNVLTLSDGTTIEVDAVVAAAGVE
FT                   PRCDWLDEVAAPRSKSDGGILVDACMRTVGPYGDSIFAVGDACTMSARASNPETPWFQM
FT                   RLWSQAAQTGAFAAKVAVGVCDADALGFNFEIFTHVTRFFGLKVILLGLYNAQKLDDVP
FT                   ANEVTTYQRESLADATYVRVLLVRGRMMGAVLVGDTDLEETFENLILDGVDLSRFGPSL
FT                   LDPELDLEDYFD"
FT   gene            complement(<355324..>355680)
FT                   /locus_tag="OSTLU_40562"
FT   mRNA            complement(<355324..>355680)
FT                   /locus_tag="OSTLU_40562"
FT                   /product="predicted protein"
FT   CDS_pept        complement(355324..>355680)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40562"
FT                   /product="predicted protein"
FT                   /note="GO_function: - electron transporter activity;
FT                   GO_process: - electron transport"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00070"
FT                   /db_xref="GOA:A4S8J8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8J8"
FT                   /protein_id="ABP00070.1"
FT                   /translation="IEVTFVERDGERRAVRGLIGENLLETAHRHDVELEGACEGSLACS
FT                   TCHVVFEDEKVFETLPEACDDENDMLDLAYGLTATSRLGCQVTLERGALEGCVVILPRA
FT                   TRNFAVDGFVPKPH"
FT   gene            complement(<356284..>357702)
FT                   /locus_tag="OSTLU_89316"
FT   mRNA            complement(<356284..>357702)
FT                   /locus_tag="OSTLU_89316"
FT                   /product="ZIP family transporter: zinc ion"
FT   CDS_pept        complement(356284..357702)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_89316"
FT                   /product="ZIP family transporter: zinc ion"
FT                   /note="GO_component: - membrane; GO_function: - metal ion
FT                   transporter activity; GO_process: - metal ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_89316"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00071"
FT                   /db_xref="GOA:A4S8J4"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8J4"
FT                   /protein_id="ABP00071.1"
FT                   /translation="MGAALGGAAVVSSALAARGALASGAHAHSFEWAGIFETPDDAYVW
FT                   QAEKVKDQYADATMKMVIYAETAAGHEELEAREDAGEAALETACTTVKTRNSVLTPGSG
FT                   CVKLQFDNAWHTSSFKIDTTGVAAVSIFAEHVPTEFERDTHYLKDVNGDDVEPVASLPE
FT                   TVTTKKSKPWSDAIGAAIIVNIVTLSGVIFLSPSFAKKQKAYPEFVSCIINSFAAGALL
FT                   SAAFYLMLYEATHLIKPAGSDESQQTAWWASASVFGFLVAYIIDLGISIAFPSRLAETK
FT                   TIDAENAIKGVQEDCETCHSHKYRVRSGIILGDFMHNLVDGIFIGFGFLNCGKTMGWSI
FT                   TAATVYHEIAQELADYLVLTDPFQGDLTPFRSLFMNFISGVSVILGVLISVGSGSNNDF
FT                   WHGLLLAFGAGIYLQIAAAECMPRVSVSATTSRLRAASLLTFVVGVVAVSLVLLNHKHC
FT                   TAGGGGGHSHGHAH"
FT   gene            <358018..>358680
FT                   /locus_tag="OSTLU_27872"
FT   mRNA            <358018..>358680
FT                   /locus_tag="OSTLU_27872"
FT                   /product="predicted protein"
FT   CDS_pept        358018..358680
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27872"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27872"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99926"
FT                   /db_xref="GOA:A4S8J5"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8J5"
FT                   /protein_id="ABO99926.1"
FT                   /translation="MTTVGGAARRDDRGSALPPRCVEIARESPSASPSRRKTPANDRAV
FT                   NRAAVRRYRERKRMDEKERIEECERLRGENETLRLALETSRAELKHSRWLLRVVAWKYD
FT                   LDLADIPTEKPSTSTMPQGRVRGSDANAVFPAGGVPARNDIARPFAARGVAETRPRKIP
FT                   RAADDDAKPAGAPDELELKDFLEEYFTHGDACPCYEITDADARAAPTRGADARHAWF"
FT   gene            <358953..>360167
FT                   /locus_tag="OSTLU_40657"
FT   mRNA            <358953..>360167
FT                   /locus_tag="OSTLU_40657"
FT                   /product="predicted protein"
FT   CDS_pept        358953..360167
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40657"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40657"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99927"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8J6"
FT                   /protein_id="ABO99927.1"
FT                   /translation="MADEQDQTSRVPVTILTGFLGSGKTTLLNEILESETHGLRFAVIE
FT                   NEFGEVGVDERILSEKADEEIIEVMNGCICCTVRGDLVVALKKLYSKIAQFDAVIIETT
FT                   GLADPAPVAQTFFVDDDIREKFVLDGIITVTDAKHILTRLDDEKPEGVENEAAEQVAFA
FT                   DRILLNKTDLVSEDELETITGRIKQINPSADIFRCQYSKVDPKNLIGINSFSLEKTLKM
FT                   DPEFLNTEGEHEHDPTVSSTSTKFSGHLNINKLERWIGEIIQTMGADLFRYKGVLSVAG
FT                   MDQKFVFQGVGMLFSGGFVDAKWGADEERECRFVFIGKNLDKDALINGFMDCKCSSKLR
FT                   FKVGDAVLAQVGAADNDGYCRGTVRKTWDSGNPYQIELEDGKKTKVWGPVDEDEFVKAS
FT                   LSATA"
FT   gene            <360635..>362359
FT                   /locus_tag="OSTLU_18387"
FT   mRNA            <360635..>362359
FT                   /locus_tag="OSTLU_18387"
FT                   /product="predicted protein"
FT   CDS_pept        360635..362359
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18387"
FT                   /product="predicted protein"
FT                   /note="GO_function: - disulfide oxidoreductase activity;
FT                   GO_process: - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18387"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99928"
FT                   /db_xref="GOA:A4S8J7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8J7"
FT                   /protein_id="ABO99928.1"
FT                   /translation="MCGACRARRASARETTTRAEFCAPCRDGARATTTRATRVADGASF
FT                   DVVVCGAGAAGTSFARTYLETTARGGDGDGDGDGDGDGARGARLLLLDRGGCAKTVERV
FT                   ERVTRRASVYGAREDALGALEALGARTATASVAACDAESKTLTLDDGARVRYGALCVAT
FT                   GATPRCPLPEASDGAVDAHEVRDVESADALARRLSSMTATASADSDSKTKRIAIAGNGG
FT                   IALELVDALCVRGLRARGLEACELVWLVKHGEVGDAFFDVDAADFLLRALDARRRDGEA
FT                   KDDDGADVDWDSPTPERGAGRSTKKRARGRESGAAAGPDWLDRFRAKSAADDARAPLSR
FT                   MKLRVLKNVCIREARKDANTGVNVLTLSDGTTIEVDAVVAAAGVEPRCDWLDEVAAPRS
FT                   KSDGGILVDACMRTVGPYGDSIFAVGDACTMSARASNPETPWFQMRLWSQAAQTGAFAA
FT                   KVAAGVCDADALGFNFEIFTHVTRFFGLKVILLGLYNAQKLDDVPANEVTTYQRESLAD
FT                   ATYVRVLLVRGRMMGAVLVGDTDLEETFENLILDGVDLSRFGPSLLDPELDLEDYFD"
FT   gene            complement(<362445..>362798)
FT                   /locus_tag="OSTLU_8463"
FT   mRNA            complement(<362445..>362798)
FT                   /locus_tag="OSTLU_8463"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<362445..>362798)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_8463"
FT                   /product="predicted protein"
FT                   /note="GO_function: - electron transporter activity;
FT                   GO_process: - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40562"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_8463"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00072"
FT                   /db_xref="GOA:A4S8J8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8J8"
FT                   /protein_id="ABP00072.1"
FT                   /translation="IEVTFVERDGERRAVRGLIGENLLETAHRHDVELEGACEGSLACS
FT                   TCHVVFEDEKVFETLPEACDDENDMLDLAYGLTATSRLGCQVTLERGALEGCVVILPRA
FT                   TRNFAVDGFVPKPH"
FT   gene            complement(<363335..>364252)
FT                   /locus_tag="OSTLU_27876"
FT   mRNA            complement(join(<363335..363706,363980..>364252))
FT                   /locus_tag="OSTLU_27876"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(363335..363706,363980..364252))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27876"
FT                   /product="predicted protein"
FT                   /note="GO_function: - protein tyrosine/serine/threonine
FT                   phosphatase activity; GO_process: - protein amino acid
FT                   dephosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27876"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00073"
FT                   /db_xref="GOA:A4S8J9"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8J9"
FT                   /protein_id="ABP00073.1"
FT                   /translation="MPHVVDSDDDAPPPRAAWCRACGHDHAPGTTCGVCGHHRRVDDDL
FT                   DDLPRPRLGHDEPIIEVIDKFLCLGAFEHTSKEDVLLACGIRTVMNSVPQCTPCCSSRQ
FT                   IDVFTAPRNANDGTKLDLGETVRKLEQLHVKAKRADEAGVPNRVLVYCMSGHSRAPSVA
FT                   VAYLMYSERRKLEDAMRALERRYPRGHKGIKLKPSDLATLEEFERELYPNE"
FT   gene            <364598..>365095
FT                   /locus_tag="OSTLU_18389"
FT   mRNA            <364598..>365095
FT                   /locus_tag="OSTLU_18389"
FT                   /product="predicted protein"
FT   CDS_pept        364598..365095
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18389"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18389"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99929"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="InterPro:IPR037047"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8K0"
FT                   /protein_id="ABO99929.1"
FT                   /translation="MLDLIDHVDERSVECLNALTDESWRNALWPGPRDRASSTLVSDDD
FT                   EELILRVEFTSNVRPRAVKIAGASATHAREDASAPRVVKIFVNAPSLSFENAAKRRAAQ
FT                   VVELDGDDEVELDVTAFENVRVMTFYVESNVGGTARTEIGRIDIKGELSGELRDVSELK
FT                   PC"
FT   gene            <365468..>366952
FT                   /locus_tag="OSTLU_40743"
FT   mRNA            join(<365468..365627,365676..>366952)
FT                   /locus_tag="OSTLU_40743"
FT                   /product="predicted protein"
FT   CDS_pept        join(365468..365627,365676..366952)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40743"
FT                   /product="predicted protein"
FT                   /note="GO_component: - clathrin vesicle coat; GO_process: -
FT                   intracellular protein transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40743"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99930"
FT                   /db_xref="GOA:A4S8K1"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8K1"
FT                   /protein_id="ABO99930.1"
FT                   /translation="MSSAPAPPVRVGHALSGIFVINLRGDVLLMRAYREDIERHVLDAF
FT                   RTQILNPRDDGFATEAPVRRIGSVTYMMKRSRDVYVVGIARGQGERGGPGDANLMLGFT
FT                   FLGHVVRLCNQYFGACDENAIRGNFVLMYELLDEICDDGYPQITAGETLKTYITQKGSK
FT                   LEGAIGKEAMERSAAEDQRRAMEAAKQVTSAVQWRREGLSYKKNEVYLDIVESVNLMMS
FT                   AEGTVLRANVQGSIYMRTFLSGMPNLSVGLNDRLGETTRVTSRGEDAETSAARDRRLID
FT                   LDDLQFHQCVRLDKFSAEKVIEFTPPDGEFELVKYRVSDNITLPFKLMPVVKELGRTRL
FT                   AVTVNLRSLYGPTTVANEIKVRIPVPKLTARATINVSGGKAKYVPEEGCLRWKIKKCAG
FT                   HEEYQLDAEVLLANTLEDHKPWVQPPINIAFHVPMFTASGLRVRFLEVKEASNYDVVRW
FT                   VRYLCQSGGSSSSSYEIRCA"
FT   gene            <367110..>367283
FT                   /locus_tag="OSTLU_27879"
FT   mRNA            <367110..>367283
FT                   /locus_tag="OSTLU_27879"
FT                   /product="predicted protein"
FT   CDS_pept        367110..367283
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27879"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27879"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99931"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8K2"
FT                   /protein_id="ABO99931.1"
FT                   /translation="MSMFTTRASSFAVGFAVASAGGFYVIKEEIQKNHEALARECSTLC
FT                   DRVKALEARVGK"
FT   gene            complement(<367349..>368980)
FT                   /locus_tag="OSTLU_27880"
FT   mRNA            complement(<367349..>368980)
FT                   /locus_tag="OSTLU_27880"
FT                   /product="predicted protein"
FT   CDS_pept        complement(367349..368980)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27880"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27880"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00074"
FT                   /db_xref="GOA:A4S8K3"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8K3"
FT                   /protein_id="ABP00074.1"
FT                   /translation="MSINKIFLIAVYHDQLDDVIALSLEGKIDPALACVDGLDALSVSV
FT                   LSPFASPSTTLWLLANGCDAFKVSPIGVSAAMLVCCDAKTSDMIVETVVRAANTPSKQI
FT                   HLVDCAARWQRCDILMRLADGEKTIGSPVRRRIANATFAMDIDRWNETWIESILDEVGD
FT                   ADRSTSHVAAFVGNRQPFESARCVVNRRDSLQRTPLMYAIDGRQDVDFVEFLIHLGADV
FT                   NAKGAHGSVLQHACRIGRHSIVEALLRTPGIRVDDFALHTAFGFGVELRTVEALCAAGG
FT                   DLNVRCRPHGWLPVHYLADSMTRDAVRQPGRATEMLASRMKLMTFALDAHENDGDDEVR
FT                   CSSGQTLLMLACAHSNAPLARMILRRAKDPAKLTALVDSRGRTAYHWACHRNATEALEV
FT                   LKEFDVIRVVREIVDNDGQSGEALLAASIDTPRKHRSWPDPIERGDVLGTRERDTDADI
FT                   ASAIGAASALCARHFDLAQLPRKPKTCAGCFRLTTSPKRCARCKSEIYCSSACQRLSWP
FT                   THRALCVDAFPTLRETLLSTPSVEPR"
FT   gene            complement(369022..>369712)
FT                   /locus_tag="OSTLU_27881"
FT   mRNA            complement(369022..>369712)
FT                   /locus_tag="OSTLU_27881"
FT                   /product="predicted protein"
FT   CDS_pept        complement(369059..369712)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27881"
FT                   /product="predicted protein"
FT                   /note="GO_component: - proteasome core complex (sensu
FT                   Eukaryota); GO_function: - endopeptidase activity;
FT                   GO_process: - ubiquitin-dependent protein catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27881"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00075"
FT                   /db_xref="GOA:A4S8K4"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035206"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8K4"
FT                   /protein_id="ABP00075.1"
FT                   /translation="MDVVFGFVGYDFAVLVADRAATQQIIVQKLDEDKIVELDSTKIMA
FT                   LSGPKGDCVAFGEYLRANVRLYRLKYGHELDVSATAHYARNELAEALRSGPYQVNCLLA
FT                   GFDKLKNEPELHFMDYLATCHRVNTGGHGYGGMFCLSLFDKHWVPNMSRAQAMDLVDLC
FT                   VGEVCERLVTAPTDYLVKIVDKNGCETIVYDATDRLKKRRDLMADVAARMASMN"
FT   gene            <370006..>370605
FT                   /locus_tag="OSTLU_40630"
FT   mRNA            <370006..>370605
FT                   /locus_tag="OSTLU_40630"
FT                   /product="predicted protein"
FT   CDS_pept        370006..370605
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40630"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40630"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99932"
FT                   /db_xref="GOA:A4S8K5"
FT                   /db_xref="InterPro:IPR006811"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8K5"
FT                   /protein_id="ABO99932.1"
FT                   /translation="MSAERKRYAVVCAANFNRSMEAHKVLAERGLDVASFGAASRVKLP
FT                   GASRDDPNVYDFDSITYEDIASDLERQPRETVENYEARGMFEMLRRNAKIKPAPQRWQT
FT                   HSDRERFDVVVCFEERVFDLVMEDLRAKGGAREGVLVVNLDVRDSHDSSVDAAPRALRL
FT                   CEALEASEDWESEVDEIMNAFEEAEGMRPLYGVCYY"
FT   gene            complement(<370654..>372387)
FT                   /locus_tag="OSTLU_51587"
FT   mRNA            complement(join(<370654..371721,372112..>372387))
FT                   /locus_tag="OSTLU_51587"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(370654..371721,372112..372387))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_51587"
FT                   /product="predicted protein"
FT                   /note="GO_function: - amino acid binding; GO_process: -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_51587"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00076"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR040217"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8K6"
FT                   /protein_id="ABP00076.1"
FT                   /translation="MSRAPSAPRARDASARARAATIADDAADDERCVAYAALDDGADAV
FT                   PCAEFRVTCPDKTGLGADICRVVFEFGLVVTRGDFTTDGVWALVLLTLEESIAPRTCVV
FT                   DWELLRQRLELLCPHKSTISTIPSVESFEMLEQMHANQSLYILQVEAHDRVGLLHDVTL
FT                   ALWELQLTVHRAHVTTAPCGKAVDLFYVTDDLHELPNPSRVGDISRRVKPVVARTPEAL
FT                   NRVNILVHPAPSFVTRQGRTKTLRESSGMIVTEAKPPVFDYETTVEVDNLMSPAHTVFQ
FT                   IRTRDRQGLLYDCLRVSKDLKVSVSYAKIEIVDDSICEVALFTRNIENEEQMEYLCAKY
FT                   KEHVDRPLKVEMLCHKGESMTSELRVVAPLDISGHTRPRVLLDVTEALQALNVMVFKAD
FT                   ILIDPRTVENFIQDEVHRFLLTDFNGEPISSPKARQEVCDSVIYTLLR"
FT   gene            <372530..>374176
FT                   /locus_tag="OSTLU_89323"
FT   mRNA            <372530..>374176
FT                   /locus_tag="OSTLU_89323"
FT                   /product="predicted protein"
FT   CDS_pept        372530..374176
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_89323"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_89323"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99933"
FT                   /db_xref="GOA:A4S8K7"
FT                   /db_xref="InterPro:IPR009637"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8K7"
FT                   /protein_id="ABO99933.1"
FT                   /translation="MRAVARSLLLWLTLAPTLARASAHAYARDSLYATNDAAILVAGAE
FT                   GVFASRVRLERETTDVRKRWLGANPRVADGRAYVRLDALTFERPRETARARGATGGASG
FT                   LVEAATFKREDVDRIGVWDDEAGARKFCCTGDMAKRGLCEKGEVGRLVVRGRGDGGATA
FT                   PWKTEIWFEGDDVEARSDVQAVSVRETGMYYMWFVVCDPEHAGVTVSGRTLWKNPDGYL
FT                   PGAKTALLPFYGFAAMAYLGLGFAWAMAYVGNWRHVLELHNCITVVLALSMCETAVWYF
FT                   DYANWNATGYRPYVFTVVAVLLGSLRTTLSRTLVLMMSMGYGVVRPTLGGLNAKVVSLS
FT                   VCYLFSTAVKDVVEHVGSVDDLKPGARLFLVLPVSVFDSVFLIWIFNSLSRTLTQLVLR
FT                   QQKQKLSLYRAFTNLLAANVVLSVGWLAYEMWFKSTDMIEEKWESVWMLTAFWQALSFG
FT                   LLAGICFLWRPASESTQYAYSELANDISEDAWWGELITNDDIEQFAGSSKMSKSPRVMN
FT                   SAKKTRAMNDFSLDADDDSAAEIEMEMGKID"
FT   gene            complement(<374279..>374758)
FT                   /locus_tag="OSTLU_18395"
FT   mRNA            complement(<374279..>374758)
FT                   /locus_tag="OSTLU_18395"
FT                   /product="predicted protein"
FT   CDS_pept        complement(374279..374758)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18395"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18395"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00077"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8K8"
FT                   /protein_id="ABP00077.1"
FT                   /translation="MGLLYVVGELFAFHATLCWRRMSTYEYIVAERAIAADARAAAIER
FT                   GEDGSDIQVRTSVCRLCRLPEAYAPDREKTAPKTPKAPRAIKTKAAEPPPPSASAKERG
FT                   GLFSPFKARANKSKVFTDEPDSPPPVKREEALGHFDETLQALSDARGASRKGGRK"
FT   gene            complement(<374939..>375097)
FT                   /locus_tag="OSTLU_10632"
FT   mRNA            complement(<374939..>375097)
FT                   /locus_tag="OSTLU_10632"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<374939..>375097)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_10632"
FT                   /product="predicted protein"
FT                   /note="GO_function: - metal ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_10632"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00078"
FT                   /db_xref="GOA:A4S8K9"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8K9"
FT                   /protein_id="ABP00078.1"
FT                   /translation="DDAALYCGRCDASVGRRAKHCRDCDKCVDDFDHHCKWLNNCVGGR
FT                   NYGAFLAL"
FT   gene            <375727..>375963
FT                   /locus_tag="OSTLU_27886"
FT   mRNA            <375727..>375963
FT                   /locus_tag="OSTLU_27886"
FT                   /product="predicted protein"
FT   CDS_pept        375727..375963
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27886"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27886"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99934"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8L0"
FT                   /protein_id="ABO99934.1"
FT                   /translation="MEAADAARVEAEARARRAAAASEASEAKTAKNRAKRAKAKAKRAA
FT                   KRRRGGGGATIGEAKADEEEEEEEAEATATALD"
FT   gene            complement(<376046..>377359)
FT                   /locus_tag="OSTLU_93811"
FT   mRNA            complement(<376046..>377359)
FT                   /locus_tag="OSTLU_93811"
FT                   /product="predicted protein"
FT   CDS_pept        complement(376046..377359)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93811"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93811"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00079"
FT                   /db_xref="GOA:A4S8L1"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8L1"
FT                   /protein_id="ABP00079.1"
FT                   /translation="MRAFAARALAPRAIDRGHRARLKRASSRVEASAGRRGARSFADAR
FT                   AAVGCDASPRARPAASRARRERPSTRRRATASSEDPAARDGEDARPELEDTIAPLSDAL
FT                   YPRALDAVPTFFGRLNPLTAVLLFYTGAMLRESREAPIIGAQWLLLVVLPTFGALYALR
FT                   RWWYENKTSPRHEGEHRPFAFNRACRSAWLDFHVGYMLLVPAGAYGGEGSSWWVMTAPI
FT                   LMALRWLGGRRGKIFKTARRACVVVFGVVGLATLLLSTSTTLTKALGALRGGGAVGFIL
FT                   GPFAMAMAYVFYVAPACLLPRAIARAWTNTLDDAPIAETSEEDKNKTPEQIAKEKRKKR
FT                   VNLIVGFVAFGATLATGSDLPLLILFAFQLLKVDPEDFVNAIINKGSPERMEMEQAIAD
FT                   KFAGVFADTKTEASKTDADDASADDARDPTTTTTTPAA"
FT   gene            complement(377515..378636)
FT                   /locus_tag="OSTLU_27888"
FT   mRNA            complement(377515..378636)
FT                   /locus_tag="OSTLU_27888"
FT                   /product="predicted protein"
FT   CDS_pept        complement(377579..378472)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27888"
FT                   /product="predicted protein"
FT                   /note="GO_function: - catalytic activity; GO_process: -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27888"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00080"
FT                   /db_xref="GOA:A4S8L2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8L2"
FT                   /protein_id="ABP00080.1"
FT                   /translation="MTTSTRVERGARTTAAKKTTKTTRRATTTRANAGSNTKNARFALL
FT                   FDCDGVIVETEELHRLAYNGAFEAFDLKIDGEGVEWVVKYYDVLQNTVGGGKPKMRWHF
FT                   NEDKKAWPTSTMFAEAPSSDADRDALIDALQDKKTEIYKKIVEEVAVARPGVLALMDEA
FT                   IADPSIAVGICSAATKAGFEKVVNSVVGVERLSKLDVLMAGDDVTRKKPDPLIYNLARD
FT                   KVGLPASKCLVVEDSIVGLRAAVGADMACLITPCGSNIGADFMGEGASKVVNDLGAVKL
FT                   AMLFPEGAETPAFDGL"
FT   gene            378687..>379194
FT                   /locus_tag="OSTLU_27889"
FT   mRNA            378687..>379194
FT                   /locus_tag="OSTLU_27889"
FT                   /product="predicted protein"
FT   CDS_pept        378700..379194
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27889"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27889"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99935"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8L3"
FT                   /protein_id="ABO99935.1"
FT                   /translation="MRASRGDDAPALPGRAVAVDEDKKSIDNDANKRAVKRYRDRQRDA
FT                   KMKLESENAALRVETTRLATELAHARWVLDAVASRCGMKRRATGRDADAALRRSVARVI
FT                   HGAGCPLGHQGRDRPFRLDATEARRREDEDEDELAAFLKEFLVHEDGKCPCPGRARDGG
FT                   E"
FT   gene            complement(379431..381276)
FT                   /locus_tag="OSTLU_27890"
FT   mRNA            complement(379431..381276)
FT                   /locus_tag="OSTLU_27890"
FT                   /product="ZIP family transporter: zinc ion"
FT   CDS_pept        complement(379676..381082)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27890"
FT                   /product="ZIP family transporter: zinc ion"
FT                   /note="GO_component: - membrane; GO_function: - metal ion
FT                   transporter activity; GO_process: - metal ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27890"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00081"
FT                   /db_xref="GOA:A4S8L4"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8L4"
FT                   /protein_id="ABP00081.1"
FT                   /translation="MARVARGDETPVDHILETYNDDNDDATMDAHELSELFERFAARTS
FT                   GAGAGADSHAGHAHASAGHAHASAEETLTNVSSADVITTYAGADQKLNETELLSALSLA
FT                   ARCLSESTCTFIASEAESAAAATGGLKHFKLKMGLMVAVFFEGLAGGMLPSLFVRTLPK
FT                   MQSALEFMNAFSGGLFLASGFVHLVPHALESATEARIGTAKEYPFAMVMVMLGFLIAFF
FT                   VERVVFHTHSHVTESEGDGEHGHGHGHGHGQSKEHHVDAAVVVVVDKASTDACDTCAHD
FT                   EKGRHVSIFAQTRTALLFMAGVALHASLAGVSLGLQSDRNSVYAIFTAIASHKAAAAFS
FT                   IGCAFLRCGMTNPQTLFIFMTAFSFITPIGILIGCAAESAHSPAVSAVLEGIAAGTFIY
FT                   VGTVEVIGDEFETQTQSCEDEHGHDHKLAPHTHTVHEAPARGMRIYKFVCYTAGVLVIA
FT                   LAQLGVEHAH"
FT   gene            381693..383148
FT                   /gene="lhcb4"
FT                   /locus_tag="OSTLU_27891"
FT   mRNA            join(381693..381853,382260..382345,382429..383148)
FT                   /gene="lhcb4"
FT                   /locus_tag="OSTLU_27891"
FT                   /product="possibly CP29, chlorophyll a/b binding"
FT                   /note="Has EST support"
FT   CDS_pept        join(381716..381853,382260..382345,382429..382987)
FT                   /codon_start=1
FT                   /gene="lhcb4"
FT                   /locus_tag="OSTLU_27891"
FT                   /product="possibly CP29, chlorophyll a/b binding"
FT                   /note="GO_process: - photosynthesis light harvesting"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27891"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99936"
FT                   /db_xref="GOA:A4S8L5"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8L5"
FT                   /protein_id="ABO99936.1"
FT                   /translation="MFKTKAPAPKTAVKKSAPAKKAPAKKAPAKKVAAKKAPVRKAGDD
FT                   ELWRPGAVRPAWLDGSLPGDRGFDPFNLSKPIEYVQFDLDALDGSAATNPAGRVIGKLK
FT                   KTDNKPKARAIVPYDESFDIMRFRECELLHSRWAMLGLVGATAAEAATGISWADAGKVE
FT                   LEQPQYLGFPLPGLSVASLTAIEVLAMGYLEVARSAELDQNKRMYPGGAFDPLGYVANA
FT                   DAEEEFRLKTAELKHGRLAMVGMLIISIEAAAGHGVLP"
FT   gene            <383587..>384177
FT                   /locus_tag="OSTLU_18400"
FT   mRNA            <383587..>384177
FT                   /locus_tag="OSTLU_18400"
FT                   /product="predicted protein"
FT   CDS_pept        383587..384177
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18400"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18400"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99937"
FT                   /db_xref="GOA:A4S8L6"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8L6"
FT                   /protein_id="ABO99937.1"
FT                   /translation="MWTLDLSAPIIEGPTSLVVGRLCVALGATLLAGLNFWPQAEKQLG
FT                   RCARTFASKESSERLKADAAKFAAMVAMKMGFEFYAYWKALTSFTPCSQSLELPAWYGL
FT                   AFVGHATFVAASSKILGPGGASTEDVPLQMRKLIGGFDVLLALACVGTSKLAMAGYGVP
FT                   SAALGFVFMLAATYFTFENKLPSKKTPSSGAAA"
FT   gene            <384305..>385474
FT                   /locus_tag="OSTLU_27893"
FT   mRNA            <384305..>385474
FT                   /locus_tag="OSTLU_27893"
FT                   /product="predicted protein"
FT   CDS_pept        384305..385474
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27893"
FT                   /product="predicted protein"
FT                   /note="GO_component: - intracellular; GO_function: -
FT                   double-stranded RNA binding; nucleic acid binding; 3'-5'
FT                   exonuclease activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27893"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99938"
FT                   /db_xref="GOA:A4S8L7"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8L7"
FT                   /protein_id="ABO99938.1"
FT                   /translation="MRVPSAAKNIRNAAARLLSAEPPPSVASSVVDPFALPPVDVAYDV
FT                   ESAERALALRGFAPSAAPGAPRFIGFDVETKPNFTKNVANVNAPALVQLANERGCVLVH
FT                   LASMRGETPPTLRALCEDAGSIFVGNGVWSDMRDVDWAFGTKSRGYVDVGVIAQTFGHS
FT                   RHGLKAMSARYGYDAEKPKSVQTSNWEKSPLEAKQIDYGAKDAALGLWVLKQLYAEYAG
FT                   GEVSLEDWAMAFGNASQPKEAFRSARANAKTTPECVMKAFERFDQKNRELVKEAWLVRQ
FT                   MKKAQRVVKQMAEGALHPVSATHALMDILHAPKSKRKVVEWVGSGSKGGGLFEIELKLG
FT                   SSVRARGEGRTVKAAKFEAARGAFAALKDGDAADATIWIKRELEHAWSQ"
FT   gene            complement(385500..387301)
FT                   /locus_tag="OSTLU_27894"
FT   mRNA            complement(385500..387301)
FT                   /locus_tag="OSTLU_27894"
FT                   /product="predicted protein"
FT   CDS_pept        complement(385528..387228)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27894"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27894"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00082"
FT                   /db_xref="GOA:A4S8L8"
FT                   /db_xref="InterPro:IPR007603"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8L8"
FT                   /protein_id="ABP00082.1"
FT                   /translation="MADHAREDDDSALFTSSERHEIANENDGNLAARPHRDVAFKRAFA
FT                   TSLAVTILCGLLALSRVSADAHVLTEAETLNKYESCHAANGVGARRRTLLEDGADEDAA
FT                   TALTKARPYVVMAMLGACAMGALALTAFKRHPRFATWSMIYVKIGSCFALSIAFAIERM
FT                   AFPCILFALFAAFFAYWMHATRDRVELVAKLLGAASTALKDNPHLITTSVFAGLAVIVS
FT                   SIMFFTCVWGAYMNGSIAPSDYEHYTGGKCYYGEEVVPCCEWQTDSWVGPYVVFALLVW
FT                   LWSHMIAAEMRTFVIGGSISRWYFAPAGTTAFVGTTREFIGHAFGASFGSLAFGGLVLT
FT                   GVTILRNLNERLRRESRGFMAILACIVTAVMDCIAEIIETITKFATIQCAITGESLLES
FT                   GREVTRLLKDNFLSALRVWWLPEMILNMTALFFAIFYGVVVGISVHVGVQVSTGDDDLA
FT                   HNVGAIVGACAGVSSIVILSFLFSVLLTCIDAVFICYARDKDENMITKPEIVAIYDEVT
FT                   EKTRAPDVAVAAAQRAQRPPPTARSDPGVVFQTPNAPMMYGRPDGNSLV"
FT   gene            complement(<387498..>388361)
FT                   /locus_tag="OSTLU_4851"
FT   mRNA            complement(<387498..>388361)
FT                   /locus_tag="OSTLU_4851"
FT                   /product="DMT family transporter:
FT                   phosphate/phosphoenolpyruvate"
FT   CDS_pept        complement(<387498..>388361)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_4851"
FT                   /product="DMT family transporter:
FT                   phosphate/phosphoenolpyruvate"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_4851"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00083"
FT                   /db_xref="GOA:A4S8L9"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8L9"
FT                   /protein_id="ABP00083.1"
FT                   /translation="YAVAYLLVATVLILANKHLITETSFNCPVFVSSLGSWFGWGVAAA
FT                   AIKLDPKRMSHRLSAREWTANILPIGFCTALSLAAANVAYSYLSLSFIQMLKAFAPVVC
FT                   YFTLVAFGLDRWSGRIIATLSVVMIGCFIAAWGEAHVTMFGLACMLTAEIAEAFRSVGI
FT                   QYLISNKKFSLFNGMYYFSPATLVFLMALSLIFEREELFRTENIATFTRYWYLFFICAT
FT                   FGFAVNYVCLGVVKHAGSLMVKTMSQLKNVAVIGAAMFLYGDEVSVTEIVGYAVATAGF
FT                   VAFNHAK"
FT   gene            <388765..>390717
FT                   /locus_tag="OSTLU_27896"
FT   mRNA            join(<388765..388968,389239..>390717)
FT                   /locus_tag="OSTLU_27896"
FT                   /product="predicted protein"
FT   CDS_pept        join(388765..388968,389239..390717)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27896"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nucleic acid binding; helicase
FT                   activity; ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27896"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99939"
FT                   /db_xref="GOA:A4S8M0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8M0"
FT                   /protein_id="ABO99939.1"
FT                   /translation="MAAATRVSRATARESARGARALARGTWDDARAIRALAGDERRAGG
FT                   AGRGRGVVSASAASGASGASEREIASAQTVHAKVRWALKNLGFETLTEIQAAAVPAAAE
FT                   NSDVVIAAETGSGKTLSYLIPIWSNLLERGVGGRDDDDGSRETGALILCPNATLCEQVA
FT                   RVANSLVDEGTGEPLLRTYALTPETGTPFHAPDVYVTTPARAVDDLLRFREGAWRRGSF
FT                   SPTARTLRHVVFDEADMLFSGGYLKPLRMCFDVLYREEKLASEGFYLPGTGNEDAAAEW
FT                   DGDVDRDASSFERDWRKDHDGPRKRGPALGGKGKVGLGDGRDFRRQYIFAAATVMSNGK
FT                   KTPGAMIKYGFPDAKWIEGRRLHRSVESVNQTWVEATLETRAMALADAVGLTSAGASAE
FT                   KTMIFVNTAAAADEIAREFNALGLRAAAFHADMASHERAMRLKDFADGVITALVCTDSA
FT                   ARGVDIPGVTHVVQAEFAGNAVDYLHRIGRTARAGATGRVTNICLPGSADLVRAVRDAE
FT                   ANGDPVESAFSRKRSFRKKTKKYGPSRKGVADLSLRRARDQRS"
FT   gene            <392126..>392920
FT                   /locus_tag="OSTLU_27897"
FT   mRNA            <392126..>392920
FT                   /locus_tag="OSTLU_27897"
FT                   /product="predicted protein"
FT   CDS_pept        392126..392920
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27897"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27897"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99940"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8M1"
FT                   /protein_id="ABO99940.1"
FT                   /translation="MGESGFLLAAAGEPGRCVVWSWSVNDANDDEFLLKEHVTCDEMPA
FT                   MNYRGVVPKPGTPTSLQWLDVDRNPKIVAVVDEGLTYVWNVLEKARDRSSYAIDHGIRS
FT                   LIPVHCEGVPSRGPAEDEPLAAVALARRKRAPLLDLESKDSSDDSLSSERGESCAIGAA
FT                   LIRVHGLSIGESLFASESSTAVSLACAGEDACFGARDGAFVAWNIATGECALKVLLAVP
FT                   ASGELTDDQDLAVRSVACAERHVAACCGDGVFVFAKSAPRAS"
FT   gene            complement(<393072..>393605)
FT                   /locus_tag="OSTLU_27898"
FT   mRNA            complement(join(<393072..393195,393499..>393605))
FT                   /locus_tag="OSTLU_27898"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(393072..393195,393499..393605))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27898"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27898"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00084"
FT                   /db_xref="InterPro:IPR035204"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8M2"
FT                   /protein_id="ABP00084.1"
FT                   /translation="MGFLTRFIASGIDDGVERQRALEKHLEKTSAKCATLKDNWDQPTK
FT                   SDRYWLREKSQLAYADANQTGDDVPGRRPVW"
FT   gene            <394048..>396090
FT                   /locus_tag="OSTLU_93816"
FT   mRNA            <394048..>396090
FT                   /locus_tag="OSTLU_93816"
FT                   /product="predicted protein"
FT   CDS_pept        394048..396090
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93816"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93816"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99941"
FT                   /db_xref="GOA:A4S8M3"
FT                   /db_xref="InterPro:IPR002999"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR039776"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8M3"
FT                   /protein_id="ABO99941.1"
FT                   /translation="METAIGAGGRTWARATSALCRTAARLDARDTEDGKRYLDESLRLL
FT                   ETRESERGSGDADARARAAMCARLSGARVLGSMGSAAKESARGAFDETGALRGEFFARA
FT                   VPALLEHSYKDKAGSVRRACAEALGRVGGLKTTDVRQLGRALGDKRDDVRTAATRSVGA
FT                   QGGVAKFLVPKLVENARRDDPELRQTTCEALESVWKGRQGDPAQDGSEDVLLFQTAECM
FT                   GELTNDADAGVRAAATRCLGHLRGAAAAKVSLINKRVDDSDEGVRDAAAETLIKLGFIN
FT                   PSTGTLRNKGNYRTSKFSANKNLFAVLTGKQDSLATTSRVNVPAGAIVRVWWPLDECYY
FT                   EAKVKGYDKSTRKYRLLYLDDNVEEEVNFRKEKVDLKHKPTKNARATWIPCGAVQRKPK
FT                   SKDKDQPKHKIARKRSSATSAWVDYDAEEQKRIGREALVGRRMKVWWPDDKAWYAGEIR
FT                   RFSADTGKYTVFYFEDGEEEDLDFDKEERAPKIYEPVQDESATPTIHGLEPRRLPVRSG
FT                   EKDALYEPGCFRGSECCSFVNEEGEKTTMLCSDFDKMYGGGSRWRRSIVVTSETGAEPI
FT                   DTFFRVNGERWGNAVLGYEFDMDVAVDMRDFPVDRQPVEPSWQRVKIISYNPTSGEHQC
FT                   VDIKDDGEPDPSRAVWLPLCMQRTRARAAADDDDGEDSISDIISS"
FT   gene            <396264..>397934
FT                   /locus_tag="OSTLU_27900"
FT   mRNA            <396264..>397934
FT                   /locus_tag="OSTLU_27900"
FT                   /product="predicted protein"
FT   CDS_pept        396264..397934
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27900"
FT                   /product="predicted protein"
FT                   /note="GO_function: - pseudouridylate synthase activity;
FT                   GO_process: - tRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27900"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99942"
FT                   /db_xref="GOA:A4S8M4"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8M4"
FT                   /protein_id="ABO99942.1"
FT                   /translation="MHKTCAFQRTLARGVLTARAPRTSADAPRSSRRITAHAQTRRESH
FT                   RKVDGNGGKDYAQVRHQPDPSAHPTHLIPDDLRAPDVDDARKKKPVAIVLAYVGQGYKG
FT                   NTHNAQAPRGTTVDDVVEDALFAWGGILMPNYRSRGLQRLKWSRSSRTDKGVSSLCTVV
FT                   SLRAEIDPEVWTKDVEARETAREITKHLPEDVECFAVYNTPKSFQARRECIMRTYEYLL
FT                   PARVLDLERGVLDASDAERLELFSKALAAFVGAHPFHNYTKRKQYTREAIGKYSAKRRD
FT                   ARGKLAWKGQEGAVMDDGSDEDVEGEHGEEDEEENVVASTSAAEHDDGFPKHVGERRRG
FT                   TYWLYESDPNDKIGPSHFRRIHNFTAGADVERMEITNDDGSKTTSEPFIRVSVRGESFM
FT                   LYQIRKMIASAVAVSLGHCPLEFLPASLSRPCRAAMPLAPASTLYLYDVEFMKFRVNHD
FT                   PSQPNRLERLEPSESVRADLARFQREKLEPALAPALLNDEWDDFKENLKQGNVTPELSR
FT                   DILAAYETYKANRDEARALQDAEEAAAAAAAAAAAADSP"
FT   gene            complement(<398026..>398349)
FT                   /locus_tag="OSTLU_27901"
FT   mRNA            complement(<398026..>398349)
FT                   /locus_tag="OSTLU_27901"
FT                   /product="predicted protein"
FT   CDS_pept        complement(398026..398349)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27901"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27901"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00085"
FT                   /db_xref="GOA:A4S8M5"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8M5"
FT                   /protein_id="ABP00085.1"
FT                   /translation="MKIRAVTRACALATLALAHADVAGAASFAVGGGDGFAGAPSFAEE
FT                   DYAYQTPDLAVDLASPLVAYRLVTTALRQEVPLWLDAIIVSAALGALWVVVTGNHSLDS
FT                   VLQ"
FT   gene            <398545..>400288
FT                   /locus_tag="OSTLU_40716"
FT   mRNA            join(<398545..398700,398891..>400288)
FT                   /locus_tag="OSTLU_40716"
FT                   /product="predicted protein"
FT   CDS_pept        join(398545..398700,398891..400288)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40716"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40716"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99943"
FT                   /db_xref="GOA:A4S8M6"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR024598"
FT                   /db_xref="InterPro:IPR031774"
FT                   /db_xref="InterPro:IPR031776"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8M6"
FT                   /protein_id="ABO99943.1"
FT                   /translation="MSATQLEHARRAHEEIERLERRAARALSDGAPTTHRARLTQNRIV
FT                   DAILTASRRTYADDDGSMREEAESMGDGEDVERALRGFYEAVKETRRSHAARAGAVAEA
FT                   GGAFAEEIVEEAERAVGGVFSGEENSGRYLDLHESHMTYANATFGERCDYSEYLERCGN
FT                   FAETPRSKKFCAAYTDYLDALLAYLRSFHERAIPLQFVHKALAQDAEEFERRWKKGECP
FT                   GWEDGGVRAVDEKTLESSAVDLSAFKSLKDMEKALDVDAIKSALGSLGLKAGGTPEQRA
FT                   ERLWSVKGKKLSDIDRKLFAKGVVLGSASSTSKKKKSQNGEDGDAKVKAENRARAIAFK
FT                   ESQCALVLKLLGKQLDATRTNVEKKSTLSLAELQAEAEEDDDFSDAETDEDEEIYNPLK
FT                   LPLGWDGKPIPYWLYKLHGLNMEYTCEICGNYSYWGRRAFERHFTEWRHQHGMRCLKIP
FT                   YTKAFNEVTSIADAAALHKNLSQREVGTFNVKLDAEVEDAQGNVYNKKTYEDLQRQGLL
FT                   "
FT   gene            complement(<400386..>401534)
FT                   /locus_tag="OSTLU_27903"
FT   mRNA            complement(<400386..>401534)
FT                   /locus_tag="OSTLU_27903"
FT                   /product="predicted protein"
FT   CDS_pept        complement(400386..401534)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27903"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27903"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00086"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8M7"
FT                   /protein_id="ABP00086.1"
FT                   /translation="MASSEEATALARLRERAFAASHIAEAALNGHESYMRLLALAFTAP
FT                   DCAEAASTGHLECLKYLRERGCRWNAWTCKSAASNGHLECLKYAHENGCPWHEDTCACA
FT                   AYSGHLECLKYAHEHGCPWDKGTCNAAASHGQLECLKYAREHGCDWNLRTCNNAASNGQ
FT                   LECLKYAHEQGCDWDEETCISAAWKGQLECLKYLHERGCPWDEKTCAVAASNGHLECLK
FT                   YAREHGCPWNERTCSFAALNGHLECLKYAHENGCPWHEETCARAAGSGSLECLKYAHER
FT                   GCPWNEDTCRDAAYDGQLECLKYAHEHGCPWDKDQCIDAARRLHFTACLTYMLTLKDAE
FT                   ESKLDDAMSALDEIARDIPEGAYVTICAALKLSHDEHKKRKR"
FT   gene            401600..403908
FT                   /locus_tag="OSTLU_27904"
FT   mRNA            401600..403908
FT                   /locus_tag="OSTLU_27904"
FT                   /product="predicted protein"
FT   CDS_pept        401605..403890
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27904"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27904"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99944"
FT                   /db_xref="GOA:A4S8M8"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8M8"
FT                   /protein_id="ABO99944.1"
FT                   /translation="MVERAPRRRRARSPVARRARRALDRFRDELGGPAPSASIATSRAA
FT                   PSDEDDADAESRPRRDDAAADARGADVAALRSALTCVITNALFVDPVTTACGHTFERDA
FT                   LARWLTRGERERAAGRDGRGRVASGEAPASCPQCRSPLYHELPHEWPVNTTVRECVEAT
FT                   FGREAALGEAEARREANARGEREDDRRGRDGGEGTRRRRAQDEAWVSTRGNVNVVGPTY
FT                   ELPMFFLEALVPGQEVTLNVFEAKYKVLVRRCLSGSRKFLMMTNEDSNEEHYLEDLEDD
FT                   DATAAVSRGVADGYGLTDVDLAQFGRFCAECQIVTCQELVDGRFLVRIRAMRHVFVHSA
FT                   VKDPSGFIVARCSRVRDEINADLSVLDNRGFKDDSELRKANAAAVKLELRIDRVLELFD
FT                   VWVAMTIGSRWLYNYGGSMSQLLQAVGPSPRRESPSDLAWWIVRVLNPLPTIDGTIEMR
FT                   SICLNTSHIDTRFQVIAQMLIYSLSLVQRINVRDWTKREHVVAVSVCNELFAVLSESPS
FT                   DAAGDLRRERLVEDIYELLYDVDFIEHEAYEGLRICPPGYDDPQGVAAKSFLLEKSKRP
FT                   DPSKQTDSKKAQSEQTKWSDYPPPVFDAVMDRLIWEHGYGALALAAWRALSDYECGDPK
FT                   LKRWNERLLAHCPSSINVGTHVKDTNELLRLSRKFSKCLRRDMRCGFYKFLYLFDLCRM
FT                   LVYLVYRVLVLVIFALGFLFELAFDREFHGGHRTAARGLFMAVAIGAASGLFARSSLDA
FT                   YLGRVRSE"
FT   gene            complement(<403923..>404552)
FT                   /locus_tag="OSTLU_27905"
FT   mRNA            complement(<403923..>404552)
FT                   /locus_tag="OSTLU_27905"
FT                   /product="predicted protein"
FT   CDS_pept        complement(403923..404552)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27905"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27905"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00087"
FT                   /db_xref="InterPro:IPR010492"
FT                   /db_xref="InterPro:IPR036224"
FT                   /db_xref="InterPro:IPR038437"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8M9"
FT                   /protein_id="ABP00087.1"
FT                   /translation="MRRDYYDIDDFLAREHAVTVEFAWGAATVGPEVIGPKAKKDSNGR
FT                   ADVPKEHRAPVPLWWLDGEMAKDVYICETPAAFADDVFALLKAEDGAKITNLRTTCESY
FT                   FGFARATLDALERDAGDDAEAMEPVIELKEKISDALERRWREVLVDSIGRVGDDDKTER
FT                   LLSREERRIWDAGRMAQAEYERWRYGRSGRVVATKAVLDNKRQKRG"
FT   gene            <404681..>405208
FT                   /locus_tag="OSTLU_7390"
FT   mRNA            <404681..>405208
FT                   /locus_tag="OSTLU_7390"
FT                   /product="predicted protein"
FT   CDS_pept        <404681..>405208
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_7390"
FT                   /product="predicted protein"
FT                   /note="GO_function: - catalytic activity; GO_process: -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_7390"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99945"
FT                   /db_xref="GOA:A4S8N0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8N0"
FT                   /protein_id="ABO99945.1"
FT                   /translation="ALVFDCDGTLIDTMGLFYVADVRACDEVGVKMSKGTFYELAGVPI
FT                   RDIFRKLCVEQGAASDDATLDAMVRSCGAHARALGPPKAIECVVEVARNAKARGKRVAV
FT                   ASSGVKTTVLEHLEHHGLLDLFEVVVTCEDVTRGKPAPDLYALAAEKLGVAPERCCAYE
FT                   DAVLGVESARAAG"
FT   gene            <405442..>406293
FT                   /locus_tag="OSTLU_89332"
FT   mRNA            <405442..>406293
FT                   /locus_tag="OSTLU_89332"
FT                   /product="predicted protein"
FT   CDS_pept        405442..406293
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_89332"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_89332"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99946"
FT                   /db_xref="GOA:A4S8N1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8N1"
FT                   /protein_id="ABO99946.1"
FT                   /translation="MSRASPTFVDTHAHVDVVLDKLGLPSADAYLEYADAFAREHGAAA
FT                   ALEACVTIGCSEKSLASAAAVVDGSERMFGAYGCHPLSAREWTRTRTRVREMLTTGARV
FT                   VAVGETGLDYHRIRDDAEDGEDAEAYKTTQRDAFAEQMRLATELGLPLIVHTREAETDT
FT                   VAMMKEHLPADARVHVHCFTSSVGMAMELLRAFPNLCLGFTGVSTFKNGQDVRDTIKEV
FT                   PLDRILLETDSPYMAPVPFRGQTCHPAMGERVAHAVAAVHEVDVEEVFARCRENTRRVY
FT                   GI"
FT   gene            <406445..>407527
FT                   /locus_tag="OSTLU_27908"
FT   mRNA            <406445..>407527
FT                   /locus_tag="OSTLU_27908"
FT                   /product="predicted protein"
FT   CDS_pept        406445..407527
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27908"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27908"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99947"
FT                   /db_xref="GOA:A4S8N2"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8N2"
FT                   /protein_id="ABO99947.1"
FT                   /translation="MLDADNASTRARAFERGATLQPEYDSFSWLKTALLATPRARGLRA
FT                   FAWPWLCINGVSVLWTSLYELALPKRTSSLGSFGMVYQLVFSTMGFLLVFRLSRAAVRF
FT                   WDCRAAFGNFNVGVRRLVDVALVHGKGRDARALDDVCAWACAFVVASKQFLRGVKTISA
FT                   EEVMGILSDDDRKRVENARHPPLYCASMLRRAIHRAFGVDEKGGTTSDTIRLESRLRQL
FT                   HEQCDFLITNEGALERLRGTKLPMIYVMHLRTFLMAYCVSMPFVFVNQWRWGTIVAVAV
FT                   VSFALLGIEGAATECEIPFSADHANHLRMDQYAQACLLSVGAYLAWNERLEGANDFGHR
FT                   EGNVSCASLEDLVIDVDTNV"
FT   gene            complement(407570..408747)
FT                   /locus_tag="OSTLU_25622"
FT   mRNA            complement(407570..408747)
FT                   /locus_tag="OSTLU_25622"
FT                   /product="predicted protein"
FT   CDS_pept        complement(407595..408617)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25622"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25622"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00088"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8N3"
FT                   /protein_id="ABP00088.1"
FT                   /translation="MILRALLTAYGALLCASLVDKRAKRGVRKVHDAVRANAHLVASDE
FT                   KRWKRSKVDPKTLATRATKTRTVVFIRHGESTWNEVFNRKFDHTFPVRLIGGVIAELGK
FT                   FFARDSFFLDSPLSATGVAQAQALRAHFATESASRAAKSQTKGYVGDVVDVMLGLRGKS
FT                   VIASSNLRRAVNTTAHALWCRLSNAKANDKIIIHSALQEMARNVDTYALACKKGDFVPT
FT                   QTLAKELGVSSVDEAKLFDASSNAGQKKLNRKGRDSMREFAAWVMNQDADVVIAGGHSI
FT                   WFREFFKTYLPFDSTCPGKKKKIVNCGVVSFDLSFGVLPEHGEVYAIENVKEIYGGFAK
FT                   "
FT   gene            <408872..>409807
FT                   /locus_tag="OSTLU_40498"
FT   mRNA            <408872..>409807
FT                   /locus_tag="OSTLU_40498"
FT                   /product="predicted protein"
FT   CDS_pept        408872..409807
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40498"
FT                   /product="predicted protein"
FT                   /note="GO_function: - transferase activity; GO_process: -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40498"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99948"
FT                   /db_xref="GOA:A4S8N4"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8N4"
FT                   /protein_id="ABO99948.1"
FT                   /translation="MPERRADARGRRARTIVSVVRDGCRRFIARALRAGPIPRHVAVIM
FT                   DGNRRFACASGVALARGHARGADVLREACAWCFELGVETLSVYALSTENFKRSERELEA
FT                   LFDLACGEIGTLIDDEGLRLREARVHVSGDLDALPKRVRDKAKEAMEKTKDNRGPMLNV
FT                   CMAYTGREDIARAVMKTREDVRGGALDASEVDERAVASRLHGAEREIELGAGMPEVDLL
FT                   VRTSGETRLSDFMLFNARFAKLVFVEVLWPDFTFMDFVHAVWQYQLGAKDLKRSRQAYG
FT                   DANAIEAESAVVAEVRVQPGRVAKGAKRSV"
FT   gene            <409909..>411420
FT                   /locus_tag="OSTLU_93818"
FT   mRNA            <409909..>411420
FT                   /locus_tag="OSTLU_93818"
FT                   /product="predicted protein"
FT   CDS_pept        409909..411420
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_93818"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_93818"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99949"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8N5"
FT                   /protein_id="ABO99949.1"
FT                   /translation="MRASLLRATTVVLLLYASTVANAASLNAFGQDGLFEFDTVTVAIP
FT                   SASAREGGEIVVTHPTGVMDEPAPLVLFMFPIHGFPFSTWRTLMANVIRALASNGFAVA
FT                   TPASIDPNGNRPIQGGMFPGTTSTVSGIDLREMATRYLNFFTHASRYLVDLAQSDPSFA
FT                   LHGKLDTSRIGTMGFSVGGALSQYLAQRLDAELPGRVVAEVALAPTIGTEVPFTGVDDI
FT                   GAELFREFASSMTVPTVFVAGENDGMGGLRDSAIYYDQSRAPRVRVTAGNGATHCHAIV
FT                   PMSECDLVQGTRGLQSLDSIIAHAMMTLYLRPDTPRWRDERELATEIIWRDGLEALHAQ
FT                   MVTPLAPPNRAWEIRKVERDPELSLTMNAYSVAAPLAPQSVELIAVVRSSSRADECDEV
FT                   QVTVENVPVGIEATVTRLSPTEFGVDVRWTTVPQRARGAQTRQFLGNLLNARSNRRPVQ
FT                   VSSEFGPRVGFAAPSQSVLTIQAKHACVRSGFAFADVFVNQPYAY"
FT   gene            complement(<411509..>412381)
FT                   /locus_tag="OSTLU_27912"
FT   mRNA            complement(<411509..>412381)
FT                   /locus_tag="OSTLU_27912"
FT                   /product="predicted protein"
FT   CDS_pept        complement(411509..412381)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27912"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27912"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00089"
FT                   /db_xref="GOA:A4S8N6"
FT                   /db_xref="InterPro:IPR021883"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8N6"
FT                   /protein_id="ABP00089.1"
FT                   /translation="MATAPARSSARPAARPTARRAARRPARRATTTPRRALEDDDARYS
FT                   NETKLRSEAQAPFRVARQFLYGACAASATIGFGIATIQAATKAAGAPNAPPLEGSLENL
FT                   AIDGAALATFAWLYAREEAARERQMARIGREERLGRLRVELAGGKTVRLEDLRSFSRVV
FT                   VVSGDEAYARTALEDAEDVREALIERGVLVVPVIRGDGAIEAPSAEDRKFRCTPLRAND
FT                   WLEWVAEQKKMSKVSDDKGVYVGLRMDGRVRSSGTGRVPFNRFAVELPPVDSWGGALDG
FT                   FDGRVGVDN"
FT   gene            <413070..>414589
FT                   /pseudo
FT                   /locus_tag="OSTLU_2524"
FT   CDS_pept        <413070..>414589
FT                   /pseudo
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_2524"
FT   gene            <414920..417989
FT                   /locus_tag="OSTLU_25624"
FT   mRNA            join(<414920..417137,417169..417989)
FT                   /locus_tag="OSTLU_25624"
FT                   /product="predicted protein"
FT   CDS_pept        join(414920..417137,417169..417182)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25624"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25624"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99950"
FT                   /db_xref="GOA:A4S8N7"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8N7"
FT                   /protein_id="ABO99950.1"
FT                   /translation="MGTRQSASIYFKHLVNKSWTQREGATATTETNPILDEGDKAAVRR
FT                   VALEAIANTPSKVRSQLVEAVRVIVHHDFPGRWPEVANQVLDGLNAASSSESGKLCGTV
FT                   LVLHALCRKYEFKAVDERADIEEMIRVVFPKLLEILKALLAYQGPPDTELEELKKAICK
FT                   TYLSATYLNVGPSLREEGTFREWMAAFHAIITAPVPTENMPTDDKTELKHWPWWKTKKW
FT                   AMHVVNRMFNRYGNLKKCQPHDKAQATVYRDKYAGHFVTVYIQLLSSLATGAVMPDRVV
FT                   NLAVHHLSTALGVPTMYKHMEPHLDAIFQQIVFPMLCFSAEDDELWKDDPQEYVRKSQD
FT                   LIEDMYSPRTAACSYTQELVITGRRLKENLPKVLGAMVQIFTKNSSSVRSGPMDARARY
FT                   ELDGALLVITTLSQLLSTHPDYAKEIEGMLMTHVVPAFGCVHGHIRAKAVSCVSKYSDI
FT                   TFRDQNNFMQLFSSVVNAMKDPEIPVRFEAVVGLGAFVQATDDVSALKGILPQLLDEFF
FT                   KLMNEVESEDVVYTLETITEKFGEDIAPFALGMTQNLAAAFWKVVQEAEGKDDDEYGMM
FT                   ACMGCLRAMSTILESVSSLPHMYPELEAAVFPILHKMISEEGYDVFEEVLEILSYLTYF
FT                   TPVVTPRMWELWPLMMRMMDDWALQYFENMLIPLDNYISRGTEHFLTPGSSYVEDTYKL
FT                   CEKVLGGDYPEPDCLPAPKLMECVMTNCRGRVDVVIEPYVNIALAWIGS"
FT   gene            complement(417985..>419853)
FT                   /locus_tag="OSTLU_25626"
FT   mRNA            complement(417985..>419853)
FT                   /locus_tag="OSTLU_25626"
FT                   /product="predicted protein"
FT   CDS_pept        complement(418024..419853)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25626"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25626"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00090"
FT                   /db_xref="GOA:A4S8N8"
FT                   /db_xref="InterPro:IPR007941"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8N8"
FT                   /protein_id="ABP00090.1"
FT                   /translation="MPTTIDWSVVDFDADVGRAHWTRERRRETGARVRRALEAAAETRR
FT                   AGRMATYDESGDEEESMERMSVEFAAEALIASGTYDADARAGLRTRATRAGESWRTFAE
FT                   AEDGAAERMRRAAALDDGSESESEERAEGEWSWTRAVKIGGAAAIGGAALFVTGGVAAP
FT                   AVLASLSGLGVIGAATTGVLATLGGVGAVFGATGAGLTGYAMLRRTSTEMEQFQFIPLR
FT                   GVGRRFALHVFVPGFLRDERDLLRAWGAEKNQYVVVIDDPGELGMTLERDDDGYLIVQT
FT                   TDALKQTVKGAASLAGVISGSILVSYRSIDPQELARSRSSKILSKKGKTPKIEELEAMP
FT                   RPLELRLQLTKDEALDKKMDSLVEKMREVVLEKTIDEKDAEAPAAKPEWGNHTGEQYVL
FT                   NWEPSTLTELGTAMQFVGGKYAITVAAPKVLARTALASITTAVSWPVTLLSCACYLDNP
FT                   WTIARAKAEIAGEEIANALLTQQHGRRPVTFVTYSSGAFVVQSALMKLHAAGEKGKKIV
FT                   ERVVFISAPMSTSNKVWEPMREVVSGRLVNVYVPDDWMLLFFYRLKSVDTTLGLAGLQR
FT                   VDRDDVENFEMSFKHANIPDEMSRILNEINLDE"
FT   gene            <420200..>421933
FT                   /locus_tag="OSTLU_27916"
FT   mRNA            <420200..>421933
FT                   /locus_tag="OSTLU_27916"
FT                   /product="predicted protein"
FT   CDS_pept        420200..421933
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27916"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27916"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99951"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8N9"
FT                   /protein_id="ABO99951.1"
FT                   /translation="MLFALERRATRGALTTVREQTGASDAEALAEDAHLAEGDPRALRA
FT                   MARAWEALDATPANEAMRLYVKVLDEEKPNWWDGAATEARRSNRGMHAKGGMEALPEAM
FT                   RVERGRWEFLEYAGTKPTARFQHAATVAGAKMYVIGGSFRGRFMNDTHELDLTTSTWRR
FT                   LKTKPGTSALPACAGHRAVTCRGVVFVVGGRFKGPETSAMSVYRMETKDDGLDEVEWVK
FT                   IETGGDEAPCARRGASVTMVGEHKCIVFGGEDDERRFLNDAWILDMTSFVWRAVKAPGG
FT                   HPPESRAEHTATMWGQDTLLVFGGTGRSTKCFSSLFALDLVQHKWIEVNPRGAARVEPR
FT                   AGHAAVLIKDGRFWVLVGGGNNERGLSECSILDLEEMEWVDRNDAFLAPPIVGEGMTLC
FT                   ALSTRDGMEDAVVAFGGYNGACQNETQILRVPEDFPEHEALASDENRAPPVSTSVLRDD
FT                   KSIERDDERDDEHASSPASALIDFASPDKPAATTFAFGTDASVQAYRKENVELRRALHR
FT                   MRNDAQIVADAHAALRVRCEDLERGLSDERRRNEDLERKVAALAEQIRGGLGASGSFFS
FT                   P"
FT   gene            <422440..>423612
FT                   /locus_tag="OSTLU_40732"
FT   mRNA            <422440..>423612
FT                   /locus_tag="OSTLU_40732"
FT                   /product="CPA1 family transporter: sodium ion/proton"
FT   CDS_pept        422440..>423612
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40732"
FT                   /product="CPA1 family transporter: sodium ion/proton"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40732"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99952"
FT                   /db_xref="GOA:A4S8P0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8P0"
FT                   /protein_id="ABO99952.1"
FT                   /translation="MCGLPSLTGMLLCGLLLRNVPGGLVNDLPERWSSDIRAAGLSVIL
FT                   MRSGLELDLDAFRSIGWMASRLTVMPGLSEAIACGLFSMLIFKMSFPLGMCLGFILGAV
FT                   SPAVVVLGMFELQSLGYGVAKGIPSLVVAAASFDDVVAITGYTIFKSFALGSKGHMAWT
FT                   ILHGPVDVLAGLCVGTLGGVICGMTKIWNERWKRSSMVMILGLFTMFLGRHYGFNGGGA
FT                   MSALALGISANKCWRTNKPHPALTNGPSDDHAHGVETDLAKLWRFIFQPLLFGVIGTAV
FT                   SFKDVTPSTIPKSIGLLLIGICIRLPMAYVAVGGGELSRIERAFVSLAWIPKATVQAAL
FT                   ASDPLDYIIEKKKSAEYVSWGNDILTTAVFSIILTAPLGMVIIATLGPKWL"
FT   gene            <424599..>424904
FT                   /locus_tag="OSTLU_18417"
FT   mRNA            <424599..>424904
FT                   /locus_tag="OSTLU_18417"
FT                   /product="predicted protein"
FT   CDS_pept        424599..>424904
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18417"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18417"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99953"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8P1"
FT                   /protein_id="ABO99953.1"
FT                   /translation="MLGNFYQTLEKFDDAEREYRRALELGTNVDAANNLAMILQARGEL
FT                   DEAEAYYLKALEPDPDCVDVLFNWATLKLECRKDLNATRILIERIVTIQPDLKKHPL"
FT   gene            complement(<425019..>427274)
FT                   /locus_tag="OSTLU_40751"
FT   mRNA            complement(join(<425019..425498,425550..>427274))
FT                   /locus_tag="OSTLU_40751"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(425019..425498,425550..427274))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40751"
FT                   /product="predicted protein"
FT                   /note="GO_function: - protein kinase activity; ATP binding;
FT                   GO_process: - protein amino acid phosphorylation;
FT                   regulation of transcription, DNA-dependent; signal
FT                   transduction"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40751"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00091"
FT                   /db_xref="GOA:A4S8P2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8P2"
FT                   /protein_id="ABP00091.1"
FT                   /translation="MSRARSIEGGAHAPSLDAKVARAFAAFDHTFTVCDATREDCPIVY
FT                   ASDGFLRMTQYGADEVIGHNCRFLQGEATDGNDVRELREAIKRGDRWSVRLLNYKKDGT
FT                   PFWNYLVVAPVKLADGTVAKYIGVQVDVTEVKDATTGERGIDFDEEGMPVPSRYDARAA
FT                   AVSLGRVSEVENAVRAAEGLSEDGVDDAGARKGRVGLDLASTLERIEQSFVITDPSLPD
FT                   HPIVFASDGFMDFTGYSVDEILGRNCRFLQGPKTDRAAVAKIRQAIELGEECTVRLLNY
FT                   TKSGKQFWNMFTLAPVRDDQGIVRFFAGVQVDITAHDPSTEDESIAEITFKGTDEENIA
FT                   ISKGAASMVAGATAKDKEFEPPWVRMHGKMLTPKPHQIENRRHWEALRKATNDGTRALT
FT                   IDDFVPVKRIGQGDVGTVHLVTLAKQQDITFALKILTKQEIIDRNKLHRLHTESTILNE
FT                   VDHPFVATLFASFQTATHVYFLMEYCEGGELYDFLQKIPDRRLSENATRFYAAEVLVAL
FT                   QYLHLLGFVYRDLKPENVLLRRSGHIVITDFDLSFCATCKPHINIQPGNPSWIAGERAN
FT                   GSNPMLMAEPFTFTNSFVGTEEYLSPEVLNGTGHSGSVDWWELGIFMYEMAYGTTPFKS
FT                   ATREETFNKISDGKVTFPDDVPMSDDFKDCVGKLLQHDTTNRLGTLGGAEEIKSHPFFK
FT                   SINWGLLRWEVPPNIPKLKPTRSAPPPAKEEPEEMFEIEV"
FT   gene            <428347..>428826
FT                   /locus_tag="OSTLU_40439"
FT   mRNA            <428347..>428826
FT                   /locus_tag="OSTLU_40439"
FT                   /product="predicted protein"
FT   CDS_pept        428347..>428826
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40439"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40439"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99954"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8P3"
FT                   /protein_id="ABO99954.1"
FT                   /translation="MKANVSRVSTSKFHALAVDESGSVYAWGCARDGVLGFGRERGDEA
FT                   VVFPTLVRSFGCDVRVVRVSAGLAHSAVTTDAFETFTWGNGALGRLGYSVAVDDSASDD
FT                   ERERERRCTQFTPRKVPNMAGARAVDVSCGDTFTAVLDADGAVWTMGSNARGALGY"
FT   gene            429613..432273
FT                   /locus_tag="OSTLU_19853"
FT   mRNA            join(429613..429890,431074..432273)
FT                   /locus_tag="OSTLU_19853"
FT                   /product="predicted protein"
FT   CDS_pept        join(429878..429890,431074..432269)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_19853"
FT                   /product="predicted protein"
FT                   /note="GO_function: - argininosuccinate synthase activity;
FT                   ATP binding; GO_process: - arginine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_19853"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99955"
FT                   /db_xref="GOA:A4S8P4"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8P4"
FT                   /protein_id="ABO99955.1"
FT                   /translation="MSSAVVLAYSGGLDTSIILKWLQDTYGCEVVTFTADLGQGEELEP
FT                   ARAKAAQFGVKEIFVDDLREEFVRDYVFPMFRANALYEGTYLLGTSIARPLIAKRQIEI
FT                   AKQVGADAVCHGATGKGNDQVRFELGYYGLKPDVKVIAPWREWDLNSRTKLLAYADEAG
FT                   IPVAQSKRQDAPYSTDANLLHISYEGNALEDPWVEYSEDMFTRSVSPENAPDKPTYIEV
FT                   EFEKGDPVAIDGVKYSPADMLAKLNQLGGDNGIGRLDIVESRFVGMKSRGVYETPGGTI
FT                   LLAVRRALETICLDRGEMHYKDQMMPQYAELIYNGFWFSPEREMMQAAIDTCSESVTGT
FT                   VRAKLYKGNVIVVGRKAANTLYDDRLSTFEEDGGAYDQKDAAGFIKLQALRLRTLKVAR
FT                   EKK"
FT   gene            complement(<433262..>433669)
FT                   /locus_tag="OSTLU_8959"
FT   mRNA            complement(join(<433262..433436,433494..>433669))
FT                   /locus_tag="OSTLU_8959"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<433262..433436,433494..>433669))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_8959"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_8959"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00092"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8P5"
FT                   /protein_id="ABP00092.1"
FT                   /translation="EKLGRLKFQCYFDHEIDGMLRVKVVSAHGIKGSDLSGLSDPYVVV
FT                   KLHRVNESTAKIKATETVKKTLDPVWNETFEFERVDRGSESYVTFELWDHDMVGDDDLL
FT                   SQYAVRVREIKAA"
FT   gene            <436009..>436230
FT                   /locus_tag="OSTLU_9043"
FT   mRNA            <436009..>436230
FT                   /locus_tag="OSTLU_9043"
FT                   /product="predicted protein"
FT   CDS_pept        <436009..>436230
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_9043"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_9043"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99956"
FT                   /db_xref="GOA:A4S8P6"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8P6"
FT                   /protein_id="ABO99956.1"
FT                   /translation="YSREDVAKHAARDDLWVIIDGKVYDLTEYVDEHPGGADAIARNAG
FT                   GDATTGFNGPQHPSRVFDIVDDYLIGALK"
FT   gene            <436982..>438508
FT                   /locus_tag="OSTLU_1559"
FT   mRNA            join(<436982..437563,437633..>438508)
FT                   /locus_tag="OSTLU_1559"
FT                   /product="predicted protein"
FT   CDS_pept        join(<436982..437563,437633..>438508)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_1559"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_1559"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99957"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8P7"
FT                   /protein_id="ABO99957.1"
FT                   /translation="VNPVNLGRKSRAAFENVFKQLTSLTSFQKSTAPTNAREFDQVYDA
FT                   DLLSGSSVGEFETPNAKFTTVLVTGATGRIGRVLIRKLLLRGYTVKALVRRQEDVEKLP
FT                   GLVQVIVGDVGEKEVIKNAMIGVNKVIYCASAKTSVTSDLYNVADQGVKNVVSCMQDYY
FT                   HMLASRRAGRSAKSKVMLTNFKHPTAYEAWDRVNFDPLYPEDEDKPFEFATFNGFITSR
FT                   TGKAEVSSNVEGLQADVDFSAKEGLLFRLKGDGKRYSVMLTQDDGSKFRFSFNTTGGWQ
FT                   VIRMPFHKFVSEGKTSWGDDGDAILDLTRIEKIGVRFDARKNQRETTMSDVMSGNNNMF
FT                   NLTLEYVKAIPKGEEPDVILVSCFGAGLEEGEEKERILKIKRDGERVLRNSGVGYTIVR
FT                   PGELVEEAGGGKALVFDQTERINTPISCADVSDVCVKAMHDEEARNKSFDVGYEYESEQ
FT                   AEYELITQVKGKSDNYLTPALKVLEKNS"
FT   gene            complement(<438634..>439194)
FT                   /locus_tag="OSTLU_7611"
FT   mRNA            complement(<438634..>439194)
FT                   /locus_tag="OSTLU_7611"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<438634..>439194)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_7611"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_7611"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00093"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039856"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8P8"
FT                   /protein_id="ABP00093.1"
FT                   /translation="ATTLGKEGGAAEARKMLDEMLEENKGEARLRKMRVACAKSEGDVP
FT                   GAVAALTEYLEDFGADDEAWLELGKLYAERCEYEKALFCYEEVLCARPFDPNSHRRMGE
FT                   VLYTMGGEENIRDAKHHFAAAIDFTNGKDIRALYAVILCVKKLRIMSSKRGEEFKDNGA
FT                   LELADAATERLLQRYASDNETLLS"
FT   gene            <440054..>440416
FT                   /locus_tag="OSTLU_40699"
FT   mRNA            <440054..>440416
FT                   /locus_tag="OSTLU_40699"
FT                   /product="predicted protein"
FT   CDS_pept        <440054..440416
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40699"
FT                   /product="predicted protein"
FT                   /note="GO_component: - mitochondrial inner membrane;
FT                   GO_function: - electron transporter activity; NADH
FT                   dehydrogenase (ubiquinone) activity; GO_process: - electron
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40699"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99958"
FT                   /db_xref="GOA:A4S8P9"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8P9"
FT                   /protein_id="ABO99958.1"
FT                   /translation="ARRHLESRSGEKVGEDELGNAYYENKSYQQGRSRWVVPKNLDDYS
FT                   AANIPREWHGWLHHINDEPGLPNATTPIYEDASPYFVAGKSNAGTYLPKGHFLRQRPSD
FT                   AGVTRSWAKYQPWSPP"
FT   gene            <441037..>442410
FT                   /locus_tag="OSTLU_40656"
FT   mRNA            join(<441037..441416,441531..442015,442058..>442410)
FT                   /locus_tag="OSTLU_40656"
FT                   /product="MIT family transporter: magnesium ion"
FT   CDS_pept        join(441037..441416,441531..442015,442058..442410)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40656"
FT                   /product="MIT family transporter: magnesium ion"
FT                   /note="GO_component: - membrane; GO_function: - metal ion
FT                   transporter activity; GO_process: - metal ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40656"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99959"
FT                   /db_xref="GOA:A4S8Q0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR039204"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8Q0"
FT                   /protein_id="ABO99959.1"
FT                   /translation="MVGKPPRGVGNYDKPNGDDIEPVKAVPVSTSGRAKVGWVRINTLG
FT                   VVNRLSMEKTKIATLLRVPLRDLRVLEPTTADSYSAAVLCRERAIVVNLEQIKVLITAE
FT                   EVIMTDSQTSTVTHFLPELQTRFETSPEKELRQAQPTTDEFPFEFVALEVALEMVCNTL
FT                   EVEANKVELDAKPALEALRKRVDNVNLERVRRMKTRLVRVAGRVSKVREEIQRYLDDDS
FT                   DMRDMYLTRKSKQQSESLRREGSVTSPPPNGADGGQRGATAHYQLEHALSASSGRSPLG
FT                   VHGVHTQNKDLQELEDLLETYFTHVDSTHRSLNGLNEYIDDLEDLIEIELDSQRNQLIK
FT                   LELILTTATLCLTCFSVVVGIFGMNIKNNVENEHGMFLLVVLLGSAATIGMFIILLRVC
FT                   RYYRLF"
FT   gene            <442664..>443284
FT                   /locus_tag="OSTLU_7494"
FT   mRNA            <442664..>443284
FT                   /locus_tag="OSTLU_7494"
FT                   /product="predicted protein"
FT   CDS_pept        <442664..>443284
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_7494"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_7494"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99960"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR032862"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8Q1"
FT                   /protein_id="ABO99960.1"
FT                   /translation="PGLAYCREFIGARDAEFVESALLREPAAWWTKGRGRRVMNAGGTS
FT                   PSRLYREGDDEAIPTYLRELVEVLVRRKASERAANHVLVNEYDADGFISPHSDGDVYAP
FT                   DVQILTLRSSALIEFWPAEGATAGDFDECDNIDAPRPVVSVLLEPRSLLMYRGEAYRLR
FT                   HGIRARVKDVVAAETANARELGLEIGDVVERNPAGRLSVVFVRK"
FT   gene            complement(<444125..445667)
FT                   /locus_tag="OSTLU_27929"
FT   mRNA            complement(<444125..445667)
FT                   /locus_tag="OSTLU_27929"
FT                   /product="predicted protein"
FT   CDS_pept        complement(444125..445321)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27929"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27929"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00094"
FT                   /db_xref="GOA:A4S8Q2"
FT                   /db_xref="InterPro:IPR022035"
FT                   /db_xref="InterPro:IPR039881"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8Q2"
FT                   /protein_id="ABP00094.1"
FT                   /translation="MKRVREAFRAACERRGGLEAPPQLALERWRFATKLAEEARGRTAA
FT                   AAGKGKTKRRRRGACGLVGENTDAMFPNVAHDGATKGTMANDLMRAGVSEAIAIEIEAS
FT                   VCAASAKEVVALEAMKQKLVDGGAHGLAKLAATKLTIHKHSRDLTLGDDYLVKLTHEAY
FT                   GKLRALYEKHSRAGGDDDGDDDVHDRMFALLLRYKTIHGHGFQAACSHDVFRVLHDDLK
FT                   VTMECFASPMNAYFARFCSAFGDVDAPFGSIGSFAAFQPSRGSYEVNPPFVREVLDEAA
FT                   LWCEALLERAEKSQNALTFVFIMPGWKETGAFDALTNSAFLRANVLIAAVDHGYCDGAS
FT                   HQRRDPYRASPYDTCVFVLQSSKAARDVGVKDTFATSVRVAMARAVPTLAQLKRQKRA"
FT   gene            445993..447032
FT                   /locus_tag="OSTLU_27930"
FT   mRNA            445993..447032
FT                   /locus_tag="OSTLU_27930"
FT                   /product="predicted protein"
FT   CDS_pept        446102..447001
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27930"
FT                   /product="predicted protein"
FT                   /note="GO_function: - nucleic acid binding"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27930"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99961"
FT                   /db_xref="GOA:A4S8Q3"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8Q3"
FT                   /protein_id="ABO99961.1"
FT                   /translation="MNADEMIADGDANGVDVRALDEAMAMDDDHASARKSASSAPANAN
FT                   PPLPPNARPRHEGRGGANGHGGERRRGGGERGGGRGGGRFQQRERAPTRPGWFATGEVD
FT                   EHSGRPAHSGQCEGCRVSTVVNFRPVVGGNPPLCGVCLDSLKAATAGGSVDGDNASGGP
FT                   NRGRRGGRNGAMMMMGMPHQGGFQGGARFSPYASGGQMVMIDPRMMAAYGGGRGGGMMA
FT                   AYGAAGAGGGGGRGKNRTWTREGGDAGAGVGGQEDVDTSGIPCIFFQRGACRAGDSCKY
FT                   SHSGEGSGAAPAEMNVEM"
FT   gene            complement(447082..448652)
FT                   /locus_tag="OSTLU_25632"
FT   mRNA            complement(447082..448652)
FT                   /locus_tag="OSTLU_25632"
FT                   /product="AAAP family transporter: amino acid"
FT   CDS_pept        complement(447202..448605)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25632"
FT                   /product="AAAP family transporter: amino acid"
FT                   /note="GO_component: - membrane; GO_function: - amino
FT                   acid-polyamine transporter activity; GO_process: - amino
FT                   acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25632"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00095"
FT                   /db_xref="GOA:A4S8Q4"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8Q4"
FT                   /protein_id="ABP00095.1"
FT                   /translation="MATTTATRATRGCVAGRATARPTRRGVAIERRARARRGFARVPLD
FT                   AGRARRDDATTIAGRGTREARATRTFASAGDASGENAAIVNTVKAIFGAGGFALPWAFA
FT                   QGGIALVGTCMAASLVFALEALRMLIKAQDALVGAGASTASEVATYAGLTNAAMGRAGD
FT                   AACRVMNVLTCFGITVSYLIFIAETMKVVVPALGVSAFGASPTTASMLALVGPLMIALS
FT                   WLREMSGVAVISAVGTASVAVGMAVTTATALSNPLQLGALPVANFAAFPGFFGTVAFLF
FT                   FIHFTLFGIKEAMPQPDKFFGAAVKAFTGAAVIAGLFGVAGAAGFGTGVSSVVVTMLTG
FT                   PSGIAVQLLLCLNLLSTYPIMAQSALRICENVLEGDKPGSIGAPQALAVRTAFTAGALW
FT                   TAANVPNFGVVLGYVGGVCCSILSLVLPAMILYLTQKKVKAEIVPLELARIGGVFVTGV
FT                   TCIVLSIVL"
FT   gene            <449077..>450405
FT                   /locus_tag="OSTLU_27932"
FT   mRNA            <449077..>450405
FT                   /locus_tag="OSTLU_27932"
FT                   /product="predicted protein"
FT   CDS_pept        449077..450405
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27932"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27932"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99962"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8Q5"
FT                   /protein_id="ABO99962.1"
FT                   /translation="MEALTRDGTTINAPFCFTAGAIGLKRALHLEAWARLRGGEFRGRD
FT                   GEIFGVAGGCVGYGECEVGVYASRANGDIAEWHRDACDNATIQLVGKKQWEVEVYRDAR
FT                   DGAELREELRGKSRNASASDEATCGADYIEQIWTETEIVTRVIGPGETICVPRGRMHRV
FT                   VPLGEGVSVSADIRMTTIESAEIAAEIAYLKAIALYDERSVSKRPVELPPIHWLPFEEE
FT                   FSDGLVLGARLEYIVAAAANRSGTHDDATTYEPVRRTDGTEKLGVSARAETLRRSPTAV
FT                   LHPSCACAVRDDDERGDYHVFNVKATSALTNKDLMSEFNIYVRRDSVREGEMRAFNSPV
FT                   DFIEAELGRLERQSPDRGNDRRLVARDSGEFSDAVSSLRGVLYDANILLPPGNDWWFFW
FT                   CNTSKRLSDAHPSGLARRDRSPAAVRIPSIQQSIGLRAIASQN"
FT   gene            complement(<450459..>452963)
FT                   /locus_tag="OSTLU_40456"
FT   mRNA            complement(<450459..>452963)
FT                   /locus_tag="OSTLU_40456"
FT                   /product="predicted protein"
FT   CDS_pept        complement(450459..>452963)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40456"
FT                   /product="predicted protein"
FT                   /note="GO_function: - subtilase activity; GO_process: -
FT                   proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40456"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00096"
FT                   /db_xref="GOA:A4S8Q6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034185"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8Q6"
FT                   /protein_id="ABP00096.1"
FT                   /translation="RRSLLGDVSIAKSMGAPTLWEQGYTGAGVKMAVFDTGIAEDHPHF
FT                   RHIVERTNWTNENQLHDGLGHGSFVAGVVAGTSKQCAGFAPDALIHTFRVFTNDQNSYT
FT                   SWFLDGFNYAIATGVHVLNLSIGGPDYLDRPFTDKINEITAAGIIMISAIGNDGPLYGT
FT                   LNNPADNLDIIGVGGITDADAIAHFSSRGMTTMELPSGYGRVKPDIVTYGDGIWGSKVG
FT                   DGCRALSGTSVASPVAAGAAVLLSSIIPESERWSVLNPAVMKQALVEGATRIPLAHRYE
FT                   QGAGKLDLLKSAEILKTYTPRASVIPATFDLTECPYAWPHCKQGIYATMMPLMLNATIV
FT                   NGLGTHGEIVSGPDFIPNDGDLGAHLDVRFAFSETLWPYSGFLALYVRVQDDAATKSGV
FT                   ASGRVRFTVASSGARGETKLRVSEVEMTLKVNVVPTPSRDKRLLWDQFHNVRYPPGYIP
FT                   RDNIDMKQDVLDWHGDHPHTNFHQWYDDLTRAGYFVEVLGSPFTCFDAKNYGALLLIDL
FT                   EEEYASDEIAKLTRDVREEGLGLVVFADWYDLTTMESLKFFDDNTHYEWHAATGGANVP
FT                   ALNDLLKDFGIQFGGEVTEDSIVFDDDQVIVSSGTHITRAPAGAYLHSERMTQRGKAEG
FT                   DYAFLSLFEAGKGRIFAFVDSNCVDSSHMRGQCFGFARKGVEFAVGGSCAAAHCDDRKR
FT                   LAESWSDSKPLPSRRTDVDFSRFSTVLGGHPGNEGSMTCGPNAPLDRHDAKAAYSDLPG
FT                   RLKVSESEKTSLKTTVPQRPMKDSRTTLDVKTDYVATDRADDGSNVRYYVVAFGVVAAL
FT                   LAPRARRRRARRARLRASGGAS"
FT   gene            454075..455511
FT                   /locus_tag="OSTLU_27934"
FT   mRNA            454075..455511
FT                   /locus_tag="OSTLU_27934"
FT                   /product="predicted protein"
FT   CDS_pept        454231..455406
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27934"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27934"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99963"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8Q7"
FT                   /protein_id="ABO99963.1"
FT                   /translation="MWVDAVERVVAADAEDDAEGVETTAATRGRWIPTKARVGGDFDVG
FT                   EESDDAEREDAEASSDADDAYEANATLRALDDEVWIENYGQAKRRRARAKFLRAHGVDP
FT                   KTTSGTAAFAALGATRDDCPAAYFAPKVGAASLGGPGASELPEHFAKFSVHATKLAALA
FT                   DQIYILCTECSLGIPEDWRAKTSFVHGFRIDECLKTQGIDHWHKASFSHAHALMDAQKK
FT                   QHKTVAIIEEDVITRDFADGGVGWRMLLDNLGHVRDTMRLEKDWRTIRVGYRAMFIDRS
FT                   IESVSKLEGKETCPKDCRCEKKNAFTCIMRQSGCDMRSSDFYLVREAAYQPIIDKIYEG
FT                   YTVDCEALREVPNQIYITPQLSFQGTLDLKLQTQIQMGEEFMQKCAVGATA"
FT   gene            <455874..>456218
FT                   /locus_tag="OSTLU_27935"
FT   mRNA            <455874..>456218
FT                   /locus_tag="OSTLU_27935"
FT                   /product="predicted protein"
FT   CDS_pept        455874..456218
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27935"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27935"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99964"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8Q8"
FT                   /protein_id="ABO99964.1"
FT                   /translation="MLLVKLWIAKKLAVLLAVRAFGVKRLYRRGLKLSRYAFGDVEASE
FT                   NAYRRTTERVLWHTCHAAMITEQWLVRRATAFTEKVFTNAGFSARGMPSGGEAFGGTKA
FT                   TPKPPKTKTP"
FT   gene            complement(<456404..>458029)
FT                   /locus_tag="OSTLU_40637"
FT   mRNA            complement(join(<456404..456955,457049..>458029))
FT                   /locus_tag="OSTLU_40637"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(456404..456955,457049..458029))
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_40637"
FT                   /product="predicted protein"
FT                   /note="GO_function: - oxidoreductase activity; GO_process:
FT                   - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_40637"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00097"
FT                   /db_xref="GOA:A4S8Q9"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8Q9"
FT                   /protein_id="ABP00097.1"
FT                   /translation="MDKRTTRSATVRRHRSAVRLEATSEAATAETNAPPAAAGESFDWS
FT                   SAWYPLRPVSFLDANEPNELRVLGKKLVAYLDPTCKEWRVLEDSCPHRRAPLSLGYVQK
FT                   DGTLACRYHGWAFDGKDGSCVSIPMSVDEAAEKTACASPRSCATSYPSRVEDGILWVWP
FT                   TAGADGLLASAGAPCATSLAREGTLPGEWGMVELPVGYAPALENQFDPSHAEWLHARYD
FT                   AEGQLDERANAGFVAMTEFSVREGTMQKDGFVVEHGGYNKSNVGVSASRVFTAPCSSRS
FT                   EYLDAKGKKYLSAAILYAPTEPGRTLMFTKFQAHQASAVQGAGARKLVRVGLSHGTPPG
FT                   SSAYNLGDQDILAMHGVEVEMELQNKPWKQSYYLPTPADAGVSAFRNWMDKHAGGKVAW
FT                   APGVVDDASKVKSEAEQLDRYHRHTKHCVACKTALSELGVLEERCVAASKYLLAGGLFL
FT                   AVTGAAFDQEAPAIIATCLAGASLVGAEKVRDMQHEFLSSVPRRGVPKPKLW"
FT   gene            complement(<458230..>458532)
FT                   /locus_tag="OSTLU_27937"
FT   mRNA            complement(<458230..>458532)
FT                   /locus_tag="OSTLU_27937"
FT                   /product="predicted protein"
FT   CDS_pept        complement(458230..458532)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27937"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27937"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00098"
FT                   /db_xref="GOA:A4S8R0"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR029003"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8R0"
FT                   /protein_id="ABP00098.1"
FT                   /translation="MGDVGDGDGDANLFEHLKSHVVRVAERVARSHDKSLTPKTAHALS
FT                   ELSYELTKSIARDVRAYANHADRDVVGVKDCDLRARRLRQLVERRRRAMDEDGDE"
FT   gene            complement(<458614..>459171)
FT                   /locus_tag="OSTLU_27938"
FT   mRNA            complement(<458614..>459171)
FT                   /locus_tag="OSTLU_27938"
FT                   /product="predicted protein"
FT   CDS_pept        complement(458614..459171)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27938"
FT                   /product="predicted protein"
FT                   /note="GO_function: - structural molecule activity"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27938"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00099"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="InterPro:IPR039633"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8R1"
FT                   /protein_id="ABP00099.1"
FT                   /translation="MRRASSSRASSSSSSSSLFELVDASRRGVGVAPNDDARRDIERAI
FT                   DALASTTRAKGDDARSNNAKSYARWELAYTTEKETLWLLGLKTRSKTRAFQTLREDAKT
FT                   LSNEVVFNDGEVVFKVDAVVEESSRATMKFRFTAASLTFRDKFSIPIPPVGSGWFENVY
FT                   VDDERRVSRDSRGDTLICVKVK"
FT   gene            459424..461042
FT                   /locus_tag="OSTLU_25634"
FT   mRNA            459424..461042
FT                   /locus_tag="OSTLU_25634"
FT                   /product="predicted protein"
FT   CDS_pept        459496..460920
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_25634"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_25634"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99965"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8R2"
FT                   /protein_id="ABO99965.1"
FT                   /translation="MGPCMSVLEAAGVNLAALPPTGPYAMSSEESLSFLTNAATFDSNG
FT                   AGKPFGKLVQLRGGSHTLAKAFGLAPGGTHNCFMYVDKAECKISKDAKPLNGATIDVSD
FT                   GELQLWYCQGAAISMPVACVKVNGGSARAILPRLHAVDLYVEIDGKAYADGHVCYGSDA
FT                   NLSRDKAIDAAVKNTFEGELWMKDFLKKGPSDGSKPWATIVKDERWGDDDGYVYLPLMA
FT                   NDVDNALMGDDKLTYVHSLMSKWAQLMGKIGAGAHSFTVRIRPRGVIYKDEDGAPMFDS
FT                   IGGGSDDNDAVLGMCGQHLTDPNAPGMSATWTMTLDAAQASGKGPVRKAQEFTNWPAGE
FT                   IEECIEMAMDFANKGVCGRKAAEMAPKSKCCHIILSDGDQGSGIKTARYGNGEREYDFF
FT                   CAWALFKNANGKPDSLGAQIKFVVKKKKIVNFRPVDEDWHSAGFETAAVGVESVTGLTI
FT                   TNAEIDAAIARDAQYY"
FT   gene            complement(<461103..>461288)
FT                   /locus_tag="OSTLU_27940"
FT   mRNA            complement(<461103..>461288)
FT                   /locus_tag="OSTLU_27940"
FT                   /product="predicted protein"
FT   CDS_pept        complement(461103..461288)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27940"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27940"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00100"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8R3"
FT                   /protein_id="ABP00100.1"
FT                   /translation="MKQTRIANLRRELDAAEEDVWLRTLACNRPAFAKDVSLDEKCRAF
FT                   EALERALRSETRQIAA"
FT   gene            complement(<461392..>462945)
FT                   /locus_tag="OSTLU_27941"
FT   mRNA            complement(<461392..>462945)
FT                   /locus_tag="OSTLU_27941"
FT                   /product="predicted protein"
FT   CDS_pept        complement(461392..462945)
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27941"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27941"
FT                   /db_xref="EnsemblGenomes-Tr:ABP00101"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8R4"
FT                   /protein_id="ABP00101.1"
FT                   /translation="MYAPPSEAREWLRPAIDWLEETYPVDLSKVEPLYNNPNVSHEWIN
FT                   IARPGGGIHSFASCLDKWLPDSENVDLFIFEFSATLELMDEGSVAEVHLARLTHELETI
FT                   MHQLTQRKQIIEGSEEKRNMPAFMIVHAQNWCSPRFAKVSSGDSFAATRQLCRELPDSL
FT                   IFKGYNLDVPRKEAMKSAIRDAYTRYHPVLDVYERLSEHYGIPVVNLRRGMFDVMRDST
FT                   QDESAPFALLDWTRDGLHPTQPNATRIVGSYFVNGLRMAIDATRLAYADEGGRKPLTSY
FT                   APFTFVSVEARDSDEQGRYVSSAYWSARDDAVSPPKDAAPGKLPPMLSSSKTAQIVSKC
FT                   YEFGKETLTHGGDVVDDIESSGFFAWPPIVDESPDWTYVEREESGRTAHKPGYVATKKG
FT                   AYIVVRQSLGKPFGKVKGVTILVSTLHSWSGYGTIAVSCSNGCSCEERVVSTQWERRVS
FT                   LTNADSIPITIDGVSLDAGPQSVEFDGSNTCDVRIEVTSGDGHRVKLIGISTSYETVVE
FT                   "
FT   gene            <463931..>466066
FT                   /locus_tag="OSTLU_1175"
FT   mRNA            <463931..>466066
FT                   /locus_tag="OSTLU_1175"
FT                   /product="predicted protein"
FT   CDS_pept        <463931..>466066
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_1175"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_1175"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99966"
FT                   /db_xref="GOA:A4S8R5"
FT                   /db_xref="InterPro:IPR019465"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8R5"
FT                   /protein_id="ABO99966.1"
FT                   /translation="RTMEALIRDEVIGKRETLEEALRGVEEAEATMKTIREGANEIADA
FT                   MRRVAREIGEPHESVEASTRTLERVMATGETLRGVVKVLKLTSKLRECYGGGDDETRSR
FT                   DASELSKAAKLLGEVKLTLKSAGRDFDGVDVVDEQMVFIQDCSVAVSREANEALDRGME
FT                   TASQADVGAALQVHYNLNELSAVVDARVASYTNAAVDAVKDAVDAESVGKTATGASGDG
FT                   ARRGSRGLVAPPSGAEHAWEDALWRRVDVAMETVQENAMAVWHLQRVLAKKRDPLTQTL
FT                   FLDEVVGKTASTQALCDRFWAVFAKGVSEHLSRTHAAGGFVSRALQKGFPSLIGALEDA
FT                   VAKCARDADAAKGAPGCTRKDGTTRALVLRACEPIAAAFFAHSSSRLSDAANYCFADGR
FT                   VIDEASADRFLSRIRAEIDVVAEYDNLLNNACGNASSALKTLADRAKRSIGRSIEASSL
FT                   TEEATPTQRANAQIAEQLARAHGLMSKVLPSFAPTPKRALEVGLEHIESAVREATRPLF
FT                   DAVGDWCDARFTQMHNTDYSSTASDGSAKHIIAVTSTLGHVADSHPGLFTAARGPLFAA
FT                   RVALGDRILHSFVVHASLIRDFDQGGKMRLVKECGEIELAVVKTLRLAGAETESMEFKS
FT                   IKAFKSLVLLPTENIEASPLVRDVSRRALLHHLYSRAPAELTTPANRASLSQTQYASWL
FT                   LKKASDAEVWRGVKGTLD"
FT   gene            <466652..>467830
FT                   /locus_tag="OSTLU_18435"
FT   mRNA            <466652..>467830
FT                   /locus_tag="OSTLU_18435"
FT                   /product="predicted protein"
FT   CDS_pept        466652..467830
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_18435"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_18435"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99967"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8R6"
FT                   /protein_id="ABO99967.1"
FT                   /translation="MAAHSREREEARREVVRETRYSFRCDMLDDAETSGVLNDELVEAW
FT                   NSLLRENHISKDDETGDGFGARDDDDEDGDRVDCMDLDARFRAHVDACKTALEPKESLA
FT                   ARLKAHLVAEVDARFDDAIHEHRLEIGKARRLAAEERLTRKNAVEEVISNTKTTFGETS
FT                   TRRDALRSEALAATDRSAAAEDADLSARSRREADARRASLIEIKLRNASEVSELRACLE
FT                   HRVSEAFSRLQYAIARAPLRAERLRDAMKRRRGDEARRRARERLASRAMKDTRFELQEM
FT                   KRCYTETERANAGRDRKLRLATLKTTSRVGSIESIGAKSERGDKMNAILSMKQTRIANL
FT                   RRELDAAEEDVWLRALACNRPAFAKDVSLDEKCRAFEALERALRSETRQIAA"
FT   gene            <467950..>468099
FT                   /locus_tag="OSTLU_27944"
FT   mRNA            <467950..>468099
FT                   /locus_tag="OSTLU_27944"
FT                   /product="predicted protein"
FT   CDS_pept        467950..468099
FT                   /codon_start=1
FT                   /locus_tag="OSTLU_27944"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:OSTLU_27944"
FT                   /db_xref="EnsemblGenomes-Tr:ABO99968"
FT                   /db_xref="UniProtKB/TrEMBL:A4S8R7"
FT                   /protein_id="ABO99968.1"
FT                   /translation="MDTRGVVPAMVGTCRLSSNTNTEEGTLTQESGDVRSVEGEVCGAV
FT                   LVDA"
XX
SQ   Sequence 468366 BP; 90135 A; 144054 C; 143705 G; 90472 T; 0 other;
     ccctaaaccc taaaccctaa accctaaacc ctaaacccta aaccctaaac cctaaaccct        60
     aaaccctaaa ccctaaaccc taaaccctaa accctaaacc ctaaacccta aaccctaaac       120
     cctaaaccct aaaccctaaa ccctaaaccc taaaccctaa accctaaacc ctaaacccta       180
     aaccgaaacc ctaaacccta cgcatgaggg agggaggcgc ttcgggagaa gtgccgtaac       240
     cgaccgacta gctaatactt attacaccca accctaggtt ctctggatcg tactaaaccc       300
     gaaaagtcac tagcattcgc atccgtcctg tgcaccttca cgacacccta cggccatcac       360
     tcgtcgacca gcacggcacc gcagacttcc ccctcgacgc tccggacgtc tccggactct       420
     tgcgtcaaag tgccttcttc agtgttcgtg ttgggcgaca aacgaccggt cgtagtttgt       480
     cctctgtgaa aataatggaa ccccaagcac tcatcttgcg tgacacacag tcgatttggg       540
     tagaaagcct gcggaggatc ctttatgccg caagctaaac cctagtttca gggaggcgcg       600
     ttcgaggggc gacgcgctgg gagacgacgc gggacgacga cggcgcgggt tcgttgtgat       660
     attacgagag aatttcgact ctctcttcga ttcgtatttt tttagatttt tccgactcat       720
     ctaattctcg cacatcctcg gtgtactcgc gccgtgcgcg ctcgcttcgc gcgctcgcgt       780
     ctcgaggggc gaatctcttc agcaggacag gcaaggcaaa acaattaatt cttcttcatg       840
     ttcgctatcg ttgctagtcg ctaaattcga aacatcaaag tggttcgccg tctttcaggc       900
     atttgtcgat gtgcgcgtta atggtttcgc ttttcgcgcc ttccggaaac tgttcgccgc       960
     agatgcagca ttctgctttc gtccgtttat tcgcgttttc agtgagatcg aagaacggct      1020
     tcttcggttt gtcttgttga accgcggtga caccgacggc ttggtgagat cgttttgacg      1080
     aagcggcgtt tgtcgccggt ttcgccttcg cggcggcgcc gaagaaatcc acaatcgtct      1140
     tcgtcttccg aaagcacttc gccctggagg ctgcgtctac cggggtaggt gcttcgatcg      1200
     acacacctaa gatggcgttc atattttcgt cgccgtcgcc gtcaccgcca tccaacaaag      1260
     cgagcgactc cggagtggag aatttttctg cccattgaac ttcgatgctt tccttcacgt      1320
     gcgcaagcaa ggtctcggga tatctcaaac cgatgacttt gcggccaact tcgtcgacga      1380
     cacgcaccgt gcgcatgccg cgatcggcct tattaaactt gtgcgcgttt ctatccaaag      1440
     ttcgttcgag ctctccccag caaggcacga cggcgccgct gatcacggtg cagtcaaccg      1500
     tgcgtttgcc cgcggtacaa gcgcccatgg tttgtcgaac gtgacaattc acgccgtgca      1560
     tgcaatgctt ctcggtcaat tcgtgcacaa gatcccacgg ttgtttcgcc acgtcgggcg      1620
     tgcacatcat gtatttgccg cgcaattcgt cgtactccat ctcgaaaaga cttgcgccgg      1680
     tgttcggacg ccacagcatg aacaagtttc gcgaacctgg cttggtgatg gccagaacga      1740
     cttgcgcgcg cccatacatc tcgcgcttca tcttgtagaa gccgtctcga tcgtgattct      1800
     tgctcttttc caaaatatcc agcgcacgct caaacgaaat accgcgatct atgaaaacct      1860
     tggtcgacac gagtttttgt ccgtggtacg gatccttaag aatcgtcttc gactctggtt      1920
     cgatgcgaat ggaagaacca ccgagatcgc tcacgccctc cgtgtacttc ccctcagcct      1980
     ttgctaattt gatttcgcaa tccaaggttt cagcaaagta tgcaaacatg atattttgcg      2040
     ttcgcaccgg aagtccaagt aggcgattga gaaacttgcg cacgtcgccg agatctttgt      2100
     tgccgtatcc aatttcctgc agcagcgtcg cttcttcgac cgaaaagccg tcatttcgca      2160
     gtccaacctg cactccgagc tccaataacg ctgaacgaag ttcaagcttc aaatcctgcc      2220
     agctcgagat gggtttcccc tcgagatcgt cgtcgttcac atgcgacatg atgccctcga      2280
     gcgtgacgcc cgacgggaga ttcgcatcga gcgcgacgag cgcctcgtag agcttcttca      2340
     acgcgtgtcg cccgagtgac gagtcgagat tgccatcgga taaatcaatg ccagtcgccg      2400
     cacgtcgatc acctctcgtc aacgccccga gactttgcaa gcgtcgtgcg acggcggcga      2460
     cgaagcgtct ttcgcctccg atattcgtcg agcacatcac gtacactgga cccgtaatct      2520
     gattggatcg atgcgtgcga ccgagctgct gaatcgcctt gtccgcactc catggaagtt      2580
     ctatcgtgac gtgcacgcgg cggcggacat ttttcgcgcc tttcgacgcg tgcaatgaaa      2640
     tcccggtact agccgcgtcc gaaattatgg ccacacgttt gtcaccattc ataaacgcgt      2700
     tcttctcggc gatgttcact ccgagcacat caccgtcgcc gctgatgctc gttccttttc      2760
     tagacgccgt cgtgccacgc gattcgtaca tgagcctatc gcctcgacgc acgatgcgac      2820
     cgcttcttcc cgtgagttcg gcaacttctg tcggccctcc gagcccatca atcagagcat      2880
     cgagaaagtt cggcggtaac ctcaacttga tgactttatt gatcaactct tccttagcgt      2940
     ccacgagctc ttcgtcgacc ttggctgggg cattcgtgtg aaaacgacca gtgtagcctt      3000
     cgctctctac ctccgcgccg cctgcacgcc tccaatcgct cgaccaatcg gaaggcgccg      3060
     acttttccgc cgccgctccg tctgaagcgc cgtggatttc agtcggaaag tgcacgttca      3120
     agaaattgac gagcatttcg cgcgtcgtac tcaggaaccc gaactccgtg acgtcttcac      3180
     caaaagtcaa gttggctgac gcatcttgag actcacctgt cgtttgcaac ccgatgacga      3240
     cgcattgctc tcgcgcgagc gcctcgttcg ccttggcgat gaccgccgga actttcatgc      3300
     tgatgcacaa gagcttgaag aatctttgat ggacgctcca atacgcactc caaacgcctt      3360
     ttccatcgga accagttcga cgcacagctt cgatacacgc attacggatg agcgacatca      3420
     agtcgcacgc gtcatcgtac atttgacgct gctctttgct gagcgcgatc gtgtactgct      3480
     caaactctgc ctgcctaaaa gataaacctc gactaacata cttcccactt gccttcattt      3540
     ccatggcgag catttctaaa aatcctacac cgcgagactt catgctctca atgaacgtat      3600
     ccgcggattt aaatggcgtc cctttgcccc agaaaccgag tctggccaag taggtcatgt      3660
     gcccaacttc agagatacct gtggcgctcg cgtacacaac gcgcgcgcga ggacagcgtt      3720
     cctgaaacgc aatcacagcc gccgcaactt tactacccga atcagaagac gcgctaaagt      3780
     tctttgcctt gtggcactcg tcaaaaatca cgacgccctc ggcgtcttcg ccgccgaacc      3840
     aatttacgat ttgatcgaga cgactcttct tctgcgtctt gctcactaac gtgctgtagg      3900
     tggtaaacaa cacgccctct tgatactctt tcgataaccc gaacgcgcga gtttcgcgat      3960
     cgagctctgg gcacgaatta ataaccttaa tagtgcttcc caaatcgctc aagtcgcgct      4020
     cggcgtctcg gtgtaaatcg cccgagctcg atatccaaac cgctttccga cggcctcgca      4080
     cgaaattatc gataataatt ccactaattt gtcgtccctt gcccaccccc gcaccgtcgc      4140
     caatcatgaa acccgaacgc ttgccatccg gcgcgaattc gcagtgcttt tgacacgcga      4200
     acatgacacc ctccagttgg agcttgctca gttttccagt ctccacgaaa tcgtcgccga      4260
     tggcgtcaaa taaaggatac ttggccggtg gtaaatcgat gctcgccagc gacgcggctt      4320
     cggcgatatc tcccgggtgt acgcgtcctc tctgcgcccg tcgatgaaat aatatatgcc      4380
     cagtcagtcg tcggttttga atcatcttgc aaaagcatcc gtctcgacgc gaacgtgcgc      4440
     gcgcgcgccg tacctcgatg gagtgacacg tgtatccgct gaaaacttca cccacgacct      4500
     cgctcacgga ctcctgcgcc cctaacccat cgttcccgcg ttcgctcgac ggaaggccgt      4560
     cgtgcgcgcg cgatgccgac agctcgacgt cgtcgccacc gttcgtcgtc gtcgtcgtcg      4620
     tcgcgcgcgc accgccgtcc tcgctggaca tgacgacgac gagtcgcacg ttcgcgattg      4680
     aaccgtcgcc gcggtcaccg cgctcgcgat cacagcgcgc gcgcttctat gtcggcagtc      4740
     tggggcgctg gcgtcatcgg cgtccatcgg tccgcacacg acgccgcaca cgtccgcaca      4800
     cgacgccgcc gttcggtgcg aaaccgtcgc gatagacgac gacgacgacg aggacgatcg      4860
     ttcgtatggg ttggttcacg tctagcgcga cgacggtcga ggggtgtcag cgaatcgcca      4920
     gcgcgtgcgc gcccaaggca tccgcgttga agcagtgcgt cgcgattaac ggcgaacgcg      4980
     cgtgcgaggg gttggcgagc gattacgagc tgtgccgagc gacgcgaatg aaggcatgcg      5040
     aagacatcgc agaggcgttc gagaagtgcg gacgaaagaa cgtccactgg aacgggcttc      5100
     cagaggacgc gcccgattgc gcgcgcgagc tcaaggcgat gcgcaagtgt gtgcggaaaa      5160
     actggagaac ggcgtgagaa cgacggacgc gcgcgtgggg aatttatttt taatgttaga      5220
     tctcattagt taccggtaga cgtgatccat cgttccttcg ccgcgaacgc cctcgcgcgg      5280
     acgctcgacg ccgcgcagac cgcacaccgc aacgcatgcg cggggcgata gcgcgagagt      5340
     cgcgtcgtcg tgcgaacatg tccgacgctc ccgcttcgtc gacggcgtgg tggcgtcgtc      5400
     gcgagctcct cgcgacgcgc acgacgacga cgacgacgac gacggcgacg acgacgacga      5460
     cggcagagga ggagcggctc gcgaatgatg cgaaagcgcg agttcaaagc ggcgttctgg      5520
     cgacgttcgc gacgtggttc gatcatcgag gcggaaaaat acacgaaagg gtgcgcatga      5580
     cgtacagacc gaatttcggt tggtcgctcg aggcggacgg tgacatcgcc gacggcgaga      5640
     ggctcgtctc tctgccgccg aaactcatgt tgcggtgcga ctccgacgac gtcagcgagc      5700
     cgctgaagaa cgtcgtcgat cgagtgccga acgaattttg gagctcgaaa gtaggcttgg      5760
     tgctgcttcg cgagcgcgtg gccggcgccc actcggcgtt tgcaccatat atcacgctcc      5820
     ttcctgcggt acacgaaggc tcgcccacgt ttttcccgcc ggacgccgtt cgagcgctgg      5880
     aatacgctcc gatcgtacag caaatcaata agcgtgcgcg attcctcggt actttcgctg      5940
     gaaacgctct aacggtggat gatggcgaga gttacgtcga cgaagctcac cctgggcgac      6000
     agcgcgtgga gatgacgatt gacgcgaacg cgctcggatg ggccactgct tgcgcgagca      6060
     gcagggcgtt caaggttggt gcgaactcgg ctccggcgat gcttccggtc atagatatct      6120
     gcaaccactc gttcaatcca tccgtcagtg tgcgggctat cgaagaaggc gacaacgccg      6180
     gtggcgtcga gttgattgct cgacgcgcgt tgacgtccgg cgagcccata gagttgagct      6240
     acgggaactt gtccaacgac gagctattgc tcgattacgg attcatagtc aaagacaatc      6300
     cgttcgactg cgtgaaactc aggtgggact taaagctcat cgagctcgct cgcgaaatcg      6360
     gaggcttagc cgcagcaccg atcggtgcgg cgacgagcga gtcggcgagc gaatccgcga      6420
     cgcatctaga caccgtcgcg aaggtggcgc cttggcaagc gacggcgctt gagagaattg      6480
     gattagtcgg agatgacccg aacgttgagt taagcgtgtt cggcgcgggt caagtgatgg      6540
     ataaaaaggc gctcgcgggc ctacgcgtgt tatattcgaa atcatcggcg gaggcttcgc      6600
     gcgcggcgga cgcgccgttc ggcgagattg acgcagacgt ggtttcgaag gatacggaaa      6660
     tcaaagctct gcgcacgtgc atgtctcttt tggctttggc gctcggcaac ttctcgacga      6720
     cgctcgagaa ggacgaagag ttacacgacg ccgcgacgtc tccgcaagtg aggttagcca      6780
     tcgcttttcg catggagaag aaaaaagtgc tggcgaagag tatggcacgc ttaaacgaat      6840
     cgatcgagcg tctgcagaga gacgagtagc gacatagcga ctcattagaa caattatcaa      6900
     gatcttgatg gatatactgc gtaaaccttg acatctggaa gtgaaattta atattgcacc      6960
     tttctctaaa cgtatcggca attagatgtc gccgtaatcg atgacgacgc ggctctcagt      7020
     gacggcggcg tccaagtccg tgtacctagc cattcccttg atcatcttcg ctccgccagt      7080
     tcccatggga acctgcacga actgaccgtc gggtccggag cctgggactt gcatcatcat      7140
     cacccctccg aaccgctttt tgtgatcctt tttgttctcc ttgcggtgtt cgtcgtactt      7200
     taagaattcg acgacattct tgcggtactg ttcgtcaaaa agccgctctc gcatgtcttc      7260
     gacgtgatgc gcttgcttcg tcttgatgtg cttgatgacg aattcttccg cgacaaagag      7320
     cttggtgctc aacgtgcaac caaatctttg ctcgtcgtgt ttcacgacgc aagattgaat      7380
     ccactcgtcg agcttgctct cgatctcaga cgtgccgagc ttcttcacct ggggatcgcc      7440
     ctccgcgatg cgtcgcttca cgttcgcgtc gaccgtcgcg aacagacgaa cggcgtacgg      7500
     attttgcgca atcgaggaga ccggggtgtc ctccggcttt ggatcgcgct tcgcgaacgc      7560
     cgagggaagc ttttcaagaa acgtcaccgg ttgcatttcg gagatacgtc tgtagtaatc      7620
     cacgccgtgc acgcgaacca agtagcacaa tcgctcgtcc aacttctccg gcgtgctagc      7680
     ctcgtttccg agcgcctcga gcgcggcgac gtcgtcctcg gcggcttcgg cgtccatccc      7740
     cgagtcttcg tcgccgtcca acaatggatt gttgtcgatg cccttttccg cgtccaaggc      7800
     ggcgatgagt cgaccggttt gcttatagtc ggttccgagg cgagtggggt gccacgcttc      7860
     gatgggcacc atcgagcgcc tcttttcctg ctggtgttca ccttggtgtt cgccttcgcc      7920
     catgtcggcg tcttttcctt ccgcgtcacc ttcgtcgtaa atccgtaagc tcccgtccgc      7980
     tttcgacgcg aagaactcgt gcgcacgggc gcaagcgagc tcgtcgcgtc tcttcagcgt      8040
     ctccacgagc acgcgcggat catttcgcgc gcgttcgcct tcgtcgtgcc tgtgatctcg      8100
     aaagtacctc tcgtaaaacg cctcttgatt ctccttcttg tactcttcgt atcgcctctc      8160
     agcctccgcg ggcgtggtgt cgtcgcgcaa gtacttgtag cagaaatcac gaaacgacag      8220
     cgcgccgtcg tcgcgccgtc ctcgccctcg tcctcccccg cctcgtcccc cgcctcgtcc      8280
     gccgcggtgg ccgtcgtcgc cgtacgggtg gtgtcgatct ccgccgcgat cgcctcgtcc      8340
     gcgtcctctt ctccggcttc ctcccccccc gtcgtcgtaa tactgctcct ggtcgacgtc      8400
     catcgcgacc ggctcgacct cgacctcggt tcgcgtctac cgcgcgcgcg ccgtcgcgct      8460
     cgagatcaga ttcgcgccga cgcgggtccg tctcgttgcc gtctctgcgt cgcggcttcg      8520
     acgacgacgc gagcgatcga cgcgcggttc tcgtctcgat cgacgagcgc gcgcgagtgc      8580
     cgagcgcgcg cgcgtgacgt cgcgaaccgc gaacgtgtgc gaatggcgtc gattctcgcg      8640
     cctgaaaaaa cgcgcgcgat gcatcaacct agggtttcgc gcgcgtgtgt ttattttcgc      8700
     gcgaacgcgc gcacgatttc gtattcgagt gacgttcaga cctgcgtaga tttcgaccga      8760
     ccgcgtatgc gtcacgatcg agacgtcgac tttcttcgcg caacgcgcgc gaatagacac      8820
     ggcgtcacac acgcccgcga ttgaacgcga ttgaacgcgc gcggcgcgcg cgggcgacgc      8880
     gccgacgtcg tgccgcgcgt cgcgccgcgg aacgagtgcg tcgcgtcgcg cgaggcgcgc      8940
     gagcactcga cgcgcgcgcg cgttcgagcg cggcggcgtg gccgcgcgcg gcgagaggtg      9000
     gaccgacgcg cgcgcgagcg cgcgagcgcg cgacgttcgt tcgggcggtg acgttcgttc      9060
     gggcggtgcg cgcgccgagg cgtcgggttc tcgcgaggtc gcacgtcacc cgcgcagaga      9120
     acgcgtatgt cgacgcaaca cggcacgcgc gcgcgggcgc ttgcgcgcga tcgtcggcgc      9180
     aaagcggtcg aaggagcaaa cgcgctcgac gtgaaaacga ccgggacgcc gcgcgtcgcc      9240
     gcgcgacttc acacagacga accgaccgat gttgccacgg catccgacgc ggagaagaac      9300
     agggttagct ctgcgagcgc ggcgaaagcg tcttcaagat cgaaacgtgc gaagggtgaa      9360
     ctcacagagt cgccgacgtc gccgaaacgc gaaggcgagt cggcggacgc cgaggacgcg      9420
     cgcgcgttcg aagacgagga caacgaaatg gacgaagtca gctcgggggg cgatgaagga      9480
     catatcgagt cgatgctcgc gacggcaggt agctcgcgag gcgacgcgat ggatcccgac      9540
     gtcgattttt ccgccgtgct tcacgaagtt ccgattgaaa tcagaagacg tctcgcgccc      9600
     aacgagtctg gtttcacgga gtcggtcacg cattcagaag agtcaacttt ttgcagaggc      9660
     tgtcgacgaa cgctgagtgt ggttcttcat ttcggtgtca acaacaagac gtgtcgccag      9720
     tgcttgattc gacaacggct gaagaggaag aggtgcgcca cgaggaactc ggagcagttc      9780
     ggcaacggaa ggactactga ggctcgaaag gataaagcaa tgaatccgac cggtccatga      9840
     atagcgatgg gtacgatcta ccctattagt gagatgcgct cggcggcgtc gagcgtttcg      9900
     gagtttagtg atttgcgtat tgaacgcttc gggtttagcc tcgtcggcga gcgcgagaac      9960
     gcgcgagacg acaaatagat ccgaccatac accatccaac gattcaattt gtattattac     10020
     ttactttgca cgcattcagc actttgtgac gttatcttgt attcattacg aaacttctaa     10080
     gcgagcgaga gctcttcgtc gttcgcgcgc ttgcccgaga ccaaatcgtt gtagaagtgg     10140
     tgcgtctctt cgatgacgcc gagcgtgtac gctctatcca tgcacttgtc gtccaaaccg     10200
     aatttgtttt gtggcttacc gtccggagtc ttgtagtcac ggaaccacac gcgaatcttt     10260
     tcgagttcgc ccgggaagtg cttttcgacg tcggcgacgt cgttgatgtc gctcgccttc     10320
     gggtcgttga cgctaatcgc gatcaccttc cagtcaagct caccatcgtc aatcatggcg     10380
     taaacgccca cgggtttcac cggcgtcacc gaacccatgg ccaacgcgct ggaaccgatc     10440
     tccacgacgt caaccggatc gttgtcgccc gaaaccttca tcgtcgggtg ttcgtgcttg     10500
     ggatcttccc acgtttgcgg taacatgccg tagttccagt tgatgttgta cggataatcg     10560
     cgaagcttgc ccttcttcgt gtcttgctta atcggggtca acttctcatc cgtcgccact     10620
     tccatcttcg ccttcgtctc cttcgggatc tcgcacaaaa agttgaacgt tccgtcggcg     10680
     ttcttgagcg gaacgccgtg ccacgcgctc acggtgttct gcgcctcgtc cttgatgaag     10740
     catcggaact ccaggctcgg gaaatccccc accttttcat tcgcgtacgc cgcgctgatg     10800
     acgcgcgtgc gctgcacgct tcgtcgctgc tgatgcgcgc gcgccgtcga cgcgctcggc     10860
     gccggcgtcg atcgcaccga cgaacccatc gcgcgcaaac gcgacgtcac cgcgcgcgac     10920
     accgcgcgcg ccatgaaaat ctgagacgcc gaggacatgt cgagcgaggc gcgcggtccg     10980
     cgagattcgc gcgatcgacg gcgctcgcgt gtcgcgcgcg ctcgagtgcg cgacgccgcg     11040
     cgcgcgctat ccgaaacgaa cgccacaaac acggaccgtc acgtccacgg acagtccgcg     11100
     tgtgactgac gatcggcgcg tccgtcgcgc cgtcggcggc gacggagcgc gacgcatcca     11160
     tggcgagcgg ggcgcagcga cggaagcgga agcgagagag cgagaaacgc gaggcgtggg     11220
     tgcgattcga cgccgcgggc ggggacctga gcgcgtacga acgctcgtta gaggaagatg     11280
     cgacggcgaa aaaggcgcgc gcggcggcgg cgagacgggc ggcggacgtg gaggcgctga     11340
     acgacgcgac ggggtcgagg gaggcggacg aacgagggca agatcgcgaa cgggcgtcgt     11400
     cgtcgctgct gcgggacgcg gtcggcgtgc gcgtgcgcgt tcgcaaggac tcggcgcacg     11460
     cgctgcgcgt gctctgccga gcgacgagcg acggcgactg cttcttcgcg tgcgggcaac     11520
     cccgatcgtg ggggagacga gggatcgagg ccgtggtgaa cgcgctcgga tttggggttc     11580
     tggagtacga cgaaatcacg ctcagtaagg cgcccgagct ggcggcgtgc gtgattcgct     11640
     tggacgccga cgacgaaaac gcctccgtca agcggaagaa gaagcgcgcg ggcggtgtgg     11700
     gaagcgccgt ggagacattc ttggcgcgag cggagaaact agtcgagccc attcaagcac     11760
     ctgacgtgag cggggacgag atcgatcgcg acggtggtgg gctcaacgct tgggtcgccg     11820
     cacaccgccg caagcgtccc ggctcggcgc aagccgtgac ggcgagcatc gacgcgtggt     11880
     ttgagaagaa ggaagccgag gaagcggcgg ctgaggaggc tgctaacgcg gtaaagagtg     11940
     acgatggatg gacaaaggta gaagcgaaac gtggacgcag aaagacgacg gaggagtcca     12000
     cgggaacaac catcggaagc atacgcgccg ccaccgcgga tagaaggcga aaggagccaa     12060
     agaaaatcgc cggcgaacag ttttatcgct ttcagagcaa ggaaaagaag cgcaatgaga     12120
     ttatcgagct ccaagcaaag tttgagcagg acaagcaacg tatcgctcgt ctcaaggccg     12180
     cgcgtaagtt tagaccgatg tgattctaga aatagtagat gtgccataac agacgacgaa     12240
     aaaactcatt ctatcgagcc gagcgactca gtgtccgtgt ccgtgtccgt gtccgtggtc     12300
     gtgcttcttt tcaccgtgtc cgtgtccgtg gtcgtgcttc ttttcaccgt gcccgtgtcc     12360
     gtggtcgtgc ttcttttcac cgtgcccgtg cccgtggtcg tgggcttcgc acttttcgtc     12420
     ggagcagcac ttttcaccgt cggcgtgcga gtgcccgtga tcgtgcttct tctcgccgtg     12480
     cccgtgcccg tgcccgtgat cgtgcttctt ctcgccgtgc ccgtgtccgt ggcactcctc     12540
     accgccgtgg tcgtgctcgc acttttcgcc ctccgcgtgc gagtgcccgt gtccgtgcga     12600
     gtggtgcgtg ccgtcgcagg gtactccatc gtgcgagtgc ccgtgcgtgt gttcctcttc     12660
     gtcatccact ttaggttttt cctttagcac cacctcgcca tcgtttgaca tcgcttccgt     12720
     cgccttcgtc gtcaaagagt acgtcgtctt ttccccgccg ctcgccgtca cggtcacctc     12780
     gatcgtcgcg ttcgccggtc gattcgccat gttcccgatc acgccgtcga tcgcgatcgt     12840
     gcacccgggt gcgaacgacg tcgccatcac gttcacgtgc gtcgctcgag gcgcgatcaa     12900
     gacgtcatac gccgtcgtag acgccgcaaa cttgggcgac aacgtcgcgt cgagtttgac     12960
     gaatcctttc gacgacgcgt cgtcgagcga ttgcgcggcg tcgtccaagg ggcgtcgcgc     13020
     gtcgactttg aggaaagcta gagtaggagc ggcagacatt ttcgcgcgtg cgttcgcgcg     13080
     cgacggggaa aaacgcgcgc ggaagtgcgg gcgcggaagc gcgtcgggtt gctcgagtcg     13140
     cgtcgctgat gggggggccg gtgttaagtt tatgtgtctg cgtttttcat caatcgcttc     13200
     gggcgcatcc aaacccgcgc cgacgagcgc cgttaatcta aaggaaatcc atgaacgcgt     13260
     cgtcttcttc cgccgcttgt tcctcgccaa agttgagcgc ggtgaacatg aagtccgcct     13320
     taccccccgg gacgacgagg cccttgaacg tctgcttctt tcgcaagagc ttgttcaacg     13380
     cgaagtgctg ctcgtcgccc aacttttggt cgcaaatata aaacacggcg gagatcttat     13440
     cgttctcgac gtcatcgacg cagaagatga actcttcctc ccacgtcggg tccaagcccg     13500
     cgagctcttc gctcgtgtac tcgtggtcct tgtacttcaa cacgactttg cagcgcggct     13560
     tttcgatgcc gtagaacttc aaatcgagct tcttgacgtt gcagcagttg acttcgatct     13620
     tcaattcatt cgctcccgtg ccgagcttct tgagttctgc gccgcaaacg aaaacaaccg     13680
     cgtcagtcgc gtcgatcgcc catcgtcatc gcgaacgcgg atcgatctat ccacccatcc     13740
     gtcgtcgtcg tcgtcgtcgt cgtcgtccgt cgggcttccg tcgccgccga tcgcgtcgtc     13800
     catcgcgatc ggtgtgcgct gtcgcccatc gcgcgcgctc gcgcatcgcg cgcgcgtcgt     13860
     cgctcgcgtc gtcgtccttt ttcacgtcgc acgcacccgc catcttttcg tcgttcgcgc     13920
     gcggtgtgac ggcggcggcg ccgcgacgac gcgcggtttc gtccgaataa acgcctcgac     13980
     atcgcgcgtc ttctagcgat gcgcgcggtc ggaatacggg atcgggacca cgatcgattt     14040
     caccgatcgc gactcgagcg ccgcggcgac cgaccgaccg cgcgcgcgcg ccccgcgtcc     14100
     cccgcgtcgt cgtcgcgcgg tccgtctttc cgcgccgcac gagagtccga tacgatggta     14160
     cgtcgcgcgg tgatgcgatc gcgcgagggc ggtgaacgac gcgcgatggt cgtcgcgctc     14220
     gatcgcgcgg cgctcgatcg cgcgtcgcgc gtcgcgcgcg cgcgcgcgtc gacgatgatg     14280
     gcgcgcgccg tgaccctagt ttgcgcgtcg acgcgcgcgc atcgccgcgc gtgacggacg     14340
     cgcgagatgc gcgcggacgc cgacgcgcgc gcggaacgcg aggaatgttt acgcacgctc     14400
     gatcacgcac tgacatcgca cgtgacgtcg cacgcgccca ggttctcgct caagacatcg     14460
     atcttttgaa cccgcccgcc gcgctcgagg ctggcaagca caagctcaag cgattggtgc     14520
     agtcgccgaa ctcgttcttc atggatgtca agtgccaagg ctgcttcaag tgcgtacacg     14580
     gaaacgaacg cgcgatgcga ctcgatgcga ccgacgcgcg aggctttcga tggcggtgtc     14640
     tgaactcgcg actgaccgac gcgctcgctc gctcttcgtc tcgcgcagca tcacgacgat     14700
     cttcagccac tctcaatccg tcgtcctctg cggttcgtgc tctgcggtgc tctgccagcc     14760
     gaccggtggt aaggcgcgac tcacggaagg ctgcgaatgg cgccgtaagg gcgattaatc     14820
     gcgttcgccg cttcctgtag tctagtatca gaggttgtga gaggttcttg gcgacgcggc     14880
     gttagggcgc gtggtcgaaa agaagaattt gtaggtgtgt gagtttgtaa cgacgaacgt     14940
     tcgcattatc ttaaacacgc ggtctatttt tctacgtacg aatacacgaa tacacgcaaa     15000
     cgcgtttcac gcgtccgcgg ggcgggaaat aattctctgc tcactacgcg gcgtcggacg     15060
     ctcgccgcgc ggagacgtcg atgctctgct tcttcgcctg ctctcgcttt ttctctctga     15120
     gcttgttcaa attgtacatg aagacggaca gaaacgcgat gacgtagccg acgtaattca     15180
     gaaacgtcac cgggttaccg aagaagtgct gcgaggcgaa gattaacatc caatccttga     15240
     tgacgcccgc gatgttcata gtcaacgcgc tcgtcttgcc gatgagtaaa aacaccgcga     15300
     ggttcagcgc gaacgcgcac gtggcgttca aagtcaacat cttccaatcg aaaaccaacg     15360
     tcgcgtccgc catcatcgcc gggtactcga cgaacattaa cggaaacgcc aagaagaacg     15420
     cgcacgccgg ggagacgtag tacaaggact gcagcggatt catcgccatg ccttgacgcg     15480
     tgattaatat ttgtaccaac atcaaccgca cggcctcgaa caacagcgcg ctgagctgct     15540
     gcgttacgcc tagcgtgtcg aagttcaact ccccgtacgc cgcgatgccg acgccgatcg     15600
     cgatgacgaa catgttcatc gacgtcgtcg cggttaattt ttccattcta aaaaacaccc     15660
     ccaccatgta caccaacccc ggcatcagcg ccttggtcat ctgaatgaac gacacgctca     15720
     agtgcaaata cgccgaatta ctcaaccaca gcgacgcggc gtaaaagaac ccgatcggca     15780
     tcaccttgcg cgtgtactct tttcgcgtca tcttcaacct cttcgtcacc ttgaacaccc     15840
     tgacgaggac ggtgacgaga ctggtgcaaa aaaccatgtg ccacatcgtc agcgccacgg     15900
     gataccggaa tccgctgtac gccaagatcc acttgttaaa catgatgacg cacatcgaga     15960
     tcgtcatcca caccgcgaca aaaaaatacg ccctgagaca cgaccgcgcg atggtttgct     16020
     cgctcgcgtt cgccctcgcg tcgtcgttcg tcctcgcgcg cgtcccgccg tgcgtcgcgc     16080
     tcggttccgc gagcaccgat tttgatttcg tcgacgccat gacgcgcgcc tcttcgcctc     16140
     gccctcgccc gcttcggcgc caatctcaat ctcgcgcgcg tccgagcgtt cgatcgccgc     16200
     gcgcgcgacc gcgcgctcgc gtcgcgcgtt cggtgcgacg cgcccgtcga cggttcgttc     16260
     cttcgctcgc gcgtcgacgg ttcgttcctt cgcccgcgcg ccgtcgtgtc gcgctcgtcc     16320
     gtcgccgcaa tcgacgcatc gaatcgacgc atcaatccat cgcgcgaatg cctcgcgacg     16380
     gtcgcgccgg gcgccagtgc gcgcctcgcg atcgacgaga cgcgcgatga agtacacggt     16440
     cgccgcggac gcgctggcga agattgaaca cgatgggaag gagggacacg cgggagcgaa     16500
     gccgcgcacg gtgatcgagg cgcgtcccga cgcgcgccgc gacgaacgac gatcgagggg     16560
     ggctcggatt ggattggcgc ggattggctc ggattggatt ggattcggac ccgtgtcgtc     16620
     gcgcgcgagc cgcgtccgaa cgatcgcacg acgacgacgc gtcggcgagg cgcggaatgc     16680
     gatgatggcg tcacggacga acgacgacga cgacgcggaa gactgacgag ggcgatcgac     16740
     gcgcgatgca ccaggttttc aaagccgcga aggagagcaa gcttcgacac accacggcgt     16800
     tggtggcgtg cacgggggag aaatggacgg tgaaggaata ctacgacgat tgcgtgaaaa     16860
     cggcgaaatc gttcattcat ctcggattgg aacgatacga gtcggtgtgc attctcgggt     16920
     ttaactctcc ggaatggctg atggcgaaca acggcgccat cttcgccggg gggttcgcgg     16980
     ccgggattta cacgacgaac gaaccggcgg cgtgcgagta catcatcgag aactcgagcg     17040
     cgcgcgtggt tgtcgtggac gggcaaaagc aattggataa gatcttggaa attcgatcgc     17100
     gattgcccaa gctcaaggcg atcgtgatgt accgcgaaga ctccttctcg gatccggctg     17160
     gcgcgaagga cgcgtcgctc gccaaggtgt acacgtggaa ggatttcttg aagctcggcg     17220
     atgcggtgag cgatgatacc ctcgaagctc gcatgtccgc gcaaaagccg ggcaactgct     17280
     gcacgctcat ctacacttcc ggaaccacgg gcaacccgaa aggggtgatg atttcccacg     17340
     acaactgcac gtggacggcg tcgtcgaaca ttttgcacaa cccaacgatt acttcggggc     17400
     cgttgcgtgt ggtgtcgtac ttgccgcttt cgcacatcgc cgcgcaaatt gtcgacatcc     17460
     attcgccgtt gatgtgcatc gtggactttg acaagaccgc ggccgtgtat tttgcgcgcc     17520
     cggacgcgct caagggtacg ctcaaggaaa cgctcatcga agccaaaccg acggtgttct     17580
     tcgccgtgcc gcgcgtttgg gagaagtttg ccgaaggctt gcaagccaag ggtaaggaaa     17640
     tcaccggttt gaaggccaag atctccgcct tcatgaaggg taagtgcgcg ggcgtgcacg     17700
     cggcgtctca agtcggagcc accgtcggcc acccgttcat gggcggcttc gcgatgaagt     17760
     tcatgaagaa gaaggctcac gccgctatcg gtctcgatca agcgcgagta tgcctcacgg     17820
     gcgctgcgcc gatcatgaag cacacgctcg actacttcgg cacgatcggc atccacattc     17880
     tcgaagttta cggtatgtcc gaaaacactg gtccgcaaaa tgtgtgcaag tctgattact     17940
     tcaaagccgg ttcttgcggc gtgccgattc cgggcgtcga gatcaagctc gaccacgtca     18000
     aggggcgcga caaggatggc gaaggtgaga tttgcttccg tggccgtcac gtcatgatgg     18060
     gttacctcaa caacttggcg aagacccaag aaagcatcga cgaagacgcg tggttgcaca     18120
     gcggcgacgt cggcgccatc gacccggaga cgaacatgct ttccatcacc ggtcgcatca     18180
     aggaactcat catcaccgct ggtggcgaga acatcgcacc ggttcctgtc gaagatgcca     18240
     tcaagggcta ccttccggcg atctctaacg tcatgatggt tggcgacaag cgcaagtaca     18300
     acaccatgct cgtcaccttg cgtcaagttc ccgacggcga aggtttcacg gaaaagctct     18360
     tcggcacgtc tctcgaggtc aaccgcgacg tgacgaccgt gaagcaagcg caatctgacg     18420
     cgaagtggaa ggcttacatc gaagaaggca tcgccaagta caacaagacc gcggtttcca     18480
     acgctcaacg catccaaaag ttcaagattc tcgacaccga tttctccgtg ccgggcggtg     18540
     agctcacggg cactcaaaag ctcaagcgca acgtcgtcac tgagaagtac gccgctgtta     18600
     ttaactcgat gtactaatca actattcaaa tgctacgagt aatcctatgc tactaatccc     18660
     atcaacttat cacgcaacag cccggctgtt ttgactcgtc gattgactgc ggcgagcgcg     18720
     gttgcatttc cgcgcgttcc tctcgcgcgt ttcgctcgat caccgccgcc ggggccggga     18780
     cgacgctcga cttctcgttc gcgtgcgtct ccggcacagg ggcctcttcc gcttccgcaa     18840
     cggcgcgttc cggattcggc tctcccatcg gcggcgacgg tttctttggc tttggctttg     18900
     gttcggcgtt cgcctcgacc gcaggctttt cttgcggtag cttttcttgc ggcgcatcgc     18960
     gctttatggc gtcatacgcc ttgttcgtct cagcgcactc cgcgtaagct tccgccgcgg     19020
     tttcggcgag cgccaggaac tccttcacgg ctttttcacc gttcggcacc atccagagcg     19080
     gcgtcaccgg ggacacccgt ttaccattct ttgcgtcttt gatttcgcgc tcgtccggaa     19140
     gcgttacgtt cacacacgtg tacggcatgt catgcagcgc gttctcgcca ccgccgccgt     19200
     aaatgtccaa aaacacggtg aggtggacgt ttgacgggac cgcgtcgacg cgcaacgcct     19260
     ctcgaaactc ttggcgcgtg atcctggccg tggggtcgcc cggcgtgtcc gacgcgcaca     19320
     gcgcggtttt attcaaaccc ttgtacgcgc cacctccggc gacgctatcc ttggtcgtcg     19380
     tcgtcgtcgc cgtctcgctc acttcttgcc cgcgtccgct aaagtaaaag aacagcgaat     19440
     cccccgcgcg cgcgccgtcg acgagccatc gacacgcttt caaaatcgcc ttcttcgagc     19500
     acgagcgatt gatggatcca tcgttcgtac tcgcttcgct atcttccaac agcaccagca     19560
     cttcgtcgtc ctcgtcgtac ccacagtgcg tctttaaata ttcgcgcatt cgcaacgcgt     19620
     cgcccccgcg tcttcgcaac cgccaccgct cgacgccgca ctcctcgtaa tttatcccca     19680
     caaacacccc tcttcgccta cccacgtttc gcatcgtttt cgagaacgtc atcctttcgt     19740
     gttcgatcgc gatgcaccgc gtcgcgcgca ctcgtatccc gctcgacgtt cccggcggca     19800
     gtcgttgcat cgctcgctgt ttgctcctca ggaattgtcc ccacgacgcc gtcgtcgcac     19860
     cgtttcgccg ttcgagcgcg ttcaggcacg cgcgcgtcaa taaaccaccc acttgcgcgc     19920
     actctcgctg tcgttcgcgc tttcgcgtcg ccataaagat cctcttcgcg tcgtccgtcg     19980
     cgttcatcct tcgcatcgcg ccttcgtcgt cgtcgtcgtc gtcatcgcgc gccttcgtcg     20040
     tcgtcgtcgc gagcgcgtcg tgcgccgcgc ggtctagata cgattcgcga tcgtccctgc     20100
     tcgtcgccac gagcacgacg accgcgtcgt cgcccatcgc gtcgcccatc gcgcgcgacg     20160
     ccgagtgtcg cgacacggcg acgcgcgacg acgcgaacga tgcgcgcgac ggcgacgcgc     20220
     gcgacggcga cggcgacggc gacggcgacg cgcgcttcga cgcgcgcgct tcgacgcgcg     20280
     cgcgccgcga cgacggcgcg gcgcttcgac gcgtcgagac gcgcggcgtc gacgtcgaac     20340
     gatggcgacg ggagcgacga cgccgacgcg agcgacgcga cgccgacgcg agcgaagcga     20400
     gacaaaccgc tgcccgggtc gggggtgaat ctgtacgacc ccgtggcgac ggcgtcgagg     20460
     ttcctgacgc gacggttcgg catcgtcggg gggctcggtt tggtcgcgct cctcgcgagc     20520
     gtggagggcg gggaaatcgt aaaggcgttg ctggagcgcg acgtggacgt gtcgacgacc     20580
     gcggaggagt tcgcggtgga gggcaacgcg aatgggttgc gagcgcggga cgtgaagatc     20640
     ggcggcgggg cgagcgcgaa gcgaggagac ttcgtcggcg tcaacttgac cgtcgtcgac     20700
     gccgaggacg gcgtcgagta cttgaacacg aagaaggcga aacgaccgat cgcgttcacg     20760
     tacgagaaga aaccgttgtt ggcaccgatt tgtgaagcga tcgaggacgg cgtgcggacg     20820
     atgaaaaggg gcggcgtgcg acgggtgttc gcgccgagcg cggcggcgtt cggcgaacgc     20880
     ggcgtcgtct tgacggatgg cacgcgcatc aagccgaatc gcgacttgat catcgacatc     20940
     gtgctcgagg aggtgtcgcc atcgtacgtg taatataatt caaagtaagc gttatgattg     21000
     ggaattaacg atcaattaca tggtcgggtg gttccaaaga agcattctaa agtgttatac     21060
     gtgtccgcgc tcgctcgcaa cctattccca cgcggcgccg ttctcgccga aaaaggagga     21120
     aatgtgcgcc aacgccgacg cttccacgat gaccttatcc gcgttcaaga tgtcgtacac     21180
     gttcaagtgc gagacgtccg tctgcacgac gcgctcaatg ttccgcgcgc tcttcgcgac     21240
     gttttcgttg gcgtccttgg tgatgacgta cgccttctcc gaggcgccga cgccccacgc     21300
     catcaaagac ttgttgaacg cgttcgtgcc cggggcggag atgttacccg agatatcatc     21360
     aacgacaatc atcgcgctcg ccgccgattg caacgcggtc gccatcgcca atcgacgctc     21420
     cttcttgttc atcttaatcg accagtcgcg cggcttcggc ccgaacgaca cgcctccgcc     21480
     cggcttgagc ggcgttcggc tcgaaccggc gcgcgcgtta cccgtaccct tttgcttgaa     21540
     cggctttctc ccgccccctc gcacttcgct cttcgtgagc gtgctcgccg tgccctgcgt     21600
     tcgtaagaaa gtccgtcagt ctcgccggtc gtcatcgtgg ataaccacgc ccgctgaata     21660
     gggtttgttt gccctcgagc gatggcgtgg ggtggcgacg acgatcgcga cgacgttcgc     21720
     gacgacgatc gcgacgacgc cgcgaacgat aaatcgtcgc attcaccggc gttcgtctcg     21780
     tcgtcgccgc gcgcgtcgcg cgtcgcgtcc cgcgtcccgc gtcccgcgcc cgcgcctcag     21840
     ggtttcccgg gatgcgcgcc ctcgcggtga tgtttcattc gcgcgtgtcg cgtcgcgcgc     21900
     gcacgtaccc tgcgagcatt ctgtcgaacc atgacgacgt atttatgcac caaccctctc     21960
     gccacctccg cgcgcgcggt cttgagctcg agcgtggcgg cggacgattt cgcgccgtca     22020
     aaggtgaccg catcgatcgc cgccgcgcgc gggacgaccg gggcgacgcg cgcgttggcg     22080
     ccgcgcttac cggcgatcgg tcgcggagac gtgatcgcgg tggtgccttg gagcgccgcg     22140
     ctcgagcgca tggtgaagcc ttgcatcgcg tcgcacgaga gcgagtcgcg aagtgatgac     22200
     gcgcgtcggg gcgggggagt gggtgcgtga ccggacgtca ctgccggttc gagactcgag     22260
     aggagtaccc cctcgagacg tctcgccgcg ggtggcgaag cgatcgcgcg cgcgacgcgt     22320
     ttggctcgat ttcgggggct aacctaataa tattactctc acgtcactct cacattacgc     22380
     tcacatcatc gtcatattac tcttgaacgc ctcgaaaaaa cgcatcgttt tgccgtacgc     22440
     gtcgtcgtcg atgacgtatt gctcgagcac gagggacacg cgctcggagc ccgagcgcgt     22500
     cttgtacgag cgcacttggt ggaacgcgtc gccgcggaaa ttcaccagca tgttttcttt     22560
     cggacgaatc ttcttctccg gcgccgcgcc ggtgtcgggg tatccatcgc cgtaagggaa     22620
     cagctctaac tctccgccga ccatgtcgtt cggcacgctg ttgtacagca ccgagacttg     22680
     gtgggctatg aacatgtgac gagagtaaat tccgaccgtg gtatccaaat gtaaccccac     22740
     cgaaagctct tctgcgttgt acgcgtcgta atcaccgagc tcgcacaaca gaatattcat     22800
     cacgaatgcg ttggcgtcgg gtagccgcaa ttcgtcaaac accgacgcga agcactcgta     22860
     gtctggcgac gccttgaact tatccacgcc ctcgagattg aacttcacca cgaaacctcg     22920
     cgtcttgcta aacccggcat cgtttaaccc acccttgacg cgcaatttgg gatgtttcag     22980
     cgcgcactct ttgaggtcgc cgtacctctt aaaatctaaa aagtcctccc tcgcctccac     23040
     gagcggttgc tcgtccgtcg tgctcaggta tcgcgcctcg ctcgccgcgt accaccgctg     23100
     ggccattcgc aggacgatga acacgaggat cgccgccacg cccgcgcgtt cgttcgcgct     23160
     ctgcgccccg gcccgccgcg ccgccgctcg cttcgcgttc gcgtcgtcgt cgtcctcgcg     23220
     cgtcgattcg cgcgtcgcgt cgtcgccatc gtcgcgcgtc gtcctcgcgt cccgtcgtcg     23280
     cacgcccgcg ctcgcgttca ccggcgccat cgcgcgcgtc gcgtcgtcgc gtcgtcgtcg     23340
     tcaaccgccc gcgcgatgtc cgaccgaccg cgatttatca tccatgcgaa ctgtttgcgc     23400
     acacgaggga cggcacccga attcgaatcg accgcgtcgg cgtcgcgcgt cgccgcacgc     23460
     gtcgacgcgc gatggcgacg acgccctcga cgcgcgcgct gtgcgaggcg acgtgcgtcg     23520
     tcgaccgcgc gatcgcgtcg tggcgcgcgc gcgacggcgc gatcgacgac gcgcagcgac     23580
     gcgcgtcgcg cgcgtgcgag acgctcgtgg cgccgttcgt cgaagcgcga gcgacgggcg     23640
     aggacgcgtc gcgcgacgcg agcgaggcgc agcgcgcggt gaaagcgctc gagaagcacc     23700
     acgcgcggtt gcgagcgctg gcggacgcgc gggtgaagct ggcgcaggcg acgtacgacg     23760
     ccgtcgacga ccacatcacg aggctggaca aagatctcgc gacgttcgag cgcgagcgcg     23820
     gttcggcgca tcgcgcgggc gagcgcacga agtttgatct cgcgctggcg ggcgaacacg     23880
     gattcgaggc gctgacgaac gcgccgagcg cgtcgccggg atccgcgctc gcgtcgccgg     23940
     ggaatccaaa cgagccgaga tattgcgtgt gccggagcgt gtcggacgga aagatgatcg     24000
     ggtgcgataa cgacgattgc gcgatagagt ggtttcactt cgcgtgcgtg gggttgaatc     24060
     cgaacgcgga ggtgaaggga aaatggatct gtccgccgtg tcgccggaag aagcgctgat     24120
     agacgcgttg ttagagagta gtccactagg cgtagcgcgc gccgcactcc tcgtcgcgcg     24180
     aacgcgaccg cgaccgcgac tccaccatta acgcgcacca ttaacgacgc gctcgtgccg     24240
     agcgacgacg acgccgcgcg cgcgagcgtc gtcatgacgt ccgtttcgac gctcgcctcg     24300
     agcgcattcg ccgtcttcgc attctggatg gcgcgcgcgt acgtccccgc ggcgaccctg     24360
     ttcgcgtggc atccgctgtg cctgagcgcc gcgatcggac tgtgcggcgc ggcgtccgtg     24420
     atcggcgtgc gcgtcagggc attcgcgcct gggcgcgaac gagtgcgcgc gttgtggtgt     24480
     cacctggcgc tgaactccgc gggcggcgcg gcgtgggtga ttggattttg ggccatttac     24540
     gcgaataaaa ataatctagg caaggcacac ttcacgagcg cgcacgggaa agtcggggcg     24600
     gcggccacga tggtcttggt ggcgacgtac gcgctcgggt tgttttcgtt caacgcgctc     24660
     gggttgctga cgcgactgga tatgaaccgc agagcgaagg acgtcaaggc gacgcaccgc     24720
     gtggcgagtc tcgtggctat tttcggtgga atactcgcgg caagcatgcg cacgggacac     24780
     gactccaccg gattcggcgc cgcggggcgg gcggttgcgg acgtcgcgct gttcgcgggc     24840
     gccggcgcgc tggctttttt ggcggcgacg acgcccgcgt ggaaaataga acgttagtcc     24900
     gtagcgtggt aaaattgcga attcttcatt acataaggta cagtctgttc acattaaacg     24960
     taaaagtctc gagaccgcgt cctggtccag cgcgtcctca cagcggcggt ttgcgcatcg     25020
     taatcaggtt gaattttatc gtccccgtcg ccaagcccgt ttgcatcagc ggcatcacca     25080
     acgcgccgcg taaagtcgcg gcgccggatt taagcagacc gatcacaccc ttgagcgtca     25140
     acgcggtctt gatcacgccc ttccaaaacg gcttgacctc ctcgctccaa tcctcggttt     25200
     cgatgtcgac caacccggcg tcctcggcga gcgccttgta atcggcgatc gagcaccacg     25260
     ccgggaggta gtacgcatcg caaatgcgat cgagtaaaac gcgctccgcc ggctccagcg     25320
     cgctctgccc cggctcgagc gttcgatgac accacgtgac gattaaaatc cgtccccccg     25380
     gcgcgcacac tcgcgccaac tcgtcgacga atttcttctt gtccggcatg tgttccccgc     25440
     tctccatcga ccacacgaaa tcgaacgaac cgtcctcaaa cggcatgttc aacgcgtccg     25500
     cgacgcgata tttcgccata ttctcgacgc cctcctcttt cgccagcgcg ttcgctcgcg     25560
     ccgcctgcac cggcgaaagc gtcaccccct ccgcctcgca cccgtatttc ctcaccatgt     25620
     gcctcgacga ccccccgatt ccgcacccaa cgtccagcac tcgcttcacc tctcgcactc     25680
     ccgcccagcg caggctctcc tcgatcatgt ccacctgcgc cttcgcgtgg ttcaccggtt     25740
     cgccgcgtcg gtagtacccg tggtgcatgt gcgtcccgtc ccctccctcg cttccccaca     25800
     cgtcctccca cacccgcgag ctctcgtcgt aaaacttcgc gatcccctcg ttcagcgtct     25860
     tcgtctccgc gatcagcggt tcgacgacgc gctcgagctc gaacgtcgac gtcgttcgct     25920
     cctcgttcgc gctcgcggac ggcgtcgtcg ccgcgcgtcg cgctctgcgt cgcgtcgcgc     25980
     gcgcactcgg cgacgcggtc gtcggcgcgc gcgcgatgga cgccatcgtc gccgagtgcg     26040
     gcgaatcgcc gaagaatgaa tgcgttgatg aatgcgcgca tcgcctcggc acacgccgac     26100
     gcgcgcgcga tcgacgatga gcgcgtccga ggggaaatcg cccgcggatt tcctcaaggc     26160
     gatcaagggg aagacggtgc tggtgaagct gaacacgggc gtggattacc gaggcgcgtc     26220
     gagacgcgtc gacgcggggc aagcgagatg aatgaatgaa atcgacgacc gcggcgcgtc     26280
     cgatcgagcg ccgcgcgaac gcgaacccga ctgacggacg acgcgacgtc gaaccgacgc     26340
     aggcgtgctg gcgtgcctgg acgggtacat gaacatagcg atggagcaga cggaggtgcg     26400
     agagagggag cggacggacg cgcgcgagag cgcgcgaaga cgcggaaccg ggacgaagga     26460
     ggactgacga acgacgacgg cgcgcgatgg taggaatacg tcaacggaca gttgaagaat     26520
     aaatacggcg atgcgttcat tcgcgggaat aacggtgcgc ggcgagggat cgaacgcgcg     26580
     agcgacgcgc tcgaatcggc gcggcgagag gaggtttcaa aggtttcgat tcggttcggt     26640
     tcggttcggt tcggttcggt tcggttcggt tcggttcgac tcgcgcgcgg aggagactga     26700
     ctcggcgatc tcgttcgtcg cgaaacgcag tgctttacat cagtgcggtg aagaagtgag     26760
     cgcggtgtag ctgagcttga atctaggcga cgaccgcgac gcggcggacg cgtttgcttt     26820
     gtaacgtcgc gtcgccgctc gttgttaact cgcgcgcctc cctcggtcta gaaaagaacc     26880
     cgtaacgacg aacacgaaac gacgccgatg tcgctccgcg cgcgcgtttc gccatcgatc     26940
     gttattccgg gtgcggcact ctcgattgca accgccgagg aaattttttg actcgtcagc     27000
     gcctctgcgg caccgcgcgc gcgccgcaca tcgacgctcg gcgtcgcgat ggcgccgccg     27060
     tcggcgccga acgacgagct cctgtcgacg atactgtttt tgatcaacaa tcactactgg     27120
     tgcgcgctgt acgagctcta cgtcgacgcg cgaaggctga atgtgttgga tgcggatttg     27180
     ccttcgctga acactttaaa gtcgttcttt aacgactcaa agcggttccc cgacggcgtg     27240
     tttcgcgcgg tcaacgacgc gttcgacagt ggggtgtcgg ccgcgcgcgt ggtggacgcg     27300
     gagtcgcgcg cggcggtggc ggagtacgag ttgaggtgcg cgcgggaaga tttgcaaaac     27360
     tcgcggcgag gcgccggcgg aggcggaggc gaggacggtg gcgaagacgc gagcggggcg     27420
     agcgtgcggc gaggcgtgga cgcggatgat gcgtttgcgc ccacgagcgg tgattccgcg     27480
     cgctcgagcg cggatgacgt gggtttggat gcgaaactag acgcggcgac gtacgagtac     27540
     ctgtctcgtc gcggatacaa agccacggcg ctttcgatgc gcgacgaatc gtccacagcg     27600
     gcgaagttga tggaaaaaga tttcgcgagc gatggagaaa gaagtttcgg ggcgctgcga     27660
     aggatgtacg agcgcgcgag aatgaccgag acgacggcga gcgccctgga gagcgaacgc     27720
     gcgcgcgtcg acgacgtgga gagcgagctg attcgcgccc gcgcgcgaat cgatgaactc     27780
     gaacgcgaaa atacgacgac gacgacgttg cgcgacgcgt tatcgtcgaa attagcgcta     27840
     gcagaaagtg agctgagcga tttgaaggtt tcggcggcgc agtgggagaa gaaggcgacg     27900
     gaatccgcga gcgaggtgaa taggctgttg tctgaactcg gcgctgggaa cgaggaatgg     27960
     tcgagtcgcg acggcaacgg agtgccgcga acgacgattg aagagaacga tacaatcgac     28020
     gcggtcttgt cgttcatttg cgcgatcgcg ccgaaggttt cgccggcggc gcggaaggag     28080
     ttgctgccga tgatttcccg cgcgtgcgtg cgagccgccg gcgatgaaaa acgcgccgca     28140
     cggtcttcga atctgttttt tgagctcttc aaagccccga atgcagaaca gagagatgca     28200
     atcgtcgacg cgatcgcgaa cgttggcgaa atcgtgggca tgaacgcctt cgaggggaca     28260
     ttcattcgag gctgcctcgg atccgaagcc gtggcgacga tgaacgaaga gcgacgagtg     28320
     ctcgtgctcg acgccatcgc caagctcggc gcatcatcgt ggtttacttt gaataatttt     28380
     gtcatggatg gtttcaagcg tgccgcggta gatccaagcg atggtgttcg agcggagtgc     28440
     tcacgagcgg tggagcgtta catcgccgca aacgcgccga gcgacgacaa catggaaacg     28500
     attgaagacg ttttgatgac gctcgcgtgc gacggctccg acgaagttgc cgacgccgcg     28560
     cgagcgacgc tcgcccccgc cgtcgcatct tggtacctag gtgcgaatcc acgacggttc     28620
     acggacgttt tcgcgcgaaa ggtgctcgac aaagccgccg aggcattgcg gagcggatgg     28680
     accggcgaag gcgccgagcg ggagttcaag ggttgggtgt ctccagaaga tggtgatcgt     28740
     catcgatggc acgcgacgag cctagtaaag acgtttgaag cgtttgcgcg gccgattcgc     28800
     gaggcgttaa gcgcgacgaa acccgcgtct atcgcagacg gcgtcgacga cgcgctgagc     28860
     aaagacgctc cagattcctg gcctttcgcg cagtggtgcg taaaagaagc ctcagacttg     28920
     attgtccaag tcattagctc caccgcaccc gatgtcgtcg gtcaagagtc cgtgagagag     28980
     agcatatgcg ccgccgtcgc gtcttggtgc ggcgttctcg gcgcgctcgc cacgcgagcg     29040
     gttttgattg gaaaagtgaa cgatgcttgc ttggtgagtt acgatcagcg tcgcgcggtg     29100
     atgccaatat tgctcgcggg cgtggttcct tacaccccgg acggtggcgc cgtgctcgga     29160
     gattacatta agcgcctgat tcaacaagcc agcgcggagt cgtgcgatga aatcatcgac     29220
     gccgcgcggt acctcgccgc gttcgagcag cacaccgcaa acttgctcga tgcgttgaag     29280
     cggtgcgcgc atccgatcgc tgagaaccca ccgaccgtgc gccttatcac cgcacgtctt     29340
     ctcgcggcga cgtcggagat tttgccgctc aagcacgtgc tcgaacacgt ctatcccgcg     29400
     ctcaacgttt tgcgagccga tcccgagacg agtgtccgcc gcgaaaccgc tctagcgctc     29460
     gcggtgtgcg cgtgcacgca ctacgagact atcgaaccga cgacgcaaac gatgcgtcag     29520
     ctcgagtcgt tgatcggcga ctccgacgtc ggcgtccgcg tcgccgtcgt cgaggcgatg     29580
     tccctcggcg cgtcggtgcc cggaacgtcg ttcgccgtct ccgccgccag cgcgctctca     29640
     gccatcgcgc agctgccgag tgaagaacac gagatcgcgc acgcgctttt cgcggccatt     29700
     cgcgacatgc tcggcgcgga tggcgatttg ttccctcaaa tctcccccgc cctcgtcgcc     29760
     ttgctcgcga gcggaggcct cgaccagggg cgtcgcgccc aagtcgaaac catgcttcgc     29820
     gacggcggct ggtcccccga caccgcgcca tcgagcatca ccaacgtcac cgtcgacgcg     29880
     ccccacgcac cgggacgcgg gaggtcctcc gcgttcgatc gtatgaagag cgtgggccgt     29940
     tccgccttcg gcggccgcgg tcgcgacgct cgatgaccct cgccgcgccc atcgcgcgtc     30000
     tcgatcgatc tcggcgatcg atcgattagc actagaaaaa tttgtcgtcg cgaaatctcg     30060
     caccgaggtc ccgttcgatt gcgcgaaatc gcgtcctctc ttcctcgtcg tcgtcgtcgg     30120
     cgtaaccccg cgacgccgcc ccagcgaaat tcgtcacgtc gcgagcgcgc gccgcacatc     30180
     gcgtcgcgct cggccgtcgc actcgcgcgc gtcgcgcacg acctcgagcg cgccatcgtc     30240
     gacgcccccg cgcgcgtttc cgcgatcctc cgcgcggtgc gacgacgatg tttcgatcgt     30300
     cgagccgccg cgcgatcgcc gccgcggtgc gatgcgcgcg cgcgccgcct cgagcggccg     30360
     attgcgcgcg cgcgacgcgg acgatgccga cggacgcgaa cctgtcctcg cccgcgcgcg     30420
     tcgggcgcgc gacgatgcgt cgcgcgtcga cgatggagcg ggacggcgag aatcgcgcgc     30480
     gaggcttcgc gtcggcgtcg aacgcgacgc gtatgagcgc gaacgcggac gacgaggcga     30540
     agaacgcgaa ggacgatgac gtggtggttg atttggacgc cgagctcggc gcgccgaaga     30600
     gcgcaaaggt ggcggagatt gcggatcgag tgtgcgagtt gacgctgatc gaggtgaacg     30660
     agctgtgcga cgtcttggcg gagagactcg gattgggcga tatgagtggg atgatgttcg     30720
     gtggaggcgt gatgcccgcc ggcggtgggg gcggcggtgg cggcggcggc ggcggcggta     30780
     acgccgcggc ggcgcccgcg gaggagaaga cgtcgttcgc gttgaagctg gaatccttcg     30840
     acgcggcgca aaagattaaa gtcatcaagg aggtgcgcgc catcaccgat ctcgggttga     30900
     aagaggccaa agaactcgtc gaaggcgcgc ccgcggtgtt gaagaaagag ttgaagaagg     30960
     aagaagcgga ggcgttgatt gctaaattga ccgccgtggg cgcggtggcg gcgctcgagt     31020
     aaattacgcc ggcgcgccgg ttagcgtttc tagacagagt tcaataacga catcgacgac     31080
     gatcgcgtcg cgtcaccgtt cgagatctca cgcctcatcg cgcgcgcgcg cgcccgtccc     31140
     cgattctcga ttcgcgcgcc gcgccgcgct cgccgcgcgc gccgcccgta ccccccgtcg     31200
     cgcgcgtcga aattccatcg acgcggtcgg tttcgatttc gaaaccgatc gatcgaccga     31260
     tcgatcgatc gatcgagacg atcgatggag acgttcgacg tcggtcgcgc gcgcccgcac     31320
     tcggcgacga cgacgatgtt cgcgccgacg caggctcgaa cgatggcgcc gacgcgcgtg     31380
     acgatggcgc cgacgcgcgc gcgcgcgacg cgcgtctcga cggtgacgcg cgcgagcgaa     31440
     ggtgcgcgcg cgacgacgca atcgacgcgg cctcgcgtcg tggataggtc acgcgcgacg     31500
     acatcgttcg cgacgacgac gcgacgcgac ggcgcgcgcg agcgaacgat cgcgacgtcg     31560
     atcgatcgat cgcgcgcgtc gatgccgccg tcgagagatc ggtcgacgcg cgaggggcgc     31620
     ggcgcgcgcg aagacgatcg agggagggcg cgcgggacgc gcgcgggacg cgccgcgact     31680
     gacgacggaa cgcgcgttta atcgtgaata gcgtcggata agaacttgga ggtgatgcga     31740
     aagttttctg aacagtacgc gcgcgggagt gggacgtact tttgcatgga taagagcgtg     31800
     acggcggtcg tgattcaagg tttggcggaa cacaaggaca cgctcgggtc gccgctgtgc     31860
     ccgtgcaggc actacgacga taaggaggcg gaagtcgcgc agggattctg gaactgtccg     31920
     tgcgtgccga tgcgcgagcg gaaggagtgt cactgtgcgt gtgcgcgcga tgcgacgact     31980
     cggcgaacga accgcgcgct tttcgaatct cacgacgaac gctcgtttac tgacttcgcg     32040
     ctcctcgtcg aacaggcatg ctcttcttga cggaggataa cgacttcgcg ggcgacgagc     32100
     agacgatcac gatggacgaa ctggtggaat tgaccgagga catgtagagc cctcgatcgg     32160
     gacgaaacag cgcgcctcaa tgtatttaac tttacccatt ttctttccaa aactgaaccc     32220
     gcgcgccccc ccccccagcg tcgacgcgcg cgcgcgccga gcgtcgaatg ttcactctaa     32280
     tgtcgtttcg tgcagtgtta caactgaaaa gtattgatta gaagcactta cggtggacga     32340
     tagaaggtcc ggcttcgttg tactcgctct tcgcgatcca catttgttgg aacgtggaca     32400
     aagacgcgag gatggacccg ccgatccaaa ccgagtactt gcgctcgtgc ggggcgacga     32460
     ccttgatttt catggacgac ggcgccagag cggtgagctc cttggacacg cgatcggcga     32520
     tgccggggaa catggtagta ccaccggaaa gcacgatgtt ggcgtacaaa tcgcgcctga     32580
     tgtcgacgtc gcaacgcatg atggagttgt acgtcgtctc gtgaatgccc ggggtttcca     32640
     tgccgatcaa actgggctgg aacaaaacct cggggcaacg gaaacgttcg ttaccgatcg     32700
     tgatcatttg tccatcggga agctcgtacg acttctcgat cgtggaggag ctttggctcg     32760
     ccgccatttc ctcgtcgaaa tccaccgcga cgtacgcgag cttctccttg atgtcgcgaa     32820
     cgatttcgcg ctccgccgac gtcgtgaaag agtgtccgcg ctcggtcaag atcttcacca     32880
     tgtaatcggt caaatctcta cccgcgagat cgaggcgaag gatggcgtgc ggtaacgcgt     32940
     agccctcgta aatcggcacc gtgtgcgata cgccgtcgcc gcagtcgagc acgatgcccg     33000
     tcgtgcggcc cgaggcgtac agggacaaca cggcctggat ggagacgtac atggcgggca     33060
     cgttgaaagt ctcgaacatg atttggcaca tcttctcgcg attcgccttc gggttcatcg     33120
     gggcctcggt caaaagcacg gggtgctcgg ccgggtccac gcgaagctcg ttgtaaaacg     33180
     tgtgatgcca gatcttctcc atgtcgtccc agttggtgac gatcccgtgt tcgatcggat     33240
     acttgagcgt caagatccct cgcttactct gcgcctcgtc tccgacgtag caatccttct     33300
     gccccatgcc caccatgacg ccgtggtgtc gcggtcgacc gacgatggac ggaaacaccg     33360
     ccttcggggc gtcgtcgccc gcgaacccgg ctttcaccat ccccgacccg ttatcgcaca     33420
     ccagcgcgga cacttcgccc tcatccgcca tctttctttc gttcctacga attccgtccg     33480
     cgtcctcgtc gcgcgtcgtc agtcctcgct cgcgcgtcct cgtcgccgat ctcgtcccgt     33540
     cgcgtcgcgt cgcgtcgcgt cgcgtcctcg tccgcgacgc gactcgcgcc gtcctctcgc     33600
     gcgcgtctcg cgcgcgtctc gcggttcgtt cgtccacccc gagccgtcgc gcccgatcga     33660
     tcgttcgcga atcgttcgcg aatcgaatcg ttcgcgaatc ggggtgcgaa tcgaatcaat     33720
     caatcaatca acgactcgct ttgaaatcgt tcgcgcatcc gtcgcccgtt cgcgttttgt     33780
     cgttcgcgtc gcgcccgcgc gaccgacgtc gaatcctcgg gacgtcgcgc gcgcctcggt     33840
     cgcgtcggtc gcgcgcctcg cctcgcctcg cgcgcaccgt cgtccgtcgt ccgccgcgat     33900
     ctcgcggtcg tcgcgaacgc aatcaatcgc gacgtcgcgg gcgcgtcgca tcgtcgcggg     33960
     cgcgcgcgtc gcggcccggc ggtgtgtacc gtatataaaa tacgaaacaa tcgcgtatac     34020
     gttagatccc aaaacaccca tatatcgatc aatcacacga cccagatgtg ccccgatcgc     34080
     gatcgcgcgg cgcgcggcgc gtcgccgacg gggggtctct cgtctatata aaatacgaat     34140
     caatcacgta tacataacac cccaaaattg cgagctatac cttatcagta tgtattactt     34200
     tccacgtccc taatatgtgc gcgccgtcga agtgctaata actcgcgacg acgctacaac     34260
     gcgacgcgcg gcgcgcgcgg cgccgggatc tcgcgctcgt gatcttttac tttccgccga     34320
     cgcgccgttc gcgcggaact gcgattccga agtgtgccgc tttcatgcta gacgtaactt     34380
     tttgatttta gattttaagg atacaaacga actactcgcg tgattacact gggataccgc     34440
     atggaatagc gcgtttgtga cctagataca acttcggaca atggtctcga atacaaagta     34500
     tattaacaca tgaaaaccca tgggccacgt cacaagcact ggcgtatcaa ctttcgtagg     34560
     acatgtgcca aagaagtgtc aattaattgc ccatcagcgc agtggcgttt tagaaccaga     34620
     aactttttgc acatctatat acttgaggtt tcctatttgg atgtttcctg cggactgcca     34680
     atcccactca tacaaaagaa tgctaagtac agactgatcg tatcggtgca caatatattc     34740
     tgttgaaggt gggcctttgc gtggtttcgt cagcttacga ctggatcctg gaggtgccat     34800
     gcaagaaaga cagttatgca cgccgcatgc tatccaaggc gcgagaactg tcttgtaaac     34860
     atccgactgg aggttcgcta tccaatatgt ggcagctatc tccgtaaagt ttttgaattt     34920
     cgtacggtcg acgttcagat aagcataagt ggcggggtgt gtgttcaccc ccatacccaa     34980
     agcacccaaa cgaccggcga atcccacacc atcttcgagc acgtgagaca cccacgtttc     35040
     cgggtttcca aggaaacgtg ttgaagaatc tgcccacatg aaagcatcca ggtcgtcaaa     35100
     cacacgtaaa aacatctgca ctacacgtgg tttaaaacag tacgtgtcta aacgctcttg     35160
     ctcttctatc actaacgtct gcaacttgat ctgcgccttt acttttttca attgtagctt     35220
     gtacttttgc aataacctga actccgcatg cgccatatcc aacgcgtcaa ccttgtgcat     35280
     gtagtataca gaaactatcc caccataccg gctgtctgct agagagcgca gcatatcgag     35340
     attttcagcg gcgtggttcg atgagcacgc tgtcactatt gcaaatctga ctgtcttggc     35400
     gcgagtcctg tggccgagtc ctaaaataaa ttgaggcctg tgaaaagcca aatatcccaa     35460
     caataacagg agcagcgtgt tcaagtgcgt acacgccctg aatttccacc ggtctgcttg     35520
     gtcgtcgccc ctgaatttcc accagtctgc ttggtcgtcg cccgcgaacc cggctttcac     35580
     catccccgac ccgttatcgc acaccagcgc ggacagttcg ccctcatccg ccatctttct     35640
     ttcgttccta cgaattccgt ccgcgtcctc gtcgcgcgtc gtcagtcctc gctcgcgcgt     35700
     cctcgtcgcc gatctcgtcc cgtcgcgtcg cgtcgcgtcg cgtcctcgtc cccgacgcga     35760
     ctcgcgccgc tctctcgcgc gcgtctcgcg cgcgtctcgc ggttcgttcg tccaccccga     35820
     gccgtcgcgc ccgatcgatc gttcgcgaat cgttcgcgag atcgcgaatc gttcgcgaat     35880
     cgttcgcgaa tcgaatcaat caatcaacga ctcgctttga aatcgttcgc gcatccgtcg     35940
     cccgttcgcg ttttgtcgtt cgcgtcgcgc ccgcgcgcgc gacgtcgaat cctcgggacg     36000
     tcgcgcgcgc ctcggtcgcg tcgcgtcgcg tcggtcgcct cgcctcgcct cgcgcgcacc     36060
     gtcgtccgtc gtccgccgcg atctcgcggt cgtcgcgaac gcaatcaatc gcgacgtcgc     36120
     gggcgcggcg tcgcggcgtc gcgggccggc ggggtgttgt acgatatata aaatacgaaa     36180
     caatcgcgta tacattacac cccaaactac cgatatgtcg atcaatcaca cgacccagac     36240
     cccccgcgat cgccgttcgc cccgatcgcg atcgcgcggc gccggacgcg cgccgcgcga     36300
     tctctcgtct atataaaata cgaatcaatc acgtatacat tatcccccaa accacccata     36360
     tatcgatcaa tcacacgacc cagatgtgcc ccgatcgcga tcgcgcggcg ccggcgcgtc     36420
     gccgacggtt tccgcggcgt cggcgctttt tacgcgccgc gcgacgcgcg cgcgtcgcga     36480
     gatcgcgccg cggtggcgtc gcgcggcgtt cgagcggacg cggtcacgcg cgcgcgtcgt     36540
     acacacatac gcgccgacgc cacaacgcgc accgcgcacg cacaacgcgc gcatcgtgtc     36600
     gccgtcgacg cgaaaaagcg tcgtaggttt gtcggataac gtgacgcgga tcgcgcgcga     36660
     gcgcgacgtc ggataacgag acggctcgcg agggggcgcg cgtcgcgaga tcgcgcgcgc     36720
     gatggcgatg acgcgcgcga tggcgcacac cgcgtcgcac accgcgtcgc atacgcgtcc     36780
     gacgtcgcga acgggacgcg ggacgcgacg cgcgcgcgcg cgcgcgattc ggaacgacga     36840
     ggcgagcgac gccgaggcgg gcgtcgaacg aggcgaagac gtcgagcggg cgacgcgggc     36900
     gacgcacgcg gtgtacgtgg agaatcccga cggtgggacg aacacgtgcg tgcgcgtggt     36960
     ggggccgaat cgccgggggg ggttggcgaa aataatcgcc gcgttgacga attacgggtt     37020
     ggacgtgcag agctcgttca cgcggacgac ggcgaacggg agcagcgtgg acgacgtctt     37080
     ttacgtcacg tgggatccga gagaggcggg gaagtcattc gatgaatctc acgcgcgatt     37140
     ggcgtcgcag ttggaggaag atcgattcga ggatttgaaa aggttcatcg tcgacgccat     37200
     gacgccgacg gagacgcgcg agcggtacac gtcgcgcatg ccgaagattt acggcatcgc     37260
     cgccgaatct gaagttttgg cgatgaagcg acgattggat gacgcgatcg acccgtcgaa     37320
     tcaggaggag tcgaagatcg cgcgcgaccc cgtcttcatg gcgtcgcagc tcgagttcgt     37380
     cgccgccgag ttggcgagcg ccacggcgcg cctggtgcaa atcgaccgcg tctacgccaa     37440
     ggttgaatct tgcggggtgg agtatttatg ggaactcgaa ggctccgatg aagaagtcgt     37500
     gaacgacgag tgcgtcgtca tcgaagccga gcgctccgac gctcgcgcga tgtttgaacg     37560
     caagctcgcc gccatggagg cggcgctcgc cgctcgcgac cgagcgcgaa gagggctcac     37620
     gacatcatcg gacaccgctt cgggtgtcgc ggtggtgcaa cggaccgatg aagcgacgtc     37680
     cacgctcgcg aaatcacgcc agcctctgaa cgaaaacaac accaccaagg cgaagctttc     37740
     caagctttcc acggatatgg cgccgcagac gccgttcgcc tcgcccctca gtcgccctct     37800
     cccttcgaca ccgtgcggaa acggtcggga actcatcctt caaggcttca attgggagtc     37860
     gtgcaacgaa aaagcgaaca acgatcgatc ttggtatcaa ctgttgaatg aaaaggttcc     37920
     cgaaatcgcc gccgcgggct tcacctccgt ttggatgccc ccgccgacga aatccgtgag     37980
     caagcaaggg taccttccca ccgacttgta caacttgaac tccttctacg gctcagaaga     38040
     tgagctgaga tcatgcgtcg ctcgcatgcg cgagtacaac atcacgccgg tggcggatat     38100
     cgtcatcaat caccgctgcg ccgaggcgca ggacgacgcg gggcgatgga acaagtacac     38160
     ggggaagatt gattgggatg cgcgcgcgat cacgtgcgag aacccgcaat tcgggggaca     38220
     gggatcgcaa agcacgggcg aggactatct tcccgcgccg aacatcgatc acactcaaca     38280
     gttcgtccgc aaggatttga aggagtggct ttcgtggatg cgcgacgacg tcggattccg     38340
     cggctggcga tttgatttcg tcaaaggcta cagcggcgtg ttcactggag agtacgtcga     38400
     agaaacgcgt cctttcttat cgttcggcga attttgggac gaatgctcat accgtgacgg     38460
     ggttttggaa tacaatcaag acgcgcaccg tcaacgaacg tgcgactggg tggattccac     38520
     cggcggtaac acggcggcgt ttgatttcac caccaagggt attctgcaag aagcagtcgc     38580
     acgcaccgag tactggcgat tgatcgacac gaaagggcgc ccaccgggtt tttgcggcat     38640
     gtggccctct cgcgccgtta cgttcatcga aaatcacgac acgggctcga cgctccagca     38700
     ctggccgttt ccgagggata aaatattgca aggatactgc tacatcctca cccatccggg     38760
     aacacccacg gtgttctacg accactgggt cgacccgaag tggtcggagg ccatcggcgt     38820
     gatgttggat attcgcaagc gcaccgggct ttcgtccaac gccgccgccg tgcacatcga     38880
     gcgcgccacc gccggtcttt acgccgcgca catcgggcac gcgcaagaga tgtacaccga     38940
     agggttgagc atggacgtcg atgtcaaacg tccgtcgatc tgcatgaagc tcggcgtcga     39000
     agactggtcg ccaaacgcgg ctaaagttgg aaacttgtcg tggaagtgca cggcgagcgg     39060
     cgatggatgg gcgatttggg aagacaagaa ccatcttgaa gacgaagaaa tcagcaaagc     39120
     gaggtgaagg agatcgcaaa tttaatcgaa acgcatagct ccactgtttc ttttaaatgt     39180
     aatgcaaaat tgacgcatta aacacaccgg ccatctgcgc gcgccgacat cgtagaattc     39240
     tgcgcgccgg ttcgggagcg ctctatcgag aaagattggc gaagcagagg atgatttaag     39300
     agcaagtaac attgaaacgc ataatattaa tgagtaaatt cgagcgcctc acgcgaaaac     39360
     gagttcatcg caggaggtga accgcttagt agaagccgaa gcccttggcc gcgttggtga     39420
     ggacgttgga gtgaaccggg tccgcaacgt gggattgcca gttggcgatc gggccttctt     39480
     gggtggcgag cgcttggaag atgcagccca accacgcgaa catggacaag cggcagtgct     39540
     tgagctcctt gatcttgagt tcttcaaggt cgccagactc ggcgaggccg agcgggtcga     39600
     agcgtccacc cgggttgacg tcaccgacgg tgaggccatc atcgaacgga gagtcggaga     39660
     taccggtacg gtacgcttcc gcggcgccga cgagaacgat ctcgatgatg agaacgttcc     39720
     agaaggacgg gtagccagag ccttccggcg cgagcggggc gacggcgccc gggaacttgt     39780
     ccgcaacggc ggtgcagtca tccggggtgc acaaggtacc cgcggtgaac cacgggatac     39840
     cggtgccgtt ttcggcggcc cacgcgccgg tgacaccgag catcgcccag cggccgtgga     39900
     tcacttcacg ctcggcgttc ttttcgtcgc cgaacgggat gatcggggat tcgccaccgc     39960
     ccgggtaggt accgaattcc gggtagatgt cagccttgac cgtcgtggag acagacttgg     40020
     cctgcgatcg ttaaaaagcg cgcgaagcga acgttcgtca gtcaccgatc gcgcgcgcgt     40080
     cgtttcacgc cgccgtcccg cctctccgcg cgtcgcgcgc gaaccgcgaa cccaatccac     40140
     cgttcacgac tcagcgccga ccccctcccg aatccccgcg cgataaagat acgatacgga     40200
     aaccgccacg aatcgcgtat cgcgcgcgtc tcgcgcgtct ctcgcccgcg ccctcccccc     40260
     cgcgcggcgc ctccgattca aatcatttct ctccgcgcgt tcgcgtcgtc ccagcgccgt     40320
     cgcctcgccg cgcgcgcgtc ccgcgtcgcc gcgccccgtc gcgcgcgatc ccatcccatc     40380
     gcgcgcgtcc catcgcgtcc cgcgtcgccg cgtctccgcg cgccgcgtcc ccgcgtctcc     40440
     gcgcgtcgct cgaaggctaa aaaatacgca cttggatctt ggtcgccttg aaggcggcga     40500
     cgcggccgac gaaggaggaa gcgagaaggg cagacattgt agaaatgcgc gtgtgcagga     40560
     atgccgatac gcgtgggcgc gatcgcgtct tgggattcgc ccgcggtcgg tcgccgcgat     40620
     cgtccgcgcg ccgcgctcgt attacgcgcg tcgcgaacgc cgcttagtgt tcgatcgcgc     40680
     gcgatcgcgc gcgtaaataa aaaaaatacg acccgcgatc gcgcgcgcga tccgatcggt     40740
     ctcgcggcgt cgcgcgtgca cacacggacc acgcgcgcca caccgtcgtc gcgccgtcgc     40800
     gcgcgcgatc gcgcgtcgcg agagcgcgac gcgcgtcgac gcgcgtcgac ggcgcgacgc     40860
     gaggcgaggc gaacgcgatc gtcgaggccg cgcgcgtcga cgcgcgcgtc gcgagcgtcg     40920
     gcgcggcgtc gcgcgacgcg gcgagggacg tcgcgagcgt tgggtgttac gcgcgcgcga     40980
     gcggcgacgc gatgacgcgc gagggcgacg acggcgcggc ggcgtggccg cgaccgagcg     41040
     cgacgttggt cgcggtggga tgcgcggcgc tggcgctggc gtgcctgggc gacgggacga     41100
     gggtggcgac gagcggattg ctgggagggg cgtcgacgac ggcgcgcggc gacgcgggac     41160
     gggagcgcgt gctcgacgac gtgccgttcg aggatgatca cgtgcgactg gtggtgccga     41220
     gagtggagcg agatatcgcg gcggaggaac tgcgggggga ggtgtcgtgg acgcgagcgg     41280
     cgacgacggg ggtgttcgac gcgagggcga acggcggcgc gagcgcgacc aacggaacgg     41340
     agtatcgtcc cgtggcgacg tacgccgcgc tcgggcgccg acggcatcac ggcagaaaac     41400
     atcatcgata cgatgatgac gaggaagaac tggcgtacga gacgaaaggg gacgatttcg     41460
     agcttcccga gttgtcctcg gtcgagccca aggattcgaa aaagaaggag acggagacgt     41520
     tcggcggcga gctcaccgcg agtgaggtcg agtccatctt ggacaagctc cgagcgcagt     41580
     cgcaagcttt agaaacggga tcagacgcga cgagtagttt aggggcaaaa gaagcgtcga     41640
     cgcccggcga gcagattgac gagctcgaga agacgcttgc gcggggctcg tctaatgccg     41700
     cgaacgagat taagactaag aagagctcgc tcttgagctc gatcgaagaa acgtcgaaag     41760
     atttggttga agagttagat tcggtaccgg cacaaacgta caagctcacg tttccgtcgc     41820
     ccaaagctcc gtcgaaagat gacaaggcgc gcgacgagac gtccaccgct gacgcggatg     41880
     cgcaacctga agcaaactct gaaatttcga gacagatttc gagcatggca aagggcgaat     41940
     cggatgctgg agatgccgcg ttcctcaaat cgttgatcga agatccggaa acatcggagt     42000
     tgatgtcgga atcgatgtct ttatcgtcgg cccagcctac gtcgaaagcg ccgacgccgt     42060
     cgaacacgcc gctaacgccg tcgccggcga cggatgcgac ggttttgggt gataatggga     42120
     cgacgacctc gcctgttgac ataccgacca agccagccat tctgccagac gttgtgcgcg     42180
     cgactggcga cgttgctaag aatacgacaa cgtacgacga cgcgtcagat ggaagctccc     42240
     acgaagattt ggagtacggc gaaggctctg aagtcgcgcc gaactcaaaa cacgacgacg     42300
     cagaatcgaa attgacagaa acggcgcaga cgggagaacc tgcgatcgag tacaagaaga     42360
     aaatcgatac gacaaacgac ataaacctat acgagaacgc gttgcgaggc gaggcgcacc     42420
     ctgagcgatc ttgggcacag aagggtctga aacccgcgga cgagagcgtt ctgacggaag     42480
     aaaacatcaa gcagaacgaa ttagcggaag accagtcgct cacagttgat tttctcaatc     42540
     gtttcccggt acaattgcct aaatcggagc gagagacaca aaattggagg cgttatcaaa     42600
     aattgcgaac gcgcgccggc gcgaagtcgg cggaggagca gtcggaagag gaccgagaaa     42660
     cggtggagag agtcaccgcc gccgcggttg agctcgttcg cgcggaaaag aagggcgaag     42720
     atgaccgtaa agaaaaatcg tggagagatg tggtgttttc tctgtacttc atgggcccgc     42780
     ttggtttcgt agcattcgtc agcgtgtttt acgccgtcgt cgtgctcgtg gtgaggaaaa     42840
     gtaaaaagtc gccctcgaag accggtaccg atcccgatga cgacgaggct tttgataagt     42900
     ttcttcgcga cgtgactgtg acaaagtcaa agactcacac gagacgagag agcgacggtg     42960
     gattggcgtc cttcctgggc tttgtcaaga agcgagtcga cgacgtggat gagtttgcaa     43020
     agtacgctag cgctcgatta cagcgtaccg tggacgaaga tggtgaggat gatgtcgacg     43080
     aagaaaaggt gtggcatcaa tccacggtaa gcgcatcggg tttggaatcg acctccatct     43140
     ctggaacctc gacgccacgc gcgtcgacgt cggcgtcgtc gccgaatcga gtcaatcacg     43200
     atcccgatcg cgtcttggat aaagcggtgg tgaatcgaag tttgcagtcg attcgtacgc     43260
     gtgagctttc atcgcccgaa cgcatacgaa acgtgcgctc gcgtgcgggg acggcggatc     43320
     cgtcgccggc gacgactcct cgcgaaacat cgtatctaac gcaacaaacc atcgatagac     43380
     tcgagccgga acgaccgaag caacggcagc cgcagtcgga tcaggaacca ccgcaacgtg     43440
     aacagcgtga gcggcaatcg tcgcgagcga aggcgaacaa accgtcaccg caagtgtatc     43500
     gctcgctctt ccctagggaa caaaccgagc cgcctcccgc gccgccgcgc cgccccggag     43560
     acgcgccgca aatagtgcgt tcgatgacga ctaaattcta ctagattaga ttacgttgga     43620
     attacacttt cctctcgatt atatatacgc gctcgcgcgc tcaccgtcgc gcccgccgca     43680
     ccggtcggtc gcgcgcgcgg cgaccgaccg acttatccgt ttatcgcgac gccgattttc     43740
     gccgcgcgcg accaacgact gcgcattgtg agcgcgcgaa gcggtaacgc gacgcatcgc     43800
     gaggtgccct cggcggcggc ggaaacccgg aaaccctcga ctgccgggtg tgttcggttg     43860
     cgcgcgcgac tttgacgcgc gcgcgctcgg acgcacgcgc gctcgatcga acgcgtcgac     43920
     gagacgcacc gcgagagcgc acgcttcgcg cgcgaacgcg tcgacgagcg cgcgcgcgcg     43980
     cgcttcatcg cgacgcgggc gaacggcgag cgacgcatcg gacacccggg aggataaagc     44040
     gcgcgtcgag cgcggacggc gaacatggga ctgtctcgag gggcgcgcac ggggtcgtac     44100
     gtcgatctgt cgaaggaagc gacgcgtccg gggcagacgg ggatcttgga taacggagac     44160
     gcggcgtccg atgggacgtt caagtcgaag atcatctgca cgctcggacc ggtgtcgcga     44220
     acggtggaga ttttggagga aatgttgagg gcggggatgt cggtcgcgcg gttcaacttt     44280
     tcgcacggct cgcacgagta tcaccaggag acgttggata atttgcgcgc ggcgtgcgcg     44340
     aacacgggca ttcattgcgg ggtgctgctc gataccaagg ggccggagat tcgcaccggg     44400
     atgctcgcgt gcgggggacc ggtgatgctc gaagcgggga aggagatcgt gctcaccacg     44460
     gactacgagt tcaagggtag cgcggaaaag ctcgcggtgt cgtatccgga cttggccaag     44520
     gacgtcaagc ccggttcgaa gattttgtgc gccgacggtt ccgtcacctt caccgtgctc     44580
     gagtgcgacg tcgccaaggg cgaggtgcga tgccgcctcg aaaacagcgc caagctcggc     44640
     gagcgcaaga acatgaactt gccgggcgtc aacgtgaact tgcccacgat caccgagaag     44700
     gatcgcctcg atttgatcga gtggggggtg aagaacaacg tcgacttcat cgccgcctcg     44760
     ttcgttcgca agggaagcga cgtcgagtac attcgctccg ttctcggcga cttcgcgaat     44820
     aaagtttcca tcatctccaa ggttgagaac atggagggct tagataacta tgacgatatt     44880
     gtcgaaaagt ccgacggcgt catggtcgct cgcggcgact tgggtatgga gattcgcatg     44940
     gaacaaatat tcttggcgca aaagcgcatg atcaagcggt gcaactacgc gggcaagccc     45000
     gtagtgacgg cgacgcaaat gctggagtcc atgacgggtg ccccgcgccc gacgcgcgcg     45060
     gaggccacgg acgtggccaa cgctattctc gacggtaccg acgccgtgat gctctccggg     45120
     gaaaccgccg cgggcaacta cgccatcgac gcggtcaagt gcatggcgtc catctgtcgc     45180
     gaagccgaag cgtacgtgga caacgtggcg agctatcacc aaatcctcga gcaacagccg     45240
     attcctatgg gcgtcgaaga gtctttggct tcgtccgccg ttcgtaccgc gcaaaaggtg     45300
     caagcctcca tcattgtatg cctctctcgc accggcacga cttctcgttt gatcgccaag     45360
     taccgcccgg atgcgccaat cttatctgtg tgctacgctg aagaagccga tccggcgagt     45420
     gttgcgcgcc gctcgctcgt cagccgtggc attatcccgg ttatccaacc gccggagtgg     45480
     ggtcaaggca acgccatcgt cccgcaagaa gtcatgcgta acgccatcct ctacgcccgt     45540
     gatacgctga agatcgtcaa gcctggcgac gctgtcgtcg gcgtgcaccg tctcttgggc     45600
     gaagccatct tgaaggtcgt cgtctgccca gaaggtaacg ccttctaagg actcaaagaa     45660
     tcgttctttt ccatcacacg tattgtcggc agcacgctct gcacacacgc gctctgcacc     45720
     catcgcgcgg taggaagtaa tctcgcctta tccggcacat cacaatatta cacaaaacta     45780
     ttttctccaa aagctaccgc tcgactgctg gcgttagtcg tcttcgtcaa agacagattc     45840
     catcatgagc ttgaactcgt tcatgctctc gacgccagcg atgctcggtg tggagttgtc     45900
     gccgcgcatc atgggcgaaa caatcggcgg tgcgcgcgga tgcaagtcgt cacccgcgac     45960
     ggcgttggac caggaatcaa tctgatcgtc ttcgttcgcg agctcgagga tggtcgccgc     46020
     gtcttccctg gtgtactggt gcgtgaatcg tctctcttcg tcgcccgaat cgccatcttc     46080
     gacgtcttcc acgacaacct catcttctaa tcgcgcagtg gcgacgacat ccttgtacaa     46140
     attcgtcgga gctcgagtat actcgatcgg tttactcttc actttctcct ccaaatccgc     46200
     cacgagcttg agcgttgtct cgtgcgtcaa agacgcgtcg acgggcaatc ccaaaacccg     46260
     cgcctttggt ggcgaaaccg gcgtcggcgg cgcgctcgat cgcggtcgta atgcctgttc     46320
     acgtccgacg cccataaatg cggcatacgg gtcccacggc gcgtcatctc cgcccgcggg     46380
     tttcggcgac gtcatcgccg gctcgaaatt cgccttcgcc tccgggctgt cttcgacggg     46440
     catgggtgtc aggcttaacg ctacgcgcgg tgtcggcgtc gatacctccg cctcatcact     46500
     tctcctcgtc tctatcgtgt tcaacggcgg cgaaggtgcg cgctctacga cgcccggaag     46560
     cgccgcagcg ctcgccgcct tcgtcggcgt ctccacgacg ctctgcaacg cctcgtccac     46620
     gacgcgttca cccaacagct cgcgaagctc gtcctcaagc gcgcgcaagc gttccaacgc     46680
     gctccccttg gacggttccc acggtcgcca cggtcgctca ctgtctcgcg cgtctctctc     46740
     tcgcgcgtcc cgctcggcgt cccgctcggg cgccgccccg ccgtcctctg cgcgacccga     46800
     acccgtcgtc tccccctcca gctgcgcgag cacgcgcggt aaatcacgca tgagcactcg     46860
     cgcttgcgcg agatcgatct cgtccagttc gtcgtcgtcg aacgcgtccg acgcgacgtc     46920
     tggaataccg ctcgaacgtc gattcgcgtc gtcgccggct ccgcgctcgt cgcgcatgat     46980
     ctcgagcgcg cgcgcgcgca ggtcgacgtc gacgtcgacg tccgtcggcg cgccgcgcgc     47040
     ggcgaggggc gacatcgacg cgcgatgggc gcgaggcgac gactgaagcg gcggttcgtt     47100
     cgcgcaccaa ccaacgttta tttatttctg caacgagcga gacgcgcgga acgggcggct     47160
     gcggacgcgc acgcgcgagg cgtcgcgccg ccggatgacg aggcgaaagt tgacgactat     47220
     cgcgatgtac aacacggcag gacgcgcgat gcgtcggcta aataccatct aaatcgtcga     47280
     agatgtcgaa ttcttccttt tcctcgtcgc gttcgcgagg atcgagtcga cgctcgcgga     47340
     cgaagaacgc ggaggcgaat cgacctttgc ggtagcgtcg agcgacgacg cgacgctcgg     47400
     tatcgtctaa catcgcgctc ggtgggcctt ggtcgtagcg accgcactcg acgacgagtt     47460
     ggtcgtcgac ggattcgacg aggacccaaa tgtggttggg aaggaacacc aacggcgagt     47520
     tcccgccgag gacgtactca ccgcccatgg cccagctcga tggggacttg accgcccacc     47580
     acggaaccac aagcatgccc tcgggatcac gcgccgccgc ctcgatttcc tctttcgctc     47640
     gtcgctcctc tgcttccctc tccgcctccg cggcgcgcgc gagcgctgga tcgtttggtt     47700
     tttgttccgc aagcttttgc gctggaccga cgtctatcgg cgaagacgtc gacgcatcct     47760
     caccacttgt ttcgcgctct tcgggtacat ctgctagcgc ttcgagcgct atgaatgtca     47820
     ccccgctcgt cgctcgccat tcgccgacgc tcacggcgtc ttcggttaaa atatcccccg     47880
     tcgccggact cgccgcccgc gtctcgcatt cgctcgccgt ctcgtgagtg atttcgattc     47940
     cacacaactc ccagttccgc ctctgtcccg gtgccgcgcg cacgcgaagc gagatccgcc     48000
     gccgctctct cggcgcctcc tcttcggcaa acgcaaacgc gaacccaacc tccgcgccct     48060
     cgacgcactc tggaagcgtc ttcggcccat cgcaataaca accttgcacg atgaacattt     48120
     tagccatctg tccgcccgcg cacacgtcgt gcgattccgc gaacgcaacg tcattcttcc     48180
     cgtattcgca ccccgcttcc gggtacaact tcttcgtctc caatcgcaac ccatcgccat     48240
     cgctcgtctt gcctccgctc gtcacgattt gccactccat gacgtccaca ccgtactcct     48300
     tgaacgcatc ggggacgtaa ttactcggca gcggcaccgc ggcacccgtg cgcggatcga     48360
     acgtcgcgct cgctccggcg tattcgcccg cgtgcgcggc gacgaagtca tcccagacgt     48420
     ccgagggcgg ccaatcgcga ttggcttcga gcgctctcga cgcgacgtgc gcgcaatgac     48480
     gcgcgtgaat tttgagtcgc gccgaggtcg acgtcgagcg cgcgcacgcg ccgtggcgat     48540
     gcgttttctg tacgctccaa aaagtacact gggacgtcat tgcgcgcctc tcgcgtcgtc     48600
     gatgcgacgc aaaagacgcc gaaagcgcgc gtgtcgaatg acacaccgcg cgttccgtca     48660
     acaaaactcg cttgcgtcgt aaacgtcgcg ttttcgcgtc gacgcggggt gaaatggcga     48720
     acacattggg acagcaggtt gttaacattt ggcgagtcaa aacttgtgac ggtcgaactc     48780
     gtcgcacatc gaggcgggcg acgacgcgag aatgcgcgcg cggcgtaaac ggttccaagt     48840
     aattgtcagc gcgtgttacg gctcgcgcgg ggacgtgatg ccgtgtttga cgatcgccgc     48900
     cgcgttggcg cggcggctcg aaggccaagc aacggtggtc gccatggcga atccagtgtt     48960
     tgagaatgcc gtcgcggcga acgtgcggtt catcggtgtg gggagtcgag atgaatacga     49020
     gtgcgtgcaa cgcgaccacg cttctaggcg agacgcgcgc gtggtggtgc ggtattggtt     49080
     ggatcatttg gagacgcacg cggagcgtat tcttgaggcg cgcgcagacg ctggaaggac     49140
     gattgtgttg gctcacacgc tcgatttggc ggtgcggtgc gtggacgagc gcgctaacga     49200
     cgaatgttta acgtgttact ccctggtgct ctcgcccgcg ctgttgagaa cgccaaatca     49260
     aacgattccg ccgttcgcgg gtgagcgcct tcggtgtttc gggcgatcgc gttgggcgat     49320
     gcgcgcagcg gattgcctag tcgatatcgc gttcgcaccg cagctcaacg cgtttcgcgc     49380
     ttcgctcggg tcgacaaaac cagtcaaaag agtgtttgac gagtggtttt tatgtaaagc     49440
     cggcgtgttc gcgatgtatc ccgaatattt cgagcgagcc gcagacgccg gctcgagaaa     49500
     agtattccaa atagactttc cccaagaagg cggcgacgtg aacgtgactg gcttgaatgc     49560
     gattcgcgtc gctcgagagt tcatcgatcg cgatgacgcg ccgaccgtcg ttttcgtatc     49620
     agccagtgga aatccaccct ttgcgtcgca atttttcgcc accgccgtga aggcgatgcg     49680
     acggctggcg ggcgcgaaag ccatcttgct gacgcgtcat cgcgatcgga tcggcgagtt     49740
     acccgaaaac gcgatccaca tcgactttct ccctttgcac ctctgtcgcg acgctggctt     49800
     gaaaatcgct gcgctcgttc atcacgggac catcgggtgc tcggcgacgg cgttgcgaag     49860
     cgcatggccg caagtcgtcg ttccagcggc gttcgaccag ccgtacaacg ccgcgctcct     49920
     cgaagcgatg ggtgcggcgc aaattatcca catgacacgt ctcacgcgca cgcggcttgt     49980
     gaaagcgctt aaaattgtgt tcaaggaaga ggcccgcgcg ccggaaaccg cgccgcgacg     50040
     tcgagcgaac gacgcgtcgt cacctcaagc gcgcgtcgcg gaaatcatcg ctaaggaatt     50100
     attgcaatac ggctaaatat acatctactc tacgatcacg tcgctgtcgc tgtcgtgcat     50160
     atcgtcgtcg ctatcatcgc tcacgtcgct cacgtccctg gcccacgatt gcactctcgc     50220
     gcgttcgact tctcttctct ccgccgaccg caagcgtcgg atcttttcag tcgacgtcac     50280
     gacttcgccg tctcgctcgc aatcacgcga ggcgtggact cgaggcgtcg tcgtttccgt     50340
     cgcgggttct ctcgccgcgc cggcgccgat cgccgcgccc caggtgagac gttttccgca     50400
     ccgcgcgcac ggcccgtggt ccgggatcaa tcgactcgac cacgacaacg cctcgtcccc     50460
     ggcgcgatcg aaaaaatgac gcgccaagca caccggatga aaacgcgcgc cgcacgtcgc     50520
     gcacccgacg gcgcgatcgc ttcgaatcgc cttcccgcac gcgtccacgc cgcacttcag     50580
     cgcttccccg cccggccgag acgccgacgc cgacgcgctc ggcgtcccac tcacaccgac     50640
     gtccatcacc cgcgctcgca tcgcatcatc catctcctca tccatctcct cctcctccgc     50700
     gttcgcgctc gccgcgacga tcgcatccat ctcccgcgtc gtcgttcgtc tccgctccac     50760
     gtgcgccgga atcgcgtccg cgtacttttc aatcagcctc tccccgacct cgctcatgca     50820
     gtgcaccgtc agcggcatgt gtttccacgg cgccgtgttc aacatcccac acatcaccat     50880
     cgccttcttc cccggcgcgc tcgttttatc gctcactccg cgctccctcg ccaacgttcg     50940
     cgtcgctcga cagctcgccg gtcgctgcca cgcccactca aactgcagcg cctgcacctt     51000
     gtcgctgaat cccgagacga cgagcaccat gtcgcacggt cgcagtcgca tcgtgtactt     51060
     ggccccgttc gcgatcgcgc cgttgtgctg cgcgagtcgt cgcggcgggt tcgtcgtgaa     51120
     tccgacgtac gactttccct tcttgctcgg atcgaggctc acgacgaggt aacacgcgta     51180
     gagcgcgcgc gcgggcgcgc ggcgcgtcgg cgcgtcgcgc gtcgggggcg cgcgcatcgc     51240
     gcggcgcgcg cgacggcgac ggcgacgcgc gatcgattgt gacggttggt gtctgcggtt     51300
     ctttttttcg ccgtgtgtag tggattaatg atggtatcca gaatataggc cgtttcgagg     51360
     agtgtgtgcg gaaggacacc ggacgctctt aattttttaa gaggtcggcg ttgttcactt     51420
     aagcctactg cgtcgcgttc gtcgcctcgc gaaggatgaa tgatgaatga tgaatgtggc     51480
     gttacaaggc gcggcgatgg cgaataaagg tgacggcggc gcgctgctac gcgatggcgt     51540
     cgtcgtcgtc gcgcgcgttc aaggcttgcg cgatgagacg cgcgttttcg gcgttgtgaa     51600
     tggcgagcga accggtcgcc ggcgcggcgc tcggcgggcg gccgacgaat cgaacgcgtc     51660
     tgttttcttc gtcgacagac gcgcggacgc gggtggcgcg ctcggttgtg gcgatgcgcg     51720
     gagcgacgaa agaccagtaa cccatgtttt tcggctcctc ttgcgcccag acgagatggg     51780
     cgttgggata gcgctgtaat cgacgcgcca gggcgtcgtg aggaaacggg aacagctgct     51840
     ccaatcgaat gatggcgacg tcgtcgatct tcttcgccgc gcgttgcctg gcgagcgagt     51900
     aataaatctt gcccgtgcac aaaatcacgc gtttgatctc gccgttcggt ttgagcggaa     51960
     tgttttcgtg acgcgtgacg tcgtctcccg cgtcgccgtc ggcgatgacg cgccggaacg     52020
     aagacttcgg cgcaaagtcc atgagcttgg acgcgcagtg cttgtgatgc agaagcgttt     52080
     tgggcgtgag cacgacaagt ggttttgagt gcggagagct tatttgccgc cgaagcgcgt     52140
     ggaagtattg cgccggcgtc gatggctgca ccatcacgaa gttggcctgc gccatgacag     52200
     aggctcgcgc gcggcggcgc atgtaacgaa tccagtctcg cctgtgcacc ttgccgctcg     52260
     acccgaaata cgcttcgacg tcgtcccaca tcccactctc tgcggcatca gcgccgttcg     52320
     catcttggcc ttggccgaac gtgtccatct tagatttact ctcggcgtcg tttcgcgtca     52380
     agatggagcg aatgttttcc aattccacga aatcattctt gtccggcccg agcgcgtcga     52440
     atgtgcgttg ggcgaacgcg agatcggccg cggcgttccc agggagcgag tcgcagtcgt     52500
     cgttcgccgc cgcgagccaa cgttcggggc gtgctgtgga gtgatccggg ccttgaccct     52560
     catacccgtg cggtaagagt aaaacgatgt cgcttcgctg accccaacgt tcttcgcccg     52620
     agcaaatata ttggtcgatg atgacctgcg cgttgtttgc gaagtcgcca aactgtgctt     52680
     cccaaagcac gagcgcttct ttacccatct cggatgcgaa accgtactcg aatcccaaca     52740
     ccgcgtgttc gctcagtggg gaattcgcag cggtgaattt gtcttgcgga cccatgttca     52800
     tattgtccag cggcacgtgt tcatgcgacg tgcgattgca atacaccgcg gcgtgacgtt     52860
     gattgaaggt tcctcgaacg caatcttgcc cactcagtcg aacgtgcgcg tgggagccga     52920
     tcgggggatc ttcgccttcg cccgtccacc acgggacgtg attttcccat cgcttttcgc     52980
     atgggtgcat gagaagcgac gcaaaagcga gcgcttcggc ggtcgcccaa tcgatttgcc     53040
     ctgcacctac ctggacatcg ggctccatgg cgcgtcgacg cgcttcgaac atcgccttga     53100
     cgtgtggatg aagcataaaa tcagtgtcct cgggaggcgt agtgatggag tggcaaatct     53160
     tctgcagcgc atcaatcggc atcccggtgc ccgccgccgt cacgcgagct tcgcgaccgg     53220
     atacgcctgt agagaccgct cgcgtcgacg cgagccacga ttcggtagtt cgaatgaagt     53280
     cttggtgcgt ggcaccttcc gcggcgaact ccttctccat ccctcgacgc aagtcgtcga     53340
     gctcatcctt gctcaggatg ccctccgcca cgcacgcgtt ggcgtaattc tccgccactc     53400
     tcggggtggc ttcaattctt cgagacatga gcggaagtgt gatggatgga tcatcgagct     53460
     cgttgtgacc gaatcgacgg tagcacacgt agttgacgac gacgtcggat tgaaattcag     53520
     ctcgatagtc cgcagccaag cgcatggcgg agacgacggc gtcagggtcg tcgccgttga     53580
     cgtgaatgat cggcgcgccg taggctttcg cgacgtcact cgggtgtgga ctcgagcgcg     53640
     cgcgtcgagg cacagtggtg aaaccgatct ggttgttcac caccacgtgc accgtgcccc     53700
     cggtggtgta atcgggcaag tcttgcaact gcatcacctc gccgttttgt ccgagcccac     53760
     aaaatgacgc gtcgccgtgc aacagcaagg gcagaacgtg cgcccgcgcg ctcgcacctt     53820
     cggtttgtga atcacgcttg aactgtttcg cgcgaaccac gccgctgacg acggcgttga     53880
     ccatttccaa atgactcgga ttcggcacca gagtcagcgc cacttgcttt gctcctcgct     53940
     cgacgtcgac gtccacaacg gctcgcgcgc cgagatggta tcgaacgtct ccgactagaa     54000
     atgatgacct atcgtctacg atttccgcgc atatcgctcc caagggtttg ccgaacacgt     54060
     tgtgtaacac gttcaaacgc ccccgatgcg ccatgcctag aacgacgcac cccacgtctc     54120
     gctccgcgga acgctcgacg aacgcttgta aacccggcac caagctctcc gcgccctcca     54180
     acccgaatcg cttcgccgaa gggaactttt ccgcgagaaa cacctccaat cgatccgccg     54240
     tcaacaaccg ctcgagcgtt cgtcttcgct ccgtcgccga agcttctcga gggccgcact     54300
     cgacttgttc cctcaaccat cgctttctct ccttgctcgt caaatgatta cactccacgc     54360
     tcatcgtgcc gcaatacaca tctctcaacc tttcgaataa ctcatcgacg cgccacgccg     54420
     tcttcgcgcg cgcgccgctc ggatccagcg tcgccgcgtc ctcgcccaga tgaaacctct     54480
     tctccggcgc gcgacgcgcg ctctcgctca gccccaaata ctcccccaag ctcaccttcg     54540
     tcttgcagtc ctccttataa aagtgatccg ggtacccttg caacagcgcg tgaatgtctc     54600
     gcgcgtcttt cggcgtcgtg gcctccatcg tctcgtaccc tcgcacgatc ggcccgagcg     54660
     agcgccccag cgggtccaac gccgccgtca ggtgtccccg cgctcgcacc gcccgcgtga     54720
     gctccgtcag cgccagcgcg tccgtgacgt cgtcgaaccg atcgccgtcg tcgttcgcgc     54780
     ccgtcgacgc cgtcgtcgac gccgtcgtgg acgacgcgcg acgcgcaatc accgtcaacg     54840
     tcggcggatt accgttaccg cgcgcacccc tcgcgccggc gtccgcggcg cgcgcgcggt     54900
     cgagcgcgcg cgcgagcgcg ctcgtggctc ttcgcgtcga catgcgcgcg gcgctcgcgg     54960
     cgacgaggac gcgagcgacg cgtcgtcgtg tgcggatgcg attcgttcgt gaatcctcag     55020
     tcgacgacgc gatgtcggac gcgcgaccgc cgcgcgcgcc gcgcgaggac gcgcgcgcgg     55080
     cgacgccgga gcacgtcgtc gtcgacggcg cgcagtgcga ggccgtgatc gcgcgattgg     55140
     cgcacgaacc gtcgctggga cacgcgtacg tggtgtcgca cgcgaaatcc cgcgcggcgt     55200
     tcttcgcgcg cgaggcgcgc gcgatggacg cgcacgcgtc ggggacgtgc gcgaggatgg     55260
     cgagcgacgc gacgagcgcg atggagacga tcggggcggt ggcgagggtg gattttgatg     55320
     gggtgatgga gaagatggat cggtgcgcgg cggcgttgga ggcgttggcg aagccgtcgt     55380
     agatagattc gttgcgtagc gtagcgtagc gtagattatc gttgatttcg tcattgtctt     55440
     tcatttcgtg gcgtacagcg cgatcattct cgagaatcgc gcgcgcgatg tcatcggttt     55500
     gaggtcggcg tcgaacagaa tccatcgtat cacgtcttct ggcaagtcaa gttcgggcca     55560
     agcgcgaagg aagtgattca ccgcaggcgt gagctcgcgc agcgacacgt acccgtcacg     55620
     ttgacgcgac aatgcgattt ggacaatcaa atctgtcgta caggcgcata ttcgttgcca     55680
     accgacgacg tatcgcgccg attccggcgc gctgtgatct tgcgcgtact tcaaacaccc     55740
     caaacgtcca gtataggcgg cacatgcgca cgtctcctcg ttccaaggac acccgtgctc     55800
     gtgcgcgtac ttcaaacact ccaaatgtcc atgcatggcg gcaaatgagc acgtccactc     55860
     gtcccaagga cacccgtgct cgtgcgcgta cttcaaacac tccaaatgtc cactataggc     55920
     ggcacaccgg cacgtcccct cgtcccaagg acacccgtgc tcgtgcgcgt acttcaaaca     55980
     ctccaactct ccatacttgg cggcaaactg gcacgtgtac gcgtcccact cgtgcccgca     56040
     ctcgcgcgcc atccgcacga gttccaagtc tcccagaaac gccgcgcacg ccgtcacgca     56100
     cgccccgtgg cctcccccca gcgactcgtc ctcgagcgcg cgcagcgcgt cgtctatcgc     56160
     acgcgccgtg aaccaaccga cgctccctct cgccgacagc aatcgcggtc gcaaccgccg     56220
     tcgcaaccgt cgcctcgcgc gcgccatcct gtcgatatcg accgcctcga cggcgacctc     56280
     aaccgtcgcg atcgatcgac cgatcggtcc gtgttgtaac cctcgatcgc gacacccgcg     56340
     cgcgcgtcgg cgtccgcctt tccgcgccgc gacgcacgcg cacgatgtcc aagagaggtg     56400
     cgccgacgac gacgcgacgc gcgcgcgcgc gaacgccatc gatcgatcga tcgacccgcg     56460
     cgacgcgcga cgccgcgcga cgcgcgcgct cgaacatcga cgcgcgcgcg atcgcgctag     56520
     ggctttgacg cgcgcgacgc gaacgatgga cgactgacgc gatggacgcg cgcttcgacg     56580
     acgcgacagg cggcggtaat gcctccggca cgaaatacaa aatgtcctac ggcgtccccg     56640
     tcggcgcggt ggtgaactgc gcggacaaca ccggggcgaa gaacttgtat ttgatcgccg     56700
     tgaagcgatg gggctcgcga caaaaccgct tgccggcggc gaaccccggt tcgatggtca     56760
     tggcgacggt gaagaagggg aagccggatt tgcgtaaaaa ggttttcccg gccatcatcg     56820
     tgcgtcagcg caagccgatt cgacgcaagg aagggttgat catttacttt gaggacaacg     56880
     cgggggtgat ttgcaacccg aagggcgaga tgaaggggag cgccatcgcg gggccggtgg     56940
     cgaaggagtg cgccgatctc tggccgcgtg tggccagcgc ggcgagctct atcatctaga     57000
     tctcgacgcg atcgagatcg agagagaatc gcgcggtttg aagtagaagt agactcgccc     57060
     ggtttcattc aatagccaag gaggttttgc ccaaactttc gcggcgcgcg cgcgcggttt     57120
     gtgtgtttgc gttcgtcgtc acgtcgcggc gcgcgaatcg cgatgcgcgc ctcgatcgcg     57180
     cgcgcgtgac gctcgcgtct acatcgcagg actcgctcgc gcgagcgcgc ggcatgcgcg     57240
     ccgtcgacct ttcgttcgtc gtccaaccga cactaaaaag tgcaccgcgg ctgcgggcga     57300
     cgtccgagcg ctggcggcgc gcgcgcgcgc gcgcgtcgcc gcgagaaggc gccgcgtcat     57360
     cgtcgtcatc gactgattcg tgcgtcacga cgcgcgatct cgtggatacg tcgctgaagt     57420
     ttgcctacgc gtgggcggcg ttcggttacg tcgtcccgag cgcggcgctc gcggcgatgg     57480
     tcgacgcgga cgatctcggc gcgagcttag cggtcgtgca gctttcgtgc gagagcgcga     57540
     aagccgcggc gacggtgcgg gtgctggacg agatagatcg gggcgtggga agtctgagct     57600
     cgagcgacga cgacggtttc gtcgcgcgcg gcgcggcgtt cggcggcgtc gccgtcgtcc     57660
     tcgcgcgcgc cgtcgatgga ttagtttcga cgacgtcgac cgtggacgcc gtcgcggctg     57720
     ccgacgcacc gacatcgctc atcgcgcacg cgggtccgtt cgctgcgtcg tgcgccgtcg     57780
     tcgcgtcgtg cgtcgtcgct cccgcgctcg aagagctgtt ctttagaggg ttcctctgcg     57840
     aggacattcg tcgacgcacg tccaacgccg cgctcgcgat cggcgtttct tcggccatct     57900
     tcgcgctcgc gcacttttct ttgccagacg tcccatcgct gttcgcgtgc ggcgtcgtct     57960
     tcgcgctcgc gagtcaaagt cgcggaggcg ttcgctccgc cttcgtcgcg cacgcgctgt     58020
     tcaactccag cgtcctcatc gagcgcgccg cggtcgcgcg cgccatcgtc gacgcatcat     58080
     agctcgcgcg ggcgtctgag cgcgcctctc atcgtacagt gctgtggtat tcattccatt     58140
     ctagtttgct acttgccctc gccgcgtcta gtccttgatc cgctccagct ccgccaatcg     58200
     ctccatgatc gcccgcttac tcgtatcctg cacctcccct cccaataaaa actcatccac     58260
     gagcaagtac accttctgga agttgaacac cagatcgagt tcgcacacgt tggcgaagaa     58320
     gtgatccagc atctccacga ataagtgaat cgattccaag tgcgtcagct cgttgtcgtt     58380
     caggtccacg cacagcgaga agaacaaccc ggcgtagcgt ctgtatatca ctttatagtt     58440
     gcgaaactcc acgaagttcg tgtgcttcgg gtcgcggttg acgacgaggc ggtggacttc     58500
     ggattctaat tttcgctttt catcgtcggc gaacgggacg taatacttgg ccaagcgcgt     58560
     cttgccttga cggttttgga gcaggatgaa gcgtatcatc gatcggtttc gacgtcgggc     58620
     ggtgcgtgac gcgcgcggtg gcgacgcgcg cgcgcgtgtg cggaccgcga aggatgactg     58680
     aggacctggg ccgtctcgag gcgtcgcggc tttgtacgag gtgcaagatt tctgatttaa     58740
     aattattaat tgtgcttgat ttattcggga acgatgatga ctttaagcac ggcctcgccc     58800
     atgatgcgat ggacgccgac gatggcgtcg cccggtttca ctaaacctaa aatgtcgcgg     58860
     cagtgtacga tggcgttgcg catgacttct tgcgggtggc cgctctcgcc gcgccacgcc     58920
     gggttctcca agagaggtac gaggccgcgc gtgatgagcg agcggtgcac gacgtcaaga     58980
     gcgcgacctt ggtgatcggg ctcttcgatg caaacgttca cgatgcgagt ctcgggtcga     59040
     tacttggcga tcatttgcgc cgtgtgaccg gtgcgagaca acgtaacgat gagcgcggcg     59100
     ttcacctttt gcgcggtacg aacggcggac gaagccaagg cttcggtgat gccgagcggg     59160
     atcacttgct gctcgagaat ttggaaatag ctcgcgacgt catcgacgta cgcttcggct     59220
     tcgcgacaga tggacgccat gcacttgacc gcgtctatgg cgtagttgcc cgcggcggtt     59280
     tccccggaga gcatcacggc gtcggtaccg tcgagaatag cgttggccac gtccgtggcc     59340
     tccgcgcgcg tcgggcgcgg ggcacccgtc atggattcca acatttgcgt cgccgtcacg     59400
     acgggcttac ccgccaagtt gcaccgcttg atcatgcgct tttgcgccaa gaatatttgt     59460
     tccatgcgaa tctccatacc caagtcgccg cgagcgacca tgacgccgtc ggacttttcg     59520
     acgatgtcgt taaagttatc taagccctcc atgttctcaa ccttggagat gatggaaact     59580
     ttattcgcga agtcgccgag aacggagcga atgtactcga cgtcgcttcc cttgcgaacg     59640
     aacgaggcgg cgatgaagtc gacgttgttc ttcacccccc actcgatcaa atcgtggcga     59700
     tccttctcgg tgatcgtggg caagttcacg ttgacgcccg gcaagttcat gttcttgcgc     59760
     tcgccgagct tggcgctgtt ttcgaggcgg catcgcacct cgcccttggc gacgtcgcac     59820
     tcgagcacgg tgaaggtgac ggaaccgtcg gcgcacaaaa tcttcgaacc gggcttgacg     59880
     tccttggcca agtccggata cgacaccgcg agcttttccg cgctaccctt gaactcgtag     59940
     tccgtggtga gcacgatctc cttccccgct tcgagcatca ccggtccccc gcacgcgagc     60000
     atcccggtgc gaatctccgg ccccttggta tcgagcagca ccccgcaatc gacgcccgtg     60060
     ttcgcgcacg ccgcgcgcaa attatccaac gtctcctggt gatactcgtg cgagccgtgc     60120
     gaaaagttga accgcgcgac cgacatcccc gccctcaaca tttcctccaa aatctccacc     60180
     gttcgcgaca ccggtccgag cgtgcagatg atcttcgact tgaacccaat cctctgcgag     60240
     tctttcgccc gaaacgccgc ctcgctgtcg ttaaacgcat agtcctcgct cgcctccccc     60300
     ccgttctcca gcacgtgcgc cgcgcgccaa tccccgaccg atcctttgct cgccagcgcg     60360
     ctcagcgctc gctggctcga cagccccgcc aaggccaccg tccgccgtcg tttctcgtcc     60420
     cctcgcgcgt catcgtgcac gatgggatcc acgctcgagt ttcgcgcgtt cagtcccatc     60480
     tcgatcgccc tctcgcgcgt cccgtcgccc tcgccgcgcc gacgttcgat tccaaattcc     60540
     gaatgcgcca ccgatcgatc cggcggcggc gaacgatcgc gcgtctctcg cgcgtctctc     60600
     gcctcgtctc gcccccgcgc gcgctcggtt cgctcgatcg acgcctcgcg cgcgttcgct     60660
     cgcgtccggg ctcgcgcgcc gcggtcgcgc gcgtcgtcgt gtcgcgtctg tgcgcgaaca     60720
     cacccgggat cgccgcgtcg gcgcgcgcga tcgatcgcgc gcgcgcgcga cgccgcgatc     60780
     gtcgcgcgag gttcgacgcg cgcgcgtcga ccctcgaccg tcgatcgatc gatcgctcga     60840
     gcgatcgatc gatcgatcgc gcgcgcgcgc ggcgccgcac acgacgacgg gcgacgcgcg     60900
     cgcgcgcgcg cgatgcgcgg cgcggcgctc gagcgcgcgt ccgcggcgcg cggcgcggga     60960
     cgacgcgcga tcgcgcgcgc gcggggcgac ggcggcgcga tgcgcgcgcg cgggcgcgcg     61020
     atcgtcgcga cgcgcgcgag cgcggacggc gcgacgacgc gcgtgatggt gaacggggtg     61080
     agcggaaaga tgggacacgc gacggcgtgc ggcgtggtca agcgcgcggg gttcgagctg     61140
     gtgccgtacg cgctgacgaa gcgggcgacg gcggcgacga cggatgtgct ggggacggag     61200
     gtgcgaggcg tggacgtcgg cgaggaggac gcgggagaga cgctggaacg cgcgaaacgg     61260
     gagtatccgg ggttcatcgt ggtggattac acgcaaccgg acagcgtgaa ctcgaacgcg     61320
     gcgctgtacg tgaagcacgg ggtgccgttc gtgatgggga cgacgggggg tgaccgcgaa     61380
     cgcatgctcc gagaggtgaa ggagagcgga aattacgccg tgatcgcgcc gcagatgggg     61440
     aagcaggtgg tggcgtttca agcggcgatg aaattgatgg ccgaacagtt tcccggcgcg     61500
     ttcgaggggt acacgctgac ggtgacggaa tcgcaccaga gtagtaaaaa ggatacgagc     61560
     ggcacggcga aagccatcgt ggcgtcgttc aacgatctcg ggtgtgggtt cgatttgaac     61620
     gatatcgagc tcgtgcgcga cgtggagagc caaacgggga agatgggcgt gcccgaagaa     61680
     cacttgttgg ggcacgcgtt tcacacctat cgcctgacga gcgcggacgg cacggtttcg     61740
     tttgagtttc agcacaacgt gtgcggacga agcatttacg ccgaaggtac ggtcgacgcg     61800
     gtggggttct taaagcgcaa ggtggacgcg aaggatccaa aaacgttgta cgacatgatc     61860
     gacgtcttga aagagggcgc tatgggggag tgggtcaagt gagcgccgcg cagaacaaaa     61920
     tctaataaag aaacaaacgt catctactat cacgctacta gtctacctaa acgcacgaga     61980
     ccgcgctcgg cgtcgacgac taacgcgcct tgatttcgca agacggataa tccagcgaag     62040
     acgatgtgaa aatcgtcccc gcagcccggc cacggaacgt cgatgggggt gacgacgaat     62100
     aaacaatcct cgctcagctt gcacgtccgc agcgacgagc cgcaatactt tgtctcaccg     62160
     ttcgtgtccg tgaacttcat gtgcgtctgg tacgtgccga gatgaaaatc gctgtcttcg     62220
     tacaactgcc gatcgacgag catgcccgtg gtgccgctgt cgaagacgac gtaaatcggc     62280
     ttggacgtct cgaaccgctc gccgtttatc cacagctcgt cgcacggcgt cgcgtagtgg     62340
     tacaccggcg ccccgatcga gcgcaaatcc accgttcgca agaccccgat ctcgctctca     62400
     tcgacgagcg agtcccgact cagcgtcagc gtctcgcgct cgaaatccaa cgcgaagctc     62460
     gcgatgtccg tctgttgcaa gaaactcggt cgaatgcccc gttcgcgatt cgtgtacttc     62520
     accaacccca cgaacggcgc cgcgtctcgt cctcgcacgt catccgtgac gccgaacacc     62580
     aaatcttcaa actccaagct ccccagcgtc gctcgcttac ccgcgtacca cgacgttcgt     62640
     ccgtccgcct gcagcccgta cgtctcgaac gtcgcgtcgt acgcctcgaa ccgcacgtcc     62700
     tcggcctcga cgcaccccca acccgcgccc gccccgctcg cgtcgcaccc tcgccgctgc     62760
     gacgtcagaa acggcgaccc ggtgtcgacg acgcctcgca gcgtcctcgc cgcgtcgccc     62820
     agcgtccact cgacggcgta cgcgccgccg cgctcgagcg tcatcggcac cgtcgtcgtc     62880
     gccgcgttcc gtcgcagcgc ctcgaacgcg tccgcgtact gcgcgcgaag cgtatcgctc     62940
     gcgctcgcgt ctctccgcgt cgcgagcgcg ctcgcggacg cgcacgacag cgcgaacgtc     63000
     cgccgcggca tcatcgcgcg cgcatcgccg tcgttcgcga cattcgcgcc gtcgcgcgcg     63060
     ccctcgcgcg ccctcgcacg cgcccgcgat cttcgcacgc gtcgtcgcgg tcgcgtcggc     63120
     gtcgtcactc gccgcgacgc gccgcgcgac gccatcgagt ggcgtcgcat cgcgtctcga     63180
     cgcgtcgcgc gatgatgccg cgcgacgacg cgaataccgc gcgcgacgac gcgtcgcgcg     63240
     cgctgacgac gcccgcgacg acgaccgacc gcgacgatcg cgcgccgcgc gtcgacgacg     63300
     tgttcagcac gcgcagaccg aaagatctcg gcgccggtct gagctctgga ttgcagagcg     63360
     cggcgaaatc ggtggcgctc ggcgcgggcg cgctgctcac ggcgcccgtc gtcggcgcgc     63420
     gcgaggacgg cgcgcgaggg ttcgtcaagg gactcggatt gggcgtcgcg agcgcgatcg     63480
     tgctgccggt ggtcggggcg agcgtggggg tggcgcaaat cgcgcgcggc gccgcgaata     63540
     cgccgagcgc ggtggcggcg cgcgcgcgag gcgagcgatt cgatcggaag acgcgagagt     63600
     gggtggcgga ggatctggcg cgcgatgggg cgtttttggg ggagacgagc gatggggcga     63660
     tattcgagcg agcggtgagg cgggcggaga cgcgaggcgc gcggccgggg atcggaggga     63720
     tgctcgagga ggcggcggga tcgagcgggg ggggcgcgag ggagacggag tattacgacg     63780
     ccctggaggt gtcgccgacg gcgacgagcg cggagatacg acggaaatat tatcttctgg     63840
     cgcgaaagat gcatccggat aagaatccga acgatcccac ggcgaaggcg cggtttcagg     63900
     aaatcggcga ggcgtaccag gtgctgagcg acgaaagttt gcgacgcaag tacgacgcgc     63960
     gcgggaagga cgcgctgggc gacgttccga tcgtgaatcc agcggcgttt ttcggcatgt     64020
     tgttcgggag cgagcaaatg gaagggttcg tggggaggtt acagctcgcg tcgctcgcca     64080
     tggcggggac ggatttgacc ggcgacgaac aggatttgct gcagaaacgc cgcgaggcga     64140
     ggttagcgat caagctcgcg gcgatgtgtg acgtgtacgt ggacattgac tcgaagatgg     64200
     gcaccgaaaa agagcgcgcg gcgcaatttg tggagacgat gcgccccgtc gcgcaaactt     64260
     tggccaacgc gtccttcggg caaatcatgg tgcaaaagat cggctgggtg tacgcgatgg     64320
     aggcggagaa gttcctgcac gacccactcg cgggaacggg gacgtggctc gatctcggct     64380
     tgagatcgac cggggtgacg atgcaacaaa aagcatccaa atggaagaat aagttttcgg     64440
     cgctcaaggc gggggtgaac atcttttcta ccgtccaaag ctcggaggca gaggtgcaaa     64500
     aggccacgaa cgagcagcag gcgaacgagc tcagggcgaa acagcaaaga gacgtcttac     64560
     cgcacgtcct cgacgcgctc tggtcgactt cgagcgtgga catcgagtcg acgcttcgac     64620
     acgtgtgctc caaggtgctt cacgacgcca gcgtcgcgca gtctcgtcgc gcgggtcgag     64680
     cgaaagcttt actgtacttg ggtaaaatgt ttcaagagac gaaatcaaca gatcccaaag     64740
     cgaaagacgc agcggcggtg cttgaggacg ccctacgcgc cgcgtttgaa cccgagcgcg     64800
     gcgccgacga cgcctgagcg cgtcttttct tgtaacacaa cattccgaca aatgcatgca     64860
     taaatgaata aataaatcaa caagcaagtg ctagctatga tacactacgc cacggattcg     64920
     tgcacgggct tgacgcgcgt cgtcggctcg acgcccgcga aggtctcggc gacgacttcg     64980
     gcggcgagtt ttccggagag caccgcgcct tccatggacc cgagaaactt ttgcgacgtg     65040
     taatcacccg ccagggtaaa gtttttgatc ggcgtgtgtt gactcggacg gaacttgttt     65100
     cgtcccggaa tcgcggcgta cacggagcgt ggcgtcttca ccactgcaaa ctttcgaagc     65160
     ttggcccccg acgcgccgtc tttacccgcg ccgagctcat ctgggaacag cgtttcgagc     65220
     tctttcatcg tcgccgcgac gatgtcttcg tcgctggcgc cgatccagtt cacgtcggag     65280
     cctgcgcgtt tgtcgcacgg cgcgaagacg agctcgagca tggagcggtc gtcgtcctta     65340
     tattctgcgc agcattcgga catgtccgcg tacacgctga gcaacggcga gcgactgaac     65400
     acaagaccgt cgtacgggcg caacttgcgg tcgaaccaga ggtgcacgtt gatgacaggg     65460
     atgccttcga gctcgttcaa ctgcctgaaa aacggcatcg ctttccaaac gtcgggaagt     65520
     tttaatttca acgcgtccac gggcatggcg gacacgtaat ggtccgccgt catgatttga     65580
     ccgtcgcgca tcttcacccc ctccacattt ccgtcggcgt cgacgagaat ttcttgcatg     65640
     ggcgcgtcgg tgatgacttt gccgccgccc acgcgttcga tgtgctccgc catgggagcg     65700
     cacagcctat ccggttggtt tccgtccaaa aacgcagtct tgctcccgtg cgtctcgttg     65760
     atgaaccgat tcatcgccgt caaaatgacc gtcatcgaga gcttatcagc gtcgataaaa     65820
     tccaacgcct tgcccatggc gatgaacagc tcgtcgcgca ctcgctttgg catgaaattc     65880
     ttcttcatcc actcctcgca cgacaactca tcctgggcgt cgatgtaatc ctgtcccccg     65940
     accaacatgg gcaccaacgg cgcgcccgtt ctcaatttct cgctccacgt caacatctta     66000
     tcgttcgaca aaatcgcgta acccatattg agcggcgcgg gcaaagccgg cggaaagtaa     66060
     aacttcgtaa actccccggg ataatccttc atcgcgaacg tcatcgcgtg ctccttccac     66120
     tgcaatcgat cctctatgtc gagctctcga aacaaattca tcacattcgg atacgcgccg     66180
     aaaaaaatgt gcaatccagt ttcgatccag tcgccgtcgt cgtctcgcca cgcgctcacc     66240
     ttgccgccca gcgcctttcc tcgttcgatc accgtgggcg cgcaccccgc gtcggcgaga     66300
     tacttaccgc agctcaggcc cgcgagaccg ccgccgatga cgagcaccgt gggcttttcc     66360
     ggggcgtcgt cgcgtcgcac gcgcgcgcga aacgtcgcga gcctggcgct cttcgccttg     66420
     gcttcttgaa agttggcgtt ggatttgacg tcgaggtcgg gcttggggta gtcggcgcat     66480
     cgcgtgcgag gcgtcgcggt gcgcgcgcgc gcgccggacg cgcgggagag ggggatggga     66540
     cgcggcgcga gggcggcgcg catggcgacg tgtgcggccg ggacgcggcg ggacgggagc     66600
     gacgtataat acaatcgagt cgctgggcta cgacaccgcg ctcggggggg tgagcttgtt     66660
     cttgactctg agaacgtact tttttaacgt gtcgtcgccg cggcgcgcga ggtcgtcgag     66720
     gatgggtttc aactttctcg acgcgacgcg ctcgcggcac gcgcgatggc ggcagacgtt     66780
     gccgagggcg tacacggcga tcttcaccac ctcggcgtcg gccgaggggt cgccaacgac     66840
     ctcggatggg gtggacatca agttgataat ggcgtcgagc gcgccggagt tcaccataag     66900
     atcgcacaga atgcctgaat tgcgaaccaa gtttccgagc gcggcgcacg cgttcgagcg     66960
     cgtcttcgcc tcctcggtgg cgtcgagcaa gtgcatgagc ggatccacag cggcggttag     67020
     tgggccgtac aaagcgtcgg aatgaaacgc tgcgtttcca atcgcgaacg ttgcaaactt     67080
     gcgcgtcgtt cggtctcgat caccacatcg ctcgatgagc ttttccagcg tcttgacgtc     67140
     gcggaattct tcgtaaaaga agtcgtcgtg gcggcacacg tttccgatgg cgttacacgc     67200
     cctcgcgcgc acgttcgggt cgtgatgatc cagcagattc gtgatgcgct cgataacgtc     67260
     tgcttcgtcg atcaaggggt agttttcctt cttcatgcgc gccaactgca tgatgacgat     67320
     gagccagtcg acgacgattt gcgcgttgcc gcgttcgcca tcgagaatct ttgagcacag     67380
     cgtcggctct aaaccaccgt ttgccaggaa ctcgctcgcg aacacgctcg gacccatgac     67440
     taagcgactc aagagcgcga tcggtgccgg ccaaatctct cgcggagacg acttcaagcg     67500
     agcgatgagc gctttcacga cgccgcgttc gctcaagatg ccttggtatc ttcgcatcgc     67560
     ccgctccgtc gcttcagggt ccatttcggg cgtaagcatg tacttgaacg gcaggtggag     67620
     aagctccgac gccgggacaa gggtgacgtc gtgaatgacg tcgccgctca tcttcttccc     67680
     aaccttggtg aacgccgtga gggccaagca cagcgcctcg cacacgccga cgtcgagcat     67740
     ggtcacgacg gggtgccgcg tgcgcgagct caacaggggc tccatggcgc acaacaccgc     67800
     cgccgctaat ttcgcgttat cagaggtaat cgtccgcttt gaggtttcgt cgacgactat     67860
     ggcggctaat atgcgcacgc cgtccgcgtc gatcgcctgc gctcgaacgt cgtcgctcgc     67920
     gtcggcgacg agtctcagca atttcgccga gtgcgtcttc gtcgtcgcgc tcctaatgag     67980
     cttttgcgtg ccatctttct tcagtgatag cgtcgcggcg acgtaagcgg tcaatggccc     68040
     aatttccgtc gccgcaaaca acgcccgaca cgtctctgtg gctgtcgctt gcgtagacga     68100
     cttcgccaat gcctgacaca acgcgtcggt gacaccgccg ccgcccttgg aactgtgcgg     68160
     ccctagagcg ctgcgcgtcg ctgcgagttc ggcactcaac cctcgcgctt ttgcgctttc     68220
     tatggcgtct gcaatcgctc gtgacgccgt cgtcgctacc gtctcgccga cgtctcgatt     68280
     tgtgtacccg agcaatttgc cgagaaatat caagtaaccg ttcaagccga gtccgcacca     68340
     cggtgacggg ccgtcgggag acgccatggc ggatacgaca ctgatggcca gcgccaataa     68400
     ttcgggttgc ggtggatcca ccgcgttcgc cgctgtcgtg cacgctgcga tgactgccgc     68460
     gggcatttct ttcgtcatcg ccgttgatcc accgccgacg ctcatcagcg tcgcgcgcgg     68520
     cacgcgcatc atcgccaacg tcgtcctcaa agccgacgca atatccgcca ttttcgtcgg     68580
     cctagcttct actttctttg aggcaagcgt gcggttcgag atgtagctcg gcaaaaactt     68640
     gctgcgatac gacgtctgcg gctgaagcgt gtccaagagc ttggtcaacg ccgctctgtc     68700
     gcgtctcaaa cccgccgcgg attccgcaga ctgcctcgca gtgttctcca actcgcgcaa     68760
     aacctcgctc acgtcttcca tactcgtcgc cgttattgta ccattcgcgt ctgcgactct     68820
     cccgtcgcgt cgccccgcac ccatggtgct ctgtctttgg cgttcacttg tcggccttga     68880
     cggcgtcctc ggcgacacgt catcctcaat ggcgtcgggc gccgcttcat caccgctctc     68940
     gtcgccgtcc ttgcgcacga acgggtgatc aagtacggac ggccaattca atcgctgctg     69000
     cggcttcttg ttgagtaatc cttgcagaaa cgatttaaac gacgggctca tcgtgtccgg     69060
     ccacttgacg tcctccttga cgattttctg aatcaacgta taaatagacg tcgtgtaaaa     69120
     cggcggttgc ccgacgaaca actcgtataa aatcacccca acgctccata aatctaccgc     69180
     atgatcgtac ggttgctcct gcacgagctc gggcgccatg tacaacggcg ttcccttgat     69240
     agaagtcatc accaacgacg acttgctcat cgatcgcgcc aatccaaaat cgcacacctt     69300
     gacgcaccga tcggtaccga tcaatatgtt ctgcggcttc aaatctctat gaatcacccg     69360
     attactgtgc aaataataca acgcatcgac gagctgccgc gcgatcatcc gcacctcctt     69420
     ctccggcaac cgcgcgtcgt gttccaacac gtcgtagagc accccttgcg caaactccat     69480
     caccacgacg aactccatgt tcgtctcgaa cgcgtccagc atcttgatca cgttcggatg     69540
     atcgagcgtt ttcatgatat cgatctcact tcgcaagctc accaaatctc gctcggattt     69600
     cccgtgtttc gggataaact tcatcgcgca cgcccgtccg ctgtatcgct gccgcgcctg     69660
     aaacaccttc ccgaacgatc cctcaccgac cggtcgcaat atgacgtaat catccagcgt     69720
     cgttttgctt cgaagcggcg cgcgaccggg ggcgttcgcg tcgccgttgc gctcgcggag     69780
     cgtcgtcggc gacgccgcgg tcgtcgggtt ttccatcggt cgcgcgcggg gggacgtcga     69840
     gattcgacgc gatcgactac gatttcagcg tcgacgagcg cgcgcggggc gattcgcgcg     69900
     cgcgcgagcg cgtcgcgagt cgtcgttgac gcgtcggcga cgtctcgcgg tgtcgcgcgt     69960
     cggtcccggc gcgcggaacg cgcgcgagtg cagattgtcg cggtgacagc tcgagtattc     70020
     tttgaaatcg acgccgcggg acaaatcgcc gcgcgacacc atcgatgtga acgcgcgaga     70080
     cgcgagcgcg acggtgggaa cggcctgaag aaagaagcgt tgttacacgg tgcgcgaggg     70140
     cgggacgggt gatcatcgct tgccgcgacc gcgaccgccg cggccgcctt tgccgccgcg     70200
     gccgcccttg ccggcgcgct tggcggaagc gcgttcgccg cgtgcgtcgg cgagctgacg     70260
     cttgtcgacg ctcgggccgc cggcgttgcc gcgatgatac ttgcgagcga cgacgacttt     70320
     ccgaggcttt ttgatcgcgc cgcttgtcgc tcggcgcgcc ttggcgaaga cgcgctcgat     70380
     ttccttggct ttgctgacgt cgggaacgtc gtcttgctcg atgatggcgg aggcgcgtac     70440
     tcgggcttga gaaatcttcg cctccgcgcg tttcttctta cgccatttcg cttcggcgac     70500
     tttcttgatc gggcgcgtgt tcaccgcggc gagctgcgcc ttggcctcgg cgagctcagc     70560
     ggcggtgtac tgcggaatcg gcttcataaa gcgacgctcg tcttcagcga accagtcggg     70620
     cacgtcgtcg tcatcgaagg cgtagcggtt gtacgcgtct tcgatgagtt cttcgcggtc     70680
     cttcttgcga atcatcttct tccctaaagc taagattcgc gcccgagtgt cgtcggagag     70740
     ctcgtcgact tcggaatcgt acccgtagcc ctccgcgtcg gagtcgctat ctgtaggcgg     70800
     ttccgcctcg gcagtgacga cttcgaaatc gccaccatcg acggctttgc gtctcttttg     70860
     ccgcgtggtg tcttcatcgg attcgtcgtc gtacgtgtcg tcgcgcgcgg cgccctttcc     70920
     gccgcgaccc gatcccttcg tcttcgcctc cgacttggct ttcttttcct ttgccttggc     70980
     tctgagatca tcgaaatttt cctcttcgtc ttcggtcgct tgttttttct tctttttctc     71040
     cttcttgctc gatttgactg gaacttcctc ctcgtcttca tcgctgtcta aagcttccgc     71100
     gggcgcggcc ttggccttct ttccgctcgc aaacaagtcg ttcgagaacc acatgtccgc     71160
     agccttgacg gcgtttttct tttgcttagt gccgagatcg acgacgagcg ggtttgcatc     71220
     tttcttcgac ttggactttt tacctttagg cgcgtcctcg tcctcgtctg cgtcgtccca     71280
     ctcgagctcg tcgctgtccg acttgaattc gtcgtccgcg gggtcgctcg cgtcgtcgtc     71340
     gtctccgtct tcgtcgcttg agtcttcgtc gtccaactcc cccgcgccga gttcagtgcg     71400
     cctatctcta cccttgctag cctcggtgaa cttttcaccc tttttctgtc gacgcgcctt     71460
     gtacatgtcc cacatgtcat cgacttcttt atctaatctt cgctcgtcct cttcggtgtc     71520
     ggaatcggcg tccgagtcgt cctctggctc ctcgtcgcta tcgcgcgcgg cgtcgatgcc     71580
     cggcgtcggc gccttggaga cgacgtcgag cgcacctttg gttttgatgc gcgcgagcga     71640
     gaacaaatcc atctcttgct ccacgatcgc ctcgccgctg ctcgccaacc ctctcgcgac     71700
     gcgaagacgc tccttggctt tgattttagc cctcttcttc ttgtctcgtc tggcttgggc     71760
     atccatcgag tttttcaact cgctcatctc gtccaagagt tgatcctttt catcgccggc     71820
     gttttcgtca tcgctatcgc cagcttcttc ttcttcgccg gatgactcgt cggaggaatc     71880
     ctcgtcgtcg tcttcgccgc gtttgccgcc tttgcgagcg tgcttcttct tttcgagtcc     71940
     cgcttgctta cgaatcgtca tgcgccaacg aagcaagagc ttgaagtcag cctttcctaa     72000
     aacaccaaga tcgctcatca acgaacgaat ttcatccgtc gtcgtcgggt gattgtcgag     72060
     atccatccat ccttcctcgg gcggttccaa accttttcga ttctgcgtcg agaaaaagtc     72120
     aaatcggtca gtcgtcgtcg tcgtcgtcgt cggatcccag agagaaaaag tcacaaaagt     72180
     acgagcgatc gaaagcctca gatgggtaaa cggcattgta ctataggttt gtttcagcag     72240
     gggctctgac ctcccttcaa acaaactgtg aagctgtatc ttcataagct ttcgatcgcc     72300
     gcgagaaaaa cgtcgcgctc ttgacgacgc accttgccgt ccaaaataaa cgtgtgatga     72360
     ctcccaagca tttctcccgg cttttcgttc acgatgaatt cttccgccgt gcattctttg     72420
     tacagcgtgg acacgccgtc ttcgtaaccg ctacgattcc gctttcgctt gccgttgtcc     72480
     ttcgtgacgt cgagcggctg aatctccgcc tcggtgtccg caaacaaatg cctcgcatcc     72540
     aataatcttg gatcaatctt cgtcggcgcc aggtacccac tacacaccac gtaaatttca     72600
     gccgaggttc cgcgcgacgc cacgggcttg gtgctctcaa cctttttaaa caactgttga     72660
     aacgcgtaca acaacgcgtg atactcgacg ctccggaaaa ccttcgtcac gaaccaccct     72720
     cccggcccca aaaactccgt cgccagccgc aacgaatcca acgtcagcgc cgcctgcgtg     72780
     tacgactcct tcgcgaagtt cccaccgacg ttcggcgccc catcgtgtat caccacgtcg     72840
     tactttaatc cctgcggcgt cacgcgtttc agcgccgcgc gacagctctg cgtcgtgata     72900
     tcctccacca gcgtcgtcac ccctcgaatc ggtcgaatcg gcgctaaatc cacccccacg     72960
     atcgtcgagc tcatgggcat gtatttctgc gccacttgca gccatccacc gggcgcggcg     73020
     cacagatcca tgcacgcgcg cgcctttgac aaaaagtcat acttccggtt caactgcacg     73080
     agcttaaacg ccgcgcgcga gcggaaccct tgctccttgg cgaggtagta gtacttatct     73140
     gcgatcgatc gcgcgcatct cgcgcgctcg cgggtcagtc tggcgctcgc gcgcgtcgac     73200
     gcggcgtcga ttcggtttgc ggcggcggcg gcggcggcgc aactcgcgcg cggctcgcgc     73260
     gcggctcgcg cgtcgcgcgc ggctcgcgcg cggcgaacga cgtcgtacct aatcgatgct     73320
     tccccttggc gcgtttgccc atgcctgcga cgacgcgagg cgcgaggcgc ggagtgcgac     73380
     gcgacgcccg ggatactttg acaaaaagtc atgcttccga cagcgtcgga cgctcgaatg     73440
     gatgggaaag ggcgatgcgc gagcgatcaa aggacatcgc gcgattaata ttaagcgtcg     73500
     acgttatcgg gcgtgcccgg ggcgggcggg gcgtcgggag cgacgacgcc gaattcttcg     73560
     gcgcgttgcg cgacgaatcg aaggaggtcg ttggcgcgcg cctcgacggc gacggcggcg     73620
     tcggcgtcgg cgaatgattc cggtgggaac atcgtggaca gtcgattgag catgcgcagg     73680
     aggtgcgtcg cgccgtacgc ctcgctcgga cgcgcgtaga cggggttgtg ccattcgtcc     73740
     ttgtacagca aggacgcgtc gagcgcggcg ttgaaggact cttcaaagcc tcgaacgatg     73800
     gcgcgcgtgc gcgcggcggt gactcgctgc gtggaggtct tcgtcctcgc cggatcggcg     73860
     cgatcggcga cgaatcggtc cagaatgttc gcgacgttga ctcgaggggc gacgtacgcg     73920
     cgcggatcga cgccgcgcga gtcttcgtag tcgcgaagga gcgccttgcg cagcgccgtc     73980
     ggcacgttga cgcgaatcgt cctcgcgacg cgctcttcct ccgtgagctc cggatccgcc     74040
     gccgagggct gcgccttcgc cgcaccgcgc gcctccgcgc tcttcccgac cgcgcgcttc     74100
     gcgaccgcgc gcgcggcgtc gccgcgtctc gcgctcgcgc ctctcggcgc cgcgttcgag     74160
     ctcgcgcgcg ccgccgtcgc cgccgtcgtc ttcgcccctc ccactcgccc ttccttccgg     74220
     tgcttcggcg cgatgctcgc cttcgccgtc tcggccaaac gcctttcccg catccttcgc     74280
     ttcgagacgt gactctgttc attcttccac aaccgccgcc gttccctcgc ctccgcctcc     74340
     gtctcgttcg gcgtcgccgc cggcgccttc ctccgcttcc cccctcgcgc ctgctcgacc     74400
     gccccgttcg ctcgcgcgcg tttccgtttc tcccgcgctt ccgtcgcgtc gagcggtcgc     74460
     agcgccgccg cgtcgaccca ctcgtcgtcc cgtctcgggt ggtggtaccc gccgtacctg     74520
     accaagtact cgcctcggcc gtcgtctcgc gcccgcgcgc cgacgatcgt cgcgttcacc     74580
     gcgtcgtcgc cctccaaacg aatcgccttc gcgccgagtt caaatccaga aatcgctttc     74640
     gacgtcgcgc gcggcgttcg cgccggtcgc gcgcgcgcgg cgacgtccgg gaccgcgcgc     74700
     gtcgccgcga gcgccgcggc ctcggccgcg gcgagcatcg cgcgtcgaaa acgacgcgac     74760
     gcgacgcgat gtggagattt gaaatctttg aaatctcgac actcgagcgc gcgccgcggg     74820
     acgcgcgagg cgtcgcgcgc gacgacggac gcgcgcgcgg gcgcgcggac ggacgacgcg     74880
     cgacgcgcga cgcgcgaacg cgcggcgcga gcgacgcacg acgcgaatca tcggaatcat     74940
     tcatgacggt tggataacga acgaccgcgt tcgaatggcg acgacgacga cgacgcgatg     75000
     cgacgacgac gacggcgctc gacgcgcgcg ggacgcgcgg gggaaattac tggacgcgcg     75060
     ggcgcgacga gacgccgcgc gcgaggcggt gcgagaggcg ctgacgcgac cgagcgcgac     75120
     gacgcggtcg aacgcggcga cgacgacggc gctcgaggag ggacgacgac ggcgcgtcgg     75180
     ggacgcgcga cgcgagatcg acgcgctgcg ggaggttttg aagatcgagc gagcggcgct     75240
     ggaggcggcg cggacgagga tcgaggcgat ggaggcgacg gaggcggagg cgtacgcgac     75300
     gcttcgggac gccgagcgcg cggcgctcga ggtggaggtg ccgtgcgcca tggccgaggt     75360
     cgagcacgag tttcgcgcgg tgagcgcggc gagggcgttg gagacgcgac gggcgatggt     75420
     gaggctgcga gcgctgctgc cggtgaggat cgatgaggaa cgagggagcc gcgaggcgcc     75480
     gcgaggcgtg cgcgcgtgcg agtggcgagt gccggacgcg atcgacgatc gagggttcga     75540
     cgcgcacgaa ctcgcggccg ggttgggggc tttgatgcat ttcagcgcgc tcgcgtcgcg     75600
     gtatctcgac gcgccgcgat tgcacagagg atcgcacgcg gcgtcgcagt cgtacgtgtg     75660
     ggcgccgacg agcgcgtggg acgacgtcga ctcgtcggtg tgggagaata aaggcacggt     75720
     tcacgttcgt gatttcgcgg gcgtgaattc agagcgtttg gagctatttc taccgcgcgc     75780
     ggtcgtcgaa ggatcgtgcg atcccgcgtc ggttcgcgag agcagactgc ggctcaagcg     75840
     agcgattcga ctgttgacga gatccgtctc ggtcatgtgc gcgcaccaat cgcgagagtg     75900
     cggcgtgatc gcgccgccta attggggacc attttctcaa ctgtgtgcgc tcacttcggc     75960
     ggtggcgaaa ggagaagaga cgacgacgac ggcgccgcaa cgcgcgcccg cgcggcgaca     76020
     aacgccgcca caaattttgc gcacctccac gaacgatcgc cgccgcgagt ccgtggagag     76080
     ttttgaatca cgagacatgg ttcaacccgt aacagacggc gcgcaccgcg gcgatgtggt     76140
     taaacgcgcg gtgtcgtcga caatagcgga aatttcgcga aaccattggt tttccgctca     76200
     cgcgtcgacg ccgcgagaat ccaacgcgat cgtcgacgac gacgagttgc tttttgagac     76260
     tttaaacgcc ggtgatttct tcatcgatca cgattcagtg gacgatatcg gtggctggga     76320
     ggcgattcac ggcaatcgtt tgcgcccagc ggcggtcgaa gacgccgtcg ccccagtctc     76380
     gaaccgcggc ctcgtcttac cgccaccacc cagcgcggtg gacgacatag agcattggga     76440
     gcgcgccatg ctggtggata atgctggtgg ataaccagtc aagttgttga acggcgcgtg     76500
     cgattgtaat tctacgatgt acactacatt tcactcgcgc cgaacgaagc gtcttttacg     76560
     acttcaccag actcaaaatc tcctccaccc gcgcccgcgt ctgcgccaac gagcacgacg     76620
     tatcgatcac gtaatccgcc ttcgccctct tctccgcgtc cgggatctga cgcgccgcga     76680
     tcccattaaa cttctcctcc gtcatcccgt cgcgtttcaa cacgcgcgcc cgctgcgtcg     76740
     cctcgtctcc cgtgctcacc acgcacaccg catccacgct cgcctcgtac tctttctcgt     76800
     acaacaacgg aatatcaaac accaccacgt catcgttcgc gtgcgcctcg acgaacgcct     76860
     ctctcgcgcg ttccaccagc gggtgcaccg ccgactcgag cgcgcgcatc ttcgcgtcgt     76920
     ccccgatgac gatcgccccg agcttcgcgc ggtcaatcgc ccccgtcgcg gcgtctaaga     76980
     cgccatcacc gaacatctcg gccacgacgg cgacggcggc gccgtcgggg gcgtataaat     77040
     cgtacacgac ctgcgcgcgg gacgacgagc gggacggttg ggtcagcgcg cggcttctct     77100
     cgagtcttcg acgcgtcgcg aaagggcgac gtcgacgcga gcgcacgcgc gaaggctcga     77160
     cgcaccgcgt cggcgtccat gacggccaca ccgaggtcgc gaaacatggc ggcgacggtg     77220
     gacttgccca tgcctatgga gccggtgagc ccgagtcgcg tcgtcgagcg cgacatgacg     77280
     acgcgcgcgc gactatgagc gcgcgagaga cgcgcgatgc gcgcgagggt tcgagttatg     77340
     cgcgtcgtcg acgtcgtggg cgctcgcgat cgatcggtcg aaccgacgcg catgcgccga     77400
     gcgaggcgcg ttgtggcgcg cggcggcgcg cgcttctcaa atcgacgaaa tcatcacaaa     77460
     ctcaaagctc gcgctagttt acttcttggc gaagccgaga ccgttatcct cggcgtaacg     77520
     cgccatgaat cgcatgaatc tgtcccaatc tctctccgtc ttcatcacgt atcgcgcctc     77580
     gatgccgctc ggtttaccgt tgatgaactt cgcgttgacg tccaccgtgc tcatctctcc     77640
     ctcctcgtcg ttcaggaaca tccccgtgat gtcaccttga ccgttttcaa acacatccgg     77700
     ttcggcgaag atgaagaacg ccgtgccgtt ggagccgtcc ttgcttcgcg tgagtttcac     77760
     ttcggggacc gaggtttcgt tttgaccctt gacgaactga atcgacgtcg tccccgcgcg     77820
     cgtcaccgcg cgcgacgcgc gagtcgcgcg cgcgacgccg cggttcatcg tggacggtct     77880
     gtgggcgatc atcgcccgag aggcgagcgt ttgcgcgtgc atcgcgcggt tcgttcgcgg     77940
     cgaatgggac aaagttgcgt gacgtcgacg gtcgtttcga cggtcgtgcg gcgcgcgcga     78000
     gcggtcgtgc ggcggtttcg cgggccgtgt gcgcgcgcgg aaggtcggtc gcgaagactg     78060
     cgcttcgcgg gcgagatcgg cggtcgtgcg agcgcgcgcg tcgatgtgcg gcgagtgggc     78120
     gcgttatcca gaggcgtctc ggcgcgtggc gtcgcggcga agtgatattg aaatgaatgt     78180
     gcgcgtgcgc gcgaaattgc gtgagtcgat cgtcgtcgat gcgctcgcta gtcgttgcgc     78240
     ccgtcgacga cgccggcgtc gtctctgaaa ttatcttgaa gcttgtccag acgcttggcc     78300
     accttttcga gctgtcgctg ttcctttttg gtgagcgtcg agtttttatc atcctttgtg     78360
     acgaaaccgg cgggacggcc cggaccggag ttgacgagac cgctctcgag ccgtcgaagc     78420
     ttctcttcca gagtcacggc ctcggtggtg aagaaggatt cgatccgttt gacgtctttt     78480
     tcgatgtctt tttcgatcac ctcggcgtcg tcgacgaggg tgtcgagatc cgtcggcttg     78540
     gtgagcttga gctcgggggc gggcttgcac gaattatcgg tgatgacgaa gtcgctccac     78600
     ttcacgccca cctttttgga cgcggcttcg agatcgggga tccactctgg cttgagatcg     78660
     ggcgtcgtcg cgtacaccgt ggcgccgccg tatccgtccc acgcgtcgtt ggtaccgcga     78720
     tagtaaatgt acacccactc cccttccttg tacgcgggga tgtaccaatc gtcttgatag     78780
     tgcaacatca cgttcccgtt gttgtgcaag atggctttac cgtcgggttc ttggtaaaat     78840
     ctctgcacgt cgttgcgttc gtagaattgc ccattcggcc ggttcacgcg ccagttaatc     78900
     ttaatgtaca tcttcccatc gtctcctttg tcgaaaaagt gttcttggca atcgaaggtg     78960
     tcaaagtcct tattcaatcc ggcgacgatg taccagcgct tttccttcac catggtgtcg     79020
     atcgtgaatc catccgcgag cgcgtcgaac ggcggcacag gatacgttcc gtcgtccttt     79080
     cgctgcgcca cgcacgactt ctccgtcacc gcgcacgtgt tgaacgtccc gaccgcttgc     79140
     gaggcgtaca aatcaccgca tcgaatctga cagtccccct cgtccggctg tccgaagcat     79200
     ccctgcaggc acaccaaatc ttccaaacac ttttcatccg tcacgcactt cgcgagctcc     79260
     ttcccgcagt tttgcaacaa acacgccccc gtgtccttca tctccgcctg cttcgccgcg     79320
     ctcaccgcca gcgcgcttcc cggcgccacc gtcatcgccg acgccgcgat cgcgacggcg     79380
     gcgagcgcgc tcgccgcgcc tcgcgcgacg tcgcccagcg ccgtcgtccc gtcgtcccgc     79440
     gcgccgtcgt cccgcatcgc cgcgcgcgcc cgcgagatcg gcgtccgcgt caccgcgcgc     79500
     gccttcgacc ccttccgcgc gctcgccgat cgcgcgctcg ccgcgcgcga ccgcgaaaac     79560
     atcgcgccgt cgatcgcccg catcgccgcg accgtcgcca ttcgcctcgt ccctcgcgtc     79620
     ctcgcgccgc gttcgaccct ttcggcgcgc cgacgcgcct cgcgcgcgcg ctcgcgcgtt     79680
     cccgcgcgcg ctcgcggcgt ctcgcgcgct cgcggcgcgt tttgcggcgc cgcgcgcgtc     79740
     gccgcgaacg gataagacga cccgcgatcg ccgcacacgc gcgcgcgccg tcgtcgctcg     79800
     cgccgagcgc gcgcgtcgcg acggctcgtc gcacgcgcca tgcgctcgac cgtcgcgccg     79860
     tcgcgcgcga ccgccgcgcg cgcgacgccg gcgccgtccc cgcgcgcggt gcgctcgacc     79920
     gcggcgtcgc gtcccgcgcg cgcgccgcgc gcgatcgtcg cgcgcgcgcg accgcgcgac     79980
     cgcgcgcgag cgccgcgcgg actcgcgcgc gcgcgcgcgg tctcggacga cgtcgcgatc     80040
     gacgcgacga agcccaaggt gctggtcgcc ggcggcggga tcgcggggct cgtcgcggcg     80100
     gcggcgtgcc gacgcaaggg catggaggtc agggtgttcg agaaggtgaa aaagtacgaa     80160
     ccgttcggtg gaccgattca gctgcagtgc aacgcgcagg gagcgctgga ttcgatcgat     80220
     cccgcgatgg cggaggcggt gacggcgaag gggacgatca cgggcgatcg cgtcaacggg     80280
     ttgctggacg gcgtgagcgg ggagtggttc tatcggttcg acacgagaaa accgtgccat     80340
     gataatggat tgccgctgac gctggtgctg tcgaggttcg aactgctgga catactgtcg     80400
     aacggggtcg gggcggagaa catcgagatg gggacggtgg tggagaggta cgaacacagg     80460
     ggcgaaaagg tggtggcgac gctcacggac ggacgagagt tcgagggaga cgtgctgatc     80520
     ggggcggatg ggattcggtc caagcttcgg gcgcagatgc gcggcgcgga tccggagaag     80580
     ccgccgctcg cgtacgcggg ctacgcggtg tacacggcgg tgtgcaagta ctcgcagccg     80640
     catcgagagc cccagcacac ggacccgaac aaggtcggct accaagtctt cctcggtccg     80700
     aagcaatact tcgtctcgtc ggacgtcggg aacggcgaac agcagtacta tgccttcttg     80760
     gaagtgcctc cgggcgggga cgacgagttc gccaagtgcg aaaagtggga aaactatcgc     80820
     gagatgctca tggaccgctt cagcggctgg gcgccggcgg tcatggagcg tctcgagtgc     80880
     acgcgaccgg aagacgtcga gcgccgcgac gtgaacgata ttctccccga tcctcgctgg     80940
     gtcgacggtc gcatggcgtt gctcggcgat tccgcgcacg cggtgcaacc gaacctcggc     81000
     caaggcggcg gccaagccat cgagagcgcg tacgtcttgg cggatgagct ttccaagtgc     81060
     gagggcggca agggcgtgca gaacgcgttg atggcgtacg cgtctcgtcg attcttgcgc     81120
     acggcctcca ttcacggctt gtcgcgattc tcgtcgttga tgaatacgtt ttaccgacga     81180
     cacctcggcg acgaaccgta cgactggtac cccgagccgg tcaaaaacat gtggaacacc     81240
     gtcgccaagg cgaagattcc gcaccctggc tcagtgatcg gtcaaatcgc gctcatcggc     81300
     accatgccca tcattttaga gtacgtcggc gccggttacg gcttgcccgg cgtcttgggc     81360
     ggcgcgtcga cgggcaacgg caaggatcgc gttccgcgct cccaagtccc gggcatctcc     81420
     gcccctcttc gagacttgac cgccgaagat ttcaagatgc gtggcattcc cggtttcgcc     81480
     aagtgatcgc cacgcaccgg cgcgatcgat ccatcgattc gccgccgacg aagagcgacg     81540
     cctcgcgtcg actcaaccca caccaccgcc gctgtaccat caaacgtcac catctcacgt     81600
     tgaagaacgt ctgaattcac gaacaaagac atttaccgta ctgaactatt attaataacc     81660
     acgacgacac atcgtatcgc tcggcgcgcc gctcgctcga cgcgccgctc gctcgacgcg     81720
     tccgcagagc gcgacgccga tccgcatgcc tcctctcccg cgccgccgcg ccgcgcgcgc     81780
     gcgcgtccgc gcgcgcgccc gcgcgtccgc gcgcgcgttc gtcctcgctc tgctgtcgcg     81840
     cgcgcgcccg agcgcgtcgt cggcgcgaac gtccaagatc ggtgccctgc gcgagtgcgt     81900
     cgacgcgtct cgctcgcagc ggcgcctgtg cggcgcgtcc gccgccgtgg tgctcggtca     81960
     gaacgtctac gtcgcgtcgt cgcgcgcgga cgcggtgacg gtgatcgacg cgagcgatcc     82020
     cgaggcgatg cgggtcgccg ggagcgcggc gagcttcggc ggcatgcgac gaccgacgga     82080
     tttgcacctg cacgcgtcgc agagctacgt cgcggtgctc gcgaccggtg acgtgcagac     82140
     gaaaaagtcg agcgtcgtcg tcgtggacgt gagcgcgtcg aggtggtcgg cggacgggac     82200
     gacgattacg ccgacgatgg cggcgagcgg acacaactgc acggcgacgg agaagggagg     82260
     acggacgttt tacgacggat acctgtgcgg cgcgacggct ttcgcgatcg tgggtaattt     82320
     ggcgtacgtc gcgtgcggag acacgaatcg gttgacggtg atgtcgctgc cgagcgacgt     82380
     cagcaagacg gcgctcgaac cggtggcggt ggtggggacg attcagagcg aggagttgac     82440
     gaacgcggaa gccatcatgg tggcgaataa taaggcgtac gtgcgatcgg atggtgtttg     82500
     tgggtcgtgc gtggccgtgg tggacgtcac gagcgcgtct tcgatgtcga tgttggccac     82560
     gaaggacatt tctgagattt catccgacgt cccgacgtgg cgatggtcga cgggatattt     82620
     agcgcgcggc gcgcacagag acaacgcgtc gtacccgtac gattgggtag tagatcccgt     82680
     gagttcgagc gtgacgagcg tggcgaggga atgcgtgaat gtggcgctcg caataggcga     82740
     tacgcccgcg gcgtgcgtcg gacggaacga attcgcttac gacgccgacg ccgagacgag     82800
     cgcgttcaat ttcgacttgt tgacgtctta ggtaccgata gctatagcta tagattttgt     82860
     agattttgtt acagaacgat tgtagtatta ggtgtgttct acgcgatttt ctccaagagc     82920
     tcgggcgagg cggcgcgaat caacgtcggg ttcggcagga acaaaagccg catcccgccg     82980
     acttcgatga gcgtatgcgg cgccaaaatg caccgctgcc ccgtggtgag cggagagtta     83040
     ttgcaccaaa tcggtcgtct tccgacgtta cgaagcgcga actcgccgtt ccaacgaagc     83100
     ttcaagaagg cttgctgtcg agaaatcttg ctcgcgtttc cctccgaccc caagtccacg     83160
     tccaccttca aatcctccgt cgaccgtccg atgacgcagt cccgcttcgc gatctcaaac     83220
     gtcacgttcg cccccacgag ttccgccagc gctcccttgg ccgtggccaa ccgcgccgtc     83280
     gccgcctgcg cgctccgctc caacgctttg attttcttca gcgtcgtcgc gttcgcccct     83340
     cgcccgacct ccctcttcgc cttcgccttc gtctccgccg cccgtcccgc ctcggtgcgc     83400
     tccacgagat cgcttctcaa tatcgcctgc tcggcgcgcg aaaacctcgg cggggcgccg     83460
     tcgtcgctct ccggctccgt ctccgcgccg ccgtcccggc gccgcgacgt ccccagcccc     83520
     gcgcgttcga gcacctcccg cagcgtcgcc cctcgcggcg ccactcgctg cgcgatcgcg     83580
     cgctctatct catcgtcccg cacctcggcg agccttcgga cgcacgcgcg cgcgaaggcg     83640
     tcgtcgcgga gcatcgaatt ccagcgcgcg cgcacgtcgt cgagcgtcct caccgacgcg     83700
     aatttcacgc acgaatccgc gccgacgagc gattcgaggg cgacgccgct ctcgcacgcg     83760
     agttttaaca ggtagtcatc gatcgcgggc caacgcgaga ggtcggggtc gggcatcgcg     83820
     cgcgagtgag ggattcgatg tgacaaggac gcgccgcggg acggcgacgc cgcgcggcga     83880
     cggctagacg aagagaaaca tcggacgctc gtcgtcgtcg atcatcttgc gcgctctggc     83940
     gcagccgacg atgcgctcga gctttaaggc gtcgagcttg ctgaataagg cgacgacgcc     84000
     ggcgacgtga ccgacgacgg gggcgccggc gacggcgtcg gtcgcgcgcg cgctcgcggc     84060
     ggcggacgat ccggccaagt aagagacgag ctctgggtaa aagtcccgat gctcggggag     84120
     ggagtagaag caaatctcgc gggcgccttt gattcgacgc ctgaaataaa agtgcgcgcg     84180
     ctcggagagg agcaacacgc gcttgcgacc gtcggcgaat aaggtgcgag cgcgagcggc     84240
     ttcgcgaggc tcggtgtact cgctgttcac ggcgaaggag acgtcttcgg cgacgagcaa     84300
     gttgcgaact cggacaaagt caaagtacga actgacgaag atcacgaccc ctggctcggg     84360
     gttttcacgt atgcgcggta agaccttctt ggtgaagtac ttgaaccgaa tgtcgtcggc     84420
     gtcgacgacg tcggaggctt tcatggcgac gcgctcgaat tgttgacgcg tcttcaccgc     84480
     gagcttgccg aggacgcctc gttgaggggc gcggaatcgg actttgccct cgaagttgac     84540
     gcatcggcgg ttgaacaacg cgttgatttc aggggtttgg aacgccgata acagaatcgt     84600
     ctgcctgaga tgacgcgcgt gaccgttcaa gtgcgactcg tgcacgcgtt gaatgtcgca     84660
     gtcgcgcgtg tctttgggaa gcgcgttcgt ggcgtcgacg agcgtggcga cgtgcgccca     84720
     attctgcatc tgaatcacgt gcgcgtgatc gatgaccaaa atttcgatcg cgctcaagaa     84780
     atccgcggcg gatttttcat cctgtaacgc ggtgacgatc ccgagaggcg aagcgaagat     84840
     gatatccgcg ccgaagaaat cgacgtacaa gcgcacgctc gccttcgtga gcttcaaacc     84900
     gagtcggaag tggtcgtcgg tgttaccctt gaacagcgcc ttgtgatcgt ctggaacaaa     84960
     cggcttgtac tttttcttct tgtttccgtg ttcgtcctcc acctcgtctt cgctatcgct     85020
     cccatcgtac gctaaaaagt cttcctcgat gcgttcgagc ttgttcaccg cgtcgtttct     85080
     gccgtgcgcc gccggacaca gctcgagcaa gcgcatgatg gctcgaccgg cgatgttacg     85140
     catcggggtt aaaaataaca ctgtcggtcg cacgaagcct tgatcgcgag ggaggtcgtc     85200
     ttcgatcact ttgacgcccg cctttgcctt tttcgccagg gattcgttat tcttcatcac     85260
     gcgatttcgc gtcctcgtca cgtgatcgat gacgtgcaag cacaccgcat cgagcgtctc     85320
     atcgttcaat tgttgtcccg ccggtccttg gtcgggaatc aacattctat ttccgtgctg     85380
     tacgtccacg tacgcggcga gcatggagta caatcgcgcc tgatcctcgc tcgcgaagcc     85440
     ttcgctcccc gtcaccgtcc tccatcgctc gcgtaatttc gcgttcacga acctcggcac     85500
     atccagcgtc ttcggcggct ccaacccgtt cgcgccctcc cacgctccct ttttacccac     85560
     gctctccgcc gacgtcttcg ggaacgacac tctctgcgtc ttcaaggcct ccgcctcggc     85620
     gtccgcgagc gtctctccga ctctcaaatg tcgcgcgagc gcgccctcgt cctcgtccat     85680
     cccaccaccc tcctccagct tctctcccgc gctcgcgctc gcgtcgtcgt cggcatcatc     85740
     gtcgtcgtcg tcgtcgtcgc tttcttcgcc gcgggcgtcg ctttcgtcgt cgctctcgct     85800
     cgaatcgctc gccgcgccgc tcgcgcgcgc cgaaccgccc gctcgagcgt ccgccggcgg     85860
     cgaatcctca tcttccccgt ccgacgcgct cgacgtcgtc gtctcgctcc ccgagcgctc     85920
     cgacgcgtcg gacgacgacg cgtcctcgtc ctcgtcgctc tcgcgcgcga cgttcgcgcc     85980
     gagcgacgcc aacagcgcgc cgtacgcgtc gccgccggcg agttcgagct catcctccga     86040
     gtcctctcgc gccgcgttcg cgccgtcgct cgcgtcgacg cgcgccgtct tcggtcgcgc     86100
     gcgatcgctc gcgcgtctcg agcgcttgcg cgcgtcgctc gcgggcatcg cgcgtcgcgt     86160
     cgcgcgagag agtgacgcga aaagcgatgc tcgacgcgcg cgtcgacact tcgacgcgcc     86220
     gacgcgcgcg atgtcgcgcg cgctcgcgtt cggcgtcgcc gtcggcggac gacccgcgtc     86280
     gcgcgcgatc cggacgcgac gcgcgacgcg cggacgcgcg ccgagagcgc gagaaacgcg     86340
     cgcgaaggtt gaccaaacgc tcaatgaacg cgtcgccaac ttgcagccgt cgaagacggt     86400
     cgcgctgacc gatctcgcgc gcgcgatgcg cgacgcgggc gaggacgtca tcggtctcgc     86460
     cgcgggcgag ccggatttcg cgacgccgcg cgcggtcggc gacgcgggga aggcggccat     86520
     cgacgcgggg aagacgaagt actcgccgaa cgacggcgac gcgaaactgc gaaacgcgat     86580
     cgcgcgaaag ctcgaggaag agaacggatt gacgtacgat gggaaaacgg agatcgtgct     86640
     gtcgaacggg gcgaaacaga gcgtggcgca gtgcgtgatg gcgacgtgcg gaccggggga     86700
     cgaggttctg gtgccggcgc cgtattgggt gagttatccg gagatggtgc ggttgtcggg     86760
     ggcggagagc gtgatcgtgc ggacgacggc ggatgaggga tttttggtga cgccggaaca     86820
     gcttcgaaag gcgatcacgc cgcggtcgag gttgttgatt ttgtgctctc cgagtaaccc     86880
     gagcggggcg gtgtatccga aggagacgct ggaggagttg gcgaaaatcg tcgtcgaaca     86940
     tccgagattg atggtgctga gcgatgagat ttatgaacac atcgtgtacg cgcccgcgga     87000
     gcatcactcg atcgcggcga tggatgggat gtgggagcgc acgatggtgg tgaacgggtt     87060
     ttccaaatcc ttcgccatga cgggatggcg tttaggatac gtcgccgcgc ccaaacactt     87120
     cgcgcgggcg atgagtatga ttcaatctca aatcacgagc gggcctaact caatctctca     87180
     agaggctgcg ctcgcggcgt tggaattagg ctacaagggc ggcgaagacg tcgcggcgat     87240
     ggtgcgagcg ttcgagcaac gtcgcgactt cgtctccgca cgcttaaacg ccattcaagg     87300
     cgtcaagctc ccgaaagtcg acggagcatt ctacgtattc ccagacgtca gcgccttctt     87360
     cggtgggaac gcgtcggcgg aaggcttcgg ccccgtcgcg gacgtcgacg agctctgccg     87420
     gtacatttta gaaaagggcc aagtcgccct cgtccccggc agcgccttcg gcgtcccaga     87480
     gtgcctgcgc atctcctacg ccgcatcaaa cgcgacgctc gaggaagcgc tctcgcgcat     87540
     agagcgatgc ctatcgctcg acgtcttcac gcgaaactcc cggcgttgag ccgagcgagc     87600
     gacgcgacgc cgcgccaacc gatggttcgc gtcctgggcg tccgaaatac ggcaatacga     87660
     cgcaatcatc attagcgagc gcgcgcgcct cgaaatcctc ccccagctcc cgcgccgcgc     87720
     gcgtcgtcat ccgtcccgct cgcgtcgtcg ccgcactcgt cgcctcgctc gccgaatgtc     87780
     tcgcgcccga cctcgcgcca ccctcgacga cgccctccgc gcgcgcgcgc tcaccgtcct     87840
     cggcgccccc gcgtccgcgc tcgagtgttc gacgtccgcg agcgcgctcg ccgcgctcgc     87900
     ggagtttctc gaggacacag tcataagagc cctgcccgcg gaccaacgcg acggtttgcg     87960
     acgcgcgcga accgcggacg cgcgcggcgt gcgcgacgcg ctcacggcgt acggcgaaca     88020
     cctcgaaccc gcgatcgagg cgctgggcga gggcgcgctg gacgccgtcg cggacgagct     88080
     gctggagcga gcgacggcgc tcaaacacgc cgacgcgtcg ccgtcggcgg cgcgggacga     88140
     cgtcgaggcg atcgaacggt cgagcaagag gctgaaattg ttttcgcgag acgccgatga     88200
     agtgagcggg gcgctggcga gcgacgcggg atgggaggcg ttgacgcggt tggcgacggc     88260
     gctcggcgcg gagacgaacg ggacgggcgg cgggagggat ccgctcgacg cgtgcgtctt     88320
     gctcgaacgc tgcgtggtgg ctcaggagag gtttgtgacg gcgttcgcgt cggcgagcgg     88380
     gcgagagacg gcgagaaatc cgccgaagct ggaggacatg ccgagcgggg tcggactgaa     88440
     cggcgacgcc gaagtggagc gcgccgtcgc cgtcgctcgg ttattgcacg tgaacgatct     88500
     gcggaggtta cagagcgaag tggatgcgtt tttagtcgcc atgcaagagt acaccgccga     88560
     tcccaagacg gattctcgca tcggaaaagt cggacgatag tcggcgcgtc gcgttcacgt     88620
     tttaattcac acgccgtcgc tagatagcta agctcgctac gtcctaaccg atcgctactt     88680
     cacagcatga aattgcacga accgtctgtc cggatcgact tgcgcatcag caccctggga     88740
     gactgtttct tcccgccgaa caatccgccg agcgaaaacg cgcgttcccg cgccacctcg     88800
     tcgtaacctt cccccgaata caacgcgtac gccgccgcat cgtccgcgcg cacgtgcaac     88860
     cacacatcac atccacccat atccaaaacc aacgcctcga ccgccttcaa cagcccccgc     88920
     ccgacgcctc gccttcgtct cgatttcgcc acgcacgcgt tggcgagata cgccgcgtcg     88980
     ctcggcggcg acacgctcgc gtccctctcg atcggtcgcg tcttcgcgct gatgctcgtc     89040
     gtcaccaacc ccacgacctc tccccgagcg tcgcttccgt cctcgacgac gtcccgcgcg     89100
     acgagcgccg tctcctccgc gtcctcgccg ttcgccagcc caatcaaata cttcaacacg     89160
     tacgccctcg gcttcgcgtc ttccgtgtcc ccgaacgcgt cgacgaccaa atcgacgcac     89220
     tcccgcacgt ctctctcgcg caatcgctcc acgcgcgcgc gtcgcgcgtc gccgagcgtc     89280
     atctcgcgcc ggaacgattt ctgaagctcg agcaagtcgt cccgtctcgc gctcgccgcg     89340
     cgcgtcccgc gcctcgcgcg tccgcgacgc gcgattcgcg cgctcgcgcg cgtccgcggc     89400
     gcgcgcgcgc tcgccatcgc gcgcgctcgc gtcgcgccgt ggcgcgcggc gccactccga     89460
     cgcgcagtcg ttgaccgatc gcgtcgacga atcgcgacgc cgcgacgcga cgcgagggac     89520
     ggcgcgcgat gtcgaccaag gacgaggtcg cgaggctcga gcgcgagctc gcgaacatgg     89580
     cgctggacgc caagcaggtg cgcggcggcg acgcgagcgc gatgattgat gatttcgatc     89640
     tcgacgcgac gacgacgacg acgacgacga cgacgacggg atgactgacg ggacgcgacg     89700
     acgcgcagcc gggaaaactg aacgagacgc tcgataagat gctggcgctg gagaagacgt     89760
     accgcctggc ggcggacttc gtcgcgacgc cgcggctgtg cgtcgcgatc gtcgacgtgc     89820
     tgcgcgcgtg cgaagactgg gacggattgc gagaacacgt cgccgcgctc acgaaacgac     89880
     gggcgcagtt gaaacaagcg atcgcggcga tggtgcgacg gtgcatggag ttcatcgatg     89940
     aagcgccggg ggcggaacag cgattgaagc tgatcgagac gctgtgcgac gcgacgagcg     90000
     ggaaaatttt tgtcgaagtc gaaaagagtc ggttgacgcg agcgctggcg aagatgcacg     90060
     aagacgaagg gcgcgtggcg gaggcgtgtg gggtgatgca agaggtggcg atcgagacgt     90120
     atggggcgct gacgaggcac gagaagttgt tcttcatcga ggaacaggtg cggttgtgct     90180
     tggcgaagaa ggattacctg cgagcgttga ttttgagtcg taaaatcaac cccaaggtgt     90240
     tcgacgagct gattgagaag gagaagaagg acgcagaaaa ggcggcgctg gcggcgaaga     90300
     gcgcgacgga gctgagtgag acggaaaaag cggagctcaa ggcggaaaaa ttgaaaaagg     90360
     aggggcaagt cgagcacgcc gagggatact ttgaacccac ggacaaaggc attccttcgc     90420
     tcgaggcgct gaaattgcgc tattacgagc tcatggtgga gtactatagt catagcgatg     90480
     aatacctaga gcagtgccgg tgctaccaga acattctgga gtgcgccgag gtgaagcacg     90540
     acgtcgcgcg gtgggggccg acgctgaaga aagtcgtgtg gttggtgtgc ctgagcaagc     90600
     acgagccgat gcaacagagc atcttacacg gcgtgaaggg caacttaaag ctgagcgatt     90660
     tacccgcgca cgaggcgctc atcaaacagt tttgcaccaa ggaaattatt cactggacga     90720
     cgctgcaaga acgatacgcc ggggaaatcg ccgcggagac ggaactcttc ggcggcgaga     90780
     agggcgcgaa gcgcgtggaa gacttgaagc ttcgcgtgat cgagcacaac atgctcgtca     90840
     tcgccgccta ctactcgcgc atgtccctca gcagactctc cgagctcttg tgcctgtcgc     90900
     ccgaggagac ggagaagcac ctctcctcgt gcgtcgtcga caaatccgtc gccgcgaaaa     90960
     tcgaccgccc ggccggtctc gtcaatttct ccgccgcgaa atccagcgac tttttgctca     91020
     acaagtgggt gtccaacatc gattccctgc tcacgtgcct cgacaaggcg tcgcacttga     91080
     ttcaaaagga atcccaacag ttcaaagtcg cgctttagtc tcagaaacca tcgcgaaata     91140
     catacaacgc tcttcttttt tacaatcccg acttcgccgc tcgccttcgc cgctcgccgt     91200
     cgctactcgc cgtcgccgct cgccgtcgct actcgccgtc gcgtccggct ccctcgcctc     91260
     gcgccttttc gtcccgctcc agctccgcca gcctctccac cgcctcccgc tctcgcgcct     91320
     cccgcgtcgc gatcgcctgt tcgaatcgtc gcatctcctc gctccctcgc gtcagcgtca     91380
     cctcaaactt cccgttcgcg tccgcgcgtc tctcgcacgc ctcggcgcac gccagcgcgc     91440
     acgtctcccc cgcgtcctcg ctcgcctccg cccccgccgc cgcgcgctcg cacccgcccg     91500
     cgcacgctct ctcgcacgcc tccgcgcgcg tcacccgcgg ctcgttcgcg ccgtcaccgc     91560
     gcgtcgtcga cgccgtcgcc tgtttttcat cgccctcgac gcggcaaaac acgcgcacga     91620
     tgaaatcgtc gaattcgtgc gcgtcgtcgt cgtcctcgag cgcttcggag gcgtctcgac     91680
     gcgcgcgcgc gacgccgcgg acgcgaatga cgctcgcgcg ccgtcgcgcg acgctcgacg     91740
     cgtcgtccgc gcgcggcatt ctgcggcgac gcgcgcgcgc gtcgaattcg agcgttcgac     91800
     cgacgaccgc gacagagcgc ggcgcgcgcg acgaccgggc gcgcgcgaag ggcgcgcggg     91860
     acgacgcgcg agcgcgacgg cgcgtcgcga gggcgagcgc gggcgcgagg gcgagggaaa     91920
     cggcgcgcga aacgcgaatg ggtgggaatc gtgacgggac gacgatgcgg gcgcggggac     91980
     tcacgagcgc gctctgggcg tcgatcgacg cgcgcgcgcg cgacgggggc gcagaggggg     92040
     acgcgttcga cgcgcgggac gcgcgggggg gcgcggcgac gacgaagcgt ggatcgggcg     92100
     aggtcgggac ggcgacgacg gcgacgacgg cgacgacgcg cgagcgagaa gagacgacgg     92160
     atgatttaga gctgtacgcc gcgcggtgcg cgctggaagc gacgcgggcg atggaaacgc     92220
     gcgctgtgct gtgggcggcg atgaatcagt ggaaactggc gatgggaagg agggtgagga     92280
     acgaggcgtt ggcgacgacg gcgcggagac ggaggcgcaa gcgggagctg aggcgatgct     92340
     tcgcgcggtg gtgcgtgcag atgccgatgc gggcggcgaa cgatgggtgg aatcggttcg     92400
     gcgcgcggtc gacgtacatc gcggggttga tcgagaccga ggatggggac ttcgacgacg     92460
     aggaattccc gacggattat cgcgccgagt tggagattcg gctgagtcaa atcgcgcgct     92520
     tggaggacgc gttgaaggac gcgaacgcgc gcgcggcggt ggcgagacgc gaagaaaacg     92580
     tcgaggcgca gatgagtaag tttcgtacgc acttgcaaaa cgtgcagcgc gagttagaga     92640
     acgtcaagcg cgagagggac gcgtacaaga tgaaatggca cgcctcgtcg ggtccagccg     92700
     aggcgaagac gcgcgaggcg cgtcgggcga atcagcgcac gatggcgacg cagacgacgt     92760
     ttgacgacga cgagaagaag aaagacgcag aggtggcgcc ttcaaagaag gaaattcgcg     92820
     ccgcggagga aaagtggatg gaacaggcgc gtctctttga acaaaagttt gaacgccaaa     92880
     tggaaatctc caacgagtac gaccgcaagt tgcgagacga gcgcacgagg ttgatgcgca     92940
     gtgaggcgag atatgaggca agaatcgagg agttaacgac aaagcaagcc gaattgatcg     93000
     ccgagttgtc cgtgcgaggc gtcgggacgg caccgacgag cgaacaaacg gtggatttca     93060
     gccgcaatca attcgccgag tacgcgaaaa tcggcgccga ggcggcgacg acgcgcgcgt     93120
     tccccgacgc ttccccgatc gcgacgctcc atccgccgtc gccaccgatg gagatgtttg     93180
     agtcgccgtc agcgaatttc gacgacgcgg aaaccaagtc cgatgtcgaa gttgagaaga     93240
     tttcccccgc gaaattcgag agcgcgaaga agctcaactt cgccgcggcg ttggatgatt     93300
     tctcctcgag cgacgacgag gatgtcaacc gcagaccgat gccaccgccg cagataccaa     93360
     ccacaaataa tatgcaggca ccaacaccgc cgctcgcgcg gacatcgagc gcgaggaagc     93420
     ctcttcgtct caccgtcgcc gtggcgaaaa tcgtcatgct cggttactcg cagcgagacg     93480
     ccatcgaggc tttgaaacac gtcgacggca acgacgtcca cgacgccttg gcctggctcg     93540
     agcgtcgcgc ccgcacagcc gcgtagctca cgcgtgtaac catatttcgc acacttcgcc     93600
     gcgccttctt cgtccttcgc cgcgcctcgt tcgcggtcgc ctcgttgacc gcgcgtcgtc     93660
     acacgccagc gcggtcacag cgcggacgga cgcccccgct cgcccgacgc gacaccgacg     93720
     cacggaaccg cactcgcgcg acgcgtaggc accgcgagac gtagaaatca gccaccatgg     93780
     tgcgcgagcg acgcgcgtaa agtttgattt ccgcccgatt cacaacaaac tttcaccgcg     93840
     aaaatcgcac gcgtgacgcc cgcggagcgc gctcgagacc gtgactgacg ctcgaacgct     93900
     tgcgcgatgt ctgtcgcaga tgatcaaagt gaagacgctg actgggaagg agatcgagat     93960
     cgacatcgag cccacggaca gcgtggagcg catcaaggag cgcgtggagg aaaaggaggg     94020
     cattccgccg gtgcagcagc ggttgatttt cggtgggaaa cagatgaacg acgagaagat     94080
     cgcgaaggat tacaacatcg agggtgggag cgtgctgcac ttggtgctgg cgctgcgagg     94140
     agggcggaag tagagcgcga cgagtcgacg agacgactga aatgttagcc taaacgctgt     94200
     aatggtaacc taaagaatcg ctgatttatc acacaaattg aattacgcag tcttcatgaa     94260
     catcgtgcga aggacaacct cttcgctccc gacagccggt ctcgcgagtt cctcggaggc     94320
     ggctttgaac accgccggcg cgcacgtaaa gttgacgacg acttggtacg catccgggta     94380
     acccttaatc tcgtacgagt tcggcttcaa tccgtgctcg gtttgctccc acgccaccaa     94440
     accttcacca aacatcgcct tgaaatcatc catcgtggtc gcacgcgtgg cgtcatcgca     94500
     atccgggcgc aacaacatga cgccctcgta cgagttcggc tcgttcttct tcgccacggc     94560
     gcgcgtcttt tggcattcac cacgacgcgt cgtcgacgtc acgcgcgtcg gcgcgcgcac     94620
     accagaggtc actgtgcatt cacaaacgcg catctttcgt cagtcatcgt tcgcgtcgtc     94680
     tcgatcgagc gtctcgccgc gccgcgccgc cgcgataggt tctagggcag cttctagggt     94740
     ctcgccgcat tcgactcgtc gtccgtccca cgcgacgccc tcgcgcgcgc gcgaacgcgc     94800
     gcgaacgatc gcccgaaatc cctcgcatcg gtttcgtcgc tccgagcgcc cgcgcgacgc     94860
     gtttcgcccg cacgcgcgag ggaaatcgcg ccgtcggcgg gacgtcaccg cgagcgtcgg     94920
     cgtcgcctat ccatcgtcac caccgcgcgc gcgcgcgcgc tttcgcgtcg cgcgtcgcgc     94980
     gaggtggtga agaatattcg cggtcgtcgt ctacgggcgt acctcgagcg atggagtgca     95040
     tgttcgcgcg tcaatgtgtc gcgcgcgcgc ggcgtggggt gctttcggcg cgtgggacca     95100
     gggacactga ctgtttatag tgtacatgac tgtttgccca tagacggatt gacatcggtc     95160
     ggtcgacgcc ggcgacggcg actgacgagc gcgtcctgcg cgaatactaa gcgagctaaa     95220
     tctctaaatt cttaccacca cccatcgcga tcgggtggtc gtgccaagtg cgcgcgccgc     95280
     acttgtccac gacgtcgcgc ggctccgtcg cgacgctcaa gcctcgggag tcggcgccct     95340
     gcgggaacga ccacgggacg tcggcgtgcc gcgcgggatc gtaccgcacg acgtcgcgca     95400
     cgcccgcgtt ccaatcgaga acttcgtaac atcgcgcttc ggcgtccaga agacactcgg     95460
     gaacgccctc ggcgcgttcg cgaagcgcgg gattgaagac tatgggaagc cacgcgcgct     95520
     ccaacgtgtg ggcccactcc aaagcggcga agtactcgaa atcgaccgcg ctcgtgagtt     95580
     tgccgtcgca agcgacgagt aaactgagcg cttcgtaaaa cttttgcgag cgatgcttcg     95640
     ccatgtcgcg cgtcacggca aaaatcgccg aaatgggcca atcgagcctc tccccgaggt     95700
     accgcgacga cacgcgccag cccggtcttt cggatgcgtt cctatcgggc gcatccgcga     95760
     gttcgctcgc cggatcctcg acgtctttga cgacatcgaa gaacgttcgc agaagcagcg     95820
     cgaaggcgtt ggtgtacatg taagtaccca ctaaaggctc tcgcgccacg ctgtacgcga     95880
     tgaacgtgtc gccgtcgaag tctgtcggcg cttttccgtc gcgagcgacc gaaaactctt     95940
     tctccatctt ccgcgcgcgc gcgtcgacca cgcgcgtaac cgtcccgtct cgctctcccg     96000
     ttcgcaactc ctcgacgaac gcgcgcagac taggccaaaa cggcctgtcg tcgtgcgcga     96060
     agatgaaaat cttcggcgcg tcgccgacgt acgtttcgcg caaaaaccac gccatcgcgt     96120
     ccacttcgcg cgcttgtgaa ttcggcatct ccgcgcacat ccacgtcatc gccctcaaat     96180
     cgtcggtgag cgcgtcgcac gcgctctccg gcgtcttcgc cgcgaagacc aatccgagcg     96240
     tcgtcgccgc caaaccgtcg aatcgtttcg tcaagtgcgc caccgagttc ccgcagcacc     96300
     acgtcacgac gtacgccacc tcgggcacga catcgcttcg ccacgcgcca ctcaccgcgc     96360
     cccgcgcgag atccgcggac gcctccgcgc gcgtcgccgt cgtcgcgttc gccgccgccg     96420
     accccaaatc caaatccgcc tccaccgtct ccaccgtctc caccgccgac ccctccaccg     96480
     ccgcgcgcga cgcctcgccc acctctcccg tccctcccga cctcaccgcg cgcgtcgcga     96540
     tgcctcgcgt cgctcgcgcg tcgtcgagcg cgcgtcgcgt cgacgcccgc gccgcgcccc     96600
     gcccccttcc cgcgccgtcg cgcgccgtcg tccacgtcgt cgccatcgtc gcgatcgccg     96660
     cgatcgccag catcgtccgc gccgtctcgc gccgtcgcgt cgtccgccgc ggcgtcgcgg     96720
     tcgttcgcgc gtcccgtcga cgccgcggcg aatcgccatc ggcgtcggcg tcggcgtcgg     96780
     cgtcggcgtc gtcgcggcgc gtcgcggcgt cgtcccgcgc gacgcgcgtc gcggcgcgcg     96840
     ccatcggcgc gcgcgtcgcg gcgacgcgcg tcgcgatgcg tcgcgcgccg cgcgcgtcaa     96900
     agattaaaag attgaaaatc tgcgaccgcc gcgcgcgcgc gcgacccggc gtcgcgcgta     96960
     cgggcgtctt taaaaaaaaa gacgcaccgc gaacgcgcga ccgggcgaac gtacgaacgc     97020
     gggtcgttcg aatcgacccc gcgcgcgacg cggccgtcgc gcgcgcgcgc gcgcgtgccg     97080
     gcgtcgcgcg accgaccgtt ttttcggcgc gcgaccgacc gttttttttt tatccacgcg     97140
     cgcattcgta agaacgctcg aatgaacgcc atgtgcgcgc gcggccaccg cgcgcgaccg     97200
     accgtttttt tttttgaatc cacgcgcgta ttcgtaagaa cgctcgaatg cacgccatgt     97260
     gcgcgcgcgg caaaacccgt aatcgatcgc gcgcgcgcgc ccaccgcgcg atcgattacg     97320
     ggtttttatc gcgcgccgcc ctaggtcgcg acgatcgcgc gtgcgccgcg cgcgacgccg     97380
     cgacgcgcgt cacgtcgcgt cgatcggacg cgcgcgcgcg tggcgtcgcg tctgatcgtc     97440
     cgatcgaccc gcggcgacgc gatggcgctc ggcgcgcgcg cgacgacgcg ggatttcgcg     97500
     acgggcgcga cgcgcgtcgc gcgacgacga cgacgacgcg cgacgacgac gacgacgacg     97560
     cgggatgtcg cgacgcgggc gcgcggtgac gacggtgacg cgcgacgcgt cgcgcgcgcg     97620
     gcggtcggcg acgacgcggc gccgatggcg agcgaggacg gggcgacggc gacggggtcg     97680
     gcgagacgcg cgctggggcg agcgctgagc gtcgacgacg acgacgcgcc gggacgaccg     97740
     tcggcgctga tgaagacgcc gcgaccgacg gtgaagccga cgaaggtgcc gcggtggttg     97800
     gcgccgctgg tggatcagta tttcgtcgat cacaaggcgc aggcgagggc gctgcgagag     97860
     ggtcggaggt gggacggcga ggcggaggat agggagtacg cggcggcgtt taaactgttc     97920
     aagacggacg aaagcgagcg accggtggag atgacgtatc tgttggagga ttacccgaag     97980
     ttgttgaagc ggatggggaa gatgcgcaag gcgcgacggg cgagtcgggc gcagcgggag     98040
     gacacgtacc cggatcccga cacgaagact gtgaaattcg ggtaccagcg aatcgcggag     98100
     aagatgggcg tgtacccgcg catcgatggc gaggcgacgt acgcgcagtt tttggagtac     98160
     ctcgaacgac gcgaggtgac gcgggtgttg ctctacgaag aggggaacat ggccatcgcg     98220
     gagatgggcg gtccggcgac gcacttggat ccgaacgtcg acgtcattcg gtggaaggtg     98280
     caaatcccgg gcgacgcgca cgatgaggtg acgcgggcgt gtctgaaagc gttttacacg     98340
     aaaccacaca acccggaaga tttgttcact ccggcgcaaa cgccgtgcca cctgttcatg     98400
     aacatcaagc cttggaacgt gggcgtgcac ggcgcgcgca actggctcat ggcgtcgacg     98460
     tttttctacc tcgcgggtac cgtgtgcaag ggggtgattc aggcggacaa ggatcccgag     98520
     gtcaaaaagc gacgcgcgtt gaggcaaaag atgaagaacg agcgcgcggc gctcgcgggg     98580
     cagatgggaa aatccaaggc gaagctggtg aagaagaacc aatccaaggt gcgcttcaaa     98640
     gacgtcgccg gtcaagacat ggtggtgaac gaattccaga ccatcatcga cgtcatgaag     98700
     ggcaatccga aatacaaggg gcgttacgtc gagccgccga aagggatctt gttggaagga     98760
     ccgcccggca cggggaagac gctcttggcg aaagccgtcg ccggcgaagc cgggttgcca     98820
     tttttttacg ccaacggttc cgagtttgtg gagatgttcg tcggcgtcgc cgcgagtcgc     98880
     atgcgcaacc tgttcaagcg cgcgcgtgaa aacgcgccgt cgatcatttt catcgacgag     98940
     ctcgacacca tcggtcgcgc tcgcaacgct ggcgaacagc gcgactcgtc gacgtctgag     99000
     cgcgagcaag ggttgatgca aatgttagtc gagatggatg gtttcgacaa caaggagtcc     99060
     ggttgtgaga tcttggtcat cggtgcgaca aacttggcga cgcaactcga tccagcgctg     99120
     ctgcgttcgg ggagattcga tcgcacctat cacatcggcg tgccgccgac gtccgaggct     99180
     cgcatgccga ttttgcaagt gcacgctcgc aacttaaaca tcgaccgcgg aggtgacgac     99240
     aagtacgaga gcgatgcctt cttacatcgc gttgccgatc tcaccaccgg cttctccggc     99300
     gccgagctcg cgaacgtgct caacgaagcc gccatcttga gcgttcgcga aggcaaggac     99360
     tccatcgata tcaacgacat agaagccgtt ttggaaaagc aagccgtcgg tctcatcagc     99420
     gctccgctgg acgatggttg ggggaaagag cacttggcca tcatcgaagc ggccaaggct     99480
     gtgatttatt ccgctcgccc cgagctcggc ccggagctgc tgcaagtctc cattcgccct     99540
     cgaggaacgc aaatgtctgg cctcatcttg acggagcgct cgagcgaagc cgaagccgag     99600
     attcgcacca ggataggtcc ggacacgctg ggtttgtaca tcgacgctct cgccgtgacg     99660
     ttgactggtc gatgcgcaga gttgcacttt ttcggtcccg acggtgtgtc cattcgaacg     99720
     aatgaagaag tttccgcggc ggcggagatg gcgttcgaca tcgtcaccac gtcgggtctg     99780
     tacccggata gcaagtttgc gccgcacttc gatatggcca tggttcacca gctcagaatt     99840
     cctcgagaaa atatggaaaa aggcacgctc gatgtcatcc ttcgcgcgca caccaagggc     99900
     atggaactca ttaaggagta tgcgccgctc atcgaacgcg tcgcgaacga gctcatggag     99960
     aacgaacgct tgtacggctc cacggttcgc gcaatggtga agaaatacca gcaagaagaa    100020
     ctaggcggca actttacgcg cacgccgtcg ttctacgaaa gggcggcgat gaatagcgca    100080
     tccagcaatt agacactagc ctacgaatta ataccagttc tacaacaatg atttgctatt    100140
     ttctaaaagc aaagcttttc ttctacgcgg cgcccctcgt gttgcgacgc acttcgacgt    100200
     agtgctcgac ggcgtaagac acacagtttg gacacgcgac cgcgcacttt tgcaatttat    100260
     agtcgctttc gagtaacatg gacgacaggg gtaaatccag aatcttcaat ctcgcctttg    100320
     cgtcgttgac ttcgcgctgc aactcttcag agccgtagcg gtgtccgcac gtgaatgccc    100380
     agcactgcgc accgtcgact gaagtcagag agtccagttc catcgcgtcg aaagctcgcg    100440
     tttgaacaaa ctcgggggaa tccaggcgag atgctagatc ttgcttgatt ttcaaccaaa    100500
     cgctttcgat tgtagcgcca tccttcgaag aatactttga ctcgtcctcg gctactcgtt    100560
     tcgtcgcgac ggcgagaatg aattgaccgc tgaattgaaa tccgagatca ctttgcagta    100620
     caacttgcat agcctctgcg tgaccttgag agacgagtac gtcaagaaac aaacgttcga    100680
     gttcgtcgat aggcaatcca ttcctttgcc agcatcgtgc tacgtcttcg attgatttca    100740
     cttgcgcgcg cgtgtcgacc acccgcgcga cgtacgtctc gacgcccagc tcgagctcag    100800
     cctgtaaggt tgacggcgac gtctcgccca cagcggcgag cttttgaaca gcggccacgt    100860
     ggcacatagc ggcggtggca aagtcttcca tctgtgacgc tgccaactcg gtgatgcgaa    100920
     actttcgctt gtccagacac ttggacgcga tccaaccaaa caactttgga tcgtcttcca    100980
     acatgacttc gatgcgctcg gcaagagcgt tttcgtcgtc caagtacaaa agtatcgtta    101040
     gctcgatttc agctgcaccg gtgacgccaa gatttttcgc ctcgcgcgcc atatccgcga    101100
     gcgagcgcag ctcatctctc gtcaacatgt cgtacacaag ttccaagggc gacgcctcgc    101160
     acgtgtccgt cgtgtcgctg tccaaaccga gcacatgaac gatgtcgtac agattttcca    101220
     tcgtctgcgt agcgatgacg tagtacgtga cattcggatc ccaaaacacg agtggtttgg    101280
     actcccaagt acgcacggtg ccgccgctgt gctcggctgc ttgcgtcatc aaattcgctg    101340
     tgacgccacc gagcatgtgc aagctctcaa cggtggatga tgaggacaac agcatggtga    101400
     ataacgtttt gattcgatct gagtactcgt tcgccgcaca cgacgagatc acggatgtgc    101460
     tcaccgcgtt cgcagcctcg aacgcgacga cggcggcgct cgccgagcac gccacgtcgc    101520
     gctgcacgcc cgcgtctttg gtggcttcga taccttcacc gatgacgcgc aaaagatcct    101580
     tcaccgcttg ttcaggggag cgttcttctt tcaggttcaa cttttggagc ttcgcttgaa    101640
     tcgattctcc caaatcgtgc gcggcggcgt tgtacgcgac tgcgttcgac gcttcgcacc    101700
     acgcgtgcaa atgcgcgtgc gcggcggcgg ccgtcttcaa ccacgaaagg ttcgcctgtc    101760
     ctccgtacgc ctcgactgat tttccgtgga agttcgtcag tgcttgcgac gcctcccacg    101820
     cctctaagct cagcgagatg aaatctttga gtggctttcc agtcttcccg aataaatcgc    101880
     gcgctcgaga gaaattttgt cgcttgagct cctggcgcgc agcctcgacg aacacgggca    101940
     tgtgatcctc gtccaagacg tgcgcgacga gttttaagcg ttcgtcttgg tcgagatcta    102000
     cgcttaaagc gttgtcaccg aactcgtcgc gttcgatcgg cgcccacgcg tcgcggcggg    102060
     tcgaggcaac gaccgcgttc ggcgacatga acgatcgcag cgtagacgcg atgtcgactt    102120
     ttgacttaat ttcgtacacc ccgtacgatg tccacaacat gcatccgcac agcgtctctc    102180
     gtcttcgcac gtacgtttcc gggagctcag ccgcgaggaa cttttttggc acgcccgcgg    102240
     agcgcggcac gtgaaacgtc tgcagcgtaa acgacttgga accgtcggtc ccgaatcttc    102300
     gcgccaacac gtgcacggac gcggtgaatg aggttaagtc tgcgagatct tcctcaccga    102360
     aaaccggttc gcgcaccaag gcgaatatta aatcttcagt cacgtgcacg gcgacggtgt    102420
     gattcggcaa cgcgtgcgtg gattttggct cggtggcgcg atccacgtcg tacaactcca    102480
     acgtacggcg atcgatcaac gcagcgatga gcgaatatcc atcgctctcg ccggtctctt    102540
     gcacgctcag cgtcacctgc cgcccctcgc gaacgccgta ctcatccttg agcaggtgcg    102600
     cggcgaatcc gtgcgaaccc gcggcgtccg gtaacgattc agccttggtc gtcgtctcca    102660
     ccttgccttt ttcgctcgtc gacgtcttca ccacgcgcga cattttctcc agcatcaacg    102720
     tccaaacttc gccctgaaca ccgttgatga cgagaaattg cttcgtcgcg ccgcgcgcga    102780
     gctccgcgct cgcgcacttg gcgccgacga cgcacgcgcc cagaggcgac ccctccttca    102840
     cgtcccacgc ccgcacctcc ccgtccacgc cgacgcatat ccccaccacc ggatcctcgc    102900
     gctcgggttc gagcgcgcga taccaccaca gcgcgctcgc cggcttcggc cctctcgacg    102960
     ccaacacccg catcgccggc gacgcctccg cgtcacgcgt caactccaaa atcggcacca    103020
     cgtacacccc tcccgcgctc gtgcagcaca acaagctttc cccatcgcgc gagtgcgcca    103080
     tcgcgtggat cctcgcgcgc gatccctcgt accacggcgc caaccgtttc gtcgcgcgtc    103140
     gtctcgccgc gataaaattt tccaccttgg ccgctcgcgc gctcccgctc gcgccgaatc    103200
     cgctcaccga gcacgccaac gcgcgtcctc gcgcgtccgc gtcgccctcc tcgccgcgcg    103260
     cgcgtcctcg cgcgctcgac gccgcgatga attccatcgc cccgtcgtcg aattcttccc    103320
     tcgccgccgc ctccgcgccc gcgctcgcgc cgccgtccgt ctgcgcgtac ccgaacatgg    103380
     cgctgatgct gaacgaccgc tcgaccgcgc cgtcgggcgg tcgcgcgcgc gcccggcgcc    103440
     gtcggtcgac gccgagcgcg tcatcgacga cgaagatttc gcactccaat cgcgcgtccg    103500
     cctccgtcga cgccccggac gcgtcgcgcg cgtcgcgagc gcgcgcgtcg cgacgctcgg    103560
     cgcgcgtctc gcgcgcgtcg gcgtccatga cgcgcgacgc cgcgccgtcg cggcgtcgag    103620
     tgcggattca ccgttggcgc gcgaatccgc ttcaccgcac ttcgcgatgc gcgacgcgct    103680
     cgatcgcctc gcgtcggacg cgctggtggt tctgaacgac ctcggcgacg cggtcgacgc    103740
     gccgagcgcg tacggggacg cgcacgggac gcgcttgagc gccgcggatg cgaatttgtt    103800
     gaaaaagttg tttcgcgcgt tcgccgcgcg cgacggcggg gcgccgtggc gacgcgcgag    103860
     cgacgcggac ggcgcgcgcg tgtatcgccg cgcgtcggcg agcgcggcgt cgagggcgca    103920
     ccaagtgctg ggggtgacgg agacgagggc gagcgcggat gaggtgttcg cgttctttag    103980
     cgaggcgagc gcgttcgacg aacactttaa gattctggac gacatgttca agggagggga    104040
     cgtgctgagc tataggttgt acgacgacat ggtgaagacg acggggggcg agggcggtgc    104100
     ggtcgagcgc gcgggggcgg gtggaggaga gggggcgaaa acgcgacggc gcgcgcgggg    104160
     actttggaat cgaggcgcga atttcggcga gttgttcgag cggttggaga gatcggccaa    104220
     ggcgaaggcg cgagacgcga aggcgcgagg gacggggcgc gcgagcgagg ggaatcggtc    104280
     ggcgatggag acgatcgagt cggtgccgcc ggagcggccc gacgcgagta atccgctcgg    104340
     atgtcgtccg ggacacgcga ttttgcgagg gacgtttagg cttccgtcca tcatacgcga    104400
     ccgcgatttc gtgtgggagc aattgacgat gaagatgccg aacggggccg tcgtcgtcgc    104460
     cgcgcaatcg atcgaaaatg gcgtcgtcaa cgccgtggcg ccgccgctcg agggacacgt    104520
     gcgcggtgca attctcgttt cgggatacta cgccgtgccg aatcgggaga ccggtggatc    104580
     gacgttgttt tacgtcgttc aggccgaccc gaaaggcgtg ctcccgatgt gggtggtgaa    104640
     cttggtggcg ccggatcaag cgcaaaacgt cgctcgactt cgtaaccacc tcgacgggcc    104700
     gaagaagtga atagattatt tcgcggcggc tcgcgcgcgc gggctaggaa cgcgtaacaa    104760
     caacgccgct aacgttctaa tgtgtatctc taaggtaatc taaaacgcgt cgtcgacctc    104820
     gcacccgaat aacgcgcgcg ccattcgccc gacgatcatc tccaacagcg ccggttcgcg    104880
     cgccgcggcg tcgatgaagc cttcgacgtg gcgcaaacgt tcgtggccgt cgacgtcgac    104940
     gtcgtcgtcg tccgcgacgt ttcgcggcgc taatttcacg cgcatcatag cgcgcgtggg    105000
     gttgacgtgc gcgtgcacgc acagcagtag cgttcgcacg gattcgcgaa acgccgcggg    105060
     aaagtttttg tgcgacgcgc gactccagcg cgtgggattg ccgacgcgcc agcagtgcgc    105120
     gacgccgccg tcacacgtcg cgccatacat ctcatctcga gcgggcgtga tcgcgagcaa    105180
     gcttggaagc gttcgtctgt gcccgctcgt gtcgtgaaag tgctgcgccg ggtgaagcga    105240
     ggtgatcaac gcgccgttgc ccggattgat gacccaaatc gcgccgtcgc gatgcgccaa    105300
     gaataagctc ccgcccacgc tgcacagcga accgcagtcg atgaagacgt tggacgcgcc    105360
     gagcccttcg atgctaaacc gattcacctc cgcgccgtcc tcggcgtcta aaatcacgag    105420
     ctttacggac gaatccggag ccgcgtacgt cgtcccgtgc accatctcct cgcacgagca    105480
     cgtcgccgcg cgagacgaca acgtccctcc cctgtcgatc acggccgcgc cggcgagaaa    105540
     cacccctcgt cccggctcgc gcctcgagcg ccaaatcaac cgcgcgcgcc cgagatcgtt    105600
     cacctccacc gccgcgacgc tcttttgatc catcgacgtc gcgacgaatc cgtcgccgcc    105660
     caacgccgcg tacgccgacg tcgtccccaa ccacgtgctc ttcgccatcg acgcgaatcc    105720
     cttcgcctct cccgaagccg tcgacggcga cagcgtctcg acgtcccaca ccgccaggct    105780
     cgcccccccg gagccgtgcc gcgcgaccaa cgtccccgcg cgccgcgctc gaccgacgac    105840
     gaccagccgc gcgcaccgcg tcgccgacgc gtcccgcgcc cgaccccatc ccgcgtccca    105900
     tcccggcggc gtcagcgtcg ccactttact cgcctccatc ccgcgctcgc gcgcgcatcg    105960
     atacacccac accgacccgt ccgtcatccc gacggcgaac tcgtccgcgt cgtcgcgcgt    106020
     cgccgccgcg ctcgcgcacc ctcgcgcgcc tcgcgcgcgc cgccacaccc cccgaccgcg    106080
     cccgcgcggc gcgaagtaca cgacgccgtc ccccggcgcg ctcggcgcgc atcccgcgca    106140
     cgcgacgacg ccgcgcgacg tcgcgagcgc gtgacactcg aaccgcgtcg cgccttcgtc    106200
     gtcgctcgac gcgtcgccgt cggcgttcga gacgccgatc gagacgcgac gcgccgggcg    106260
     atcgacgtag tcgtccgcgg cgcgctcgag cacgacggcg ctccgcgagc gcgcgccgcg    106320
     cggacgcatc ccgcggtgtg acgattacac gccgcactcg ccgacgcgcg acgacgcgcg    106380
     acgacgcgcg tgccggcgtt ctcgagatgc cggaagacgc cgcgacaacc gacgccgtcg    106440
     cgcgcgccac cgcgacgctc ggcgacgcgc gcgcgccgac gcccgcgcgc ttctccgcgc    106500
     tcttccagct ccgcgcgctc gcgacgcccg acgccgtcga cgcgctcgtc gagcggctgc    106560
     gcgcgtcgcg ctcggattcg gcgctcgtgc ggcacgagtg cgcgttcgcg ctggggcaga    106620
     tgcgcgcgcg acgcgcgatc gacgcgctga tggagacgct gcgggacggc gacgacgacg    106680
     ggatggttcg acacgagtgc gccgaggcgc tgggcgcgat cgcgagcgac gatggacgat    106740
     gcgcgacggc gctgagggaa gcggcggggg atgcgcgccg ggaggtggcg gagacggcgg    106800
     cgctggcgct gaggaaactg gagatgtgcg gcgcgggggg cgcgagggac acggggagcg    106860
     cgacggggag cgcgaaggaa cgcgcgagtc gacgacgcga cgacggaggg acgacggggg    106920
     gggcagagga gggtaaaacg gagacgacgt gtttgagcgt cgatccgatc ccggcgatgc    106980
     cgacggagac gccgttcgag cgattgaagg cggtggtttt ggacgacgcg cacgaaatgt    107040
     gggagcggta cgcggcgatg ttcgcgttgc ggaataaatc gtgcgccgat cgagaatcca    107100
     gcgacgcgtg cgcggacgtc ctgggcgagg ttttgagcgc gagcgggagc gcgctgctga    107160
     agcacgaggt gtgctacgtg ttggggcaat tacagagcgc gagcccgggg gcgcgagacg    107220
     cgttgattcg atgcctcgaa gactcgcgcg agcaccccat ggtgcgtcac gaagccgccg    107280
     aagcgctcgg atcgatcgcg catccgagca cgcgagggta cctcgagtcg ttcgcgtccg    107340
     atcccgagcc catcatcgcc gaatcgtgcg aagtggcgct cgaaatcatg cgccgagagc    107400
     gcgagggcga aatcgtcacc gccgacggcg ccgtcgtcgc cgtcaaacgc gactgagcgc    107460
     caccgcgcga taccgcgcga taccgcgcgc gtctacgttt tataaaatgc gcacgcgcac    107520
     gcattcatcg ccgcgtattc atcgcgcgcg ctcgaagaga tttcctcgcg tcccgacgcg    107580
     cgtcccggtc gccgcggcgc aaccctcccc acaatcccac gccatgaccg ccaacctcgc    107640
     ctcccgtccc ctcgcccgcc tcccgcccga ggtcaaccgc acgctgtacg tccgtaacct    107700
     ccccttcaac gtcagcagcg aggacatgca cgagatattc ggtaaatacg gcgccctgcg    107760
     acagattcgc ctcgggacga ccaaggcgac caagggcacc gcctacgtcg tctacgagga    107820
     catccacgac gccaagcagg cgtgcgagca cctcagcgga ttcaacgtcg cgaaccgcta    107880
     cctgatcgtg ctgtatcacc agagcggaaa ggcgacgcag agcgtcgagc gacgcgcggc    107940
     ggagacggcg cgtctgcagc gcgagcacgg cgtctcggga acgcaaacct gacgctcgac    108000
     gcccgcgagc gcgatatttt agcgcgtgta acgatagtga ttagcgtact agtgccgaac    108060
     gcggcgccgc ggacgcggtc ggattcatcg cgtcgcgtcg cgtcgccgtc gtcgccactc    108120
     gtcgcctcgc gcgacgcgaa tgcgctcgag cgcgcgaccg tacgtcgcgg gtgcgctcat    108180
     tttgtgggcc gtcgcgctgc aggcgcacgt gtggagcatc ccggacgcgg agttgaggcg    108240
     attgcgcgga gattcgcgcg tgtctttcgt ccccagcgcg cgcggggtgc atgcgcgcgg    108300
     ggcgaggcgc gacggcgacg acgacgacga cgcgagcgcg cggcgacgcg attaaagcga    108360
     aacgctcgaa ggtcgcgcga acgacgcgcg caaacgcgcg gcgagtcatg gcgggagagg    108420
     cggcggcgat cgacgtgacg acgctgctgt cgacgtgcgt cgacgcggcg ggacgcgggt    108480
     gcgcggagat acggcgagtg caaaaagcgc gcgatgaagc ggcgagcgac gatgagagcg    108540
     cgttcgtggt gacgagaaaa gtggcgagcg atccgcggtc ggcgctgacg gaggcggacg    108600
     tggcggcgca gagcgcgatc gtgagcgcgt tgagggcgcg gtggccgacg gtgaaaatcg    108660
     tgggcgagga ggacgaaaac gacgacgcgg cgccgatgag cccgaagcga ggggcgccgc    108720
     tacgcgagga tttgtgtgcg gcgattgaaa cgtgcgatga cgcgcgattg cggacgatgc    108780
     gggtgaaaag cgaggacgtg acggtgttca tcgatcccgt ggacgggacg cgagaattcg    108840
     tcgagtcgcg tctgcgcgcg gtgcagtgct tgatcggaat cgccgtgcgc ggacgcgcgg    108900
     tggcgggtgc gatcgggttg ccgtttcctg atggtgacgt cgcgtcgtcg gaggcgtgcg    108960
     tggtgtacgg cgcggtggcg ccgggggcga agcgcggcgc cgtgggcgcg cacggcgagc    109020
     gcggcgccgc tctcgagata cgattcgacg cagagaacgc gcaggtgcgc tcggtgacgg    109080
     gagattccaa aaatgcggcg ttaatcgcgg cgaaagagat tttgcgagag acggcgacga    109140
     aaagcggggc gacgtacgcg cacggctcga tcggcggcgc cgggaataaa ttgctcgccg    109200
     tcgcggaagg tcgcgccgag tacgctttga tgcacttcgg gacgtcgctg tgggacacgt    109260
     gcgcacccga agcgatcgtt cgcgcgtgcg gggggaaagt gacggattta tacggcgcgc    109320
     cgctgatgca ttacgaagac tcgccggggg ggttggtgaa ccaactcggc gtcgtcggtt    109380
     cgtccgccgc gtgcgaaggc gcgatttcgc acgacgccgt gtgctcggag atgcgtggaa    109440
     acgaagactt gaagaagatg ctgaatcgct tcacgggtgg tgatagctcg ctcgcattcg    109500
     gcggcgatga aattcaggcg agcgacgtcg cgcggtgttt gggcggcgga ccgttgtcgg    109560
     cgcgagacgt cggcgaccgc gtcgcgcgcg ccgtcggcgc cgaaggcgac gtctcgcttt    109620
     ccggatactc cgcccccgag cgcgacgccg tgcgcggttt gatgagcgat gcgtgtcgta    109680
     tctatttcaa atggtccaca gacgacgacg gtcgtctgcc ccggtcggcg ttctacaaaa    109740
     aagtcgacat gggcaatctc gaatacatgc gcaccaagca agtcacgcaa ccgctcaaaa    109800
     ttgcgcgcga cagtaaatcg tacgccgtcg aggcgtcgtt tctcgcctcg gacgcgtgta    109860
     aggcgctcga agaagcgggc atcggcgtac cgatatgcta cgccgccgac ttgcgaccgg    109920
     tgcacgacga cccgatcgag agcaagtttt ccctcttgct cgaagacttt cacccgagcg    109980
     acggttggga acaggcgaag atgcttcgac cggatcaagc caaatgcgcg ctcagagcgc    110040
     tcgcgcgcat gcacgcgttc ttccttccgg gaagtcgctt ccgaaagtca tcgaaagccg    110100
     cgaatgagga tcttctcgcc acggtttgga gctcgggcgg atattggcaa ccgaacatgc    110160
     aaccggacga tcagatggac gtcgtggcga gcgcgtggga gcagcatatg tccagcttcg    110220
     gcgccgcgat tgaggccgag ccgacgatcg acatcgccgt ggcgcgaacc gtcggtgcga    110280
     gattacagtc gcacgcgcgt cgaataggcg cggagacgca cccgttttcg ggatgtccgg    110340
     gcgccgacga cgcgttgcga cacggcggcg agagactggc ggcgctgcaa accgtcatcc    110400
     acggtgatcc gaaatcgggt aacatttttg agcgacgcgc gggggagtcc gacgaatggg    110460
     aaatcggtct gatcgatttc caatggaccg ggatcgggct cggcggtacg gatgtcgggc    110520
     attttatgtg cgcgtccgtg gcgccggagg ggctgagcgc cgacggcgcc gcggaaaacg    110580
     cactcgtcga cgtgtactac gacgcgtttt gtgaagccgc ggcggaattc ggcgcggtgt    110640
     cgagtaaaga aaacgctggc gaagagttgc tcacgcgaga agagttacaa gtgcagtatg    110700
     aaaacggagt attggatacg atgcgatgcg tgtttggcta ccagtggctt cgcgtcaagg    110760
     cgtcgcccga gtcgctcgcg aagaacgcac agtccatagg gcgcaacagt tacaacaagt    110820
     cgctcccgaa cgcgttgtgg atgattcgca ctgcggattt gtatctcaag gcgcgcgaag    110880
     cgagagcgca ttaaatgatt tgttgagtaa gatatgagtt gaaattttca cgcgcacacg    110940
     ctcttcttcg atcgaagctc gacggtgtat ttgtctggaa tcgcgtcgcg ctccatttct    111000
     ttgactttac gctcgcgaat ttgttcaagt aaaacgtgcg tttgtctttc gcgccggcgc    111060
     gcctcttcag cctcttcagc cgcgcgcgcc tccgcccgtc gtttcgcctc ttcgttggat    111120
     tgcatttgat ggattaaatc gcgcttgtgc gccgccgctg cctcgcgccg cgcctcctct    111180
     ctctgccgct ccgccagcag ctgcgcctcg tactctcgtt tcaaacgttc ggcgttttct    111240
     ttttcgttct ccttctcgat gcgctgcaat cgcacctttt cttcgtgctg cgccacgcga    111300
     gcggcggcta aatcttcaag catttggcgt cgcttggcgc gttcggcgcg ttccttctcg    111360
     cgcgtctgtc tgtcgtactc atcttgcagc ttttgagcgc gaataaagtc ttgctcggcg    111420
     cgaccatcga tgtacttttc ttgcatcgaa cgaagacgcg cggtctcgag ttcgcgcgct    111480
     cggcgctgcg cttcctcctc ggcggctttg gcggcgtcgc gctcggcttt caatcgcaag    111540
     tactccatca cgcgttcatc ttccgcgcgt tcggcgcgct cggcctcggc tttgcgcttg    111600
     atttgttctt cgttttcagc gtttatctcg tccagaagtt tcagcgcggc cacgcgcttg    111660
     cgctgcttgt ccgcggcgtc ctcttcgaag gcgcgctcga tgtcttcgac gcgcttgcga    111720
     gattcccgct cgcggcgttc ctgctccatc gcgcgcgcgc gctcgcgctc cgcgatttgc    111780
     tcgcgcagcg tatctgcgcc gagtttcatc tcgaacctac gctcgcgttc gcgacgttcc    111840
     atgcgcgcga tcgcggcgac gcgatcgcgc tccatctcct cgtccaaccg tcgccgctcc    111900
     gcctcggcgg cgattcgcag cgcgcgcttc tcctccacct gcgcgtctcg cgacgtcata    111960
     accttgccgt acaaaaccat agaattcatc tcgcgcacgt ccgcgagatc attctcgagc    112020
     tcagccgccg cgcgcgctcg agtctcccca tccgtctcct ctcgcacggt gcgcctcggc    112080
     gccgccgcgt cgccctcccg cgcgtcctcc gcgccccgat tcgtctccgc cttccctcgc    112140
     gcgcgcgcag cgtccgccgc gcgcatgcgc tcgcgccgcg cgcgctcgcg cgccgccgcc    112200
     tccgtcccac cgtcgcccgc gcccgcgtcc gcgtccgcgt ccgcgtccgc gcgcgtcgct    112260
     tcgtctcgct cctccccgcc gtcgtcccac cgcccgcgcg cgcgtcgcgc catcgcgcgc    112320
     gcctcctcgc gcgtcacgcg cgaaaaccca ccgcgcgcgc ccgccgccgc gcggtgggtc    112380
     gtcgccatcg tcgcgcgccg gtctctcgcg tcgacgcgtc gacgcgtcga ttcgtcgatt    112440
     cgcgtcgcta tttttagccg cgacgcgtcc ggtcgccccg cgccctcgcc gacgacgatc    112500
     gcgcccgaac gcgtcgcgcg atcgcgcgcg gcggtattat ttaacgcgcg cgtttcgttc    112560
     gcgcgtcgtt cacgcgtcgt tttcgcgtcg tttcggcgtc gttttcgcgt cgttttaaat    112620
     cttcaagtct cgagacgctc gagcgaaacg atcgattttc gcgtctgtgc gcgacgttcg    112680
     cgtcgcgtcg cgtcgcgtcg cgtcgcgcgt cgtcgcgatg gcgcgcgcga taccgtccgc    112740
     gatgacgcgc gtcgacgccg cgccgtcggc gagcgcgtcg gcgcgcgcgt cgtcggcgac    112800
     gcgccgacac gcgctcatgt tcgcgtggct cggattgatt cacgtcgacg tcgcggtgac    112860
     ggcgctggcg gtgtggacgc tgccgagcgc gatggcggtg acggcgctcg cgacgctggt    112920
     cgcggcggcg gcgatcccgc ggacggtggc gacgccgagg tggggcgcgc ggttggcgcg    112980
     cgcggtgacg aggacggcga cggcgtactt tccgacgcga ttggaattcg aagacgagga    113040
     ggcgtatctg cgagcggtga ggaacgaaga ggcgtgcgtg ataggactgg aaccgcacgg    113100
     ggtgctgccg ctgagcgtga tatcgttcgc ggagtatttt atgcacgatg aggagggggc    113160
     gcggcgacga ggattgacgc cggcggcgag acgaggcgcg cgggcgctgg cgagcgcggc    113220
     gatatttaaa gtcccgctcg tgaaacatct gtggacgtgg ttggggttgg atccgatctc    113280
     gaaggcgtgc atgctgagga tgctgcgagc ggggaagacg gcggtgatca ttcccggcgg    113340
     cgtcgccgag tgcatggcga tggaacgcgg cgtggagacg ttgtatttgc gcaagcgata    113400
     cggattcgtg aagatcgcca tcgtgaccgg agcgaaactg attcccgcgt acacgttcgg    113460
     acaaagtcgg acgtacgggt actggcggct cgggccgccg atcgtgccga aattcgtggc    113520
     ggattggatc gggaagacgt tttcgttcgc gccgattatt ttctggggga aattttgcac    113580
     gcccatcccg tacgcgacgg cgctcaacac ggtcgtgggc aaaccgatcg aggttgaaaa    113640
     aaacccagat ccgagcaagg aagaggttca ggcgaaattg gacgagttta tcgacgccat    113700
     gcgttcgctg tacgacagtc acaaggcgag attcggttac gaagacgttc gactcgtgat    113760
     ttgttaggat ttgttagaca catcgagcgg ccgcgcgatg ttaaatataa cgttacaacg    113820
     acgacaacga cgacaaacgc ggtccgacgc ggcgcgctat cgccgcctca aacgcgcgct    113880
     atcgcaccga accaacccgt tgcgtgaaca aaaagtccgg atacacctta gtcagtcgct    113940
     ccaagctcgg catcgtcatg ttcgcgatga tcttctcatt cttctccacc aacgtcttaa    114000
     actccttcat ggaaatcacc ccatccttcg tcaaatcgca atcctcgaac gttttgttca    114060
     gcaccgcctc catcatctcc ttcgtcagcg tcatcgcctt cgactgtcgc agcaccgcct    114120
     ccaacatctc tcgcacgtcc tccctttcga tcgcgcccgt cccgcgcaag tcatacaccc    114180
     taaatgcaaa ctccgtcttc tcgtttcgcg tcgcttgcgg atgaaacacg ctcaagcctt    114240
     tcacaaattc ctcaaacgtc aactgtccgt cccgcgcgct gtcaaagcac gcgaagattc    114300
     gttcgctaaa caaatctctc gtcttccctc cgttcacttc gcggccgaag agcgcgagtt    114360
     ggaactcatc cgcgtcgatc gcgccgtcgg cgtcgtgcga gcggctcacc ttggagaaga    114420
     catcgcgcaa gactcgaatt tgtcccggtc gaaagtgtgt ctggtcggcg aggcgttggc    114480
     gctcgcgctc ctcgtccacg ggaccggagg cgacgcagcc catgcgcgcg ggtgacgcga    114540
     cgttcgtcgc gccgattcga tgcgcggtcg gacgaggcgc gcggcgcggc gcggcgcgga    114600
     gtgaggcgag cccctgcggc ggtttggaat tggtttcgcg gccaacaaga gctaaaggaa    114660
     atcgaacaat cgcaaaatgg cgtcgaagac gccgacggcg actttttcat ccatcacggc    114720
     gtcgacatcg atggcgactt cgtcagccat gagggcggtt tccgcgattt tctgaaacgc    114780
     gtattgcgcg gcgattaacg ccgcgatggc ggcggttttc gcgttgacgg cgttgggaga    114840
     gctaatgtcg gaatcttcgc gttgacacgc gttcatggtg ttcacgtgct cgccctcgtc    114900
     gtcgcgaatg ttgctaaaga cgtcgaacag cgatctgatt tgcggacgtc tcaagcgcac    114960
     ctctctcgcg gtttggaact cgtcgaaaag gtacaaatcg gcggcttcgt aatattcgac    115020
     ggcgattctc ggcgcgggca tgctcttcag gagctcggcg ttttgatcga cgaattgccc    115080
     gtacgtgtcc acggcgtgtc cctcgatgag ctctgagaag ttatacgcca acgccggaga    115140
     tatgagccac agcgcgacga gcacgaagta atacacgatg gcggcgtgct ggcccaaaaa    115200
     acgatcccgc caacacgcgt cgccgccgag cgactccatg acgagcagat gatgatactc    115260
     gttccattcc tccgcgaagt gcactttacg aagctccgag cttcgtcgcc accatcccaa    115320
     gatttcataa aacgtcagca tggacgtgta actaaagtac ggcatcctcg cgacggtttc    115380
     aagaaaccaa aaccgttgca ccggctgcgt ctcgtcgaac aatttatcca acatcacgca    115440
     cagcgccacg tacggcacct tcagtatcca aggcgccgaa atctccggcc tcgctcgctc    115500
     ccgcgcccaa atcgcgtccg cgtccaatcg cagcgcgtcc atcttcgccc gcaactcggc    115560
     cggcatcgcg tctcgcgcct tctccgtctc tggcgtattc gcgtcgaaat acgccatcat    115620
     ctctctgagc tcgcgcgcga agttctcggt gccgctctgc aaaaaccctc gcggcacacc    115680
     gtgtcgttcg atgtcgatgt agcaccctcg caagctcgcg atgtagccgt acgaacacga    115740
     aaactcgacg tcgtcgtcgt cgtctcgcga cgcctccctc gcgagcgtcg ccgccgcgta    115800
     cgccagctcc gctttcgcca gcgccgcctt cgccgcgtcg cgagacgccc gcagggcgtc    115860
     gacgtcggtg tttcgcgcga tcgcggccct cgtttcgcgc gtcgtcgcgc tcgcgaaggc    115920
     gtcggcgacg tcttccggga cgtcggcacc gtcctcgacg ccgtcgcgcg tcgcgcgcgc    115980
     gcgacgccgc gcgcgcgacg tcgcgagacg ccgaccgcgc ctcggtccgt tcgcgcgcgc    116040
     gacgacgcgc gcgcgcgacg gcgcgacggc gcgcggcgtc gtcatgacgc cgaccgccga    116100
     cgacgcgcca aacaatgacg cgatgttcga cggctcgcct cgcgacgccg agcccgcgcg    116160
     cgcgcgcgcg cgacgcgcgc gctcgagcgg ttcgcgacga cgcccccgcg cgctggcgat    116220
     gtccggcgtg ccttcgacgg ggcgcgcggg agcggttgcg gtcggagcgg gacgccaact    116280
     gtatcgacgg cggcgatgaa aaacgcgccg cggcgacgta tcgctgcgcg aacggacacg    116340
     cgctcgacgc gagcgcgtct gggtacgtga atttgttcgt cgggaagcgc gcgcgagggg    116400
     actcgagggc gcagctgcgc gcgagacggc gatttttggt cgagggcggg cacttcggcg    116460
     cgctgagcga ggcggtggcg gacgcggtgt tgggacgcgc ggcggacgcg cgcgatgggg    116520
     acgcggaatt agggttagcg gtagaattaa ggtctggagg cgatgcggcg tcgacgacgg    116580
     cgacgtcgcc acgagcgaga cgcatggcgc ggaagcggga agcgaggagc gaagcgcgcg    116640
     cggcgaatcc gaacgcggcg aacccgaacg cggcgtcggc gaaggtgaag gcgaaaccgc    116700
     tccgagtggt cgatttcggg tgcggtgagg gctattattc atccgtcgtg ctcgagcgcg    116760
     cgagagcgcg ggatgacgtc gagttggaac tcgcggcgtt ggacgcttcg aaggacgccg    116820
     ccgatttgtg cgcggcggcc atcggccgat tcgcgcgcgt cgccgtcgct gacgcgacgc    116880
     gcgatttgcc cctggacgat gatagcgtag acgtcgccat gagtgtattc gcaccgcgtt    116940
     caccgacgga gctcgcgagg gtactaagga aaggcggtcg agccgtcgtc gcgagtccgg    117000
     acgacgatca catggtcgag cttcgcgacg cgttccggga cgacgacaaa atcaccgtcc    117060
     tcggcgtcga gccgaacaag tccactcgcg ttgatgaagc ttttcttgcc gccgggttcg    117120
     acgtcgtgtt ccgacgcgcg attcgcgacg tggttccgct tcccgccgac gccgtagccg    117180
     atctcgtctt catgggtccg agtggctttc acaacccaga atcagctatt cgcgacgcag    117240
     tcggcgatgc cccgcgtgtc gtgacgatat cgtttaacgt tgtcgtgtac gctttgcttc    117300
     ggtgatgctg tgcccataga ctcccgtatc gtcgtgttgt ttgtcaatca agcaatcaat    117360
     tgtgtgctcg cgctacaata tctagttaaa aattcaaaga atggaactgg tttactgatt    117420
     gatggacgcc atcgtgcgca cgacgacgtg cccgagtcct tcgtcaaagg cgataccgtt    117480
     ctgagtcaac cagcgcatga tgtcgccgtg aataacgcgt ccgccgcggc tgtgattccc    117540
     tcgcccggtg atgagtttga ttgaccagtc cgaactcacc attggcgcta tcttcagcag    117600
     ttcgcgctcg agacgtcgaa tcgcgtccaa cctatcgtaa ccgtggaaat caatgacgcg    117660
     attgaagcct cgattatcgt tgtccgctgt cgaaggtgct acaacctcgg tatcaatcga    117720
     ctcgagcgcc tgcttcaatt tcgccttttc gccgagcaac gccgcggcgc gtgtatcgcc    117780
     cctatctctc tgcactcgca agcgcgacat ttcttcagag agctcttcta gacgcgcggc    117840
     gtttctatcc gacaaattta cgcttaacct ctgcgtcttc gcctttggac cttgtaggaa    117900
     cgccaagtgt tttgcagcgt ttatgatttc cgcgcgcgcc ccgctgactt cccaattcgg    117960
     cgtcgagctg ggcggcggct tagagaccca agtcgtcccg ctcgtgattg tcacctctcg    118020
     tcggtcggta cctaatccgg cggcttggag acggcgcgta gtttcctcat cacgagcttt    118080
     ccgacgttgc gctttcgctt gtgcgcggcg gatcttcttg ctcagccctt tgctgattcc    118140
     ttccttcttg gaagaattgt cttcggattc gggttcggag tcatattcgg attcggatcc    118200
     atattcgtcg tcttccgtat cgtactccga atagtattca tcgttgtcgt acatgtcctc    118260
     gatgtccggc gcgatgctgg ccaacaaatc ttgcgccgtc gcctccatgt cgtagccaaa    118320
     tcgaatgaac gtcgtcttca caaactctgg atgatgctcc tcgaacatct cgcacaagct    118380
     caagtactcg cgtcgtatgt tatttcgtcg tttttcctcc ttcagtgcct gctttttcgc    118440
     ctcggcgacg gcgcgttccg ccatttcctc cgccgtcaac ggccgcgcct cctcgcgcgc    118500
     ctttgccttc gccttcgccg ccgcgatttg tttcttcgtc atatactccg gtcgcgtcga    118560
     cgtcgcgcgc ggtgccgcct cgctcgttcg ccccaacgag tgtttgttct tagtcggact    118620
     cgccaatccc ggaatcgccg acgaagatcc cgagtgccgc cccgaatcgc tcgtctcgcc    118680
     cccgaatcca aaatcgacgc tgccgtctct catcttcact cctagccgac actccaaccg    118740
     cagcgcctca tcgctcgcgc ccaacgcccg caaatccaac ccctcgtctc gcgccaaatc    118800
     ctccgcgacg acgtcgccca gagttctcca ctccatcgtc tccggcgcga acaccgacac    118860
     gtgcggcgtc gccggcgtct ccagccccgt cagctcgcga tccatctcga tcgacaccgc    118920
     catcaccatc gcgcgcggtc gcacgcacgc gtgcgtcatc gtcaccgtca ccgcgcgcga    118980
     tcgccgtcgc cgcgcgagct cgagcactcg cgtcgtcgcg tctcgatccg gcgcgtgcgc    119040
     gagcgtcacg tgatccgccg acgatttcgc gcccggcggc gcgcacgaca tccccagcag    119100
     tcggtgcgcg agcgcccaca cctttcggcg cgcgtcggcg tccaggaaca ggccggcgta    119160
     gtgcgcgtcg ccgtcgccgt cgtcatcatc gcgcgccatg atgtgaagcg acgcgcgcgc    119220
     gcggcgtcgt ccgtcggcac acggcgacgc gcgcgcgcgc ggcgtcgcga gcgaacgcat    119280
     cgcgcaaacc gcgcgtcgag cgctcgacgt cgcgcgcgaa ccgcgacgcg aaatcgtcga    119340
     acggcgcgcg aatcgtcgcg aatcgcgaga ggcaacggtg acggacgaga cgacgacgcg    119400
     cggcgtcgcg cgacgacggc gacgatgctg ctgcggcgtg gagagtttgt gtttctagcg    119460
     gcggtgctcg tgggggcgta cggcgtcgat cgagggatca cggcgctggt ggcggcgacg    119520
     tgcgcgtact acgcggcgag gtgggcgacg aggcgacgag gcgagacgga cgcgcgaggg    119580
     aacgaagacg acgaacgacg acgaacgacg acgacgacga cgacgacgac gacgcgactg    119640
     acgggaggcg gtggtgctgc gcgacgtagg tttttcttgc tgaagcgagc gatacgggcg    119700
     atacgaagat tgaaagagct gcgcgaggcg gcgatgaagc ggtcgaacga gcttcgaggg    119760
     gtgttgctcg aggagtataa gattcgagcg tttcagagcg tgtcgctgaa gttgttcgac    119820
     atgccgcatc agccgcggcg aatgcgacag gcggtgcgaa tttggcgggc gtggcgggtg    119880
     cagacgaagc tcaaggcgaa attaaaggat attcgcggcg acgggttgag cgtgctgcac    119940
     aagacggagg aggatttgcg agaggcgatg tcggcgcacg gattggcgac gatgccgccg    120000
     agcgggggag cgatgcattt agatccgacg ttggaggctt tgaaggcgtg ctcggcgtgt    120060
     cgtgggatgt cggagagcgc tttggcgacg cttcgctcgc gggcgaaaac cgtcgtcgtg    120120
     cgcccgaaag agcgcgtggg cgaatcggtg gcgcgcgacg agttgaccgt gttggtcgac    120180
     ggcgaggttg atttgcgagg acagatagag attgatgtga gtgtgcgagg agacgtcgag    120240
     cagaaagcga tgacgacttt gtgttcgcgg ccgggaacgt gcttgaattc tttcatggat    120300
     atattagaac acattccggc gccggctgag gcgaacgaag gagaagacgc ggcgcgtgcg    120360
     ctttcgtcac catcggttga cggtttgggc gaagaatcga cgccagcgat gtcactgaaa    120420
     tctcatgacg agagtggaga gcgcgtgcgc gtgcgtctga cgtttggttc ggatcacgag    120480
     cttcaccggc gcgatcgcgt gcgcgtctct gcgcgcgccg ccaatcgagg ttgcgtctta    120540
     gcggtgtttc gcatgtcgga ttatcacgag tgcgctggca ctgtgattgg cacccaaggg    120600
     gtggcgctga gactcgcgag tgggttcgcg gcggtgtgca agtatgtggg catgatgggg    120660
     gacatgagat cgctctgggt gcacgataga ggcgccgacg agccgcaacc gagcgacagc    120720
     gacgaagagg cacttgtatg cacacacgcg ttatctcgga tgctggacgc caaagtagtg    120780
     agcttgattg atacgagtgg cgttattgct acgttggagc gacatgggta cagaaaacgt    120840
     agctccggag cggcgtcgaa gagcggcgga ttcttcgcta ggcgcaagga aaagaagaac    120900
     gctgagccag aaccagagcc gacgtcggaa gtctcggtcg agacgaaagt gtttcctcct    120960
     ggtgcgatcg tgttacaaca aggtgcttca gccgctgcac tcatcgtcga acgaggctcg    121020
     ctagaagcgc tcgtcgaagc agtaccatcc tcgagacgag aaaagccacc gctaccgaat    121080
     tcctcgccgc gaattcgtca ggcatcagag acgccaattt tcaccgccaa cgtcggcgac    121140
     atcgttggtt cacatttgct gttgactggt cagcgcagcg gtctgacgat tcgtgctggt    121200
     tcgagcggtg ccgttgtggt tttgcttccg ttgagtaccc tggctcgctt gggccgcacg    121260
     cgcgctgcca taacacataa gatggtcgtg tcactcgcac gaagagtgcg cgacgcaccg    121320
     agctcactga tttgggatcg atgtggcgct gaaatggaaa cgctcgaggc gggtgaagct    121380
     ttaaatgcgc gtgcaggcgg cgtgcacatc gtcgtcacgg gttgcctgcg ggaacagatg    121440
     gaagaacccc acgggctatc gcgcgcgaat tcttcgcaaa atttgttcaa gcgacgaaag    121500
     tcgcaaagtg gtaagtctac cgctgcgtac gttccaagtg gtcctggcta cgtcgtgagc    121560
     cctggcgagg cgactggaga agattcggtt ctcatggaaa ccaccgcatc gcgacccatg    121620
     gcggcgacgc cgagatcgag acggcagagc ttgatggcac ccgcggctag gttcacagcg    121680
     cgtgctgtgc gagactcgca agtgttatgg atatcatccg ccggattgga cacgctcgcg    121740
     ttcgccgcgc ccacggcatt cgtacgcctg gcgcgcggtt tgggtttgcg tcaggccaat    121800
     cgtacggcgg cgttgtccgg aaccgcgcac acggcgcctc tgattcctgg tttagtgctt    121860
     tcccagaagg cgtccaacgc gccgaagaca gtctcagtca ttcccgtcac cgaaggtgcc    121920
     gccgttcatt tggacgaatt ttgctactcc ttagccttcg cgctgagtaa gatttgtcgc    121980
     gcgagaacag tggactccgc gtgccggctt ggggaactcg gacaagccgc tatcggaccg    122040
     ctcgcacaag aagcgacggc gaattggctt tctcaacttg aatcagcgta tgacgtcgtg    122100
     atcttgaaag gggatccttt cccgtcgcct tggtgcgcac aatgcgctcg acacagcgat    122160
     accattttgc tcgtcgccaa cgcaaacgat caagcgccga cgcacgagga agggcaaact    122220
     ctacaagatc gccttcttca cggtctcggt gagacaaaat ttcaacgcgt cttgcttgct    122280
     caacgagaac ttgtgctttt gcaccaagac gccgatgtga cgcccaagga tacgaaatct    122340
     tggctcacgg cgttcagcgt ccaacgtcat catcacgtcg ccatgcaggc gtcttctggt    122400
     ctcgtgccgt cgcatgccgc gcgtctcgcc cgctcacttc gcgagttatc cgttggttta    122460
     gtcatgggtg gtggaggtgc acgtgggttg gctcacgtgg gtgttctcgc ggcgatggaa    122520
     gaagagggcg ttccgatcga cgccgtcggc ggtacgtcca tcggcgccat ggtcggcggc    122580
     atgtacgctc gcgaccctag cgcccttctc gttcgcatca tggtgacgaa gtttgccaag    122640
     gaaatgtcta gcgcgtgggg acgcgtgatc gatctcaccc ttcccgtcgt cagttacttc    122700
     accggctggg gcatgaaccg tgcgctcggc ataaatctcg gcgaaacgaa aatcgaagac    122760
     tgctggctgc cgttcttttg ctgcacgctc gatttaatct cgtgcatgcc aatcgtgcac    122820
     cgaaacggta cgctttggcg ctacgtgcgc gcgagcatgg cacttgtcgg ttttttacct    122880
     cccgtgtgtg acaccgagca aggacaacag aagaacatgc acgtgctcgt ggacggcgga    122940
     tacgtcaata atctacccac ggatgtcatg cgcgcgttgg gcgcgcacta cgtcatcgcc    123000
     gtcgacgtcg cgggcgaagg cttggatggg caatcgctta cgccttgggg cgatggtatc    123060
     agcggcacgt ggttgctttt gcgacgactc cttccgcgat ggctcggtgg tggacattcc    123120
     atcccgacca tggcggacat gcaagggcag cttccgtttg tcaccgacac cgtcaagcac    123180
     caaacgcgct tggaagacat cgacgtgtac attcgtccga atgtctcgag catcgggatt    123240
     ttggaattca acaagtacag cgccatcatt cgtcacggtt acgacatcgg tatcaagatg    123300
     gcgcgcgagt ggaagtctga aaatcccgac gtcgcgttac tactcgagca agggagaaac    123360
     attcgtcgcg gcttgacgac gatgcggtcg gctcgctcgg gcaatccgag cgcgacaaac    123420
     tcacgagaat ccatcgctag cgactcgggc agtgacgcaa cctcggcgta cggcagcgcg    123480
     gaggatttgc acaaccaccg tcacaccctc aagccactca gcgaaggttt gctgagcgaa    123540
     ttctccgacg acgacgacgt ccatgtccgc tccctgctgc gaaccaatag ttcattcgcg    123600
     agctggacac ccgcaccgaa acaaaaacgg ccaccagaca tgttttaatt cgtgtaccac    123660
     aacgctgcta cgctagatag atgtaaattt acaatcattt gtttgtttct aagagtacgg    123720
     tttgttcgaa cgtggcagct ccccgctgac gcgttggcga tgccatttcc cttgaacatg    123780
     ttccgcccgc tgcgcctcgc tcgtgaacac tttgcgacac aattcacagt gtggtccagg    123840
     aggtggtttc acgtacctcc gcccaccaac accgctcgcg ccaccccccc cggcagcgct    123900
     tcgcacgttg ctcaaatgct tcttcccgcg cgcgtgctcg gcgtactgcg cgtcgctcgt    123960
     aaagtccatc tggcacacct cgcaccgcgg tcgatccgcg cgtttcgcca agcgccgctc    124020
     gagttcattt ttaaacgtcc ccggcgcgtc cttgccctcc ccgtccgcgc gcgaaccagc    124080
     cggaatcggc gcgccacgcg cgccgacgct cgacttgccc aaaaacgacc ctcgcgcccc    124140
     tttccccttg taatcgttcc cttccggcag caacgccgcg ggaagcggtt ctatgcgcgg    124200
     taaatcgtct cctcccacga tgacctccac atcatcatcg ctcgacgctt cccggcgctt    124260
     ccgtcgtcgt ttctttgctt cctttttttc ttttttttgc ttcttctttc gcttcttttc    124320
     ctttgacgac gacgacgacg acgcgctttc gctctcgctc tcgctcggga gctcggcgag    124380
     acgtttttct aacgcctcga gctcggcatc gatcgcgttc agcgcctcgc gcggcatcgc    124440
     gggcgtgtcc cagtgtaacg actttcactg ggacaccgca ttgggacacg catgcgatcg    124500
     cgcgacgacg acgattcgga cgccctcgac cggtcgttca cgtgcggagg tttacgttac    124560
     gtcgagccgt atcgccgacg cgtgcgcgtg cgcgtgtcga agcgtcacga aggtgctttt    124620
     cgtgacgtgc tcgtcaatca agtctcaaag tcagagtttg cggcgcggaa ttcggacgat    124680
     gtagacgcgt actgggcgac agcgctcgcg gcgcgacgcg tgcggtgcgt gatagatgcg    124740
     ctgcgaaaga tgccgcgcgg cggggaggcg acggaggaga tgtggacgga gatgggtgtg    124800
     gaacatttgg acgagttcgt cccggcgggg acgctgctcg aaatcgagcg gtgcgtgcac    124860
     gagcggtgcg tcgcggatgc gatgccagag atcgtgtttg agtgtgaaaa gactgggtta    124920
     gtcgtggtgg agaaacctgc gggcgtgccg gtgctcgcgg gggcggcgcc agggtggcaa    124980
     gggtacggga atttggcggc gttgacgtcg gcgctgcggc gtcgccgcgc ggcgaaggac    125040
     gacgcggcgg acgaaacgcg gcggacgaaa cgcgcgcgcg cgaccggcga tgcgggtaag    125100
     gtctgggctg tgaataggat cgacgctccg gtgagtggga tttggctcgc ggcgacgtcg    125160
     ccgaaattgg cggccaaggc gaacgtgtgg atgtcgaaaa cgtcgctcgg gaagacgtat    125220
     ttggcgctcg ttcgaggcgc tcaaatcgag tgtggcgtgc gcatcgactc gcccctcgcg    125280
     aaagacaaag aatcatcgtt agccgtggtt tcggaaaagg acggaaagcc gtgcgcgacg    125340
     cgcgtcgttg tcttgcaaag gcgcgagagc gaagacgtcg ccctcgtagc gtgtcgtctg    125400
     gaatcgcacg ggcgctacca ccagattcgc gcgcatctct catccatcgg gcatccgatc    125460
     gtcttcgata gtgcatacgg cgatgaagac ccagagtcgt cttacgccgg tcgcgcgtac    125520
     gccgacgacg ccgagacccg ggtcgtcgct cgaaagctcg ccgagcgtcg agacgccgcg    125580
     tgcgccgaat gcgacgccct catcgccctc accgcctccg acgacgccac caccaaaccc    125640
     ctcgccgcca agcgcatcca tctccacgcc cttcgatacc aattctccat ccgagacgtg    125700
     aattacgatt tacgttcgct tcggcttccc gaattcgcgc tcgacgccct cggcgccgcc    125760
     gtctccgtcg acgacgtcgt cgcccgcgtc gacgcccgcg tcgacgaaat cgaatcctct    125820
     cgcgagtagc gcgtcgtcct gtgatttatc tagcgctcga gcgccggacg ccggcgctcg    125880
     acgccgatcc gcgccgtccg cgcgcgcgcc gtcccgatgt tccatagtta aggctctaat    125940
     catcgcagcc gccaggcgtc gcgcgcactt cgcgccgcgc gtcgcgatgt tcggcgcgcc    126000
     gcccgcgagc gatggcgcgc gcgacgcgcg gagcgtgctg tgctgcctgt gcgcgatccc    126060
     gatgcacccg aacccgagcg gcatgtgcgt cgagtgcgtg cgcacgcagg ttgacatcac    126120
     cgagggcatc agcaaaaact gcgtcgtcac gtattgctcg cagtgcgagc gctacctgca    126180
     gccgcccaag cactggatcc gcgccgatct cgagagcaaa gagctgctga cgttttgcat    126240
     caagcgcatc aagggattgc aaaaggtgaa gctcgtggac gcgggcttcg tgtggacgga    126300
     gccgcacagt aaacgactga agacgaagct gaccatacag aaggaagtgc tgaacggagc    126360
     gatactgcag cagacgttcg tgacggaatt tgtggtggag tggaggatgt gcgatgcgtg    126420
     cgcgcggagc gcggcgaata gtgatcagtg gaacgcgtgc gtgcaggtgc ggcaaaaagt    126480
     ggaacataag cggacgtttt tgttcctcga gcagatgatt ttgaagcacg gcatggagcg    126540
     agacgcgatc gggatcaaga gtcagccgga tgggttagat ttttattacg gtcatcgatc    126600
     gcatgggttg aggtttgtag attttttggg cagcgtggtg gcgacgcggt cgaggggcga    126660
     caagcagttg gtgtcgcacg acgcgaatag taatacgtac aattacaggt ttactttctt    126720
     cgtggagatc gtgccggtgt gcaaggaaga tttggtggtg attcctttca agctttcgaa    126780
     ggagtttggg agcgttgggc cggtgatgct gtgcacgcgg gtgtcgaatt ctttgcagtt    126840
     tacggatccg gtgacgatgc gacagatttg gatcgatcag gaaaagtatt ggcgccaacc    126900
     gtttcgcgcg gcggcgacgg cgaagcagat gatagagtac gtcatccttg acgttgaagt    126960
     cgatcaatcc acgagacaag ggaagttgtg catggcggat gtcgaagtcg cgcgctcaag    127020
     cgatttcggc gtcaacgaca cgacgttttt cgtcaagacg cacttgggga atatcttaca    127080
     agcgggcgac accgcgcttg gatacgattt gacaaatttg caaatcgtcg atccagagat    127140
     ggagaagtac tcgggtaaac atcaaggcgt tgtgccggat gttttcctcg tgaagaagtc    127200
     gtatgccgag agtcgtcgac gaaggcgcga gcgaggcgtg gctagaaatt ggcgtttaca    127260
     gcgcatgcaa gtggaagaag acgaagaaac gcaacaaagg tctcgcggga gcgctgatcg    127320
     catggctcag gacgaagagt tgttctatca agagttggaa gaagacgagg aaacgcgagc    127380
     gcaagtacaa attttcaagg atgaaaacgc cataaacgcc aacgtcaccg cggcggctgg    127440
     cgacgacgac gacgacgacg acgacgcacc agaggtgccg atcgaggagc ttctggatga    127500
     gttgactcta ttgcagcgcc aagctgacga cgaggacgac gagaacgatc tcgacgatct    127560
     cgacgattcc atgcaagagt gagagagtac attgtaaaat tacataaagt cggtttatga    127620
     acagagtttg ttaaaagaaa gcgccggccc gggtcaatga tcactccgtg gatgtatagt    127680
     ctatccaatc tccttcgtcg gcttcccaat catcctcgtc gtcgtcgtca tcgaaatcgt    127740
     cgtcgtcgtc atcgagatcg tcgaaaacgt cgccgtaggg gcgcgggctg ttcatgttca    127800
     tgaaagattt aaggggcatg cgcaagcttc ggatgtggtc ctccaaaacc tcttgaaccg    127860
     tgctaaggtc cgtctcatcg gatttgtgtt cgtctggcga cattctgtgg gtgttgctcc    127920
     gtacgtcagg gcgccaacct tcgagatgtg acacgtgcgt gcaaattata tttgtaacat    127980
     ttcgcacggt atccaagtcg ttcgcgatcg cctgcgcgtt gtactcgggc aaaaggtatt    128040
     tttgcttaat gccgacgatt tgcgaccctt gcgttttgcg atcactcttc gcttgaacaa    128100
     ctttctcgta gcacgatctc agcatgtgca gcaaggcttc gacgcgatgc cgcagcgtgc    128160
     acccgtgcaa catcattcga agttccgggc tccggctcac aatcgtacga accatcgcag    128220
     tcgcgacgaa ctccatgcta tgagtgtcgt cgtagggggg ttgttcattg ccttctttca    128280
     cgtgctcgag aaatagggct tccagcacta cgtccacgcg cggtgacccg ctcgactctg    128340
     cgaacggcgg atactccctc gccttcaacg ttcgcccgaa ccactcccag ccgacgtatt    128400
     tgttcagcgt gtacatcatc acattttcgt ccaaaacaga caaaatgctt cccggatccc    128460
     gcattccgcg cagcatcgtg cgcacgactt cctgaaactc gctcggaaac cgcgcgtgaa    128520
     tctcgcgttc gggttgccac aacatccatc gcaccccgta cgacaccatc ccgacgaatc    128580
     gtcgatcttt cctcaaactc gacaccatag tttcatcctc cgcgtaccac ggcgctgcct    128640
     tcccgaacgg ctcgtgactc agatgcgcgt atcccggata tatctgcaac accccgtcgc    128700
     acttcggccg tcccagcacg tctcgttcgt cgtcgtacac caacccctta tcgctccgcg    128760
     cgtccgtgtg cacgtacacc tgcacctttt cccccactcg cagcgtgatc ggcgcattca    128820
     gcttcagcgc caccaactcg tcgtagctcg gtcgatgttc ctcgtcgtac gccggttcgc    128880
     cccacgcctc ggcgtccatc aaatccgcca cgttcgcgtc gttcgcgctg taatgcccgt    128940
     accgctcgct cacgtccacc ggcggcagcg cgtcgtcgaa agtcttcaag tgcacgtttt    129000
     tcgcgtacac tcgcaccctg ccgaggtttc cgcgcacgga tatcgcgctg atttcgatcg    129060
     aatcgatggg caacgcggtg gcgcatccga gcgagaaaaa catcccggaa aagctgtgat    129120
     cctcgcgatc gggcgtgggg gcggtgaatt cggagtagtg caagtcatcg ctcgcgcgcg    129180
     cgagctcgcg gatgggcatg gcgggcgatg gcgcgcgcga cgatgcgcgg cgcggcgcga    129240
     gggcggcgcg aaggctaacc gaaacgcgag cgagagtcaa taattacaaa cgacgcgacg    129300
     acgacgcgat caggacgcgg cggttcgatc gccggcgcgg ggggagggga cgtcgtcggt    129360
     ggcggagggt gagccggcgc tggggctggg ggcgtcggaa acctcagacg cggagggctc    129420
     ggcgcggacg cgcgcggctc gggacttgtc gcgcttgacg tggcggggaa gcgcgctctt    129480
     gggactggcg cgcttctttt tgacggcaga cgcggcgttc tggacgacgc gcgcgcggag    129540
     gacctcctcg agcacggcga cgtcttcggg cgcgcgcaac gccggcgttt ggttgttcac    129600
     cgggcacacc ttgattttat acccgttttc cagcgtgttg agggcctcga tgttctccat    129660
     gcgctgcagc ggcgtcgtgt cgttggaatc gtcgacgagc gttctcaagt acatcgcgtc    129720
     gtaacacgag cagccgagga cgtgccagtg catcgccgcc gcgtcgagac ggttcttcgt    129780
     ctcgcgcttc gtcggcgtga gatcgagctc gcccgtcatc gtctcccgcg gcttcgaccc    129840
     gatcgccggg atcaccgcgc gcgtcaaata taacgcgaat ccttgcttat cgaacacgca    129900
     tcgcggtctg gtttcgctct caaaccgcgc gggatccgtc gccgccacgc acgtcgacgc    129960
     gacgcaccac tcgtccgcgt tcgcctccat ctccatcacg cacgcgtcca cggagtccgc    130020
     gtcgatcaag cactcgtcca ccttcaacgt gacgacgaaa tcccatcctc cgcccgtcag    130080
     cttcgccgcc tggcgcgcgt aagtactcgc cgttcgcctc gcgtcttgcg ccaccaaaac    130140
     cgtctcgatt ccgtactcct tcgccgtctc cacgattcta taatcatccg tcgccaccac    130200
     cactcgatcc aatcgcgcgc acctcttcat gctctccgcc gccctcgcga acgccggctt    130260
     cccgtgcacg atcatcagcg ctttccccgc gaattgatcg tcctcgccgt cctcgtacgg    130320
     cgccgaaacc acccccagga cgaaattcgc gctcatccgc cttcgcgtcc cgcgcttccc    130380
     gcccgccgcg cgcgcccgcg cgtcgcgcgc gctcgcgtcc gcgtcctcat cgaccgcatc    130440
     gctcgcgcgc gcctcgggcc gtcgcctcgc gcgccaccgc gcgcggtttt tccgccgtcg    130500
     aatgaatttc tgaagctcga tcgtcccgtc gccgtccgcg ctcgtcgcgc ggaacgcgac    130560
     gacgaacgcg atcgccgacg cgatcgcgcg ccatcgcgac gccaccctcg cgagcgcgcc    130620
     gagcatggag gcgacgcgcg ccgttcgcga cgcgacggaa aattcgattc gcgcgacgac    130680
     gagtgacgac acacggcggc gcggcgcgcg cgacgccgca ccggcgcggc gcgcgcgatc    130740
     gcgtcgcgaa tgccgccgtc gacgcgtcgg cgtcgcgcgg cgcgacggtg cgcgcgcgcg    130800
     atcggcgtcg tcgcgtcgct gttcgcgacg cggtccgtca tcgcgcgcgc gcgcgcggcg    130860
     ccgcgagcga cgcgcgacgc cgagcgcgag ggcggcgatg cgtcgacgcg cgacgacgcg    130920
     acgcgcgacg cgtcgacgcg cgacgggacg ttctgggcgc gcgcgcgcgc ggacgcggga    130980
     cgacgggacg aggtgaaggc ggcgatgcga gaggcgttcg gggcgtacag gacgcacgcg    131040
     ctgggacacg acgagctcgc gccgcgcgcg cggacggggc gagacgattt cggtgggatc    131100
     ggggcgacgc tgatcgatag cttggacacg ctgcacatca tggggttgcg cgcggagttc    131160
     gacgaggcgc tgcggtattt gaaaaagccg ggatcggcgt ttcgggattt ggtgcagggc    131220
     gagacggaca gagacgtgag cgtgttcgag acgaacattc gcgttctggg agggctgctg    131280
     gcggcgcacg atttatcggg cgacgcggac gttttagagc tcgcggaatc catcgcggcg    131340
     agactttcgg cggcgttcga caccccgagc ggagtgccgc actcgttcgt gaacgtcaag    131400
     actgggaact cgtttgggtt accttggacg aaaggcgcgt ccatactcgc cgatttcggg    131460
     tcgatgcatt tggagtgggc gacgctgagc gcgcgcacga agaatccggt gtacgaggcg    131520
     cacacgaatc acgtgttcga gacggtctca tccctgggac gacgaggcaa aagtggcgct    131580
     agcaccaagg gtttgttttc cgcgcatttt aacgtcgata ccggagagtt tgcgggcgga    131640
     gacgtcactt tcggtgcgct cggcgatagc ttttacgaat acttgatcaa gtgttggcgt    131700
     tcgctcggcg atttaaaaga cgccgagacg tggcgcgaga tgttcgacga agccatgctc    131760
     gggatgaaaa cgagtttgct gcgagactgg aaaacggacg aggcgactgg tgagaagtat    131820
     tcgtacgttt ctccgattgg aggttccggt gccggttcga tggaacatct cgcgtgtttc    131880
     gtcccgggta tgctcgtgct cggcgcggca gaggcgccca cgcctacaac cgccgatgag    131940
     tacgtgcaaa tagcgaagga tatcgcgcgt acgtgtgtag aaatgtattc ttctcagcct    132000
     tgcggcctat ccgcggatca cgtgcgattc gactcgggtt caaagaccat ctcgaacatc    132060
     aacggcaaaa atattcaacg cccggaaacg gtggaatctt tgttttattt gtatcgcaaa    132120
     actggagatg aaatttatcg gacacaagct tggaaaatct ttcaatccat gaagtcagct    132180
     tatcgagtcc ccgaaagtgg cggctggcaa ggcgtgctcg acgtctcgaa gaccccgacg    132240
     gcgggcgacg acaagatgca atcattcttc ctcgccgaga cgttgaagta tttatatctc    132300
     atcttcaccg acagtgatac aatgcacttg gatgagtggg ttttcaacac cgaggcacat    132360
     ccactgagaa tcacaaaggc acgtgaacga ctgaacgatt gacaaacacg ccgagcaata    132420
     cggaaggtgg atatttatca caactttgta ataggatagc atagaaagta gaagtagaaa    132480
     cggcgtgcgg cgatgctgcg tattactgcg tagtttactt tgagcttcat gcgttgcttt    132540
     gatgatacgg acacgctcgc tcgcgacgaa gaagacgact ccagcgcttt cctcgcgcca    132600
     gcgagacttg aatggatgaa acaagaattg aaacaattga aagaatgatc gtcatttgcg    132660
     acgaacgtaa tgaattcgtt tggaatctta ccacgaatga cgctctattc gtcgaatcga    132720
     aacggtgtag attccctcga cgtcgtcctc tcttcgacga cgaccttggt gactttactc    132780
     tcgccgcgcc gcggcggata gagatactgg cgcatgtcgg cgcaagtgta agaattgagc    132840
     tttaattcgc ggtacgtaga cgtcggtgat gcatcgatga gctcactcgc ggtgatgcgt    132900
     ttggtgtgat ccttacgcaa acacgccgat aacaacgcgc gcagtgcgtt tgagacggcg    132960
     tcttcgccgt cgacggcgcc ggcgacgtcg atgtcgtcgt ccatgatttg tatcaccaac    133020
     cccagtgggc cgccgtcttc gatatcgaac acgtgctttc ccatgacact ttcgaggact    133080
     gtgagaccca tgccccagac gtcggcttcg ggcccgcatc tcgcggcgct cgattccaag    133140
     cgttcgggcg acatgtacat gatggttccg agcgagtcgt gcgcgtcgtc ttcgacatcg    133200
     ccacccgtga agggcgtgca cagaccaaag tcgctcagtt tacactcccc gcactcgttt    133260
     atcaacacat tgctcggctt cacgtcgcga tgtacgatct cgagagtgtc gtgtaaatac    133320
     gccaacccgt tggcgacgca cctcgccgcg cacatcgccg cccgcggcgc gaaacgcatc    133380
     gacccgcgca acctcacgac gtcttccaac gatccgaaat gcatgagttc gagcgtgatc    133440
     gacacctcgt ttttaaccgc atcgtacccg aacccaaaac atcgcacgag cccttcgtaa    133500
     gtcggcgcgc tctccgtttc ctcgtcgtcc tccgccgccg tcgggtcaac gccgagcgcg    133560
     cctcgcgcgg tcaacgaaga ccacccttcg acgtccccat tcctatcgaa ccgcgcgttc    133620
     accgacgacg acgaaatgcg ctgaaacgtc cacatttccc gcttcgcttg caccgccatc    133680
     gcgcgatcgt ccgctcggat gcgtttcgtc gctcgcctcg cgtcttcgcc gcgcgtcacc    133740
     acgctcgagc ttcctcgacc gagcacgcgc gacgaccccc cccccagcgt cgacccgccg    133800
     ccgaccgccg ccgcgctcga cctcagcgac gcgctcgacg acgacgacga caccgaccgc    133860
     gacggcctcg gtttcttcgc gcgcgcgccc gcgtcgtcgc gtcgtcgtcg cgcgggcatc    133920
     tccgataaag cgccacccca aaaaagtgca tcgccgtcgc gcgcgtcctc gcgcgcgccg    133980
     atgcgcgtcc gcgccgacgc gcgcgcgccg acgccaccga aatccaaatc atcgctcgac    134040
     gacgacgacg acgacgacgc catcgcgcgc cgtcgactcg cgtcgccgcg cgcgacgcgg    134100
     gtcgtcatta aagcgcacgg cgaccgcgcg acgtcgcgcc gttcgtccga gtcgtccgcc    134160
     cgcgcgccgc gcgcggcgag tcaggactcg cgccgcgcgc gcgtctccgg ccgttcgccg    134220
     ccgattcgtc taccggcgac gcgcggcgcg acctttgacg acgcgagaag acgaaccgtc    134280
     gtccgcgcgt ccgaattttc cgtatgtccg aaccgacaca ctgccaccat acgaaagcgt    134340
     ccgaattccg cgttcgcgag ggggtcgcga tgagtcggac tcgtcgcgcg cgtcgcgcga    134400
     gccaatcgaa acgctcgatc cgagcgcgcg cgcgctcgag cgtgaggcga tcgcgcgcgc    134460
     gcgcgccggc cggcacacga cgacgcaccg cacgaaagat gtctggacga ggtaaaggaa    134520
     aatccggcaa gaaggccacg agccgatccg ccaaggcggg cttgcaattc ccggtcggcc    134580
     gggtcgcgcg ctacctgaag gctggcaagt acgcgacgcg cgtcggcgcc ggtgcgccgg    134640
     tgtacttggc ggctgtcatg gtgagtggtt ttttgaaatt tgaaatttga aatcgagcgt    134700
     tcgcggcgcg cgcggcgatg ggctcgggat ggtggacgaa gactgacgcg ttgaatcgtt    134760
     gtgttttacg ccgcgtagga atacttgtgc gccgaagtgc tcgaactcgc gggtaacgcc    134820
     gcgcgcgaca acaagaagtc gcgcgtcgtg ccgcgccaca tccaactcgc gatccgcaac    134880
     gacgaagagc tctccaagct cctcggcacc gtcacgatcg cggcgggtgg tgttttgccg    134940
     aacatccact ccgttttgtt gccgaagaag tccaagaagt ctggctcggc gtcccaagaa    135000
     tactaaatct tttctcagat tttgaatttt tagcgcctcg cgcgcgcaaa caaaacaaac    135060
     caaaaaaatt acttggtgtt cattcaacac caccacgaga agaaagaatg tttcactatg    135120
     cgcattacat catcataatt aatcgttcgc gtcatcaagc cggctggatg gctaagcgct    135180
     cgacgacgtt gctcctggaa tctctcgcga gcttgtcgag agggaacgcc gtgcgtacca    135240
     tgtactcgac gcccttgcga cctttttggt acggacgcgc gatgcccaag aactccaact    135300
     cggccacggc gcgagtaaat cgcgcctgaa gctgccataa tttttctcgc ggcaaaccga    135360
     acgtgccttt accgcgagcc gccgccgctg catcgccgcg tttcatctcc gaccccgctt    135420
     tactctcgca aaaactttga aaccagtcgt atatgggcgc tcgttcgccg aatcgcgcga    135480
     gtaggcgata cgccgcggcg gtgtcaggca acgtttccgg cacgcgtcga ccgttcgcca    135540
     aggcgtagtc atcgtgacga cagcacgcgc atcgcagcag ctcgctcgga tccgtgagcg    135600
     tgttctccaa cgacaaacga ggcgacgcct gaagcgcggc gcgaacgcat tcgacgtcgg    135660
     tgacgacgaa tattccgctc gcatcgatcg attccggtgg gtgactcccg tacttgcgcg    135720
     cgatggcgcg aagaatgtcg caaaattcat tcgccgccgc ggatttcgcc gagtcgagtc    135780
     gaggtcgttc tggcttcgcc gccgttgcca ccgtcgtcgt caccaaagct agggcgttgg    135840
     cttcactcct cgccggtgcg cttcgaccgc gcggtggaga cttaggaagt accaaaccat    135900
     cgttcgccgc ggcgtcttca tcgcgcgttg aagtcctcgg cgccggcgtg aggctcgtcg    135960
     caaacgccgc gccgtttcca cgccgtttcc gtgcgtttaa gattgcctcc atcgctagtc    136020
     gctgatcttc cgcgttcgtc tcgtcgtgcg ccagtttttc agccgttgca ttggcattcg    136080
     acgcagcgat gacgagaccg cgccgttcgt cgccaccttc gttcgtcggc gtggatgcca    136140
     aaattgccgc ctctcgccgt cgagcgtcct ccgcgtcgaa cgagccgtcc tctatgtttg    136200
     acagtaaaaa gcgcagctcc gaaccttctg ccgaccgcat gacctcatca tcgtccaaga    136260
     atttcagcat agacttgacc aaatcaccga tttccgccgt cgtgaactcg tcccgaatgc    136320
     gcgagaacgc gacgttgagc aacgtcccgc cttgactctt ggggttgaat tctccagcac    136380
     caccaaagta tccttttcgc gacgcgtcga ggagtaagtc tgccatcgtc gtcacgctct    136440
     ttttgaactt tttctccgtc gccgcgcacg cgacttgaat gcaacgcaac gagagtgccc    136500
     accgtcgccg caagcggtac acatccttca gcgccgcgct cagttcgctc ttcgtgtgcg    136560
     tcgttgaaga cgcggagtcg ccgtccccgt ctcgcatcga ctttgcaccg aatccgtgct    136620
     tgatgcgcgc gtactccacc gcgttcggat cgagatctcg aacgaattgg tcgatggcgt    136680
     cgccgtactc gtcgtcgctc tcgtcgccgt cggcgcaagg ctcgctcgaa tctttagcga    136740
     gcagcggcaa caccgcgctc agcggctctg tcatgaagtg tgtgatcgtg agcaaatgga    136800
     gcgcacgacg cacggcggcg agggaaaagt cgtgctcttt aaagcgcgtg tgcaaaacgt    136860
     tcaacacctc gcttccaaac gcgggcacgc gctcggggct caacagcacg cgctcttgca    136920
     cagcctccat catttgcccg ggcgcccaaa gctggaacgc ctgcgcgttc atcaacgatg    136980
     ccgtggcggc tggtaacatc ccttgaagcg aactcacact cgtggccaag cccaagagga    137040
     cgacgacggg cacgctcgag acgaattccg aaacgcttcg aataaacgaa tccaacacgc    137100
     gcacgtcgaa actttccgta tcctcgacga cgataaccac cggacaatcg cgaccttgaa    137160
     tcactggata taacgtcctt tcgtcgtcgc ccgcgcgctc cacgtcatct ctcgcgcgcc    137220
     gcttcgaccg tctcgccggc gacgtcgcgc gcgaatctgt cgccgcccgc ttcttccccc    137280
     cccgcgcgcg aacgtcgtcg ccctctcccg atgcgcgcga atcaccgcca ttgtacaccg    137340
     tcaacgcgtt cccgatcggc gacggcaccg tcgacgccgc gatgagcccg tctcgacgcg    137400
     cccccgacgt ctcctcgtgc catcgccgca gcgcgcgcat gctcttcccc ccccaatgcc    137460
     cccccgtgcg gtccaactgc cgcatgatca ccccaaacgc cacccctagc cccccggtcc    137520
     cggcccccgc gcgcgccttc agatctctcg accgcaacag cgccacgtgc gcgtctccgc    137580
     tcttcctcaa cgatttcgtc agcgccgcga acgtctcctc gtgatcgtcg ctgttcaccc    137640
     ctcccgccag caccacgccc accggcacgc gtcgatcgcc gccgttattt ttttcctccg    137700
     tttctcgcgc gcgttcgacc cgcgtcgcgc cctgctcgcg gacgaacctc ctcaccctcg    137760
     cgaacgcctc cgcgttcgcc tcgtcggcga cgcgttgaca gtgtccatcc agcgcctccc    137820
     acgcccgcgc gcacgccgcc gcgcgccgct ctcgcgcgcc gcgcgtttca tcccgcaaca    137880
     ccggttcgaa cgcgttcagt cgcgacgcct cgtcgcctcg cggcgccgcg cgcgcggatt    137940
     tcagcacgaa gacgcccgac tttaaaccat cgttcgtctt gaacgccccg atttctcgcg    138000
     cgtccggcgc cgcgcgcgtc gacgcgtcga cccgcttggc gcgggacgtc atgcgtcgct    138060
     ctcgcgcgcg cgtctcgcgt cgcgcggcgc gcgccgcgac gcgctgtgcg gtcgaacgtc    138120
     gtcgatgatt tgaatcatcg acgacgttcg accgcacaat cgagcgctcg cgcgcgaacg    138180
     cgacgcgaac gtcgccccga acgcggcgag cgacgcggaa ctcgtcatcg cgcgcgtcat    138240
     ggcgccgaag aaaccggcgc agaagagcgc gaaggcgcag atcaaggagc aaagagatca    138300
     gattcggcaa caaatcaaaa ccattcgaga cgaatccgcg tcgacgcacg tcctggacag    138360
     cctgtacgac gccgcgctgg ggctcgaact gtggctgcga acgaactcga gcgcgtttcc    138420
     gagcgcggcg gtgaaacaga agacggagcg actgggggag atcgcgacgc aggcgacgag    138480
     agggacgctg gacgcggacg cggcgtactg ggaactggcg ggactgtaca cgatcatcca    138540
     tcgcgagtgc cagaaggaag atttggggtt ggtgtttccg tcgttcgtgt ttccggacgg    138600
     agggatgccc gcgctcgggg agggggacgc gctgacgctg gcggacgtgc gagaggcgat    138660
     cgggtgcgaa ctcacggcgg aggcgctgga cgcgaagatc gcggagttgg aggagatcga    138720
     acgcgcgaag gcggcgctgg aggcgatgga cgcggacgcg tgagagggtg agggtagaga    138780
     tggagacggt tgtaaattac ggagtgatgt tgacatcgat aaaactaagc gtacagcgcg    138840
     acgaggcgcg gcgattacgt cgagccttcg cggcgcgcga cggcggcgcg catcaactcg    138900
     agcgcggatt tgagaaacgt ggcgttggac ttgatggatg agatcgtgaa ctcggcggcg    138960
     gtgatgatgt ctctccactc gtgtccgccg acggcgacgc agagcttgat atcgcccttg    139020
     gcgacggcgc cgacgcgcgc ggcgatggcg acgcggctga gacgccacgt cgcgcgcgcg    139080
     acgccggcga tggtttccaa cgccatggtg atttcttcga cggtgatgga cgagtttggt    139140
     gcgagctccg acgtgccggt ttcggcggcg acggaggtca gcatggaaac ctcgggcgcg    139200
     cccgcggcgg cgacggcggc ttggcactgc gctatgtcga tggcgctctc actgatttga    139260
     atgaaatcca cacacgtttt cgacgccgtc gtcgtcgtgg acgagcgcgg gagcttgtcg    139320
     aactcgagcg tggtggtggc ttcttcagat ttcaccgcgc gagattttcc gggcaaaagt    139380
     cccgtcgcct ccgcccgcgt cgtcgtcgcg tcctccgagt gcgtcgtcgc gtcgtcgctc    139440
     aaattcacct cgttcacgat cttctcggtg ccgaactgtt tcaactgcgc cgagagcgcg    139500
     acgtggttat ccatgtgttc gtgcatgtgt ttcaaccctt gctcgatttt ttcgcgctct    139560
     tcgcgaatta agcgaaattg cgaattaagc gccgaacgac tcacgccgcg ttgcttcccg    139620
     ctcgcgtcct cagtcttcga cgtcttcttc gccggcgcgc tcttcgccgc gccatcctgc    139680
     ttcgccgcga ctactttctc ttccgcttcc tccatttccg cctccaccaa cgctttcggt    139740
     cgcgggtgca gcgtcatctg atacttttgc aactcggtga gcttccacgg ttccgacttc    139800
     accttgcccc acttgcatcg aagcgtcgcg tgccagtgat tcttgatggc gttctccggt    139860
     cgtccggtca agagcttggc gagcgcggcc cacttcgtgc ccagcacttt gtgcccctcg    139920
     acgaggatca gctcctcctc cttgctccac tccccagtct tgattccggg tcgaaggtgg    139980
     ttcaggtaac gatctcgaca ctgctttccg cgtctgtgac gcattaaact cgcgatgtaa    140040
     ctccaccgtt tcgcgccgta tttatcgatc aactgcagca actccttgtc ctcgcgcacg    140100
     gtccactgtt gcgtcatccc tttaagttta ccctcgcgca tctccgcctc gtacgcgtcg    140160
     tcttcgctcg cgtcgccgtc gccgtcgccg tcgctcgtcg aggccaaccc ggcggcggcg    140220
     cgcgccgccg accgcgccgc catcccccga accgtctctc gcacctccgt ctccaccgtc    140280
     cccgccgtcg ccgccgtcga ttgtctcttc atcggcggtc gccctcgtcg cgcgcgtttc    140340
     gtcctctctc gctccggcgc cgcgttttcc gccgcctgcg cgcgcgtcgc ccgaaaagtc    140400
     aaccgtcagt cgtcgcgcgc gccctcgcgt ctcgcctcga tcccgacctt cccgcatctc    140460
     ccgtttcgcg cgtcgcctcg ctcgatcccg cgcacctcga ccaaccaaaa caacgatccc    140520
     gcgtcctcga ccgccttcgc cttgggcggt cgaccgcgtc gtcgtttctt cgtcgtcgcc    140580
     ctcggttccg gctctcgccg cgcgcgcgcc gtcgccgcga tcgccccttc gttcgcccgc    140640
     gccgcgccgt gcgtcgccgc cgacaagtcg tgttcgccgg cgacgtcagt gtcgttcatt    140700
     ttcgcgtcgc ccgcgtcgcg cgcgtggttc gcgtcgtcgc gcgacggcga ttcgttcgcc    140760
     gcgacgatcg tcatgaaacg ctcacgcgtt gacgatcgtc gcgcgtttcc gtcgcgcgcg    140820
     cgtcgtcgcg cgcgcgcgcg gcgagggcga cgtccggagt cgcggtttta tcgacgcgtg    140880
     tcgtttcgcg cgcgcgtcga tcgatcgcgc gacgggaacg cgcggtcgac gcgcgggcac    140940
     gtgacgcatc attggggttt cgctcgagcg tttcattttt ttcattttcg gcgccgcgtg    141000
     tggactcgcg cgagcgcgag cgctagaaat cggcgtcgaa ggcggcgacg cgagcgacga    141060
     tggactcgag acgctcccac tcgtcgtaat agagcgcctg cttggcgagc ttttcgtcct    141120
     tttggcgctg aagatcgagg gcgcgagcga cgtcggcgcc ggcggcgacg aggtcggcgt    141180
     cgagcgcggc gattcgggcg tcgaggacgg cgagcgcgcg ctcgattttg tcgatggttt    141240
     tgggggcgtt ggcggcctct ttttccatcg cgcgacggga tttgcgggct cgttcgtcgt    141300
     cggtggcgtc ggcggcggcg gcggcggtgg gggggggtgg acgctcggtc ggcggcgctc    141360
     gcgcggcgta gtcgccgacg ccgagctcgt cgccggcgac gcgcattcgc gcggagaacg    141420
     cgccgttttc aaccttggcg acgatcgtgg ggttgagcgc ggcggcgaag gcggggttgt    141480
     gcgtgattgc gatcaccgcg ccttcccacc cgcgcaatcc atcgcacaag gcttcgatgg    141540
     cggtgccgtc taaatgattc gaggcttcgt cgaggagtaa cacgttgacc ggtttcagca    141600
     cgaacgcggc caaggcgact cgagcttttt cgccgccgga cagactgccg atcgtgcgat    141660
     cgactgctgc ggaaccagtg atgccgagtg cgcccagaac gccgcgcgcg cgctccatcg    141720
     taatcgattt atcaaccttg cgcgcgacgt cgagcacgtg tgtcaacgcg tccacctccg    141780
     cgggcagctg ctgcgccaag tcttgcgaaa agtatcccac gacgcaaccc tcgccgcgct    141840
     cgaccgttcc gctcatctcg ggtaactccc cgccgatcgt tttcaggaac gtcgacttgc    141900
     cggcgccgtt cggtccgatg acgagtaacc ggtcgccctt ggtcacggtc acgttgacgt    141960
     cggtgaccaa cgtcgagccg acggctgcgt agccgacggc taaatctttc gcgatgagaa    142020
     tttctctcgc gccttgcggt ggatttggaa gtctcaagac gactttttta gcgtcacccg    142080
     gcccttctcc cagatcgcct tctcccgcga gttcggtcaa gtcttcgatt ttttcttgca    142140
     ccttgtcgag ggctttcgcc ttggacttcg ccgcggacgc cttcgtggcc ttggcgccga    142200
     atttcgtgat aaactcattc aatttagccg ctttttgtcc ctctttctcg agcgacgaga    142260
     gcgcttgcgc gcgtcgcgcc tctctctcct tgagaaaccg cgcgtagtcg cccttgaaat    142320
     tgcccaactt tccgccgcgc acttcgacta tgcgatccac gcacgcgagc aattcctcgt    142380
     cgtgggacac caacaccacc gtgccggcgt acgatttgat ccaattcacg agccacgccc    142440
     gcgcgtcgcc atccaagtga ttgctcggct cgtccagcag caacagcccg cccttgacgc    142500
     ccgcctcgcg agagtctccg gccggcgaca gcagcgtcct tgcgagcgcg actcgcatct    142560
     gccatccccc gctcagcgtg tcgcaccgcg cccgcatcac cgcctcgctg aacccaagtc    142620
     ctttcagcac gctcgacgcg cgcttctccg ccgtcgcgcc gccgaccgcg tcgtatctct    142680
     cccgcgcgtc cgccaaccgc gccgccgcgc ccgcctcatc cgccgccaac gcgcgcgtcg    142740
     cccgctccac cgccgcttcc gcgtctcgca cgtgcgtcat cctcgacgtc gcttcctcga    142800
     acaccatcaa tttgcttccg ctcgtcgcag tctgttccag cgcgccgacc gtgactccca    142860
     tcgcgacgcc gaagccgacg ccgttcgcgt cccgctcgcc gagcagcgct cgcacgagcg    142920
     tcgtcttccc gcacccgttc gcgccgacga cgccgcatat ctcccccggc tccacgcgca    142980
     ctggatcgcc gtcgcgcgtg cccgcgatga ggtcgcgcgc gcccgtcgtc acgcgcacgt    143040
     cggcgtcgaa aacgacgacg gcgccggcgg tttcgccgcg cgggacgctc gcgggacgcg    143100
     cgaggtcgcg acgcgcgcgc cggcgcgcgg gaccgcgcgc gcacaccgcg cgcgcggtcg    143160
     cggggcgcgt cgacatcgcg cgcgcgcgcg gccggcgtcc cggcgcgcgc gcggcgacgc    143220
     ggcgcgaact gaaggtcgag cgtcgagcgc gtcagccctc ggcggcgtcc cgctcgcgaa    143280
     gacgcgtcga gctcaacttg agctcctcgc cctcgccgcc gcgcacgaga tcgacgacga    143340
     cgacgcgcag cggcgcgaga ccaccgctcg aacgcatgtc gttcagcgcc tccgccccgg    143400
     ccacggtctc gcggctgacg acgaggccgg acatgtcgcg aaccgtcgcc gcgagcggcg    143460
     gcgacgcgtc gagcggaccc actcgaacct cgatcgaaga ttccggatcg cacagcgcca    143520
     agaacgcgcg cgcgttcgcc gtgcgatccg cgtacgactc cacgagcgcg ccgtacgcct    143580
     tattcgcgag caattccgcg gacgtaacgc cgacgtacaa aacgccgccg ccggcgacgg    143640
     cgcgagacgc cgacgcgagc aacagtcggt gcccggcgtg caaacgatcg aacgtcccgc    143700
     ccacgctcac cttatccatc gtcccatcgc tcccgtcatc gcgcgtcgtc gcgttcggcg    143760
     cgctccagga cgcgacgcgc gcgcgcaccg cgcgctcgac ctccgcgtcc gcgtcgtcgt    143820
     ctcgcgtctc ttcgtcttcc tcttcgtcct cgcgcgcgtc gccccgcgtc ccgacgtcgt    143880
     cgccgccgcc gcgtccctcg aacaccgggt acacctcgcg ccgcggatca atcgccgaca    143940
     ccacgtcgta caccttccac agcgcgcgag ccgtcgcgaa gtcgtcgctc gagcgcacgg    144000
     cgacgccgcg cgaggcgtcg ccgccgcacg cgcgcgcgag cgcgagcgcc gacccgagct    144060
     cgtcctcgcg tcgccagcgc acctcgatcg gcgccggcgc gacgcgcgcg aacatcgtcg    144120
     acgcgcgcgg acgtcgagac gcgccgcgcg cgcgtcgtcg cgacgcgaaa gcgtcgtcgt    144180
     gtgactgatt tcgaaacgaa tcgcgttcgc gcgtcgttcg cgcgcgcgcg cgcgcgacgc    144240
     gcgcgacgcg cggcgacgcg ggacgcgcga tggttacgcg cggcgtcgcg cgcgcgctcg    144300
     gcgcgagtcg cggcgtcgcg cgcgcgcgct cgcgcgccga ggtgtgcgac cgacgacgcg    144360
     cgcgcggcac atctcgacgc gacatgcgcg cgcttcgcgc gacgagcgcg cgcgcgacga    144420
     cgcgcgacgg cgcgaagcgc gcgtcgcgcg cgcgtcgctc gtcccgcgtc gctcgaaacg    144480
     cgtcgagcgc gacgcacgag ccgtgggaac tcgggctggg cgaattgcac ttttcgacgc    144540
     gcgacgtcga cgcgctcgcg ggcgcgagcg cgcgcgacga cgcgctcggc gcgctctcgc    144600
     cgacgtggcg aatgctgttg ctgagcgatg ggagcgtgac gcgacacctg agcgtgctgg    144660
     gacgggcgga gaggacggag gtggaggtga cgcggcgaag cgcgcgggac gacgggacgc    144720
     gcgcgcgggg acgaccgtcg cgaccgagcg acgtggaggc gatgctgcgg ggaccgatcg    144780
     tgcgtcgaga ggtgtacctg cgcgcgggag aggtgcgagg cgcggacggg cgaccggcgg    144840
     tgtacgcggc gtcgtggtgg aacgaggacg cgctcgcggc gtatctgccg gacgaggacg    144900
     cgtcgatgtg ggcgaatctg cgaacgcggc acgtggagtt gcaccgagag attcgagagg    144960
     tgtattacgg cgagagcgag ggtttagagg cggcgttcgg cgagcgcggg ccgttttggg    145020
     ggcggcatta tattttttgg agcggcggcg cgcccatcac cgtcgtgtac gaagtcttca    145080
     atcccgcggc gtttgaaagg gcgctcgggc ctttgaaggc ggcgtagcgc taggaaaagt    145140
     attgtcgtat tcttcatcta tgattgtcta gtcagctacg cgttcacgcg ctcgaaggtg    145200
     tcgaaacatc tcgacatttc gctcgtggta aagatggacg tgaaaggctc ggcgcgactg    145260
     gcgagcggga cttttttcac ccgcgcgtcc aactcctccg ccgtgagcga gccgtagctc    145320
     gcgccgcaca aatcgcccat ctctaattct ttcgttttca cgcggtcggt gaggtcgcgc    145380
     tcgagcaagg ctaccatttt agggatttgc ggaaagtagt gcgctcggag cgtctcgacc    145440
     tcccacagcg aactcttcaa cgcgttcgtt ttggccggat cgcgctcgtc ggcgtcaaac    145500
     gggtcggcgt cgatgagttt cgccgcctcg ccttcgacgc gctcgcgatg cacgagcacc    145560
     acgcacgact tgtgccgacg caagagatta tgaatgaatc cgacgcacac catcgcgccc    145620
     gccggcggcg ccgacagcgc cagtcgcgca aagcgcttga tgaaactcgc caccaagtac    145680
     gccggtaacg cgggcgattt caagaagaca tccatgaggg agaagaaacc gcgacggtga    145740
     ttggcgtgaa agcacgatgc gtcgagcaat tcgtacaaac ggttgtaaaa cgtcggatat    145800
     tctaacccgt gttgcgtcat gagaatgaac aacccgttca acgcgagcat ccccgtgagg    145860
     ccgccgacgt cgatggaatc gacgcaaaaa tcgctcaaca actgcggatt caccatgtgc    145920
     ggcatcacgt ccacgtgcag gcgcatcaaa atttttcggt aaatatcctc gggaaaatct    145980
     gcgcgcaaca gcgcgagcca ggcgtcgctg aacgcgcgtc gatgccgcgc gccctcggtc    146040
     cactttggct tgccgccgcc cgacgtcttt ctcttctttt tcgccgcctc gagatcgatc    146100
     acgctcccct cggcgtcctc gcaccacggt cctcgcttct tttcgccttc atcatcgacg    146160
     ctctcgccgc gcaatttcgc cagcatcgcc gcgaaatccg cgcgtccgtc ttcgtcctcg    146220
     gctcccgctt cgtcgcctcg ataatcgtca aacgcgcgcg gcgtcgcgtt gagcacgtcg    146280
     tacacgttcc tcgccacgtc caccgccgcc gcctccccct cgcccggcgc gtacgtcttc    146340
     aattcctccg ccaatttccg catcgcgccg tacgtgtgat accgcacgtc cacgcgcgtc    146400
     agatacctcg ccttgagcgt ccccagcagc gcctcgctcc acgatttcgc ccgcgtcgcg    146460
     cgccgcagcg cgtcctcgta caattcattc gaaaacttcc ccggcgtctc gcaccgcgcg    146520
     cactccatga tcaccccgag cgccaggcac cgcgcgcgct cgtccagctc gccgtccacg    146580
     acgcacccca cgcaccgctc gacgaacact cttcgatgct tcgcgaacca cgccaagtac    146640
     gcgtccctcg cgtcgtcgtc gccgccctcc tctcgccctc cctcgtcccg ttttcgccgc    146700
     gcccgcgact cggcgagctc gcccgccgcc gtgcgctcgc agaagaaccg ctcgagcgcg    146760
     acgagggcgt ccgcgacgtc ctcgcgcggc cgccgcgacg gatccctgag cgtcccgagc    146820
     agcgccagcg cgccgttcgg gtcgttcgtc gacgcgttca gcgcgatcgc gccgtctcga    146880
     atcccgcgac gcgccgccgt cgacgcgacc gacgtcgacg cgcgcttttt cggcgccatc    146940
     gcgacgagag acgcgcgcgc gacgacgcgc ggcgcggaat gacgtcgccg gtcgccgcgc    147000
     atcgagtggc ggcggcgcat cgatcgcgcg cgcacttcac cgcgcgtcgc gattcatcgc    147060
     gcgcgcgtcc gccggacgat ccgcgacccc gtcgcgcgtc tcgggcgcca tggcggagca    147120
     cctggcgagc atcttcggca cggaaaagga ccgcgtgaac tgtccgtttt actttaagat    147180
     cggcgcgtgt cgtcacggcg atcgctgctc gcggctgcac aacaagccca cggcgtcgca    147240
     gacgatcctg ctgacgaatc tgtaccgtcc ggacgtcgag gtggcggcgg acccgcgggc    147300
     ggcgacgagc ggggcggcga gccgggcggg gcgagggcag gagggattcg aggcgttcgt    147360
     cgaggacgtc ttcgaggagc tggacgagtg cggagagatc gagggcgtga acgtgtgcga    147420
     taacgtcacg gatcacatga tggggaacgt gtacgtgaag ttcgtcgagg aggaggcggc    147480
     gggtcgagcg gtggagaaat tgagagggag gtattacgac ggacgaccga tcgcggcgga    147540
     attttcgccg gtgacggatt tcagggagag cacgtgcagg cagtacgagg agaattcgtg    147600
     cacgcggggg gggtactgca acttcatgca cttgaaaccg atcggacgag gcatgcggaa    147660
     gcggttgtac ggacggtact tgggaggagg gcgacgcgaa cgacgcgagg gcgagcggag    147720
     tccggggcga aagcgcgaga gagacgacgg ggaggacgac ggtcgagtca ccgccaaggg    147780
     gatgtcggac gacgcgcgac gggcgatgtt cgcgtcttgg aacgacgccg acgacgaatg    147840
     agtgaatgaa tgaatccgcg aatctgcgat tctgcgattg attgattcga atgtagcgcg    147900
     cgttgaaacg aaacgaaagt tgatttctac actggtgcgt cggtgattta cacgtcaaac    147960
     taaactattt tttcattttt ttcgtccctc acgcgtcaat gcgccaccgc gaacgcggag    148020
     cgaatcaaga atgggttgtt tccgtcgtcg tcgctgtcca tttcgtcgtc gctatcgaca    148080
     ctgaacgctt cgcgagtgat aggatccttc ctgtcgaaga taatgcgacc gctgcgaccg    148140
     taacggggtc gacactgctt gagattgacg ccgagcggaa gcaagaacgt tcgcaccgcg    148200
     gccatggatg gagacttggt gaacagcatc tcgatgtctg gaatctccgg cggcggttga    148260
     tacggcaaca cgggaatttg gactctcggg cgaggcgcgt aaccgccgag cgcggcaaga    148320
     ccgagctcgc gacgacgctt gcgtccggcg agatcgccca tgtcgtcgcc caacacgacg    148380
     tattgtccat cgggtttctt gatgagttcc accgcgccac cggcgaggac gatgttcttg    148440
     ttcggcggaa tctccggcgt ctccgtcttg aagcgcttct tgtccgcctc catgactttt    148500
     tgctcgatcg cctcgagcga cgccttgggc tcgtgtcgaa gcttgatttg gagtttttgc    148560
     agctcctgct cgacggtgag caactcgctc ttgcgtttct cacgcttcac tacgagctcg    148620
     agcacgccta tggaaatgtc gagcgacttg cgcagctgac gaagcttgtc gtagctcgtc    148680
     acgtcgttct cgcgacgtcg acgagtctgc ggtctagaaa tcttctcgcg cggccggaac    148740
     acgttgaacg ggttactgtc gttcggtgcc ggtggcggtt gtaaccgacg cagaagcggc    148800
     ttcttcaagc gctggcgcct gtccgtccag tactcgtaca ccgccgtgag aatggcttgc    148860
     ttgccactga tttcttgaag caactccaac gctttatctt tgggtaggtt tgtcacgaca    148920
     cccagcgcgt ccactttttc ttggtagctg atcacttgcc cgcgcgccgc ggccatagcc    148980
     gtgttcgcct tcatgatctt ctcgttcgcc tcggcgcacg ccaattccaa cttccacagc    149040
     atctcctcga atttctccgc gctcagcact tcggagccat cgttataatt ctccaaccaa    149100
     tcctcatcct cgttatccaa atcatactcc acgtaactcg tcgtctccgt cggcggcagc    149160
     ccgcacgtca attttgagcg caagtaataa tccggctgct tataattcgt cggataatcc    149220
     gattcgtacg acgacacgtt caaaatctca ggaataggaa tttcactcac cccagtcgtc    149280
     gtttccttcg tcagcacctc ctcgttctct ttatccagcg ccttgtgcgc gtgcgtcacc    149340
     tcgcgttgta ccacctgctc atccttaatc gcatctggat cgcgcaacag ggccaactgc    149400
     gacgtgatat cgataggtcg cgccctgaac gatgtctgtc gagtcgccat cgcgcttcgt    149460
     cctcgacagc gcgcttctgt cgagcgctac gacggcaatg ccgcgatttc gcttcaaatt    149520
     gccgaatgcg cgcgatcgca cgcgagaatc tcgcgtttac gcgtcgacgc gcgcgcacga    149580
     acggtcttgt gcgagcgcaa actcgagatc ggacgttcgc agacgcgctc gcggcgtaag    149640
     acgcggcgcc gtcgcgcgcg gcgcgctctg cggcggcgaa ttcgcggcga attggcctag    149700
     gtcacgcgag ccgaaagtcc tatttaaaag tctacactat ggaagcggcg cgcgcgcgaa    149760
     cgcgaaacaa agctcagaag aacttcttca cgagatgacg ctttaaaacc tcggatgaac    149820
     acgaaggaca cttgccagga ccttttggct tgacgagacg aagccaacag gcgtagcacg    149880
     cgatgtgctt gcaggtggac gcctcgaagg gcttgtcgca cgtggcgccg caggcgacgc    149940
     acgcgcgagg aggagcgacg acagccaagc cgggaggggc gccagcggcg gatttctgag    150000
     ccttgacttt ttcttgacgc tctatcagag cgcggcgatg cttttcgtag atgggcttgt    150060
     gcgccgcagg gacgaattcg ccgaagaggg cgtacaagcc tttcgggttc tccggcgcct    150120
     tgagcacgcg actggcgacg cgaaggaggt caccaatatc gaacgcctcg gtcttcactt    150180
     tgtcaagctc ggcgatgagt tcgtcgtagg aatcacacga gagttcaaga cgcgcacgac    150240
     gcataaaaag cttggtacga tctgcgctcg gcggcgcctc gttttgatcg ctcgcgctcg    150300
     ccgagtcctt ctcattctgc tgcccactcg tctttgagag ctgaaggaga agggtcgacc    150360
     ttttcatcgc ctcttgcgtt tttttaccat gcttttcgcg gaagatttct gctgccgtcg    150420
     tttgaagcgg gactttttgc tttgacacaa gcataaactt ttggcgagcc acttcgtctt    150480
     cgccaccacc ttggtccttc gtgaattgac gaacgagcga cgtgatcgac gtacccgctt    150540
     gcgtgaaatc ttgtttgttc tgtgactttt tcacgaaagc agcgcccgag gtttttggtt    150600
     tcacctgcgc gatatcgacg aatttggcgg gcgcggcggc tttcaccttt gcgcccgctc    150660
     tcgcgtgctc ttggaagaat tccttcaagc cgtgcacagc actgtgaaac accgagtgca    150720
     cttgcactga cggtcgaagc caaagtgaaa gttgatttcg cgcgttttcg ttcgcgaaac    150780
     gctcgtcggc aaggataacg gcgccgaagt catccttgtg gcgaatgaca cgcccaagcg    150840
     cctggttcac tgcgcgcatc gcggtttgag agtaccactc gttcccagag tacgcacccc    150900
     cgttgtccgc ttttcgctta tccaaatacg ttcgcttgtg catcacgagt ggatccttcg    150960
     cgcccgcgta cggaatacca gtgagaatca cgccacggca cgccttgtct gcgaaatcga    151020
     tgccttcgct cagcttaccc ctacacacgg cgaagaacgc cgcaccgcgc ctcgaatcct    151080
     cttcaagcgc cttgttgtag ctatcgtagc acgcatgaaa ttcatctgca ttgcttggct    151140
     caaccaagca cgttttgttc gtctcgagct ggttccaaag cccagtcgat ctccagtgat    151200
     tgacgcacga gtgcatgacg ccgtacgacg gaaagaacac gagcaatcca tcgggtacga    151260
     ttcttgccgt acttaaaatc acgctcccta tctctgtctt atactcgcgc gtatcgcgaa    151320
     atctaaatga gctgttcagc acgccgttat tcggcccgtg cgtgacgact ccgccccaaa    151380
     cttgattcct tttgatcacg tgcggattct ccaagcgcac gggaaaatcc aatgcgagct    151440
     ctgacgcgaa agattccatg ggggagagcg taccagaggc aagcaaaaat gttccaacgc    151500
     ctttatcgat cagtgccttg aggcaaagac ctggaaagaa gcaccagtac gacaacgtcg    151560
     gcccggcgcg cgcgcgattg cttgtcttaa acttctccat atccggccca agtctcgtga    151620
     cgaaatactg ctcatatcga tgcacgaata tcctctctat gaaattaccg atttccatta    151680
     acggtgtttc gttttgtgtc ggctgcgcca tgaaatcgct cccgagttgc accgtccgcg    151740
     aagcgctctt aatgagcttt gtgatgtgct cgtaagtatc cgccgtgatg ttcaactcgg    151800
     cgagaataac gtagatgaac gcgccgtcac caatacgctc gccgagacct ccttcgtgct    151860
     tggcgttcgg cgccttggcc gcctcacgac aaatactatc gagcaaccct tcgagttgca    151920
     ccaacacgcc cgttaacatt ttaaaatctt cacccttgaa cgccgcagcg tccttgtcca    151980
     tccctctgct aaaaagttgc aaatctgcct cgctcacgat tccttccccg ctagtgtctt    152040
     ctaaagtcaa ctttgtctcg taagctctct ccgattcctt gatggctttc gccaatttcg    152100
     ccgcggtgag ggaataactc atgctatcag aagcgctcga ctcgaggttg tgcgcctcgt    152160
     ccacgataat caccgcgttc tcccacgcga tttccaatcc tttgcgcacg ctctcatcga    152220
     gcaggtaatt ataaggcata aaaattatct ccgcctccgc gcacttcgtg cgggcgagat    152280
     aaaacggaca cggccccctc gccttggcct tggacaccaa atcctcgatg tcttgcacgc    152340
     cgtcgctgaa taaatcgaat cgcccatccc gcccctgcag cgcccgatcg agcgtcactt    152400
     tcgccccaca cttttgctgc tgcaccaatt tagcgcatct atttttctgt tccgtcccat    152460
     tcaacgctcg aacgtcgtcc cgcgcgcacg cgtgccgccg actcgcgagc gtcgtcgcgc    152520
     gcgtcgtcga atcaaacaat ttcaactctc gcaccacttg atccacctgc gagtgcgtcc    152580
     tcgtcgcgta cacaatcacc ggcgcgcgcg tgcgctcctt tttttccacg tcatccacga    152640
     actcccgtcc cgacgtcccc gcgacgtcgt cggcgtctcc ggcgccgcct cgcccatctc    152700
     tcacttcctc cctaaatttc cgcttccttg cccgtccttc gctccgcacg aacgccagcg    152760
     cgctcgcaag caagcacagc gtcttccccg tgcccgtggg cgactccaag agcgcgtgtt    152820
     cgccgcgaca catcgccaag agtgcttttt ccatgaaaac gagctgattg tcgtacgctt    152880
     cgaacggaaa gtcaaccgtg aacgcgcgct tgtgcgcgat cttgaccccg tccgcgggca    152940
     cggtgatggt gtacgagtgc atcgtgccca tgatgcggcc gagcgcggcg gacgacgccg    153000
     cgcgcgccgc gcggcggagt gatgatggag aacgcgaagg gacgacagct ggggcgcggc    153060
     gtttgaaatc gaaagcgacg gacattcggc tcgaacggtc gatcggtgcg gtgcgtttct    153120
     cgattgatat agctacggtg agtgcgaacg tgcgtcgcta gaggaaatcg gcgtatcgcg    153180
     aggtgaagtc gctcttgctg cgttggcacc acccgctcga actgctgtcg ctcggattga    153240
     ccacgatgtt gttgtcgaag tagatgacgg atcctgtttc gaactcttct ttttcgttga    153300
     tgattttcgg acggtcgagt ctcgcgaacc acgtgccgag aatcttgtga aaacgccacg    153360
     aggaggcgtg gagctcgttc gctgcgagca atttgagtct gtctctgccg taatagaacg    153420
     tgaaaaacaa ggcgtcgcta tcgagacgtt tgaagagcgc cgggttgtcc aactggcatc    153480
     cgggcggtat gtctcgaggt gatcgcggat acgacgatgg cgtcgcgatt ttactctttt    153540
     gcggcgccga cgcggatttc tttgcgttct tctcgctcga taaccgccaa ttcgcatccg    153600
     cgctgagtcc ttcgcgcgga agcttggcgc acgcgatttc gagcaagcga tggctgacat    153660
     gtcggtcatt tataacgacg ccgcgaatcg acacgcccga tggaatatcg gcgtgttcga    153720
     gagccatggc accgccgctc tcgggcgaaa tctcaccgta cgcgtgtccg ccgcgcgaca    153780
     gttcatccag gctcaacaat ccattcccgg gtaaatcgaa aatacacgcg tccggatgca    153840
     tcccggtcgt aaccttcgcg cgcgaagtcg acgcagacga ctttttcggc gacgtcgcct    153900
     cgaatttcgc ctgcaaacga tttaccgccg cgccttcgtc gccgccgtcc tccgagcgtt    153960
     tcggcttctt cgcctgcgcc tccgccgggg tcgaaggcgt cgacgtcccc gacgtcgacg    154020
     cttcatctac cgccgctcgc atcgcgccgt ctttccccgg cgtttccaaa cgctcgacgt    154080
     ccgcctcgct cgcctcggct cccgcctcat cgtcgccgtc gccgtccttc gtcgcgtccg    154140
     ccgccaaaac gctctcaaac cacccgatat ccgccgcgca ctcccgcatc gcgtcctcga    154200
     tcttcgccgt caccgcgtcg tcgacgtcat tgttttctct gtattccatc aactcccgca    154260
     cgaggtcgcg caggcgcgcg atctctcgag tcaactccgt ctgcccgttc gttcgtcgat    154320
     tcgacgcgat ttctctcgtc agtctcgtcg ccgttgaccg accctctcgt caccgacgcg    154380
     ccgccgcgcg ccttcgcggc gaccatcgcg cgctcgttcg tctcgaatca tcgtccgcga    154440
     tcgcgtcgcg cacctcggcg cgtcgacgcg cggcgtcgtc gtcggcggcg ttcgtctcgc    154500
     gaatcagctc gaccgcgcgc gcggcgtgtt cgcgacaccc atcgatgcgc ttcgttcggc    154560
     tctgtatctc cgccgcgtgt cgtccgggaa gcgtcatgcg cgcgcgattc ggtcgcgcgc    154620
     gcgcgcgcgc ggcgcgtcgc ggtcggcggc gccgcgcgcg tcgatgagtg gcgattttga    154680
     cgcgccgaga gacgaacaga cacttcgacg ccgacgccgc ggcgcgtcga ccggaacgaa    154740
     gggcgatatc atacaaattt atcgtaacac tcgacgcggg cgcttcgcga gacgcgacga    154800
     tcgagcgcgg tcgtcgtcga cccgcgcgcg cgttcgcggc gtcagccgtg cgaacaaact    154860
     ttacgcgcgc gagcgtcacc tcgccgcgct cgatcgtcgc gccgtcgcgc gagtcgccct    154920
     tcgcgtcgtt cgcgtcgctc gcgtcacccg catccggcgc ccgaggacgc gtcgcccgtc    154980
     aaccctaaat catccgcgct cagctcgcgc tcgagggcct cgatgatctc cagcgcgctc    155040
     ggcggtcggc ctcgcgagag cgcgctgaac gcggcgtcct tcgcgcgcgc cccctcgaga    155100
     tccgcctctc ccgacccatc gtccaggctg tcgcacacca ccacctcgaa cgcccccggt    155160
     cgaggtcccg cgtcgccgac gacgcgcgcg tcgttgccgt ccaccatcaa tcgcgggaac    155220
     gcgtcctcga cggcgtcggc gacggcgaga aatgcattta aatgcttccc ttcgtcgtat    155280
     tcgacgtgaa tcgtcctcgg cggcgcgttc ccgagcgcgc ttcgtcacgc gtacgcgcgg    155340
     tagacgacgc gcgcgcgaag tcgctcgcat ccgcgccgcg cgagcgcgcg gagcgcggac    155400
     atgacgacgt cgaagcggcg aaacgtcgcg cagtgacgct ttatccggga caccgcgacg    155460
     tcacgatgac gcgcgtcgcg cggcggctgc gacgcgcgag cgcgacgctc gcgcgcgcga    155520
     tgacgtcgat ggttcatcac tccgcgacgc ggcacgcgcc gggggcgaac ggcgcggtgc    155580
     ccgtggtgca tcacgcgagc tacagcaaac cagtcatgcc gcgcgggcac agatttccga    155640
     tgactgtttt ccagcgcgtg cacgacatcc tgcgcgaaga gggcgtcatc gcgagagggc    155700
     agacgaattg cttcgtcccg ggacgcgcgc cgagcgtgga cgagctgtgt cgagcgcacg    155760
     atgaagatta cgtgagagac gtgcgcgcga gcgcgctgga cgcgaagcgc gagagagaaa    155820
     tcggactgcc gtggagcgac gcgctcgtgg agagaacgct gatggaggtt tcggggacga    155880
     tgctgacggt ggatttggcg atgaaggtgg gattgtgcgt gaacacggcg ggagggacgc    155940
     atcacgcgca tcgcgatagg gggagcgggt tttgcatcgt caacgatttg gcggtgtcgg    156000
     cgctgagggc gatcgattcg ggggcggtgt cgagggtgat gattatagat ttagacgtgc    156060
     atcaaggcga tgggacggcg gcgattttag cgaacgaacc gggcgtgttt acgttttcgg    156120
     cgcacgcgaa gtctaatttt ccggcgcgaa agcaacagag cacgcgagac gtcgagctgc    156180
     cgcgcgggat gacggacgac gcgtacatgg ccgtcgtcgc ggcggcgatg cgagagtctc    156240
     tcgaagactt tcggccagag ttggtgattt acgacgcagg cgtggacgtg acgtcgaacg    156300
     acacactcgg acatctcgat ctcaccgtcg aagggctgta tcgacgcgag cgcatggtga    156360
     tggacaccgt gctcggcgcc ggcattcccc tcgcgggggt cgtcgggggt gggtactcac    156420
     cggatataga tgagctcgcg agtcgtcacg cagtcttgca tcgcgtggcg cgcgaaatgt    156480
     tcgtcgatca cgggttgtaa actaaattaa tagtatcgta gtcatccggc atctgtgacc    156540
     cgtcgccgtt cttcgtcgat ctccggtagc aacgcgtcca cgcgcgccgc tctgtgcgct    156600
     tcgtcataca gtcgtctgtg ctctcgccag aaaggcaaga tttcgcgaag ggagacgtgc    156660
     ccgccgtcgg cgtcgtgtcg atgccgatgt cgagaaagtg cgatttcgag accgattacc    156720
     gcgtcggcgt ccgggagaat cggcatcgct actttttccc aggtgagtcg tagactctgc    156780
     gcgtgtggat gctctcgctc aatcaggaag agtatgactt ccatgttccc atttgacatg    156840
     gcacaaaagt acgtcttcgc gtcccaagga cacccgtgct cgtgcgcgta cttcaaacac    156900
     tccaaatgtc cataattggc ggcataccag cacgtccaca cgttccaagg acacccttgc    156960
     tcgtgtgcgt acttcaaaca ctccaaatgt ccattcttgg cggcatacca gcacgtctcc    157020
     tcgtcccaag gacacccgcg cttgtgcgcg tacttcaaac actccaactg tccattcgag    157080
     gcggcatcac ggcacgtcca cacgtcccaa ggacacccgc gctcgtgcgc gtacttcaaa    157140
     cactccaaat gtccataacg ggcggcattc gcgcacgtct tcgcgttcca aggatacccg    157200
     agcgcgcgcg cctctacgag aaggtccaac ctccccacgg cggcgcacgc accagacaca    157260
     gttccttgcg catcctcttc cggtcgtata ccgtcgtcca aggtggcgat agcatcctca    157320
     attgtgtttc tatacaacca gtccacgttt tcttccgcga ttgccacgag cgcggctctc    157380
     aaacgcgcct gaacttcact catgtgtgtc tcgcgagtcg atgtgtgagg acgcgccgcc    157440
     gatagtcgcg ctcgaccact cgatgacatt ttcaagcgcg atcgtatcgt acgacgcggc    157500
     gattcagtga cgataaacta aactaatcgt aggtagggag gtgcacgtta catcatcgcg    157560
     tcgtcatcgt cgtcatccgg catctgtgac ccgtcgccgt tcttcgtcga tctccggtag    157620
     cgacgcgtcc acgcgcgccg ctctgtgcgc ttcgtcatac agtcgtctgt gctctcgcca    157680
     gaaaggcaag atttcgcgaa gggagacgtg cccgccgtcg gcgtcgtgtc gatgccgatg    157740
     tcgagaaagt gcgatttcga gaccgattac cgcgtcggcg tccgggagaa tcggcatcgc    157800
     tactttttcc caggtgagtc gtagactctg cgcgtgtgga tgctctcgct caatcaggaa    157860
     gagtatgact tccatgttcc catttgacat ggcacaaaag tacgtcttcg cgtcccaagg    157920
     acacccgcgc tcgtgcgcgt acttcaaaca ctccaaatgt ccatacttgg cggcatacca    157980
     gcacgtcttc gcgtcccaag gacacccttg ctcgtgcgcg tacttcaaac actccaaatg    158040
     tccattcttg gcggcatacc agcacgtctc ctcgtcccaa ggacacccgc gcttgtgcgc    158100
     gtacttcaaa cactccaact gtccattcga ggcggcatca cggcacgtcc acacgtccca    158160
     aggacacccg cgcttgtgcg cgtacttcaa acactccaac tgtccattcg aggcggcatg    158220
     cgcgcacgtc cacacgtccc aaggacaccc gcgctcgtgc gcgtacttca aacactccaa    158280
     atgtccatta ttggcggcaa atgagcacgt cgacgtgttc caaggacacc cgttctcgtg    158340
     cgcgtacttc agacagtcca aatgtccacc atcggcggca tccatgcacg tcttctcgtc    158400
     ccaaggacac ccgtgctcgt gcgcgtactt caaaatccta aaatatccag acgaggcggc    158460
     attcgcgcac gtcttcgcgt tccaaggata cccgagcacg cgcgcctcta cgagaaggtc    158520
     caacctcccc acggcggcgc acgcaccaga cacagttcct tccgcatcct cttccggtcg    158580
     tataccgtcg tccaaggtgg cgatagcatc ctcaatttct tcttcataca aagcgttcac    158640
     gtcttcttcc gcgattgcca cgagcgcggc tctcaaacgc gcctgaactt cactcatgtg    158700
     tgtctcgcga gtcgatgtgt gaggacgcgc cgccgataat cgcgctcgac cactcgatga    158760
     cattttcaag cgcgatcgta tcgtacgacg cggcgattca gtgacgataa agcgctcgtg    158820
     attctataat ctattcgaac gcgtctactt ctagtccttc cggcgcgcca tcgtcgcgac    158880
     ggcgcgtcta aacctctacg tctaatctcg cgagcaaatc gtcaatgcga tgcaacgcct    158940
     cgctcgccgc cggcggacaa aactggcgcg cgcgctcgag caagtcgcgt atcttctccg    159000
     tatccgcggg tttccgttcg tccgcggcgg atttcaacaa ccaaaccgcc gtcctgtacg    159060
     catcatccgc caacgacgcg tccgtatcgc tccaacccgt ctccgaatcg gcgccttcgg    159120
     cgtcgtggaa ctcgtcgccg gcgtcgtcaa agtctcgcga gtcgtcgaac tcgtcatcat    159180
     cgcgcgaaac gaattcgtcg tcatcaccct cgtcctcgtc ctcttgttcc agcaaagctc    159240
     gcgtctgggc gatcgttttc aacaactttt ccttggcctc cgtcatcgag cgaggacagc    159300
     acgactccgc gtacacaaat cttcgcaacg cctcgttcaa atcgccccgt ttcaacgcgc    159360
     gcacgccagc cttaaactct tcatccgcga tcacggcgtc ttcatcgtca tcccgctcgt    159420
     cgtcttcatc gtcgacgtcc gaatcccccg aagccgccgc cgcgctcgcg tcgccgtctt    159480
     cgtccacttc gcgcgcccgt cgtccccact catcctcccc aggtttcgcc gcgccgtaaa    159540
     taaccgaaca cgcatccatc gcgtaccctc gccgcgcccg ccgagccgcg ttttcttcaa    159600
     tctctcgctc cgcgcgtcgc atcaaatcca ttggattctg attttgcatt tgattctgcg    159660
     ctcgtttctg attctgattc cgtccttcgc gcgcgcgcgc gctcgacgcg ctcgcgccgt    159720
     cgtcgcgcgt cgcgtcggcg acgccgcgct ccatgtcgac ggactcccgc gcggacgcgc    159780
     gcgacgaagt gacgcgaacg aatccaatcc aatccaatcc acaccggtcg gtcgccgtct    159840
     cgggacgaca tggggacacc tctcagacgg cactctgaga cgcgccgctc gctcgaacga    159900
     acgaacgaac gaacgcgacc gaacgaaaaa aacgaacgaa cgaaaccctt catgctctgc    159960
     tccgcgctga acgcgcgaac gacgacgtgc ggacgaacga cgacgatgcg aggcctggcg    160020
     ttgggaagac gcgcggcgcg cgtcggcgcg cgaggcgtcg ggacgacgac gcgcgcgtcg    160080
     caggcggaat ctcaaaccgc gacgagcgaa caacaacagg gagaacaatc tcagcaaggt    160140
     ggtttgcagc gacagcaaga gcagaagcga gcgctggcgc ggtcgccgtt gtcttctatg    160200
     atggcgtttc cgagtctgat gtcgggcatg acgccgttcg ggttgtcgag aagcatgcag    160260
     agagagatgg cgaacatgat gaacttgatg gatgacatga tgacgggcgg ggctctggcg    160320
     ccgtttgaga cgctggatcc gtttaagatc acgatgcacg ccgatcacac gcaaggggtg    160380
     cctcaacaaa tcttgaactt tccgatgggt acgacgacga cgacgacgac gcgagcgagc    160440
     gagagcaaac gagagcggga cgaaaccttg aatcacgagc gagcgagagc aaacgagagc    160500
     gagacgaagc ctcgaatcac gacgtgaacg actgacgttt gactcatcgt cgaccctttc    160560
     cgcgcaccac cagacgtgat tcaaaagaag gacaagtaca tcgtcaaggc tgatttaccg    160620
     ggcctgtcga tgaaggatgt cagcgtcgag gtggacgaaa agaatcgcat cttacacgtc    160680
     acggcaaagc gcgagcaccg agccgaagaa caagacgaaa ccgtggacaa gggcgcgaag    160740
     tgggtcgcgt acgaacggtt ctacggcaag atggatcgct cgttcggcct tcccgaagac    160800
     gcggtggcgg aaaaagacgc catcaactgt cgattggtga acggcgagct cacggtgtcc    160860
     atcaagcgca acccgccgca ggaggaagag gccgagaagc aggcgccgcg cacgaagatt    160920
     ccgatcatgg atcactaaag cagtgtgtgt ggtcgtgatc caggccggac aatcaagact    160980
     ttgcgttcgc gaatcgctgg ttcgcgagcg tcgatacggt agtctcgaac tcattttagt    161040
     tttgtctttt catcacatca catcacatta gatctccgga tcagatggag aataactacg    161100
     agccatactc tcatcatcgt tatcataaac tacgtcctag caccactcga tcgtcgacgg    161160
     aggcttgcta ctcacgtcca agacgacgcg attcacttcc ttgacttggt tcgtgatgcg    161220
     cgtgctgacc tccttcaaga aatcggtctc gaacgggaac caatccgccg tcatgccgtc    161280
     ggccgaagtc accgcacgca agccgatgac gaaggagtgc gtccgttgat cgccctgaac    161340
     gccgacggtg cgaatcggca aaaacacggc gaacgcttgc caaatgtcgt cgtaaatccc    161400
     gaattcacga atggtgttga tgtaaatctc gtccgcgcgt ctcaaaatat ctaacgcgtt    161460
     gtccgcggtg acgtcaccga ggatgcgcac cgcgagcccc ggtcccggga acgggtggcg    161520
     cgccaaaaac gcgcgcggca cgtccatgat ggcgcccaac ttgcgaactt catccttgaa    161580
     aagcatgcga agcggctcga cgagctcgaa accgagttct ttgggcaagc cgccgacgtt    161640
     gtggtgcgac ttgatcgtgt gcgagtgctt ttgatcgctg cccgggggcg gacacgactc    161700
     gatgacatcc gggtacagcg tcccttgcac caaaaacgtc gggcgcacgc ccgtgcgctt    161760
     ttcaatctca cccttgaagt ttttaaagca ctcgatgaac tcggcgccga tgattttgcg    161820
     cttcttctcc ggatcagtca cgcccttgag acgcgtgagc atttgctcgg agtgatcgac    161880
     gcaatccacg gggaggtgca agttgtcgcg aaacatctcc atgacgcgct cttgctcctt    161940
     gtatcgcaac aacccgttgt cgacaaagac gcagtgcaag cgatcgccga tggctttgtg    162000
     caccagcgtc gccgcgacgg cggagtcgac gccaccggac aaggcgcaga tgacgtgcgc    162060
     gtccgggccg actttttcct tgacgatggc gatttgttcc tcgagcacgt tcgccatcga    162120
     ccacccggcg ctcacgcccg cgacgtcgaa taagaacctt ctcagggtgt ccaacccttt    162180
     ttcgctgtgc gtcacctcgg gatgatactg caacccgaac aactttcgct tcgggtcctc    162240
     gatggcgacc accgcgcccg cctctgattt ccccacgcac gcgaatccct ccggcagctt    162300
     cgtcgcctcg tccccgtgcg acatccacac ctgctcgcgc tcgcccgcct tcgacccttg    162360
     gccgtacagc accgaatccg agctctcata caccaccggc atgcgtccgt actccccctt    162420
     cccgcgcgcc gcctccacga cgccgccgag tcgctgcacc aagagctgca tcccgtaaca    162480
     gatccccagc accggtatcg actcgcgcgc gcagtactcg aagaacccct ccggcacgct    162540
     cggcgcatcg tccacgtgca ccgaattcgg tcctcccgac agcacgatca ccctcggcgc    162600
     gtggctctcg atccgcttca aatccgcatc ccccggcagc aagatcgagt acacgccgag    162660
     ctcgcgcacg cgtcgcgtga tcaattgcgt gtactgcgac ccgtagtcga ggacgacgca    162720
     cgcatccacg ccatcggtcg cggtctttcg cttcttcgcg cacgtcggcg acggcgccat    162780
     cgtccgtcgg tgtgtgtcgc cgtcgccgcc gccgccgtcg ttcaaatttt tgtttttttg    162840
     aaaaaaattc gccagcgcgg ggcgcggcgt cgattattgg tggcgcgcgc gtcgcgcggg    162900
     cgcgaccgac ggttcgcgcg gtcggcggtt cgcgcgcggc gcggcgatcg gacggcgcgc    162960
     gacgcgcggc gtcgcgcgaa cgaacgcggc aaaaaatcgc caaacggctt taggcgcacg    163020
     cgaagaaaaa gcttcgaaac tgcacggtcg aacgcgacgc gcgtcgtggg tcggctcgcg    163080
     cggcgatggg cgacagagtt acggtttttt cgccgcgagg gggacgaagc gacgaatcgt    163140
     cgaatcgacg cgaacgacgc gcgcggcaca ccgcgacgcg cgacgcgagc gacgcgaacg    163200
     acgcgaacgc ttcgcgaacg aaacgatggc gagcgcgacg accaaggcga cgcgtcgacg    163260
     gttgagctgg cgcgacgcgc tggacgagac gcggacgtac gacgacgacg acggggacgg    163320
     cgcgaaggac ggatgggcgc ggcgcggtgg cgccgcggac gaagagaacg cgaccgcgcg    163380
     acgagcgaag ggtcaaaaaa cgagcgcgtc gcctcggaga gcgctcgccg cggtggatgc    163440
     gaacgcgacg atgacgtcgc cgacgacgcg atgcaacacg tttttggcgg ggtcgacgcc    163500
     gggggcgatg agcgccaagc acgcgtcgcg ggtgcgcgcg ctcgtggagg tggatgaacc    163560
     ggaggaggaa gcggaggtgg cggagatttc gtttgacttc gaggacgaga gcgcgatgat    163620
     gtcgccggcg tcggtggacg acgccgaact cgagtcggat tccacgggcg acgtcacggt    163680
     ggtgatgtcg agcaagcgag gaaggctgtc gcgcgtgaac gagacgttca acgtgttcaa    163740
     atcgctcgca cagctggcga tatcgccgtc agagttggac gtctccaagc gacgcgcgcc    163800
     gacgccgatg aacacgccgg cgacgacgtt gacgttcgac gacgacgtgg attcgcccgt    163860
     cgtgcaagcg agaaccgaag ccgatttgcg cgacacggtt gagaaaattg ccagctcttt    163920
     ggtggacgtc gaagacgtga tgtcgtctta tacgaccaga gttcgcgcgc accgcgtcgc    163980
     gaaggcgctc ggggcggcga ttttcatgct cgccatttcc gctcgattat actttgcctg    164040
     gaacgtcgcc atcgcggcgt tccgtccgcg gtacgcgatc gatggaaccg cgttcgcgta    164100
     tcgttggttt tggcgttcac gaacgaattg gaacgtcccg ttcgcgttcg cggggtacgc    164160
     ttcgtacggt gagtttatga ttcaaagggc gctcgacgtc gagtcgcggc gagcgatgac    164220
     gcgcgcggcg gcgtttcgag ccgccgtgag cgccacgagg cgcgtcgccg tcgttttggc    164280
     gtacatcagc ggcgttttcg gaatttttgg ggtagtcgcg aaggcgagcg aggaccccca    164340
     tccgggcgag acgacgaagc gcggcgcgac gtcgccgttc gtcttcgtgc cgaaagtcat    164400
     gatgatgatg acgacgacga cggacccaga gcggcctcgg cggccctctt ttggtgcgtc    164460
     cgctgttttg gatacttccg atcgcacatc atcgacgcac cgggaaatgg acggcgaagc    164520
     cgacgagttc gccgtcgtgc gcgtgtaaaa taatttcaga tttcagacgt ggacttcttt    164580
     tgtaataaaa cacaccacac gaagtgaagt caagtcaaca cgtggatcgc cgatgcacgc    164640
     atggactgac gggtacgaaa tcagtgaggt gaataaatca aaaaccaaaa agaagaatcg    164700
     taagaatcgt ttaagtacca gatatcaacg cacaaaacgt gtacgagcgt tcggcgctca    164760
     aacgcaggct ggtggaaatc acagaaaaga acccgaaaaa gaacaaaaga acaaaagaat    164820
     caaaagaata ccggcgcagg ggctcgaacc ctggaccaca agctttcgct acgcgaaacc    164880
     tgagaatgcg attgggagcg cgaactcccc gcttcgctcg gatttatttt ttcggacccg    164940
     atattcatcg ggaaacctca tatattaaga ggcttgcgct ctaccaactg agctacgtcg    165000
     gctaatgatg acagaaataa gctaaaatcg tccccaccga tcgtcgcgct ggcgatcgat    165060
     gtttgttatg ggttgaagcg tagtagacgt cggcgtccag aagaagcgcg cggtcatccc    165120
     gcgacgtcgc cggaacgaac gctctctcaa ttcgaatcga cactggatta caatcaatca    165180
     atcaatcaat caaaactact acccgcagtg cgcctcgacg gctcgaacga tcgcccttgt    165240
     cgtctcctcg acgcgcgtct cttcgctcgc ctcgacgtag acgcgaacgc aatcctccgt    165300
     accgctcgga cgcacgaacg cgcgacatcg agcgtcgttc gacgctcgca cgatggcgtc    165360
     gatggcgtcc tggagaccct ccggctcggc gacgcggcgc tcggcgtcaa aggtttgaat    165420
     cttcgtcctg tccgcgacga cgactttggt ttgtctcgag ggcaaatctt tgtaaaacga    165480
     tcccaaacga ggcgccttga cggttcgccg taatatggcc tcgacgagta agatgccgct    165540
     catggcgtcg cccacggagg gattgatgac ccgctgcgcg ttcgtcaacg ccaagagcgc    165600
     cttgacggcg ggcatgtcgc gagccaccag cgcctccacc gtcgcgtcct cgatcgcctt    165660
     gctcgcgctc ggggaaaaca aagccgtccc gtggccgttc gattcgaagt acacccctat    165720
     gtcgaattcc tccgctcgat ggtgcaggtg tttcaccccc gtcggcacgc acgccggcgc    165780
     cgcgccgagc tcgcgagtca aaaactccgt cgacgctccg ttggcgtacg ccgtttgcac    165840
     gacgcccacg gtgatgtcat tcaaatacgg tgccgcttct ttgacgcgcg cgttcatcca    165900
     gcacgcgatg agcaccgcca attgatcgcc gtcgaccaaa tcgacgcccc cagcggccgt    165960
     cgtttgaaaa taaaccagtc ggtccgcgtc gccgtcgatg gacacgcacc gcgtgcccgc    166020
     gggcaagttt tcaaaacctc cgcgggtcgg gatagttttt cccttttgca cgaaatcgct    166080
     accgacgccg tcgttcagcg acgacgtcgg ctcgtcgcct cggtttcgca aatcaaacgc    166140
     gagcccgtac ggcgccaccg cttcgccgag cgacgacaac ttcacaccgc ccacgccgtc    166200
     cgcgcaatcg atcaccaccg tcgcgccgtg atcgtcgtct tcgtcctcgt cttcgtccct    166260
     ctccgtcagc gcggcgtatc ccgcggacaa gcgatcgtaa tacgcgcgct ccgagtcgtc    166320
     ggcgccgacg ttcgcgcaat acacgtaata gtgcaactgc ggcgtcgtcg cgatcccgcg    166380
     atcgacggcc tcgacgccca tcgcgtgcac gcccgccagc gtcgcgtccg cgagcgcgcg    166440
     tccgctctct cgcgtgtctc tcgccacgaa gacgcgcgcc gacgcgttcg ccgacgccgc    166500
     gtccgccggc gccgccgtcg ccatcgcctc tcgcagcgcc cgcacctgcg tctccgcgtc    166560
     cccgtcctcg gcgttcgcta acatctccgc cacgccctcg agcgccatcg gcagcgtccc    166620
     tcccgacggt tccacgagct tcacgccgtt atccgacgcc gggttgtggc tcgccgtcac    166680
     caccatcccc gtcgtcttcc ccccgtgcgc catcgctcgc gccgcggcga acgcgcccgc    166740
     tcgaaagcac gtcgatcgca acgccgtcgc cgtcgttcgg aatcccgccg tgccgtacgc    166800
     gaaccgcgtc ggcgccgatc gatctccatc gtcttcgcgt cgcggcttcg cgtgcttcac    166860
     cgtcgcctcg gcgtacgatc gcgcccaggg ctcgcgcgcg gcgtccgcgg acatcgctcg    166920
     gcgtcgcgtc gcgtcgcggc gcgccgtcgt cgccgcgcgg cgtcgcgtcg tgccgaatcc    166980
     acccattcgt ccatccatcc atccatccat ccgtcgtctt ccgcacagcg cgacgccgcg    167040
     cgcgatggcg acggcgcgcg cgacggcgcg cgccgacgcg cgcgtctcgc cctcgcgcgc    167100
     gcgccgcgcg acgcgcgcga cggcgacgac gcgcggcgcg ccggacgatt cccgcgcgtt    167160
     ggcgccgacc gcgacgttcg cgacgacgac cgcgtcgacg cgcgacgacg ccgtctcgcg    167220
     cgccgccgac gcgctcgcga gcgtcgacgc cgcgacgtgc gcgacggcgc tcgcgctcgc    167280
     gttcgtcacc gcgcggtggc gcgcggcgac gcgagagcgg agacgctggc gcgacgaggc    167340
     gcgacgactc gacgaggcga accaagagct cgagtggcga ctccgcgtcg ccaccgcgga    167400
     gagcgacggc gcggacgacc ttcgccgtcg tcgatcgacg ccgcgagcga ggcccgcgag    167460
     cgcgcccgcg acgtcgccgc cgacggacgc gcgcgacgtc ctcgtcgacg gtttgcgcgc    167520
     cgagaccgag gcgctgcgcg cggcgctcgc gcaggcgcgc gccgcgcaga agtagagccg    167580
     tagcttagtc gaaaatgtag acaccggacg cgcgttcgga cgtcgatcgc gacgcgtccg    167640
     accgcggcgt cgtctcgcgc gcgtcgagtg aaataaaacg cccgcctcac tgaaaacgca    167700
     tacgtaacat gtgaccaaat cgggacgggt tttcgtgacc ggcgcgcgcg ccaaagccct    167760
     aacgcgcgtg cgcgatcggc ctttcgcgac gcgcacgatg cccgccgcgc tccccgtggt    167820
     ctccgtccaa ggcggcaacg gcgccacgag cgccctgccc gaagtcttcc tctccccgat    167880
     tcgtccggac atcgtcaacg ccgtgcacac ggggctgaac aagaacaacc gtcaggtgcg    167940
     gcggagcgcg acgcgaccgc gcgatgcgaa cgagggcgac gcgtggacgc gcgcgcgacg    168000
     cgaacgaggg cgcgggaacg agagagcgac gactgacgaa tgtgcgcgcg tcgtttttgc    168060
     gatcgcgata ggcgtatgcg gtgtacaacc gagctgggtg cgtcgacgac gcgaacgcgc    168120
     gatccatcgc gacctcggcg ggcgtctgaa ccctcaccag agagggtttc ggaggcgcgc    168180
     gacgacgacg acggcgcggc gcggtgcgag cgaactcgaa cgagagactg acgaaagatc    168240
     gatttaaacg aacaggcacc aaactgcggc tgaatcctgg ggtaccggtc gcgccgtgtc    168300
     tcgtattccg cgcgttccgg gcggcggtac gcaccgcgcc ggtcaagggg cgttcgggaa    168360
     catgtgccgc ggcggtcgca tgttcgcgcc gaccaaggtg tggcgccgct ggcaccgacg    168420
     cgtgaacttg aaggagaagc gatatgcggt gtgctctgcg ctcgcggcgt ccgccgtgcc    168480
     ggcgcttttg ctcgcgcgcg gtcaccgcgt cgagggcgtt ccggaggtgc cgctcgtcgt    168540
     cgacgacagc gcgagctcca tcaagaagac ggccaaggcg gttgaattgt tgaagcaact    168600
     cggtgcgtac gcggacgtcg aaaaggtcaa ggcgagccgt aacattcgtt ccggtaaggg    168660
     taagatgcgt aaccgtcgtt acgtccaacg ccgaggcccg ctcgtggtgt actctgagga    168720
     caacggcgtc acgcgcgcgt tccgcaacat tccgggtgtg gaattgtgct ccgtcgaccg    168780
     cctcggtttg ctcacgctcg ccccgggtgg acacgtcggc cgattcatca tctggaccaa    168840
     gagtgccttc gacaagctcg actccatctt tggcactgcg tccaagaaga gcgcgtccaa    168900
     gaagggctgg aagccgccga cgaacatcat ggcgcaaacc gacttggcgc gtctcatcaa    168960
     ctctgatgaa gttcaaagcg ccgtcaacgc gccgaaggtt ggtgctacgc gcgcgcacgc    169020
     gccgctcaag cgcaacccgc tcaagaacaa gtccgccatg gaacgcctca acccgtacgc    169080
     caaggtcgct cgcgagatgc aagctcgcgc gcaggaggag cgctccaagg ctaaggcgaa    169140
     gaagagcgcc actgcgcgct cggcggttgg ccaaaagttc tacgaatcca tgaaggtgga    169200
     ctccaactac gaaggcgaac ttttcgaaga tttcgacgac tggctcaccc gcggcgcgcc    169260
     cgtggtgcaa ggcggcgacg acgaataagc gtcttagcaa cggaccattt agctcgtttg    169320
     tcattacgaa cacacaccct aatgacccta atgaaattaa gaaacagtcg ccagcaggct    169380
     gtgcgaccgc gctactttga ctaactctct agattatgct acaaaaaccg tgctactact    169440
     aatcgcggcg agaagacggc tcaacttctc atcgctctat aacaaacgac gcgtttgtca    169500
     tcggcgttcg cgccccggta gcgcgcgaac gctcgatccg agtgcgcgtg agagtgccct    169560
     gagcgccgac gccacggagg cgctggatga ggatgttttc atcgcctcgg gatcgagcag    169620
     gaacgtcacc gcggcttcga tgtgttcgac gcgccgcgat acttcgtcgc gcgcgcgatc    169680
     atcggtggat gaagcgcact gcgcgaggaa tttcgtcgcc gcgacgagaa gtgcccgccc    169740
     gcgttcgctc gcgctttctt ccacgtagaa cgcgttcggc gcgagcgccg gcgtcgacga    169800
     tgggtcaccc caacgcacgt cgccgagatc acacgactcg cgaacgacgg cggtttccgg    169860
     aagcggcgcg agcgcgtcgc tcaatgcgcg ttccgcctct ttgcgctcga gagcgacgga    169920
     tttgtcgttc agcttttgcg ccgtggcgag cactgccttc aatcgctcaa tctcaagcgc    169980
     gcgaggcgag cgatctttcg attttgagaa caaattgacc gacacttgat tctgctctcg    170040
     actcgccggc gacgccagag cggcgcgaac gagaaacgat accgatgccg cggcgtacgc    170100
     tcgcgtcacg cgccacacgg cgtttgaatt caacgccgcg tcgagcaaaa tcgttctgtc    170160
     ctgaacgttc ggcgcggttc cggtcacggc gacagagatt gatgtgggta cgttcgtcac    170220
     cggtctccgc ggctcctgcg gcaaatcttg cgcgcgcgct ccgggaaacg gaaagcgcgc    170280
     gcgagtcgac gacggttttt gcagcggtcg aggatgaggt tgcaatcgct cctgacgttt    170340
     tcgctgcttt gacaccgtcg tcgtcgtcgt cgtcgtcgaa gacgaggtcg cggatttgtt    170400
     ctcgacctcg cgcgccgctc gtcgaccccc aaatagcggg accaaaatat ccgtcaacac    170460
     tgcggcgacg ctcgccgtgg cgtgatggtc gcccgatctc gtcgagtccg tggcctcgtg    170520
     caccatgacg atgagcggaa aggccatcga actcaacaac atagaaggcg cgatggcgtg    170580
     gctttcgtct tcgtcgttcg tcatcaagtc gcacatgaat tcgaccgacg tgatgactcg    170640
     tctcgccgcg cacttttgcg gcgctctgag cgcagagagg acaaagtgtg gaagataccg    170700
     cctcatcgca acatcgccga cgacgccgaa tggtttgtta ccgattccct gtaacgcttt    170760
     cgcgagggat tcgacgagcg agcgctcgcg cgcgcgtgaa tttggagtcc cagtgatggc    170820
     ttcgaggacg ccgaacgtgg cgatggcgag ctgtcgctgt gtcaccgcaa ggacgcgctc    170880
     gtttgaatct ctctgcgccg tcttcatcgc gtcatcgatg gcgcacaaat gcgcgcgaaa    170940
     gacgtctcgc tcggacgctt ccaagttcgt cgccaggagc tcacccagag gcgaacgttc    171000
     gtttctcgaa ccccaaaacc acgccgtcga cggaggcgag ggcgaaagac gaggaagcgc    171060
     gaacgtcgtg tcttgatcac gaatattttc cgccgactgc gtgtcggcga gaagaattat    171120
     cgaggcacaa tgtgtggcca tctctcgaac taaagcgcca atgatgcgcg cgtacggcgc    171180
     gtttgactcg tgtgagccgt cgcgtgctcg agtttgccgc ttgtacagcc cgacacagtg    171240
     agcaggcaat gcgagggcga tgcgacgcat ggtagagact acgcgcacgt cacttttcac    171300
     atccggcttg ttgagctctt tcgtcaccag tgttgcgacc gcagcgcgaa aaataccctc    171360
     tttcgatgtc aagagcgctc ccggtcgctc gccggcggcg acgacgtgag attcgccgcc    171420
     aatcttcgtt ttcccgcgta acaccgccgc aacggcggcg cctcctttag attgcgacca    171480
     acctacggtc ggtactggag aggcttgttg attcattgtc aaaagctcgc ttcgcgcgca    171540
     caacgcaacg gccagcggcg cggcgccgcc ggcgacagag tccgccgcaa acgccaacca    171600
     cgagcacaac gttaagtcga agtctttcaa accgtactta tccgaaaatg aaccaggaga    171660
     atatatcgtt gcgagagacc ttgacgtgaa cacgcgctct cgccaatcac ttgacagcgc    171720
     acgcttgtca agcgcgccca gagtttcgag cccctcgttt ctgcattcgg tggcggcgca    171780
     gccgagtaca gcgaacgccg tggcccatgc cgcggacgct tcggcgatca ccgctccgtc    171840
     ggcaaacgcg tgagtggtcc ctggtatcga tggttcgagc gctcccgtca ttttttgaca    171900
     gtcggccaac gttgtcattg ctcgaactgc ttcctctgct ggtttcgctc ggccccattc    171960
     gctgctcgtc gccccgcgag caagccaaat tccgaggcat gtcgtcacag cgcgcagtaa    172020
     gatgcaccgg ggtgcggggt cgtctctaca attgatctgc gatgcgagcg aggtgaagat    172080
     ttgcttcaag caaagcatgg cttgatcatc cagagaagat tgcgcgcaag cgcgaaacag    172140
     ttcgatgtgg acgcttgcgc gatgctggag acgcagcgcc gctggagaca aagggaaggt    172200
     gtgtcctccc aatgccctga attcattgtc gctattcttg tacgcacaca cttcatccgt    172260
     gattttgctc aagcgagcgt cgggaagcca tttgccgagc tcgcggcgta aaaccttgtg    172320
     ctcgcacgcg cactttgcga gatgatcgcc gagcgcgcga tacaacgcct cacacgccgt    172380
     accagtcacg aaccgagcgt ttgcagcttt gaaggactca tcatacggtc gccacaccaa    172440
     gggcatgcac gcttgacaac acgcagcgga ctttcgtgcc gtcaagcgcc agtcttgcgc    172500
     ggcgcctgaa ttcacactcg cgccgtgaac gagtttccac agcactcgca ctggatgtct    172560
     atccgccgtg catcgcggcc accacgcgac aagctctgcg atgcgctcgc aaatcgcttg    172620
     cgtatactct tcctggctga agtgtgtagg cggcacgatc ccgctcttgg gctctactgg    172680
     aaagctcgcg acgcgagatt cgtccaacaa ccaaccgacg acagcccacg cctgcgttgc    172740
     ccaatccgtg cccactgcgt gttcgagttg ataacctttg ctgtaccaca gctttgcggc    172800
     gataaaggta agttcccacg ccacctcgag cgatcttgcg tgactgctgt cgtcgagaag    172860
     cgtgtctcgc tcgagcttgg cagcctttct aatcgtctcg cgttcggcct ccaccaattt    172920
     cggtaaagtc tctcgaagtc ccgtccaaag tccatcagca cgctcgagaa gtgccatcgc    172980
     gtgtccccaa ccgtctattt cgtccagcgt catctcattc gagtcgcctg gcgttcgcgc    173040
     tgatgcgccg acgcgaccca cgctccggcg actgacgaaa tccttcatcg ccttttcgag    173100
     cacgcgcaag ccttctactt ttgcttcttc caccgccgca gtccactcca aatcgtcgtc    173160
     gttggagcgt tcgaatgcag ccagcgtggt gttgtcagcc gtcgtcgtcg gagctcgatc    173220
     gccgaagaca cgatgatcga atttccacgg cgccgccgcc ttcgtgaaca ccgtcgtaat    173280
     tcgaggttgc gtcgagttgt cgcgagcgag cgccgacttg tttatctccc caaacgtctg    173340
     cgtccgccgt cccgtcgagt tgtcgcgcac caacagcacc gtcggactca ccgcctcgct    173400
     cggcggaacg gcgcgacgcc gtctcgccgg cgacgcctca acttctccga cgacgacgac    173460
     gcccggtgac tcgctttcac gcaccggcga agacgcgtga tcatgtgcct cgttctcatc    173520
     gtcatcgtca tcgtcatcaa aatcatcttc atcccacgaa accgccggtc ctcggctcaa    173580
     aacgtcctcc accgattttc caaacgccgt tcgtctcacc atccctcgct tccccttacc    173640
     gaatcgctcg ttcaccacgt ccgccacagc gaacgatttc acccctcgcg tccgatcttg    173700
     actcgattcg ctgtgcaacg acacctcacc gtctgatatt tcaaatcctt cctcgtcctc    173760
     gtcggcggcg cgttcgattt cgtcgtcgcg ttcgctcgcc gacccatcat ccgttcgtcc    173820
     tcgcccattc gcccgcgatc gatgcgcatc gatgagcatg gtcgtgagcg cgcctctcga    173880
     cgcgtcgtcg tcgtcgtccg cgtccgtgtc gctcgccgcg actttccaac gcgccgcggc    173940
     gtcgtcgtcg gcgtcagcat cgtcccattc gtccctcacg cgccgtcgtt tcgcgtcctc    174000
     gcgcccgcgc gcatcgtcga ccgcgtcggc gaggaacgcc tcgacgtcgc gcgcgtcgat    174060
     ttcggcgctc gcgcgcgcgt tcgtcgcgtc gcgaagcggt ttttcgccgt cgcggtgccg    174120
     ccgcgacgac gacgacgcga cggcgccgcc gacgcgcgcg tccgcgcgcg cgcgcgagga    174180
     catcgacgac gacgcgctgg acgcgttcgt cgcgcgtcgc cgcgagcgac tcgcgagcga    174240
     ggcgcggttt gaggacggac gggcgcggcg gggacgcggc gacagctcgg cggcgtttga    174300
     atcgcggcgg cgaacgcgcg acatcgagac gcgcgctgtg cgcgcgaatg gacgcgacct    174360
     tgcgcgggat cgggtacaga aactttgcgg tgcgtcctgg atgtgcgatg gcgcgcgcga    174420
     tggctgggtg ttgatgatac atgagggacg cgtcgcgcgg cgcgtggcgc gcgcgaatca    174480
     aaagacgaaa ccgccgagga tgatgagcac gggcccgatc acggggaggc gctgctggat    174540
     gcgttcgagt aaatcgtcgt catcatcgtc gtcgcgagat ctcctcgcga cggtgcggga    174600
     aggcttcgat ttgggttggg gtttggactt ggccggacgc gccgcgactt tcgtagtcgg    174660
     cttggcgtgg cgcgcgggct tgggtttcgg tgcgctctta cgcgctggct tgcgggtgtc    174720
     ggctgggcga cgattgagcc tgggcattcg cgcagcggcg cgggtgaaac caccgattcc    174780
     agcgagcgcg ccgccttgtt tgcgatcgat cgctgctgcg ccttcgagtc cgccttgacg    174840
     cttggtcaga tagcggcgcc acaccgaggc ttcgcgccac gcgcactcgg cgtgggataa    174900
     actcaacatg aagaccaatt gtgtcgccgc acggacctcg cggaagttca tcgtgactct    174960
     gttcgtcggt ggagccaagg tgaagcttaa aatactcgcg acaatgagcg ccaacgcgcc    175020
     gttctccgcg tgcacctcgc ccgtggacat gagctctatg gaagccaaga tggcgagggc    175080
     gttcgtcgca gggtgcaatc gtcgcaggat gccgttcacc cacggaaatg cgtcgaggaa    175140
     gacgtcgtgg ttgatcattc catagtgttc gtgcggagcg ccgacgatgg caccgcctgg    175200
     aatcggccac aaagcgccaa tgaacgtcgc caaactcagc ggcggaacga tggcggcggc    175260
     ggcgttggcg atgacgcctc gcgcactatc agtgtcggtt cttcccatgg aggctagggt    175320
     ggcgggaagc agcaatggtg cggcacgacg agcgatggct tggggaatcg ccacgcgtcg    175380
     cataaactct tcgccgagct tcgcagagag cgacaagacg acactgtgcg ccgcttgaat    175440
     accggcgttg gcacacagcg ccacaatggc gagttttgca ccaccaccgt gcgctttctc    175500
     gacacgcgcg ctatctaaag acttcatgaa cgcctttacg tgtccaaccg ccacggctaa    175560
     gcgatacatc ttcgccccga atcctcgttt ggcgttgagc actttgttga tgcccttttc    175620
     gtgttggcgg cgacgaatga gcgtgtcctc acccgccgcc caagccgcgg cgcgacgcat    175680
     ctgctgctct aaatttttcc gcgtgcgtgc gctcgcgggc gaattcgggg gaatcctcgt    175740
     tccgagcggc gtgcgcacgg gcgaaggaga ccacggcgct ggcgatctcg tcgacgcgct    175800
     cgacgtcggc gacacgaacg gctcgctctg ctccggcgac gccacgcgcg cgaatcgaac    175860
     atcttgctgc acctcatcgc gcgcttcgtc tctacgatcg gcgacgggaa atgaccatga    175920
     atcttccttc ttcgccttca ccgcgacttt ctcgcgcggc ggcggcgaag gtttcttcgg    175980
     cgtcgaatac gaagcctctg aaaaatttgg cgacgccgcg gcaaacgacg cctcgggtac    176040
     cgccaccggc gccaccggcg ccgtcgcccc gacgcccaca cgcgtcgttt caatcccgat    176100
     ctctttctcg cgccaattga aatcgtactc catcgcctcc tttcgcctcg cctctcgcgt    176160
     cccgacgtcc gccggcgccg cgacgttccc ggccgccaag gtcccgatcg ccccgatgct    176220
     cgtcaccacg tcccgcaccg ggctcccact ttcgggcgcg tcccagtgat tcgcgtaccc    176280
     gtgattgaac gtcgtcttcg gctcgtaccg cgtcgcatca ccgatcgtac cgccgccgcc    176340
     gcgtccagcc gcgtctcgcc gcaactgctc caaaaacgta aactgcgccc catcgctcgt    176400
     cggtgacgac gtttcgaacc gcgtgtgcgt cgtgggtttg taatcaaacg ttctcgacgc    176460
     cgtagacgcg ctcggggagc tcgacgggcg ccacgcgcgc gaataatcgc tgtcgttgtt    176520
     tgtgccgttg gaatccgtcg gaacgccgcc gacgcgcacg gcgtgagcgt tcgacgccgt    176580
     gtacggcgac gcgcgattac ccacgtgcgg ttctcgcacg ttctcgatag tcacgtcgtc    176640
     cgaggtcggc atggcgacgg gcgcggcgac gaatgacgcg gggggactga atcaatccaa    176700
     gaatgcaaaa tttggcgccg cgaatgaacg caaaaggttt gattcgacgc gaatgttcta    176760
     cgccaaggct acgaaatcgc tagagcggcg ggaaaacaaa cgcatgaaat ttgatttcgc    176820
     gcgattgagc gcgtttcgaa gctcgcaggc gaggacttcg aataaaagga cgcgaccttc    176880
     gcgctcgcgg agggcgtcga gcgccacgcg gaatcgaggc gtggaggcga gcagggagac    176940
     gtcttggagc atggcgaaga gcatgtggat ggagagcgag cgcgtgcgct cgtctgtggc    177000
     gagctggcgg atgactttac gaatcacggg cgaaccttcg gggttggcga gtaatttctt    177060
     catcgagtac ggatagacct cggccaagat gttgaagttc gcgtcggcgg attttgccat    177120
     gccttcgagc gtgcccaacg cgcgtgcgtt gttcaaaaag tacggcggta ggacgaactt    177180
     gaagcgcgga accaaggcga cgagagcgcc gaggagttgg tcgaaacgca cgttcgggac    177240
     gccgccgccc tcgggaaatt tcagcgtggc gtttgccgcg tcctcgagcg ccgactcgag    177300
     cgcgcgcatc tcgctctcgt cctcgagtac ttcgggcgga atgagcatga gttcgccgaa    177360
     tagtcgacct accgcagcgt aattgcggct gaagatcaac agcgccacgg cggcgactaa    177420
     accatcgcgc acttgttgcg gcaccgtgga cacgagaccg aaatccaagt acgccaaacc    177480
     gccgttgggc aattttaaaa tgttcccgcc gtgcggatcg gcgtgcatca ccccagtctc    177540
     tatcagctgg ctcagcgtgc acgaaatacc gagcttgacg tagtgcaagt cgtccgcgtt    177600
     caccgcgccc gttcgcccgg cggttaactt ttcgccttca atccattcca tgacgatgac    177660
     gcgctcgccc acgccgtact tgtcaatcaa tcgcggcacc acgatcccgg gcttgggcaa    177720
     cgatttcgcc gcgctgccgt tctcaccgta aagcgcgttg aactgcatca aattcgccgc    177780
     ttcgcgtctg aaatccatct cttcgtataa tcgcgagcaa aattcattca cggcgtccag    177840
     cgcgcgcgcc ttcaccttcc ccgtgcgctc caccgcgctc gctccgagcc gtaacaacgc    177900
     cgcatccgcg tccaccatct ccctaatttc aggtcgctgc acctttatcg ccaccgtttc    177960
     cccgtctaac gtcgccttgt acacctgcgc caacgaagcc gccgcgcgcg gcgcgcccgc    178020
     cgcgcgcacc gcctccgcga ccgcctctcc ctccgctccc agatcctccc gcacgatctc    178080
     caccgctctt tcatcgctga acgccggcat gtcatcgcac agtccgcgca gcgctcgcgc    178140
     caggtcttcg cccacgatgt cgccgcgcga cgacagcgct tgcccgaatt tcgcgtacgt    178200
     cggcccgagc gcgcccacgg cctcgaccaa accttcgctc ctcgacgaat cgctcgcgac    178260
     gaacgcgacg cgcgcgcccg cgcgtaagat gtcgccgacg cgcgccagca tcgccgtcgg    178320
     catcgccgtc gcttcgcgcg tccgatgttt cgacgctcgc gtggacgcgt cccgccgatt    178380
     acgtcgactt cttcgtccgt tttcgcgcga gcgcgaccgc gcgcgcgtcg cgacgcgccg    178440
     tgacgacgcg acgcgacgcg cgctgcgtcc cgcggacgcg ctcgtggacg ccgcgagcgc    178500
     cgcgcgcgcg cgcgcgggcg cgaaagccat gacgacgcga cgcgaagtga cgcgccgttc    178560
     ggcactctcg cgcgcgttcg cgcgtcgcgc acggttcgtc gccgccctcg cgcgcgcgct    178620
     cgaggtggac gcgtaacgcg cgcgcgtcgt cgatcgacgc gcggcgcgga cggcgcggcg    178680
     cggacggcgc ggtgcgcgga taaagcgacg acgatgttgt cccggggcgt cggcggcggc    178740
     gccgtcgcgc gcgcggcggc gcgcgggcga gcgaacggcg cgcgaggacg cgatacgaga    178800
     ccgtgcgcgc gagggttcgc cgcggacgag cgcgcgcgcg aacgcgcggt ggtggtggcg    178860
     gcgaacgcgg acgcgacgcg gcgcgggacg aaggttatcg cgcgcgcggc gaacgcggcg    178920
     acgagtggaa agataaagaa ggcggaagag gccaaggtga agacgaagac gaaaagtttg    178980
     atgaagaagg cgctgcgcgt ggaggcggtg agcgcggtgg tggaggcgga ggtggagcga    179040
     gagacggcgt cgactcgagg gtcggcggcg agcgcgggga tggaaccgaa gcccatgatc    179100
     gcgcctaggg tgagtaaaca ggcgaaagcg aaggatggag tgaatgggaa gaacggtgaa    179160
     ggggcgacga gcggtgaggg gacgacgcgg ctgacgagac cgaagtttgc ggacgaggct    179220
     tcgtttacgc gccggcgtaa atttccagtg ttgttttaca gtaaagagat ggagcctttg    179280
     gcgcgaaagg tggcggagga gagcgatcac atggtcgaac tcggacagat tgattggcgc    179340
     acattccccg atgggtttcc agacttgttc atcaacgacg cgtacgatgt gcgggatcgg    179400
     cacgtggcgt ttttaggctc gtttcacacg cccgaggtca tctttgagca gttgagcatc    179460
     atatactcgc tgcccaagat gtttgtcgca tcgttcacgc tcgtgctgcc gttttttcca    179520
     actggcaccg ccgagcgagt ggtacgcgag ggcgaggtcg ccaccgcggt gacgttggcg    179580
     cggattttga gcaacattcc gccctcgcgc gggggcccga cgagcaccat tattttcgat    179640
     attcacgctc ttcaggagcg attttatttc ggcgacagca tcttgccatg cttcgaaagc    179700
     ggcataccgc tcttgctcga ccgtctgaac gagctcgaag actcgaacaa cgtcgtcatc    179760
     gcgtacccag atgagggagc gtacaagcga ttcaactcct tcttcgccgc cgcgggttac    179820
     gagtgcatcg tctgcaccaa agtccgcgaa ggcaccaagc gcatcgtcaa gctcaaggaa    179880
     ggcgaaccga tcgggcgcca cgtcgttatc gtggacgatc tcgtacaatc cggttccacc    179940
     ctgatcgagt gtcaaaagct cttgcaccga ctcggcgccg ccaaggtgtc cgcctacgcc    180000
     actcacggcg ttttccccaa tgcctcctgg aaacgtttca cctccaccgg cgccggcggc    180060
     cagggtttct caaacttttg gatcaccgat tcgtgtccac aaaccgtcga ggccgttcga    180120
     gacgccgagc cgttcgaggt attatccctc gcccgcgcca tcgccgacgc cctcgaggtg    180180
     tgagatccga cgcctcgttt ccttagcaat caccccctca tcgttcccgt tcgcgcgtcg    180240
     cgcgctcgcg ctcgttacat attcttattc gtgtcattcg tgtcaatttc acgcatttat    180300
     tagcatcacg cgttcgtttc gccgcggctc gtccgtcgcg tcgcttcgtc ggttggttgg    180360
     tgcttttgct gacgaggatt cccgatcgcg cgtcgcgcgc gtcacacccg cgcgtcgcgc    180420
     tctgacgcat catgcgcgcg accgccgcgc gaatcgaacc gtcgcgcacc tcgtcgcgcg    180480
     tcgcgaaccg cgcgcgcgcg ccgcgcaggc gtcgcgcgcg cgccgccgcc gcgtcaacga    180540
     tcggggacgc gaacgaaagc accgacgccg ccacggcgta cgacgtcctg ggcgtccggg    180600
     aaaacgcgac gaaagatgag atacgacgag cgttcctgcg aatgagcaag acgcatcacc    180660
     cggacgtgcg acagacgagc ggtgatgacg acgggatgat ggccaaggtg aattcgagct    180720
     acgcggcgtt gttcgacgac gacgcgcgaa ggaaatacga tgcgaaactg cgggaatcga    180780
     ggaaaggaga tgcgaaaatg aaacgcgcga gcgatggggt gacggcgact tacgaagggt    180840
     tggttggacc gatcgtgaac gatgagatgg cgtcgctcga cgtgtgtaaa attgaagagt    180900
     gcgcggtgga cgcggcggcg gagatgatcg attctatacg acagtgggcg aggacgttgg    180960
     cgtttacgag cgaattaccg ttgccgttgc cggtgagtgt ggacgatttg cccacgggcg    181020
     cgcggctggc gttcatgcgg tacgattcga gccaaggatt gcgagaggcg ggagcgttga    181080
     gactcgaggt gctcgaaacg agcgagggca ccaaggtttc ggtgtctcga tcattcgcga    181140
     aggcgtctcg cgcggcgaaa ttcgaaattc ccggcgaagg gcgtgtgatg tcagcattta    181200
     tgcaggagtt taagtttctc ctcggcgaag acgagaagag aacgaggaaa gtcgacgagg    181260
     cttcagacga cgactttgtg agcgctttta aaagcgcatt tgcggcgttc atcttaccag    181320
     gtttgcccat gtttggtgcc actaagagcg cgccgggtgg cgcgtataac gcgtacaatt    181380
     taaagcacga cgccaagcac atcgattaag ccagccagta cagtagttac aacagtgtag    181440
     agcgtttttt caatcacagc gcgcgcaaat ctttacctaa aaatgtcacc cacgcgtcgt    181500
     catttgcacc acatccgcca cgacgtcttt gtactccccg tatttatcca gcgctgtcga    181560
     tgccgcctct ttgagccttt tcctcgtcgg aactggcccc caaaagtagc caccaaagcc    181620
     aaggaacgcg caacggtcgc caacgtagac gacgcgcgcc agcatccaat cctcgctcgt    181680
     caccgcgctc gtccctccag cacctccaat cgccgacgtc aactttcccc acacgctttt    181740
     cgcagcttta ctcgtcccag cggcgacgag gtcctcgccg attgtcgccc gcgcgaaggc    181800
     gcgataccac gcgccgactc tcccgaccgt cccgcgctcg tccgtttccc gtttccgcag    181860
     tctctccaag tgtcgctcga aaaatctcga gaaatgcttt tcgctcgtgt acggcttcgt    181920
     cgccgctgcg aacgcgacag cgcccgcggc gatggcgaga agtcgcgtct gcgcgcttct    181980
     cctgattatt ccgagttcgt tcacaaactc cctcgttatg gcgcgcgagc gaagtaacat    182040
     cgccgaagag acgacgtcga gctcggtttt caccttggtc gtcgccaacg cgagcgccaa    182100
     ggcgaaggcg atgcgatggt acggcgcaag atcgtctggc attgggtcgc ctcggagtga    182160
     cgctacgcgg cgacgcgcag agctagatgt tgatgaatac ataatgcgac cggctaagga    182220
     ttacaagcgc ttgactgagg agaattcgac gccgcgatcg gtccactgac tgcggagcga    182280
     cgcgagcgtg cgctcgagga tatcatcgtc tggcgccgcc gacgggcgga agacgcgctc    182340
     gccgtgcgcc acggcgacgg cggcgctgag atctcgagtc gcgctcgcat cgatcgtgcc    182400
     ctctggacag ataacttttt gcacgaacgt cgcttcgtcg acgaagtcaa agtggccggc    182460
     gccgcacgag ataccccagg gtgggtggtc gcgcgcgacg gcgccgctcg gcgatgcggc    182520
     aaagaattcg gcaaagtttg actccgcggg cgcgcattcg ccaccgttcg cgccacccac    182580
     gatcgccacg ggcggtacgg cggatggatt cactttcata gccgccaacg cgctggggta    182640
     gcccacgccg agcggcgcgt acacggtatt atcgacggga tcgagcaagc aaatcgcctt    182700
     aatgcgtttg tctcgcgtcg cttggagcat ggaaatcttc cctcctctgc tgtgcccgat    182760
     caagtaaacc gcctcggcgt cggcgtaagg cgatatcagt acgtctgacc ccacccaaga    182820
     tatcaaatcg tccaaaatcg ccgtgctcag ttcgtcgtcc agcgaccctc ccgcgacgga    182880
     ttccgtcttc gtgtacgtca ccacgacgta accccacgaa cacaatctcc gcgcgatcga    182940
     cgcgtacgcg tcgccatcga tcaagaaccc aggggtgatt atcgccaccg gatacggcgc    183000
     ctccatcgcg tcgtcctcag cccgcgatcg cgtcgctccg cgctcgactt cgcccagcgg    183060
     aaacagcgcg tccggcgaca cctccaccct cggcacgtac accttgatcc tactcaggca    183120
     gctcagcccc gtgcacgatg gaaagcactt cgcgcacgtg tgttcgagct gcggcagcac    183180
     gcgcacgcgg tacggtccag gcagcgcgta gtcgaccgcc gcgctcgtcg cgctcgcgtc    183240
     ctcgttcgcg ttcgttccca tcggcaccag cgcgctcgcc cccatcgcga gcgccaccgc    183300
     gcgtcgtccc agacgcgcat catccgcgcc cgcgcgcgac gacgtggacg cgcgcgcgcc    183360
     gctcgtcgtt cgacgcgctc gacctcggtc gtcccgttcg cgagattcgt cttcaaactc    183420
     ctcgcgcgac gcgcgcgcgc gtcgcgacgc cgacgcgcga cgtccgcgac gcggcgagca    183480
     tcgcgcgcga accgtcgacg cggtcgggcg cgcgcgcgac gcgacgacgc gcgacatcga    183540
     gcgcgtttcg aagccgccgc cgatgagtga cgactcgttc gtcactcttc gccgcgattg    183600
     cgtcgatatc gagcgaacgc gatcgcgcgc gtcgaagcga ggcgataggt atcgatcgtc    183660
     gacgtcgatt ggcgtcagag cgaaccgcaa aggcgcgcgc gtcgcgagag aatcgcggtt    183720
     gaagcgcgat gctgtacctc atcggcctcg gcttgggaaa tgaacgcgac gtcacgctgc    183780
     gagggctgga cgcgatcaag cgctgctcga aggtgtactt ggaggcgtat acatccgtct    183840
     tgggcgtgga cgtgcgagcg atggaggcgc tgtacgagaa accggtgcga acgtgcgata    183900
     gggcgttcgt cgagcagggc gtcgacgcgg tgctggacga agcgttgagc gaagacgtcg    183960
     cgttctgcgt cgtcggtgat gcgttcgcgg cgacgacgca ctctgattta gtgctgcgag    184020
     cgatcgaacg cggagtggcg gtcagaccgg tgtataacgc gagcatcatg aacgcggtgg    184080
     cgggcaccgg gttgtcgctg tataatttcg gcaaggcggt ttcaatttgt ttcttcacgc    184140
     agacgtggag gccagacagt ttttacgatt tgattcgaga caatcggaag agtggggcgc    184200
     atacactgtg cttgttggac attcgagtga aggaaccgac ggtgcgagcg ctgtgtaagg    184260
     ggatcgagga gtacgagccg gcgagattca tgacggcggc gacggcggca aagcaaatgt    184320
     tagaggtgga ggaaagtcgg ggagagggcg tgtacggtga ggacaccatg tgtgtcgccg    184380
     ttgcgcgcat cggtcaggat gatgaaaaga ttcgtgcgtg cacgctcggg gagatgcgtc    184440
     gcgtggacat gggcgcgccg ttgcactcgc tcgtgctcgt cggcgacgtc atggagatcg    184500
     agtccgccat gttagccacg cacgccgtca agcccgaaga cttttacgac ggagatgcac    184560
     cgtgtcaaat gctcgacggg tagcgcacac tgaccgattg tagattagcc attcttttga    184620
     tattcaacaa ttctctcaac gactcgcgac taatcacatc ttattcgctg tctcgcgttt    184680
     aactaaactc acgcccactg ctgccctcct cgcgcgcgtc gtacactctc tcgcctcatt    184740
     acactataat tcacatcgtt cgttcccttc ccttacgtct ctgctcgtcc gttcgaccca    184800
     atcacggcgt ggacgtcctt ccccgcgcgc attcgctcgc gcatcgtctc aaacacttct    184860
     cattccatcc tggcaccccg tgtcccgccg tgcacgccac ccgcgcgcac gcgtcgacgc    184920
     atgcgtccgt cgcactcatc ccgcacgtcg tcacgcacgt gtgcatgagt tccgccttgc    184980
     ccaaaccacc gagcttggcc atcaaacgat cggacgcgca gacgcgctcg cacgcgaacg    185040
     acacctcgtt ctcgtccacg acgcctcggc gaagctcttt ttgcgagttt tgacgcgtgt    185100
     tcaagaaggt tttagtcgcc acggcgacgg cggtggcggc accgatggga gcggcgatga    185160
     gggcgagctg gaccatcgcg gcgcggcgca gagtgcggcg aaagtgaagg aagaattgag    185220
     gactcgggcg cgctgattcg ggcgtctgca aagaggcgag ttagataaaa ttacatgtcg    185280
     accgcgtgcg cggttcaacg ggattttgcg aacgtggggg gatggaatcg ttcgtacgct    185340
     gagcgacggt ttaaaggatg ccgttcagaa tgcgttggta aaagtcgtac tgacgcgtgc    185400
     tccaggcgtc gatggagtct gaaatcatgc ccagtaccgt ttccacacac tgttcttcgc    185460
     ttaaagcgag gttgaagcgt cttcggagtt gcttgatgac cttcggtccg gcgttgaagc    185520
     acggacaacc gctggcgccc atcatttcga cgagcaatac gatgcgctcg gcgtgttcgc    185580
     gaacggcgag gtagccctgg atgcacagag ccttgtacgc gtcgaacgcg tccgaacggc    185640
     tgccttcaac atcgctgtcc atgacttcca agtattcttt cgtgagcttg aacgggctcg    185700
     attcaaagtt tatgccgccg ggagacgtgg agagcatgaa attgaagtcg atgtgtatca    185760
     agtgtccatc gtcgtgcagc aaaatattgc cgttgtgacg atcctttact tgcaacaagt    185820
     aggtaaggat ggaatatccc gccagtgatt cgacgaagtt attctgcgcc ttgcggaatt    185880
     ctggcgtacc aacaccaaac tttcgctcaa agtgttcgcg cagcgtcgtg ccgcgttgcg    185940
     atcgcgactt caacgcgtgc acgctcggcg catccgtcac cgcttcaatc aacgcactgt    186000
     gcgtgttcgt ggtcaagatg tcaaagtctc gaatccagca tcgaacaccg gcggtgcgat    186060
     agatttctgc aaacgtacga acgagttgca gcgccagtaa ttcttgcctg caattatcgc    186120
     cggcctttat gatgatgggc tttagccccc atccaggcag atttccatac ggtgatgagt    186180
     gtcgaatacg ctcgcgcttg tcagcccaca attcgcccaa tccacccgcg ctgcgcttgt    186240
     gcggggaaga tgtgagcgct gcgcccactc cagtcgccgt gggaagcgaa gtgacgtcaa    186300
     aggcgtcctt ctccggagcc cacgatgtgc ggttcacctg agctgccatc tcaatcaaac    186360
     caatttctga tggtttacgt tggtgcggtg attgcgtaat gtccatgtga ccttgcgtgg    186420
     cgacgacgtg catgacgacg ctttcgctgt gctcatccgc cgtgaggacg acattgacga    186480
     gctcgtccgc gagagagtcc tctgtgctaa atgaatcagt ccccgcaccg tctatcgtcg    186540
     gtaagtcccc gtaagctttg tctagcgatc tacgaatacg ttcgcgcgag ttgatcgtga    186600
     aatcatctcc cacaggatag aaatcttcaa cggttggaag gcccgaagac tcggcagacg    186660
     atgtagcgtt gtgcatctct tcttgcgtcg gattggagct cacgacttct aaacagacga    186720
     ggtacggcgc cttctcgcga ctattcaaca gcacagcctc ttcccacggt acgcgaatca    186780
     ctcgctccat ctcgccgtgg cccatcggaa acaagattcc ggtacccttg tcggtgtggc    186840
     gaaagcgctt gttcatctgc gccaactctc gacgcaagat actttgacga ttttcgagcg    186900
     gaaacacctt cgacagcttc aacgaaagct cgcacaagtc atccgtgagc ttcatcgtcg    186960
     cgtcgaacgt tttccttcga agattcaacg ccttggctcc atcctcagcc ggtaacccct    187020
     tcgttccgca cacgccaaag agcgacgaca atccacccga gggtgatcgt aatcccgcat    187080
     ctttcgtctt gcccggtgac ttctctttgt ctttgtgatg atctctattc ttcttgcccg    187140
     agtcttttcg cgaaccggag ggagaagacc gaaaggagag cgctcgcgag acgccggcga    187200
     ggaaacctcc cgcggcgggc ggcgactcca ccctcttccc atcgaagcca tcgctcgatc    187260
     ttcgccccgg cgacttcgcc atgccgaata ttcgtctcgg tggcgtcacg ggttccggag    187320
     ttgactccgc gggcgctccc gtccgcccgt tcctcggcgg acttcctcct cgctccgtcg    187380
     tcgccgtcgc cgcctccgtc cccgcgctct cccctcccat cggcacccgc tcctcaaacg    187440
     gcgccggcca cgtcccattc ttcaccgctt ccctcgcgca ctcgtcccta aaatccaaca    187500
     ccgccttgga ctccgcgctg tcccccgccg ccgccgccag caaccagcat atctttgtcg    187560
     ccagccgcag cgatcgtcga ctcgtcatca ccatcatcct ctcaaagctc gccaggtgtc    187620
     ccgcgtcgct cccgcgctcg ttcgtcttat tttccaccgc gtgcacccac atcgtgacca    187680
     tctggctcag gtaccgctcc agcgcctcgt ccgacgtctc tcgatacagt ctcgcgcaca    187740
     ggtagtcgct cacccccgcg tgttcgcgtc gctcccacag gttcgacacc gcgatccacg    187800
     cgtcgaatcg ctcgaggtgt tgaaagtaat ccagcagcac gcgcgcccgc tcgcgctcgc    187860
     gcgcgatcgc gctcgcgtcg tcgcgcgagg tcgtcgagac gcgcgcgccc gagtccccat    187920
     cgcgcgcgac gccgacgcgc gcgtcgtcgt cgtcgcgcgc gcgcgcgagg gcgtccgcgc    187980
     gcgccgcgcc gcgcgtctcg ctgtcgacga agcgttcgag ggagtcggcg agccaggcac    188040
     cgccgctctc gtgccgggcg tgccgcgacg cgcgatccat ggcgacgccg gcgagtgcgg    188100
     agacgcgaac gcgatcgaac ctcgatcgcg cgcgcgtcga tcgcgtttga aattcaatcg    188160
     tcacgacgtc gatcgacgat ggacgcgatc gaggttcgat cgagatcgag aggtcgagac    188220
     gcgagagcga cgcgacggag acgcgagagg cgcgcgaggc gcgcgcggga agggcgggat    188280
     ttcactggtg ttacagggat gatgggttcg gtgatgatcg tcgccggcga atcgatcaac    188340
     cgggataggt ctcggtgagc gcggataacg tcttcggtaa gccgacgaat ttcaactcgc    188400
     cccactgtcg ccacgcgaag gcgcacgtta aacagttgag cacgatggtc gccgcggcga    188460
     aaatcaggga aaccaaactg taatctgcgt ttttgcacac gtaataatcc gaactcaata    188520
     ccacggacgc gcactcggtg atggacatga cgacgaacgt cgccatggcc gcggtgaaca    188580
     gcgcgtagga cgcgaactcc gtcccgggcg gcggcgcctt gcgaatcacg tacatcgcga    188640
     tcaagatcac cgtgtacgcc cagaatcccg cgtacacacc gacgacgccc ttaaattgat    188700
     aaaacttcgt gaatccacac cccgcttcac cgcagtcgtt cagcgtgctc agctccggcc    188760
     ccgccagtcc ctcggtttgt ttcgccatga acgaaaacgt cgtcaacgcc atcaactgtt    188820
     cgttcgtcgt cgtcgtcgcg tcctaggtca gtctccgcgc gtgcgagttc accgtcgcgt    188880
     cgcgtcgcgt cgcgtcgcgt cgcgtcgcgt cccacgcacg ctctccacga gcaacgctcg    188940
     aaactttgga ttcttcatca gcctgtgatt catcagcgac gtcccctcca cgctcgctcc    189000
     cacgcgtttc agcagcggtt cccgcgcttc gtccgacgcc ccgggcgcgt cgtccatcgt    189060
     ctcatcgctc gccatcccgc gatatccctc gtcgtcgtcg tgtcgtcgtc tgaagcgacg    189120
     gctcaacacc ttcgaggtgt tgagccgtcg atccatcgat cgatcgatgc gcgatgcgat    189180
     cgacgctttg agtttcgttt catatcgtcg atcgactccg cgaggttcga cgcgacgcga    189240
     tttcatcgtt cgaccgctcg aacgtttgcg gcgacggcgc ggcgcgcgcc gcacacctcc    189300
     gcgcgcggag gcgtcaccgc gcgcgcgcgt cgtcgatcgc gcgcgaatcc gcgaacgcgt    189360
     cgcgcgcgct tcccgacgcc gccgatcgcg cgcgcggcgc ggcgtcgcgt cgaatgcccc    189420
     cgtcgacgac gctgctccgc gcgcgcgatc tcgagcgcgc gctcgccgag ccgtggccga    189480
     acgcgcgatg cgccacggcg ctcgacgacg cgatgatcga cgcgctgaaa aatcggttcg    189540
     cgatcatgac gccgttcgcg aggcgcgggg cggtgtgcgc ggcgatgttg gcgtcgaaac    189600
     gcgcgacgag cgcgcgcgcg atcgcgacgt ggcgggacgt cgcggcggga gacgcggatg    189660
     agtgggtgcg agcgatggcg cgggcgatgg atgaaagcgg ggaaagattc gattgcgacc    189720
     gattcgcgac ggatgtgccg gtggtgcgtg tgcgagcgat gcgcgagcga ggggaatgcg    189780
     acgagaattc attcgggaag gcaccgtggt gtgaatgaac cctaacgcga aggacgcggg    189840
     aaacgacgcg ggaaacgacg cgggaaacga ttactgacga atgaacgccg cggtgtttgg    189900
     taaacttagg tgaataccgc cgtgcgggcg ataaaggaga cgattgcgaa cgcgggggag    189960
     gatgggatga cgcgaagacc gcgcgccgac gcctacctga cgatgaaaga gccgacggcg    190020
     catggacact tcacgctgag agaacggcgc gagccgaaga agcggccgat gagtgcggga    190080
     agtcgaggtg caacgatcgc gggcgatggt tcgtcgcaag tgaatcgcgc gcaggcgaac    190140
     atctttgcgc cgtcgcgcaa gccgacggcc agcggaggcg cttcgttttt gcgcgacacg    190200
     ggtcgatctg gcagtgtcgg tgccgcgcgt tcgcgagtcg gtggcggcat tcctcgtcca    190260
     ggggcgaaga ctatggtcat cgacgtcgcc gaagccgcgc aactcggcgc tacttcgcaa    190320
     atcgacgatc ctctccgagc gcaagcgcag gaggaacgcg atcgcaaacg tcaacgagaa    190380
     aaggaggcca aggagcaacg catgcagaga ttgatgcaag aaatcgaggc aaagaaacaa    190440
     agggaattga cgagaaaacg cgaacgcgac gaagaaattt tggagaagaa gaaggcttac    190500
     cgggcggaga ttgaagcaaa gcgcgcgaac aagcgcgtcg cttccatcgc cacgccgtcg    190560
     cccacggacg aaccggcgac gtggtgaata gtgacggaat agtaacaaaa aagacacaga    190620
     gtatccgctt gcgcgcattc gtgcgcgcag cgcgctcaca tgactgcgca ttcgtgcgtg    190680
     gtttgtacaa aaaaagccga ctcccgcgtc ggagcaaaaa aaattgataa gcgctcgagc    190740
     gagcgcgacg aagaagcgag ccaacttcgt cgttcgagcg tggagtacac tacgatagct    190800
     accccctagc gaacgatcgt ctcgatcgtt cgatgaaatt cagaaccaac caggaaaccg    190860
     gagaaaaatc aaatcgtccc gcgtctcgcc cgctcgaggc ccccacgtcg tcgcccgcgc    190920
     gctccggtga cgtcacttca acgcgtcatc tttcgttcgc catgtttcgc gccgccctgc    190980
     gacgcgcgtc gacgcacgcg agcttgaacg cgcgcgtccg cggcgcgttt cgcgcgctcg    191040
     cgacgtcggc gacgcagaaa accggcggta tttacgaagt gcgcacgtac gacatcgaac    191100
     cgtcgcgact ggatgaatac ctcgccatgt gcgccgacag cgcgaacgaa cgcaaaaaag    191160
     tgacgaacga aggtttcgtc ggattcttcg tcacggagct cggcggtgac gcgcacgagg    191220
     tgacgcacgt gtaccgatac gacgattacg acgcgcgaga cgacgcgcga aacgcgatga    191280
     agcggagcga aacgtggacc gcgttcctga aagcgtcgaa accgatggtg agacgacaaa    191340
     agagcgagat attcttagag gcgacgaaag cgacggcgag cgcgggaatg gaggcgaacg    191400
     atgtgctgcg acgggcgcgc gaagggaacg gaggacgcgc ggacggcgtc ttcgagtggc    191460
     ggcggtatca gctcgagttg ggatacaacc cgatcccgaa gctcgtcgac gcgttagcca    191520
     agggactgcc gtcgaaatta gcgagcgatc gagacgggcg cggggagttg gtgtggatgg    191580
     gatacagcga cgtggggaaa ttgaaccaat tcgtcgagct gtggcgatac gactgctatc    191640
     aggatcacat aaaggcgcgc gaagccgcgc ggtccgccga tgcgtggcgc gcggcgatca    191700
     acgagatcgc gcctatggtt caaatgtttg atacgcagct catgcgacca gcggcggcgt    191760
     cgccgatcaa gtaaaccgtc gtcgttgtaa tttttaattc gttcgtttgt cgtcgcctcg    191820
     acgccgccgt cgcgagccgt cggccgtcgc cgcgcgtcac agcgcggcgc tccatcgcat    191880
     gcgcgcgacg acgcacgcga cgacgtcgat cgcgatgcaa ggaactaacg gcgcgcgcga    191940
     cgcgacggcg acggcgcaca acggcggcgc acaacgacgc gcggcgaccg cgccggcgca    192000
     cgcacaagat ggcgaaaccg cgacgacgat gcggacgacc gaaggcgcgc ggcaccgcgt    192060
     catcttcttc gactgcgacg attgcctgta caagaacgat tggcgcacgg ccaacgtgct    192120
     gacggcgaag attgagtcgt acacgacgca gaggttgggt ctgcgagacg gcgacgcgta    192180
     cgcgctgtac aaaaaatacg gcacgtgcct aaagggattg atggaggaga agtacctgga    192240
     cacgcaggaa cacttggatg aatttttaca ctacgcgcac gatataccgt tggatattga    192300
     gcgagacgag aagcttcgag cgatgctgct gaagattaag acgccaaagt gggtatttac    192360
     ggcgtccgtc gcggcgcacg cgcggcggtg tttagagaag ttaggaatcg atgatttatt    192420
     cgaaggaatc atagacgttc gcgcggtggg gtgggaaacg aaacattcgc ctcgagcgta    192480
     cgaagcggcg atgcgaatcg cgggcgtgga cgacccgtcc gattgtctgt ttttggacga    192540
     tagcgtgagc aatatgcgca ccgcgcgcga ggtcggatgg acgaacgtgc tggtcggtac    192600
     gcacgctcga gatggaggag agctcatcac gtgcgatcat gccgatcaca tcatcgccac    192660
     cgtgcacgag ttcgaggcgc tcatgccaga acactttgac gaaatcgaag acgcggctcc    192720
     gggcaagcgc gaagaggacg ccgtgcctgg agcgcccaac tgacgtcgca gacgaacgag    192780
     cgactgaatg agtgagcgac ttaacttact aaatatattt gaattgataa caagaagcca    192840
     tggcggtgcg catgcctttc gcacctcact caagcgcgcg ccttcccaaa agtccgcgag    192900
     cgcgacgccg ccgcacttca cctcgcgccc tcgaacgtgc cccacgcgcg cgcctcgacg    192960
     atggattgtt gcgcacgcgt cgacgcgcgc gtatccgcgc gcgaggcacc ctcgcacgcg    193020
     cgaacgcgac gccttcgtcc tcgccaccat ttttcggcaa gctcgacttt gacgcgtcgc    193080
     acgcgcgcgc gcgtggcgtt cgcgcgcgca tcgagcgacg acggcgtcgc gagtgacgtc    193140
     gttggagtcg tcgtcgtcga tcacggctcg cgccgcgcgg cgtcgaacga gcagctcgaa    193200
     cggtttgcgg cgctgtacgc gacggcgacg ggacgcgccg tcgtcgagcc ggcgcacatg    193260
     gagctcgcac caccgacgat cgcagatgcg ttcgagcggt gcgtcgaacg aggagcgaac    193320
     gtggtcgtcg tggcgccttt ttttctgtcg ccgggacgac actggcagga ggacataccg    193380
     agactggtgg acgaggcggc ggcggcgcac cctggggtga agtatttaat ctctgcaccg    193440
     atagggttgc atccgcttat ggcggaggtg atcgattcgc gtttgaggca ttgtttagcg    193500
     cacgtgaatg aaggtggacc agagtgtgat gtttgtgcgg ggtcaaagtt tgggtgcgag    193560
     cttcggcgaa cgagttagcg agagcagaaa tagccgacgg cgtttgtcgt tacatgttct    193620
     ttcctagtaa gcgtaagcgt agcgcagatg tacaaaaaag atgcgaattt attttttttt    193680
     ctattttctt gccgcgtggt acagctcaat gtaatccaac gcgggtctgt tccatgagaa    193740
     atcgcacgac atgcagtttg cttgcaaggc gtggaatttt tctatgtcgt tgtagaacag    193800
     atcaatggca cggttcaacg cgtagtcaat atcgtgcgct tctgtaccgt cgaactgaaa    193860
     tccattcggt gtcattcctt cccattcagc cttggcgtga tcgtgatcgt aatcaaatac    193920
     agtgtccgcg agaccgcccg tacgacgaac gacgggaacg gtgccatatc gcatcgcaat    193980
     gagctgagat aaaccacacg gttcgaacat cgacggcacg agaatcatat cggaaccagc    194040
     gtagatcagg tgcgataacg gttcgtcaaa gtacaagtgc aaggcggcat cgttgaaatg    194100
     gttctgtttc aaagcattcg ccatgtcttc aaactcgcgc tgcacgttcg gatccggggc    194160
     gcttccgagc agcacgacct gacaacctcg ctcgagcgct ttgaaaatgg cgtgcttgat    194220
     cagatgaatt cctttttgat gcgtaagacg cgttacgacg ccgatgagcg gtacgtcgct    194280
     cttgtttgaa atgttactcc tcgagcacaa agctgcgcga caagccgcct tgccttcagc    194340
     aactgtgtct atctcatatg ataccggtaa gcacttgtca ttcgctggat cccagatatc    194400
     gggatcgatc ccgttcacca cgccgtggaa tttttggagt tgatgagaga tggagtcgtg    194460
     acctgaaatc tcttgcgcgt acgatctcga caccgttgtc ccaatttgac tgtaatccat    194520
     cgcctcgcgg atcaagcttt gaccaaagtc gaggttgtga atggtgaaca ccactcgagg    194580
     gttacctaag ccatagttgt gatagtcttc ccagtacacc ttggccacgg gtgcggtttg    194640
     ccaatcgtga cagtgaatga tgtcgggctg tcgaccgctt tgcaacatcc attccaaagc    194700
     tgctcgacta aagtatccaa atctctcggc atccgtcaaa ggaatctcca agtagtcggt    194760
     accgtaaatc atgccaacct tgaacatacc attgtctgga tcgatgaagt aagtcttcac    194820
     tccctctacg gtaccgctga aaacgtggtt gtaacagcca ccccactgaa agccttcctc    194880
     ctccttcaag tcttcgatga gatcgtactt gaggacgtcg tatttcggaa gaacgacttc    194940
     aactttgtgc ccttccgctt gaacagccaa tccgagtgat gtgacaacat caccaaggcc    195000
     accaaccttg gcgattggag ccatttcgac gctcacgctc acgacgtgaa gcggcttctc    195060
     caccacggcg acaccttttt catccttgcc tccgatcacg ggaatgtgat agtccatgtt    195120
     gttacggtta tcgtagtgag ctccttcgtg gtttccgttg gagaacacga aatccatcat    195180
     gtacgcgtcg gtagggatgt tcaactcaac ttccatgcgc ttttcgccct tgacaagaac    195240
     ctcagtcatg gggagtttga aagtcttttc gtgcgaccat ctgttccaac tccccacgat    195300
     aaacacgcgc tcagaccctt tgagcgacgt gttattggga ttatagaaca gcttcatgat    195360
     tttgcctgcc tccaactgac ccggctctgt gaaaagtaca tgctcttgct gcttgagcgt    195420
     caccgcttgc gccttcgcct ttgcctccgc tttcgcctta tctcgcttgt ccttcttgat    195480
     cttatcagcc ttctcttttg cgtgtcgagc agtcgtaatt tcttgaaatc gttgcaaaac    195540
     tgaactcatt cgcgcaatct cgagtttttg cgaagcgttg cgaaccggag cgtggaaatc    195600
     tgcgcggtcg gcgttgtcgt aaatggcacc gccgtcgcta aagacaaaat ccatcacagc    195660
     ggcagttgca ggcacatcga ccgtcgcgat gaatgtatca tcagcgccag tagacttttc    195720
     cattcgcact tgctcggcac cggtccagtc attcgagccg tagtgcataa caatggtatt    195780
     ttggccgtga agaactctgt tggtggggca atagcgcacc gtgacgggca taccgacgac    195840
     tggtaccgca ggttcaagac tccagaggtt ggcatcgctc ggtgtcgagc cgtccaagtg    195900
     tcgcgaaatc ccagaaaact tggctgatac ttcattcgtg gcgatttccc agtccttcgc    195960
     ggccatcggg atcgccgccg caagttcctt cgcctcgtca tacgcgactt gcagctcagc    196020
     ggataattcc tgttccatac ggagctcttc atcgagttcg atagtggaga ccgtgttctt    196080
     ttgacttttg gccagttctt cggccgcgag ggcttgaagc ttggcttcgg caagagcagc    196140
     agccttgacc ttggcttcgg cctctgccac ggcctttgcc ttagcctcca tctcagcagc    196200
     ggcggcagct tcagcttcgg cttgagcggc ggcagcttca gcttgagctt cggcttgagc    196260
     ggcagcagct tcggctttgg cttgagcggc ggcagcttca gcttgagctt cggcttgagc    196320
     ggcagcagct tgagcttcgg cttcggcttg agcggttgcg gcttgagctt cggcttcggc    196380
     ttgagcggcg gcagcttgag cttcggcttc ggcttgagcg gcagcagctt gagcttcggc    196440
     ttcggcttga gcggcggcag cttgagcttc ggcttcggct tgagcggcgg cagcttgagc    196500
     ttcggcttcg gcttgagcgg cggcagcttg agcttcggct tcggcttgag cggttgcggc    196560
     ttgagcggcg gcttctgtgt tgacggcgac gtcgatgata tcttcatcag tttcttcaac    196620
     ttgcacggtt cccatttcgc tagtctttgt cgtagacttg ctcaataaga aggctttctc    196680
     agctttctct gccgctcgaa gtctagcttc caatacttcg cgttcttgtc gcaacttttt    196740
     ctcttgcatg agaagctctt tgagagcggc gctcgcttca tcttttccgc tcgtcgcgcg    196800
     ctcttcaact tcagtaaact caacgggagc gggtggcgtc tccacaactt cggagacgac    196860
     gggctcgcat gctggcttct gcggatctcg tgccttcgct ctcgcctctg catctgctct    196920
     tatctttgcc atcttggcat ccacctgcgc tctcactctg gctcgcgtgt ctgctttcaa    196980
     cttctccaac gccgcggctt tctcctctgg tgttttggcg acaaatttcg gcgcagtttt    197040
     ctttgctttt gcgtcttctt ttgccttggc ttccgcgaga cgccgctcct cttcggcggc    197100
     ctcagccttg gcggctcttt tagcttccat cgccgcgcga gcttcgcttt cagcctcggc    197160
     ggcggcgcgc gcctcgagct ctcgttgctc aatcgccttt cgagccgcag ccttctctcg    197220
     cttctccctc aactgtctgt tctcctcctc gagcgctcga aacgccatca aagactgccg    197280
     ctccgcctcc agtcgccgca attcccgctc catctcagcc tcctcgtcgc cctccgccgc    197340
     gctcgcgctc ggcgccatga ccacctccat cttcttcggc accaccccct gcaccccccc    197400
     gaacgcctct cgcgcccgta tctcgctctt cagcgccgtt atctcccccc gcagcgcgcg    197460
     cacgtccgcc gctctcggcg cccccccgtc ctcgctcggc gccagcatcg ctcgcagcgt    197520
     cgtctccagc ccctccaacc gcgttcgcag ttcctccgtc gcgctccctc gcgcgtcgtc    197580
     cgtcaccgcg cgcgtcatcg cccgctcccg tcgcccgtcg tcgcgtcgtc gcgtccccgt    197640
     cgtcgcgcct tttcgcatcc atcgcgtttc cgtcgcgttc gcgcgcgttc gccccctcgc    197700
     gcgcgccgtc gcgacggcgt ccgcgcgcgt cgcgatcgcc gcgccgagcg ccatcgcgtc    197760
     gagcgtcgcg cgtcgcgcct tcgcgcgtcg tgcgtcgcgc gcgtcggcgt cgcgcgcgtc    197820
     tcgtctcgcc cgggtgtgtg gtgtggataa cgcggcgtcg cgcgatcgcg cggcgtcact    197880
     atacatgggc gttcgtacgg cgaatcgggc gtatagtaac atagcgccgc gtcgcgcgtc    197940
     gtgtcgtcag tatacatggg cgttcgtacg gcgaatcggg cgtatagtaa catagcgccg    198000
     cgtcgcgcgt cacatcgcgc gatggcgcgc gcgtcgcgcg cggagctcgc gcggcgcgcg    198060
     gtcgcgatcg ccgtcgcggt cgcgggcgtc gcgctcgcgg cgacgcgcgc gagcgacgac    198120
     gcgcgcgcga cggcgacggc gacggcgatc gcgacgccga cggcgctcga cgcgcgattt    198180
     ctgcgatgga tggacgcgcg cgcgctcgcg gcgacggacg acgcgcgagc gcgcgggatg    198240
     gtcgtcgcgc gcgtcgagga ttgggaagac gaacgcgcgg tgggcgcgag gcgaacgcgc    198300
     ggggcgtttg gcgcgcgggg agggaaaggg gaggtggaga cgaggatcgc gcgggacgcg    198360
     gcgctcgagc gcggggcgac gacggcgggc gcggggaagg atgagtgggc gctggcgatc    198420
     gaattgatgc gagagcgagc gaagggaggg gtgagcgcgt acgcgccgtt cgtggagtcg    198480
     ctgtacgaac acacgccggc gagggcggtg gagacgtcga gagcggcgcg cgcgcggttg    198540
     gagggacacg cggcggcgga gacgatgaga gagtacgaac gagacgcgga ggatggatgg    198600
     cgagcggcgc gaaggacgtt tgagacgttt ccatcgattt tttccgttca tgaattcacg    198660
     cgcgcggcgt tcgaggaggc gttggcgatc gttcgcgcga actctttcga ggcgaggagc    198720
     gaagacggga cgcgcgcgcg cgcgctcgtg ccgatggcgc atttgctttt gcacgacacc    198780
     gggagcgagg ttccgtgcgt gaagatcgta gacggtgtgt tcgtcataaa cgttgacgag    198840
     cacgaagagg gagacgagtt gtcgtgcagt cacggtgatt attccgacgc cgagacgttt    198900
     gcacgattcg gcgtgagcgc gttttattca gccgagaaga acgcgagaaa taagataaag    198960
     tttgcgtttc cgagcgaaat ttattccatg aaaagcttag atcgatgtgg atccgtcgaa    199020
     aatatcgcat tcacggacgc gggtgcgacg gaagagttta tgtgcgcctt gagactcgcc    199080
     tcggcgaatg aaaccgaatg ggccgcaatc tcaaagtcta aagccagcgt tcgagcgctt    199140
     cgtaagaaac cgctgagtga ggagagcgag atagcggttt acgaagcatt atttgccacg    199200
     ctcaccgagt tactgaactc ctacccatcg agcgataacg aagacgagcg attattacaa    199260
     agtcggacgc tgcagtcggc gcccgacgag gagcgcgcgg tgacgattcg tcttcgagag    199320
     aaacgtctcg cgctgagtag tttgaatgct gtccaatacg ccggtcgtca acaactcggc    199380
     ggtttgttgt tcgacaagca ttttgccgac gtgttaccgt ctcctgtcaa cgtgcggcag    199440
     acaaacggat gacgcgtgat cgagttgtgt ttgtagcata aagattgtat tgaaagaata    199500
     tttttactgt acagcttaat cgacatactc aggtactgag tttaggactt catcgagctc    199560
     ggttctaaac tcttccttgg ctctgttcgt tttaccgccg acgacgatgg cggtttcctc    199620
     ctgaatggcc catatttgcg aatgcgagag caagctgagg aacgacgtca ccatcagccc    199680
     ggcgaaccca gcgtatacga gtggaacccc tggatcagtt ttcaactcca agcccgtact    199740
     tcccttcacg tcaccgagca tgagcttgat tccatcgacg acgatcggtt tcttgctttc    199800
     aggacggcgg acgcccgcaa acgcgccctt gctgtcgtaa atcgccacgc tttggaaatc    199860
     ccgagcgacg agagaaatgc ctcgccgctg gtcatcgtcg aaacttaatg gtaaaaacgt    199920
     gccccatatt cggccctgaa accctccttt gccttctaaa gacgccatag gaaggacgta    199980
     tgtgttttca gtttctgtct cgccatctgc gccgggcttt gcgacagtga cttgcatgga    200040
     tgaaagcgcc caatccgttt gatacatcgt caccccgccc gctctcaatg gaacattcac    200100
     tgatatcgtc tttctagaca tttctttacc gttgggatcg accacgctca gatcggaata    200160
     aaattgcgac acctgcccgt tcggaaggta gtcaatcgtg aaatcgttca cctgaacgct    200220
     cgatttcgcg atgccaggca tggatgacag cagcgaaccg cgtgtcaaac cggaggcgat    200280
     ttcaaatgaa gatccatctg ggaccatcac cgatccactc agtcctccaa gaccgctgta    200340
     cgccgctccg ccgagggtga acaacaacgc cgcgtgcacg ccgatgggcg ctagtcgccc    200400
     tatcaatccc ttgaacgcat acattttctt ccctttgatg aagacttgat acccgcgatc    200460
     ggctaataaa tcgctgaaat cgctcagtct ggctcgagga acagattctg cctcttccat    200520
     ggcgagcaaa gtcgcgcgtc tatccaaaaa tttccatttg gctgaaactt tccaaacggg    200580
     ccactgcctc gtcaccgtgc acgccgtcaa cgacgcccct aagaggccta ataatcctaa    200640
     aaagtaccac gtcgtgtaaa tgtgatccaa tccaaggtcg agaatcaaag gaaagtctat    200700
     gaaaccaagg ctcttattct ccgtgggata gttttcgacg taccacgcaa acgacttgtt    200760
     ctgttcaatc accgtcccga gcgcagagaa tcccgcgatg acgagcaatt ctcctatcgc    200820
     gagtggcaac gacgagagtg atttcagcgt ctttttcccc atcgacggca gctcgcgctc    200880
     gaacagccat ttcgagaacg ccgcgtcgtc gccgtcgccg tcgccgtcgc cgcgtcccgg    200940
     tccgggcgac ggcgctccct tcgccgctcg ctccgtcgtt tccggccttc gcgcgttcgc    201000
     gagcgttcgc gcaccgcgtc tccgatcgac cgctcgtccg cggaccgcgg cgcggcgcgc    201060
     gggcgcgcgg tgcgcggcgt tgagcggcgg cgacgcgagt gcgcgacgac gcgcgcgcgc    201120
     ggcgacggcg acgacgacgg acgacgacga cgcgggcgac gcgtacgcgc gcatgttcac    201180
     gacgtcgacg ccgaggacgc tcgagctcgc tcgcggcgtc gcgcgtcgtc gtgtgcgcgt    201240
     cgtcgcgcgt cggtgtccac aaccctggcg cgcgcgccga ggcgaaacgc gggcgccgga    201300
     acgcgaatga aagaatgaga aatgaattcg atgaggagcg cgctaggaaa ctatgcatct    201360
     taatctatct aaaatctatc gccgcgctcg ctcgacgtgg gagcgagtgt gtggggtgtg    201420
     gtacatgcgc gcccaagcgg cgagggcctc gcgtcggaac ggcggtcggt ccaccgccgt    201480
     gtcgccgccg agcaagaacg tggccaaaca acgcgatcct tcgtcatcgt gacggccgcc    201540
     ccacactgca tcaatgccgg tgagtgcgaa aaaggcttct cctggaggcg gggcgccgtt    201600
     tgggggccag tcttctcccg accaatacga agaatcgcga ccggcgtctg gaaaaaattc    201660
     aaagccgcaa tgtgccccac agcgcgggca caagatcggt agccatgcgt atccttcgaa    201720
     ccaagaaaac tcaggatgtg gctcatcggt atccaggacg acatcggtgg ttcgatcgag    201780
     gagctcgtac ggactcgtcg accaaagctc gcgcaagctt tcattttcga cagtgctcaa    201840
     atcgacggcg ttgcgcgcaa agaccgcgta tctatcgtac caacctccgg gattgaaaaa    201900
     gattttactc ctgaccgcag tcggaacagt gtctcgcaac tcaacagaat cggtgcggaa    201960
     tccgtcgatg tttgaaaatt gccgcatcat tcgagtcgtc gtcaatacga agccgcatcg    202020
     atgcgtcacc ggaacgtgat ttggcggcat gacggcttcg agctgcaacc tgcttaaaat    202080
     caaagacaga cgagagtacg cgtcatcaat cgagaggacg agccagcgaa actgagtgtc    202140
     caaagcgatc gaaggtatgg catgaagaca ccaaaatgaa aattccgagg gatgtctggc    202200
     gccgacggga agcgactcct cgacgacttg acgcaatgcc tcttccttcc acgcgactgc    202260
     gtccgtgaac tcgcgtttgc tttcgctcag gtaatctaaa atttttccca tcaattttct    202320
     gctatcgtgc actcgattat cgcgcttgtg cacccccaga gtataaacgt tgatgccgct    202380
     cggcgcgaag acgtcgtcga gcgcgacggg tgggaacaac gacatgtcgt gcatgctgtt    202440
     gaaagcgttc tctcgcgcct ttgtcgtgtc gaaatcatcg ggaaactcgc accaaacgat    202500
     gtttaacgcg cggaactcca cgaagcaggg cgtccgatga atccattgac acagcgtccc    202560
     gacgcatcca aacgtcgccc ctctcgccgg ctcgtgcccc tcttcggtca caccggtcgc    202620
     attcgacgca tcgagcgcga acaccaccaa tcccgtcgag cgtcgccgga cggcaccgtc    202680
     atccccatca tcgagcgagc cgtctcgaaa cgcgtcctcg ggcgtcgtcg tctcgcgcgt    202740
     cccctccaac ccccaacctt gctcgacgcc atcgcgcgcg tacgccacca actctcgcgt    202800
     tcgtctcgcc gcgcttcgcc gtcgccacaa ccacgtcgcg ctctccgtcg gcgcctcgat    202860
     cctttctccc ggcactaatc ccgcgagcgc cgacgtcgcc tcgacgaacg cgcacggcgg    202920
     cgccgcgtcc atcttcgacc caccgcctcg gcgtccgcgg tcgtacctcc acgcgcgcgc    202980
     gcgcgcgctt tcgaccgctc tcccgtacgt ctcgaacgcc cgcttcgcgt cgatccatcg    203040
     tcgcgcggcg tcgccgttcg tctcgaacgc gtccaccgcg tcgtcgttcg cggcgacgcc    203100
     tcgaccgagc gcggcgacgt cggcgcgatc gcgcgcgccg tcgccgcgtc ccgtgcgcac    203160
     ggtgacgcgc gggtacgcgt cgtcgaagag gtccatgcgc ggcgccgcgc gacgacgacg    203220
     acgacgacgg cgacgcgcgg cgacgtgccg gtaacactat tcgttttcat cactccgcga    203280
     cgcacgacga cgggtgttgc gcgcgcgcga tgggcgcgcg cgcgcgatgg gcgcgcgcga    203340
     tggcggcggt gacgatggtg acgctcgcga cgtcgatcgc ggcggccgaa cgcgtcgaac    203400
     gggaggacgc ggtgcgaatg tattacgtca acgcgcgcgg tgcgacgacg aagcgattgg    203460
     agatggagcg cgcggtggtg gcgctggacg cgcgcgcgcg aaggatcgag cgcgtggacg    203520
     cgaagagacg atcgacgctg ctgatgacgt acgaaacggc gacgtgtgga cgcggaagat    203580
     tcgcgccgag cgcgcacgcg gagcgacgag aacgattcgg cgaggagtac ttgaacgcgc    203640
     tggggacgtc gctgtcgcac ctggaggcgg tgtacgcggc gtacgacgac ggggcgagcg    203700
     ttgcgttgat catggaggac gatgcgcgat gggacttgct gccgacgtgg tcgagcgatt    203760
     tggagaaatt cgtggagcgg ttgccggaag actggaccgt gacgcagttg tcggcgctcg    203820
     gcgattacgc cgagacgacg aaattgtttt acgattggca gcgcgagcga aagaatgcgc    203880
     cgggacagag tttgacgaca ttacccaaag gttcgcggcg tttgagcggt acgcaggcgt    203940
     atctgatcag tcgtaagggg atgagtagat tagtgaaggc gtatcgatcg cctgctggaa    204000
     aaacggatgt gtgttcaatg acgtgcgtgg agctcgagga gtgcgtcttg gccgacggtg    204060
     tgcacttgga tgagaagtat agagtcgcca cgccgccact atttgtcgaa cgctccccaa    204120
     gcagcgactt tctcgattcg tcgcgaaata tgattctcag ctgggccgtc tcgctgtcgc    204180
     tgactcaagg caaggcggca aatttgcgca tggacggaga tatgattcgc gatgttttgg    204240
     cggaaggctt gaaagttccc gaacacttga agcccaacac gttcatggag catttcaatt    204300
     accattgcaa gctcaatcac ggcggtggtt caaagtgttc gatcaaaaag gcgtacttgg    204360
     tcaaccaaaa gccgccacgg atggaagagc cagctctggc cgaagaagcg cccgtagacg    204420
     ccgaagaaaa tttccgaggt cacaatgcat ccgcattagg tcgcgtggtg atgtctcgtc    204480
     gagatctcgc tccgaaagaa acgagtatct ggtccgagta ttccaaatcg acgcccttca    204540
     tttcgatgtt cgtcttcggc gcgttgacga cgtttgtgct cgcggcgagc ttcgtgttcg    204600
     ccaaaacacg ccccgagtcg tccagggacg agttacagac cattctccct atagatccgc    204660
     aaactgagga gtattattcc taataataaa tctttgttgt attaaagaca cctagctata    204720
     gctctattcg tccgactctg gcggttgcat tcgtttcgcg tttataatct tgtccttcag    204780
     ctcggtgtag tccccggtga aatcgaaaat caacccgaga ttgtccacaa tctgatgcca    204840
     cacctcgcac tcaccacact gcacccacat cgtcccccgt tcgaggacct cagggttgat    204900
     catccgcatc gttcgcccct cgcacttgtt acacgtaaac gtcatctgca cgcgccgtcg    204960
     cgttcgcggc agctgcacgc tcgctcgccc ctcttcttcg ccctcgtcat cgcttgacga    205020
     tgtaccaccg tcacccaaga cgttgacgcg cgccaccgat cgcgcgcgcg cgagcgggac    205080
     gtcgtcgcga cgtcgcgcga agagtcgcgt cgagagcgac ggcgcgcgcg cgaggacgac    205140
     cgaggcggcc cgagagcgac gcgcgacgcg cgaggacgag ggcgtgcatg cggatgttgt    205200
     gctgcgctcg cgcgcacgcg cgaacggcga cacgcgcccc ggtcgggcga gggtgagggc    205260
     gaaggacatg acgcgccgcg cgcgctgcgt tgtgacgacg agctcactca gatgtgattg    205320
     atcgttctgg tcgcatatga attacataac tcgctataca ttcggaacat caatcactgc    205380
     tagcaatcgt aatgactaaa tccgtcgtcg ttctccaagc gcgtcatcgt cgcgcgcgtc    205440
     gtcgcttgcg cgagcttacg cgagggaggc gaggagggcg ctggcggtct cttggacatc    205500
     agcaagaagc gcggtggcgg cttcttggtc cttttggcgg atggagaagt cgaggttttc    205560
     gagcttcttg tagaaggcct tggcttgcgc ggcgtccgca cccttgattt cgacgaggtt    205620
     gttgatgtcg aagcggaggg taccgacttg gcggcgaagc tcgttggacg cttgggtcca    205680
     gtacttcttg ccgacgtact caccaacatc cttgttgatg cgagtctata aatcgtaagt    205740
     ggcacattgc atcgtcagtc tctcattcgt cgtcctcgtc acgttcgtcg tcgtcattcg    205800
     ccgcgtttcg cgtcgagcgc cgcacgcacc acagactccg tcgcgcgcgc cgcggtttcc    205860
     ttttgcgaaa gcttttggaa agagaagcgg gacgggccat cggatcgcgg cttttggtcc    205920
     aattccaagt cacgagcctt cgcgcgcacg aaatttgtca acagtcagtc tcgagctctc    205980
     gcgcgcgttc gctcgcctca accaccctcc actcgcccga tcgatcgatc cgggcggatt    206040
     cgagcgaatc tcgcgagatt cgagggcgcg acgcgatttt acgcgtaaat agcgcttcga    206100
     gagcgttgaa tacggtattc gaccccccga atgggttttc cacgctcgca tcgatcgacg    206160
     cgaccggccc gggttcgacc ggtcgtccag gttcgacgca cctcgtagat gagctgcaac    206220
     ccggtttggt tctccacgcg cttgtccgtg agctcgatgc ccgtcgccgc gaacgcggcc    206280
     ggggtcgcgc tcaagacgac cgccgtgacg gcggcgaggg acacagcctg tgcgcgcgcg    206340
     ataaaatcca gcacacgcgc gatcgcgagt tcgcacgcga cgcgcgctcg agcgtcggac    206400
     gacgcgcgcg cgcgcgggat gacgatcgat cgcgaatgcg atagcgatcc acgccccgcg    206460
     cgaatgtgcg cgcgcgtcga cgtcgagcgc gcgtcggtgg acgcgatcgc gcgtttacgg    206520
     agcggggcga ttcggtcagt cgaaattcat tcgatcgttc gcgcgcgtcc cgggcgtcga    206580
     aagcgcgtcg gacgcgtcga cgcgtgcgcg atagaatcgc atcatcacca tcgttcgcgc    206640
     tcgtatcaac catcgatcgc tcgatcgcgg gtccgtacct tgttcgccga ggccttgacg    206700
     accgtgttcg ccttgacgga cttcgaggtg gtgatctttt gggcgatggc cttaccggtg    206760
     aaggcggacg tggacgcggc gacagacatg gtcgaacgtt cgtgtgcgat gcgaagtgcg    206820
     ggtcgcgccg ggcgcgcgcg ggatcggatc gaggtcgcgg cggactcgag gtcgctcggg    206880
     gggggggggt cggcgcgagt caggattcga cgtgtagggt tttcgacacg aatgtcacaa    206940
     cattaggcgc gacgcgcacg attatacggg cgtaccgccc cgatctcgat ctcgatctcg    207000
     atctcgatct cgatctcgat ccgcggactc gcgcgtgaag ccgtctcgac cgttctcgtt    207060
     tgggcaatac tttgccacgc cgtcgtccga gatgggcacg acagattgtt cgccggcgtc    207120
     gtaactgatc gacggcgacc acacgagctg gatggtttcg ccgacgttct cgaaggagtg    207180
     aatccaaccg cacggcatga ataaaatgtc gcccgcctcg acgacggcgc cgaagccgcg    207240
     cgaacgcgcg attttgggtt gtttgtccaa gtcgacgttg aaggcgttcc ccagatagac    207300
     gggattgtac aactcttcac cgccgacgcg cgcggagagc gggtagaggt tttcctcatc    207360
     ggcgcgatcc cagacgacgg cgcgtttcga gccttgaacc actaaaacca tcacgtgagc    207420
     cggtttggcg tgatgatgcg cgtgatacgc tcgaacgcca tcgccactgg cgaagagcat    207480
     aaactttttg aactccgtag gtcgctcgcg aaagagtatc ttggagatat acgaccagtc    207540
     tccgcgcaat ttcgtttcga cagctgcttt gacgcgttcg gcgagtgccg gacattgttc    207600
     aataatgtgc cacgagtgta cgctcggtgg ccataaatta tccgctgggt gtaaaaagtc    207660
     cacgccgcgt tttctggcta ttttggattc ccccatcaac tcactatcga aaaaatctct    207720
     cagtgtttta atctttcctt tgccttcgag aaaatccaac gtttcattca gcgtcaaacc    207780
     tcgtgtcgtt tcgagacgtt cggaaagatc tcgcaaaagt ttttgatgcg tcgttttcgt    207840
     catagactgg aacaatggca ctattttcga ccccaagtcg gcgaatgcat cgccgcataa    207900
     atctaaaatg agctctcgcg tcacgacgct tcgtagcaca gttgcaaggt tagcgttttc    207960
     gatcaccact ggttgccctt ccttgacgta tttccgctcg aacgcgtcaa ttgatagtgt    208020
     agatgcgtca acgcgctcga tgttgttcca ctgaaaactc ggatcgctcg acgacagcag    208080
     cagcggtata tcatcatgtt gcggcgcctc gaccgtcggc gcgcgtttgt ttcgttgatg    208140
     atcctcaact ctttcgccac gaccgaggtt ggcttgatca tcttgaattc gaactaaaga    208200
     ctctaggaaa gacgtaacac tttgggcatc gttcggtccg atgaaactct gtgcgatcgc    208260
     attcaactcc ttatgatttc gcacatacgg cccaaagtgt gacgttttca tctcgcgtct    208320
     ggcttttagt gactcttcca cgggccacgg acaatttaat ggatcgcaac acggcgcatt    208380
     aatgtcatac tgactttctg cttgaagcaa agtagtctta agcgcaccct caaagccgta    208440
     acgattcaat aaagtcgcgc gatctttcag aaaggcgaca tcttcttcgg cgatgctgta    208500
     cttttccatc aactcctcta ttgttgcgtc agtgacttcc gccaaaaacg cgctaaacgt    208560
     ggaaggaaac gtgcggtgaa tggcaccccc ctccacccaa catctgtaat ctaagatagc    208620
     tccgatagtc ggtgaccagt ttccgttttc aagctccacg atgcacgccg gtttagtttc    208680
     gttggcagac tttgcgtggc acctttccat ccacggcaaa gttttttctt tctcatagat    208740
     cacataacct gcaacatagt gccagtgatg gcgcgtcccg ggaatgctca ctgtgctggt    208800
     ttcgtcctca cgtttcaaca tgtcctcgtt gtctatcagc atcaacgacc ctttggcttc    208860
     gtcgatgaag atgttgaata tatttctgtc gtggttacca aggaggaagt ccatcagagt    208920
     catccctatg acgtcctctc gcttaagtcg cgatacaacg agaaaaagtt ctttcgtcat    208980
     catgttctgg cctggtctgg caccattgat atcagttggc gcgattccct ttgcccagtc    209040
     tgtgacgaga acgtgagtgt tttgctttcc accaagagaa cgtgtgtcgc gtggcgtgaa    209100
     aaacttcaaa gtctttgcct ccgtaggcga cacaagtcgc ccgaacccca ttgtttcgat    209160
     caatcgatgg atggctgata tcctttccgg ggatcgatca cgctgactgt ggaaaccgcc    209220
     acacgtttcg tcaaccggcg tcgcgtttgc gtgttgacga aattgtccac gaataccgca    209280
     ccaagccttg acgctcacct ttttcccttc gctcgtaact cctcgcaaca ccattgcctc    209340
     agatttgccg acatacctcc ctggatttcc cgcgtcgatg cgctcaactt tgacgtcgca    209400
     gtcgcagcgc tcgcaccacc cacgcgagtc gacgacgtcg tcttcgccca gctcggaatg    209460
     aggcacgcat gtggagcaag acgaacacgt ctcaaagctc gcgcgtgtac gcttgtgatt    209520
     tgtgtctgcc ccgcgttcat cgtcactatc tttccgcacg tcggcgtcgg cgtaatcagc    209580
     gtcagcgaca ccatcggcga gtttcagcgc tctaacagca atcgtctcgc gacgcggcga    209640
     cgtcctcgtg agtgcgacgg tgagcacgca cacgaacgcg atagaataac acggtggttt    209700
     ccaccgcgcg ggccttcgac gcctcttcgt ggcgtgatgc cacatcggag gcgcggagtg    209760
     acgtcgggac ggcgacaagc gagaaggcgt cgtagaacgc atgggaacta aagcgacgcg    209820
     tgcgtaacga atgcgctgct tcaatcacga taagtctatc tattgattat tgcttaatac    209880
     tattttgggg attcccgcga gttcgtggag tgcgcggtga gatggcgctc gtccaaggcg    209940
     attaaacgtt cgccgcgtcg gtgtgttcga gctttccagc gctcacgtaa atcttgcaac    210000
     tgtgagctca aagcgccgtg ttgctggcga atagtaatcg tagagtcagc cttgatcgtt    210060
     tcaagtaaat cgtcgtcggc gaaaggaaga cgttgaccag tcatgcttcg aagttggatg    210120
     cgttcgcttt cctttgccat tttctcttga tgaatgatct cttcgtctct cttggcgtcg    210180
     aattcgtcga caatcgcctc ttcaaattcc aagtcgcgaa tagcgcgctt gatgaggcct    210240
     tcttcgccct cttcgcggaa ctggcgaacc aacgttcggg caaaatcata ccatgcccat    210300
     gcgtgcagga tgaacaacaa ggccgtgatg agatcgacaa aagtcgagcc ttgtccacct    210360
     tgttcgcctg attgtttgaa aatcagtccg ccggtgaatg ttgccatagt agcaagtaag    210420
     ccatgtgtct cgatctttgc gtacttttcg ccggcatacg gttttgcgac gatgtggaat    210480
     acaaagaaaa gttgcaacat acaattcacc gtgtatccac caatgactgc acttcgtcta    210540
     gatacgatca ctatgaagat caggatgaat tttctcgcga atatgaccca ttcccaccac    210600
     cacgcggact tgacattgat tcccttgaag agcaaaccga gacgatattg caccattgct    210660
     gaatcgtgct cgccgacaat gtcttctccg cgagcgagct gcagcaaacc gtatggaata    210720
     ccgacgatat acagtatagc ccaaacgatg accataaaca agtaaagtga gtaggcggtg    210780
     ccccggcatt ggaccgaata gtcggataca aagtgtcgat cgctgtcgcc agacgtacca    210840
     gtgcactgcg tgaactcagc caaatattga acaagggtgg gatagagaag ccacagagtc    210900
     gcgacgagcc atgatattac tatgtcgtaa gctctgatgt ttcgcacttc ttcaagaccg    210960
     acatcgtgct tgttcacttt attcgtgtta ccactatcga tggcgtttgt ttcttcatct    211020
     tcagcagaat catttgcctt tgtcttcttc gtggcttcca ctctagcttg ggccgttgcc    211080
     tctctcaact cttcgacgta cttgataacc gtgaagatga tgaacaagaa tatcatcaag    211140
     cctagtggga gcaactcgtg aaacagtaga tttccgtaaa acttccagcc aatggcgcac    211200
     tttgctgacg ccgaccgtat gtcaggtaac gaaagcttct cggcgataag taagaatgct    211260
     ttcatcgaat ccggccatgc gaggtctaaa tttttcgcca acgctgtcat ttgtaaatag    211320
     gtgacaaacg attttatcat gccgacgact tgtgaacttc ggcgttgatt gacaacccga    211380
     atgagccaca ccagcaacaa tatccagaga aagttgacga cgacgatcgg aaagttgagc    211440
     actcgatatg ctcctgccga acaatcgtaa cattttggtg gatatgcttc tcgaatggcg    211500
     tggtacgcat aaccattcgc acaagctgcg cacatagcac cagtgtaccc tgcatcaaga    211560
     catgtgctgt ttacgccgcc taggcacgcg tcagggtacg gacacgcgcg aaatttcagc    211620
     gtttgtcggt caaatctact gaaaccagga agcgcttcga cattttcgag ctcatcaccg    211680
     taacattttg cacctttcgg gcatgccata catttgtaat catcgagtgg gagttgtcga    211740
     taatagctct cgaatgggac actcgtttga gagatgcagt ggcaggaact cttgctcacg    211800
     tgaccaaggg cgcctaaaag ttgcactcct gactgtgctt gatatgtttg cctcaatctg    211860
     ccgtcaactc gcgaagtatc catggagatt gggcacgacg tgcatgctcc gtcaccgtgc    211920
     gccactttgt agaagccatt cttgcacggc acacacatgc catacgggtg aagagcatcg    211980
     agccatcgag atgacccaga tgtagctgtc ttatatagag ttatattcgt ttcgacataa    212040
     atggtatcga tatcttcagt atatcccgtg cctccactaa tgtcggcggt gaagccagga    212100
     atgcactcgc acacgccaga gcgaagcacg ctgttcggtt tgactgttga gcaattcatg    212160
     accgtcgttg gagttgaagg tacgatactc acattcaacg ttgaagccga aaaattcagc    212220
     tcataggcat tcgcgcgctc accgatgatt gtgattgaat cgaatttcgc caagccgttc    212280
     accatcgccg cctctgtccc tgaaatgctc gccacagcgg gcgatacact gaccgtaagc    212340
     gtcgtattga tatcgacgca cacgtttcct acagaatcga tcgccgcgat gactggtgca    212400
     ggcgaaagtg cgaagtcatt ttcgtttatg aagggaggtg ccgtgacgac ggccaacgct    212460
     gtcggcgcgc cagggactac ggtgaactcc aacatgtcag tctccagcac aggatagagc    212520
     gcaccaggac atcgacttga gccacatgat gaagcgaatc gcaagcgata ggtcccagct    212580
     aatgcatttt gaatatgcag accgacatta tagtgtgtgt cgggcgcaat accactatac    212640
     ccagcctccc tgcaatatga tggtgcgggg ttggtgtaca ccactctgta cgtgtaagca    212700
     ccagtcgtgg gattactgga gaccacagtc ctcgggctag agtcaagtga atctttgcac    212760
     catcccactc caccatttac tgcgagaaga gatccatccc attcggcttg caaggttggt    212820
     agcacacttg cccgtggttg atcctccgct ggcacgaaag aaaatagctc aaccgtgatg    212880
     ttacgcgctt cggtgtccca catcgagccc acatgataac cgccaggatc agtcatttgc    212940
     acgacaaagt cacgaagatc cagggtttgc gctgcgatat attgtgcagg atcccgacac    213000
     aaacctcggt cgacacgtgt gaacgagtta ccggtgcacg tgtcaagcgc cgctgggtac    213060
     ccagcgctgt aagtcagttg tgtggagacc gaatcgagac ccgctgtaga aaacgtcaat    213120
     gagtacgttc cggtgcacgg tcgatagaat acgatatcat caaacaccgc tgtgcccgca    213180
     acgatagtct gaggtgtgta tgatacattc gtctcaaagt tgcaagcgct cacgaccacg    213240
     cgctccgcct ttacagaaac ttcgtaattt aggttgagcg cattcaagcc tgcatcgacc    213300
     acacgaatct gaatcatact caattttact ttttttgccg tggaatacgc agtctgcaac    213360
     gcgattgctg caccgctggc aggtgacgtg aaagtctgaa caattaatcc accattaata    213420
     ttttgcatga aaaagaaaaa ataagtaagc cttaccggtg agatgaaaag cgcacttgca    213480
     gtgccaatcg taatcgtaaa tgtacgagtc gcgggcgcaa cgctgagccc taacgcggta    213540
     caattgtcgc agttgaaaga aatcacataa tccccgatct gtaattaatt gtgtgtgagg    213600
     atgaaagttc taatgaaatc tgtcatcaat gggagcgtac ctctggggca ttgatcactg    213660
     tgtcacgaag tagtgtactg tcggttcccg ccgctatgac gccatttctc ccgctcgtcg    213720
     caaacgtatg cctacatttt gaataaaatt aattaattcc ggttatgaat taattagaat    213780
     cgaaacgtac ctttgaccca cgatactggc gataatactg tactcgtgag tgttaagcga    213840
     cccgaaacga ttacctgcgt catctgcgat cgcaatttcg aaagggccga gggttgttga    213900
     tgccgtcgcc gggtatgatc cttgtggtga atttgccacg accagtttag ctggatctcc    213960
     taacgccact gttaccgcat aagtcgcaac ggccttgccg ttgagataaa atacgatatc    214020
     gtgctgctgc gcagtcggcg cgagcagcac gaggttctta aactcaacga cgccgggtgt    214080
     gccgccctgt gtatttaaat aagttaatta attgttctcc gtgaaataaa taattcatcg    214140
     cgttcgagca tagttgactc acctgagttg cacacgtcgt agtgctacca cacgatatcg    214200
     caaaagtttc ccctcctatc aagggattaa ttccctgtgg ataagccgcc aattcggcgg    214260
     tttggcagac aacaaatatt tgtgccccgg tcggcgaagc cgaaataaaa ttccctccgc    214320
     catcgtaaag tcgcccaact agaggactag aagcgttcgc aatcgatgtt tctagcttag    214380
     atttgaatgt tccactacct tgtgtttcgt cgaggatcaa ttgtgccgca tttcccaaag    214440
     tcacggaaaa gtagtactgt gcacccagca gacccggcga gtggatgtcg acggcgtacg    214500
     taccgatgta cggcttggcg atgtgtagtc catcaaaata gcttccacca gactcagtgt    214560
     tggcttcaaa agtcgccact gatgtacatg atactccatg cagtgtcgac gatgtactgg    214620
     caagcccagc acattcgcat gcgttgcctt caccagttct tctgcacaag gtgacatttt    214680
     gcggcgataa gtgcacacgt ctgctaggac atgtctcgca agctttcgtt tcaagatcat    214740
     cgacgggatt gaaagctccg tcgagaatag tcaccacgac tgggtacatt gcaacgtccg    214800
     acgcggcgcg atattgatga caagtgcagt tgacattagt ttggcacgct ccgtcgactg    214860
     tggcgcagta cggcagtaag ccgaggtgat tggatcgccc tgccgtgatc tctaaatcca    214920
     cgcttgcaga cctcaaactc gaatcggacg acacgaaagt caaattgtac gttcctttct    214980
     gcggcttgac gagatgcaaa cctgagaacg tcgcagtccc agcgctcgaa gtggtttcca    215040
     caagagagcc ggtcctcggg tacagtgaag tatctgtgta tacagtaagt accgacgttc    215100
     ttgcgattgt tgtcgcattt gcaccgagta tgaacggatg aatttcgacg tttgtgtcat    215160
     tcatcatcgc cgtcaacgta actccgttcg gcaaagtccc cgtcggcgac tcatttcccg    215220
     ccccatccac cggtacgacg acgaagtcat ccagaggcac agagtgcccg gctgagtatg    215280
     ctgttgcctc ggatagttgg atgctttcag tgaatgatgg tgaaaattct aagactttgg    215340
     ggctggtgac cttgaatccg ctcacggctc caatcaaaac gctcaccgtg agaactgtac    215400
     tttgtagctt tcccacgcgc aactcgccac tcacttcagc gccagtctca atgacattaa    215460
     gggtgtgcgt accgactttc ggtgaatttg caatcaaacc cgtgaaagaa acttgaccgt    215520
     tgccattcgt gaacatcgca gtcgttccag aaagtttcaa agtttcgcaa gtcacttgaa    215580
     tggtacgatt tggcgctact gcatccgtgg ttgagtgacg atccgcggtt cccattgaat    215640
     tgccgagcat atcttgaacg tataccgtga acgaacccaa tcctacagat tgatcagctg    215700
     ttaccgatga taatatcgat tgactcgaag ctagttcata tccagcatct ccagctagca    215760
     cattcaccac ttggagaacg ggtgttaaat cgccagacga gaatgtcaat ccgaactccc    215820
     cgacgacagg tccgactact ttgagatcag aaaatcgcca tacaccgctg tcgtctcgtt    215880
     ttacttgcaa agtaccatcc aaagtgatac cagccgatgc atgtacggtc acagtacgcg    215940
     gcgtaatttc cgccgcaccg acaaagttat tccccccgtc gtatgcgcca atgataattt    216000
     cacctacgga ttgcttgggt gcctcggcgt aaactgttct cttactatac gtcccattta    216060
     tacgaaggta agacggttcg ccgatctcca tttgcataat tgaatgcgcg cgatatcgaa    216120
     ctccattcaa cgtcgtcgta aactgaacaa tgtactttga agcctcgcca aagtctcctc    216180
     gtgtggcatc gctatacgtg atatcgtccg tggatcctac agctcgtgaa ccagaaggtg    216240
     gcatagcgac aagtctgaga tctgaaaatg atactcgacc atcattagtc gtcttgttca    216300
     gcgttccagt gagctgggct ccgatacttc tctctctgta gtcttcgttg ctgttgagtg    216360
     tacccgtcac gagtgacgct tgtacggtga cgtcatcaag agatagcgtc tgaagcatac    216420
     ttccaccgat gtcaacgatg tcgactgtca aatgtccgat cgatacgttt cgggccgcgt    216480
     cgagcacgac gacatctgtt ggaaataacg tagcacttga tatcatagaa ttctccgtcg    216540
     ccgcgccggg tgtcaccttc aaaccaccgc tcgaacctgg tgttacggat aaataggcgt    216600
     gtgcaagtac accaaggtca tcactacatg caccatcatc attggtacaa tcggttgcgg    216660
     taaaagtgat cacgtattcc ccagcggttg gtatcgagga tagctgtgga gtgaatgttg    216720
     cgatgccgtc cgaagtctgc actgatgacg ttgcctcggt gatagcgacc tctgacggcc    216780
     cagaaatact cgccgaaatt gtgtaacctt tcgtacctcc ttgaccacgg tcatagttga    216840
     tttcagttcc atcgatatcc acaagtccaa ccttgaacgt tccaagtgag aaatctgtcg    216900
     cggcaactcg agcttgatgc gaatccggtc cactcaagag cttaactcca actggtggtc    216960
     catgaagctt caaaatccct ccactaacgt aatcaatacc gttcagtgca actgcgacct    217020
     gcgcatcttg cggttgtccg ttcgtaagcc atggaagcgg actcccaact ggattggcgc    217080
     accttccatt gactacattg cacacaggac acttgatttc tgacgaacta acgaacaccg    217140
     cactggtcac actcgtcgtg ttatcgttga acttacattt taaatcgggc gaattcagaa    217200
     acggacctcc gagtatgcga agcagtactg gcgcgagatc ggcatcctcg cctgtgagaa    217260
     gaaccttggc gtcatctgaa ccaatctttg tactaattat gacggctgga tcgtgataac    217320
     gtagatatat ctgaccagag ttccacagcg agttggtcca aatgcttgtt ggatcgctcg    217380
     aatcggttgg taatccatcg aacgatattt ggacttcgct ataacctata gtggaggagt    217440
     ttgaatttga cgccgacggt gccatgcatg agagctctgt cgccgaaaca taagttgctg    217500
     gcgaccaaga tgtcttcgaa aacccattat tagcgtcata agtgtgtcca aacctacatg    217560
     aaatcgaatg actcattcca ctggcaaggg taggcgaata aaagccagat ccatgaattt    217620
     ttatcggcgt tccagacgtg agcgcgctga tgtgagtcgg ctcgatcccc gaaacgatca    217680
     ccgtggagta ctttgtgtac gtcgtactcg ccgcagaact caccgcgaac acgctgcgct    217740
     cgcccggtac ggcgctgatg ccaccgatgg tgtggctttc ttcaaatgtc cccacacgct    217800
     tgaaacaacc gcttatacaa gcactagacg tgtccgtacc ccctatttcg atcttgacga    217860
     tccgactctt accgctttca cgcgatccca cggcccagta catgaaatct ttttctcctg    217920
     ccgtcgctcc ggtttgaacg gtagcgctca gagcatcacg ctctccgagc gctgcgtcaa    217980
     gagcaatcac ggcgagtgga ctatcgcctt cagcaaaatt caagtcaaac atgaagatgc    218040
     atgccgcgcg atttttacac cccggacagt cgccgtctcg acctgaagtg cccacgtatc    218100
     catagccgtt gtgctttgtg atcgcagtaa acgtcgaaaa gcgtccttgc tttgaatcga    218160
     gctgcccttc gcacgcctcg agcaccttga cgtttgttga gtccaaatac atttcaaccc    218220
     catcgccgtc acgagtccct gagtttgtat tcaccttgaa caaagtagga taaaaggttt    218280
     tgccatcgga gtcatccaag agggcagatc cagcgaagat gacatagttg acacctgttt    218340
     gagtatgcgc cacactcgtc tccaacctca tggcgtccgg ggcaagcgaa catgtggggc    218400
     atttagtgct cagtaaaccc ggagctaaga agtttattcc tttatcgttc aaactgccgt    218460
     cgacgtgacc aatgacgctt cgcgacagac cgtcttcgtg cgtggccttg tacactatca    218520
     tgccgttggc tgggtctgtg cccatggcat ccaaaatgta ctgctctttt gagaaagtcg    218580
     cactcgcctg accatttgtc aatgaactga gaacgcagtt cgcccactgc gatgaatctg    218640
     atgagcatgt agtaccgaca tacttgaaaa gcgaaaatct aaactgattt gccgtggtct    218700
     gatgccacat gttcactggc acgacgacgc ccgtcagcgc tgtcgacaaa tcggcagcca    218760
     ttttagcgta cactccgtac caaccgcgcg acttctgagg atccacatgt ccatatgctc    218820
     tcggatgctt cgctgcgcac ccgctcgaga tcccaatacc gcaaaaattt ggcaaaggtg    218880
     ttatcgacaa tggcaccgcg cccgttgtct ctcgtctcgg tccgttcgtt tgtccccaac    218940
     ctctcgccgt cactgcgttt gaggtaaaag tctccggata cctcggatcg acttcgatca    219000
     ctcgcgttcc attagcatct tgcgcgtaga cgtaaattac gttctttcgc gtgtctacca    219060
     tgacgtcttc gacgtacttt tcgtcgtacg ccgtcccggc ggtgtcgtac tcgtaccccg    219120
     ccgtcccatc caagcgcgac tctttcacca ccgatggcgt gggaacatcg cacgcaagtc    219180
     ctgcccatcc tgcctcgcac gcgcacacgc cgtctaagcc gcatcgcccc tgtccagcgc    219240
     tcgccgagca cccgcgctcg caacgattga acgtcaagcc ttgacatgag tgcgccaacg    219300
     acgcgatgac gacgacgagc gcgacggtga cgagcgctct gaaccctcgg cgcgagcttg    219360
     tacgaccgtt accacccatc gtcgcgcggc gagcggcgct tgaagtcgcg cgttcccgca    219420
     cgctcacccc gcgtcccgcg cgatggccgc ggcttccgac ttcacgagac gatgcgacgc    219480
     gcgctcgagc gcgtcgtcgg cgcgagcggc atggacgacg aagcgaatga gcgctgagac    219540
     gaagtttgtg tgttatacac gcaccgctcg gcgtcgacgc ggtggagtga cgcggcgacg    219600
     cgttgacgcg agactcgacc accaacgact ccaagcgacg aatggaatcg tcgcggccgc    219660
     ctcggcgacg cggtcgttgg ttcgtttgtg agtttatttt cgtttcaacg agtttttacg    219720
     ctttgaagag taataatgga ctattatttt agatattgaa aaaggaaagt tgcaaacccc    219780
     aagtcatgtc gcgaatcgcc cgtctcggcg cccaaaggcg ctttgagacg acgaggtcga    219840
     agacgctaaa cgtgcgattt tgagacgacc gctcgatcgc gtgcgacgaa tttgagtgaa    219900
     actttgaaat aatttgaaat tcacgcctca agtgacgctt gagagaggtt tctatacatt    219960
     tccagagatt taacgggatg gtacagcgcg tcgcggcgaa tcggcgcaag tctgggtacc    220020
     gcgtcaaagt caaaggccgg acgccagcgc atgtaagcta cgtcgggacc caaatcacgg    220080
     aacgagaatg tgtcggaatt caccgtgagg aaagttggta ggaatgcctc gtgatgtccg    220140
     ctgcttctgg tagaagtgga gaggtgcgcc accgcggcgg cggcaaagtt tcgcgagatc    220200
     cgaaacgcgg gcaacaaggc actttgcttg caccaattcg gaaggcctcg acagtacgtg    220260
     caagatggcc agtgattcca tgccgtcttg tttgagtacc gaaatgttgt gttgaaagcg    220320
     atgagatcac tcgaatctga ttcgtatttc tcaaaaagcg tttgccacga gccggtgaaa    220380
     accacgtcgg gctcgatgat ccagccgaag tcgatccacg cttgatctgg ctgcgtgagc    220440
     catctcaagg ctcttggctt cactgaagca ccgtatattc ctgagaacaa ctcgaacgaa    220500
     tgacttccgt aacgcaatcg ttccacctcc cgagaggctt gcacgactgt cgcgtcgtcg    220560
     gcagttgacg tgttgaacca agggcgaaac ttgccttcat aaaccaacac ttgggcagag    220620
     attcgtgcag agcgagtgtt cgagaaaacc gtgtcgcgag cgaggcggtg cagatcgtct    220680
     agtttcctgt cgttaccaac cgtcagaatt acgactgtgt gtacgctact ttttgtttct    220740
     ggaagggggt agagaaaggc gaagagaaac gaaccacaca cgagcacaag gagcagccaa    220800
     cgcttagtca gttcacgagc ccggcgcttg cgcatctaaa cgcacagatt caataatcga    220860
     cgcggagttt tttgtttaca tcagcgtgcg cgcgcagagg tgccgtttta gaagtgccga    220920
     ggctcgaggg cgcgtcgcgt cgcgtcgcgt cgtatcgcgt cgtgtaccgc gcattctacg    220980
     ttttctattt cacacattcc cttctaagtt atcttaatcg agcgccaatg gaatatcccc    221040
     ttcttgcaac aatcttccaa tctgtgccat ccgatccctg tttgccttct tctccgtggc    221100
     catatctaag agtaagcttc gcatctcgtg ctcgacgtcg tcgactcgct cgtacgcttc    221160
     gcgcacgatg gcatcgcttt cctctctgat ggcgattgcc cgcgtctcat acatactggc    221220
     cttatccctc gcgatcgcca gttgttcact cagctcctcc aattggtgct gcaattcttt    221280
     actcttcgct ttttcgatac tatcactcgt ctccagagtc tgcgtcaacc gcttgatctg    221340
     ggattccatg tgaacaatta tgcggtcgcg ttcagccacg gcattatttg ctttgctgat    221400
     cgcgtgctca tacgatgcgt gatcgacctc ggagtccgcg agagcatttt ctagctctgt    221460
     gatgttcatt tccatcgact ctacctgttg gaccaaagat cgacactctt ccgacatcgc    221520
     attcatcctt gcttccgcct ccaccattct cgcgtcgtgc gtcctcaacg attccgcttt    221580
     ttgttcgcgt aatcgaacag cttcatcctt cagagactta atgagctgat tctggtgctg    221640
     aagcatatcg ttcttgatct ttgtgctctc atctgctgat tcgagcttca attgaagagc    221700
     ctcgacgtcc cggatgagtc gctcggcgag ctcttctcgc tcgcgagcct tctcttctcg    221760
     cgccgcggcg gacctctcag ccttcaacgc cgcgactttg gcgctcttga tcgtcgcatg    221820
     cgtgctttcc ctatctatca ccgccccacg ggcgcgctcg agctcttctt ccatgagaac    221880
     aaccatctca cgcgtcttgg cgtaaccttc gagttgatcg cgttgacttt ccaccacttg    221940
     cgccaattcc tcgttgagtg tctcagcctc ggcgcgttcg gcacacgcga ctcgaagtaa    222000
     ttctcgcatc tcactgagac ccgcttcttg ggcagcaatt ttctcgttac tcgcgatcgc    222060
     ggcttcttcg tgcgcatgct gttcgcgttc catcgacgaa atacgctcct tcaagcgcgc    222120
     gttctcctcg atggcttgcg cgtacaccgt cgattcctta cgagcttcgt tcacgcgatc    222180
     gtttagcaac gcgttttgct cgtccatgta catggctttc agatttgcga gattctccgc    222240
     agattccgtc ctgacttctt gcaatatcgt ctccaactca ctgactcgca gttgtgctgc    222300
     ttcctcgttt ctcgacgcgc gctcgatggc ttgcgaggct ttggtcaact ctcggcggag    222360
     agtttcgact tcttcacgaa ggcggcgctc gctcgcgtcg tcgatcgtca cgttagacat    222420
     cgcactcttc tgcgtctcta cgtctttcat caaaggtgcc tccgtttgac tcgactcttc    222480
     ccgaacgcgc ctgacgactt gctgatcaaa atcgatggct cgcttcgccg catccccgtt    222540
     gacctgcacg ccgcgcgatt tgacgctctc atcggcggct tggaaggctg tttgtcgttt    222600
     ttcacccgaa cggtccccgc gttgaggcgt tctcgaaaac tgctctgcgt ggggaggcgt    222660
     catgctgctt cgtccgggag ccgtcgtcgc agacgcgtcg agagtctttg tcatcgcctt    222720
     tgtgcacgtt tcgacgctta aaaccacacc atctaggtgc gtgagccaag gaacgagcga    222780
     tgccatcgta attctatatg acggcacatc gcacatcccg ttcgtttctt tcccgatcac    222840
     cgatccttct tccattttca accgaagcga ttccaagcgc gtcaactcgc tgagcgctcg    222900
     cgcggcttgg aaactttcca acgcgttccc tcgcgcgtcg agcgcgcgaa tgccccactc    222960
     cgccccgtca ctcctcgcaa acccactcaa agacttgatt ttattattgg aaatgttcac    223020
     tcgctccagc gtcgtcgacg ctcgttcgaa tcccctcgtc gactcgagcg cgttgctcgc    223080
     cagattcagc gttcgcaggc gagtcaactt ttccaaccct ctcgcctccg cgatggcgtt    223140
     cgacgacaga tcgagttctt ccaaccgcgt caacaccgcg aacgcttcgc aatccatgct    223200
     cgttatctcg cacgcgtgcg ctcgcagcgc gcgtaaattt acgaatctct ccagcgattc    223260
     gatccgctcc ggcgtcccga gcgccgtccc gtacgtcgcc agctctcgca cgtcctcatc    223320
     cgccatcgtc gtcgacggtc tcagatcgat cgtccctcga cctcccgcac cgcgcgcgcc    223380
     cgcgtcttct acctcgcgcc ccgtcgtccc ttccccctcc cgcgcgcgcg tccgcgtccc    223440
     gtcccgcccc tcgcgcgcgc gtcccgataa cgaggcgtcg tcgtcgccat cgctcgcgtc    223500
     gtcgccatcg ctccctcggt ccttcgcccg cgtcccgacc gcgaccgcga ccgcgcgcgc    223560
     ggagtcctct cgatcgagcg tcgcgccctc gctcgcgcgc gcctcccgcg cgcgctccat    223620
     gcgcgccggc gcccgagccg tcgcgaagtc gcggtcgacg gacagacatc gcgcgccgga    223680
     gacgccgggc gcgtgccttg attttccggg tgtgcggacc cctcgcgtcg acgggtcgcg    223740
     acccgcgacg ggggttcacg gcgcgcgatc gatcgagatc cgcgaaaaag gcgacgctcg    223800
     gcgacgcttg gcatggcgcg tccgaacgtc cgaacgtccg aacgtccgaa cgtccgaacg    223860
     tccgaacgtc cgaacgtccg aacgtcgacg cgcgcgcgtc cgaacgtcga cgcgcgcgcg    223920
     gcgcgatgcg ggcgcgacgg gcggcgacgg cggcgacgac gcgatcgagg gcgagacgag    223980
     acgaggacgg acgacgcctc gaacgggcgt cgcgcgtcgc gacgacgacg acgacgacga    224040
     cgatggcgac gacgacgacg acgacgacga cgacggcgac gacgggaagg cgacggcgcg    224100
     cggaggcgtc gggcggcgcg gtgacgacgg cgcgcgaggg cgcgcgcgag ggatggggcg    224160
     cgaacgcgcg ggggttcgcg tgcggcgcgc tggtcgtcgg ggcggcgacg ggggaggggg    224220
     ggtgcgagcg gcgcggggcg gcggcggcgg aggcggcgcc gacgtcgaac aagtcgacgg    224280
     cgcagtggcg aatatacacg gatataggac gaggattggt gcaagaggga aaactcgacg    224340
     aagcgcgacg gtatttacag cgcgcgctgg tggaggcgaa gaaagggttc ggcgaggacg    224400
     acgcgcacgt ggcggcggcg ctcaacaacc tcgccgagtt gaatagaatc gaggcgaggt    224460
     gggaggattc gcaagcgatg ttcgaggagg cgctggagat attgcgacgg aaatacggag    224520
     aaaatcatcc agcggtggga acggcgttac acaatctcgc ggggtgtcga ctcgcgcagg    224580
     acgacgtcga cggagcgtac gatttgtacg ccaagtcgct cgctcgcaaa gaggcgacgc    224640
     tcgggacgaa tcatccagag tacgcgacga cgctctatca catggccgag gtgctgtgtc    224700
     gaagcgatcg taaagaagat gccatagtgc tgctcgaaag atcgatcaaa gtgagcgaag    224760
     agatcggtgc cgcgcacacg gacgcgtgcg cgcggcgcat gaagcgtctc gcgcaactgc    224820
     tgtgggagtg cgaacgattc gaggacgccg aacgcgttcg gcgccgtatt ttaagcactc    224880
     tggagcacat gaatgggata gatcacgtga agattgctgg tgcttgcgaa tcgctcgctc    224940
     tcgtgctcat gaagctcggt cgtctggccg aagcgacgtc gttgctcgag cgctcggcga    225000
     agattctcgc tcgagtgcga ggagacggcg gcgcgctcgc gctcgcctcg acgcgtctgc    225060
     atctcgccga ggccgcgcag gggatgggaa acgacgacaa agcgcttaag ttctgtcgtc    225120
     tggctctcga aatactctca ccgagcgcgc tcgacgcggt tcgtcgagat ggtttgcgtc    225180
     ccgagattcg cgtcggcgtc gtcgtgcagc acgcgcgcgc cgccgcgctc ctttgtgaac    225240
     tcgcccctga cgacgcgacg ggggacgagc acgcgagaaa cgccgctcaa aacttagtcg    225300
     cggtgaaagc ggtgcccgga atcgatcgtc gagtcctcga cagcatcgat cgcgccgagt    225360
     ttaatttaac gcgagcgagc cgtcgcgttc gccagtgatt agttctctgg tctcagagtt    225420
     gtatttctaa gcgcgctatt ctagtctctc tatccacgtc gccccatccc tcacgcactg    225480
     gccgcatctt cgtccagttc cggcaagtct tcggggtcgt aaatcaccaa caacaccaac    225540
     gagcacgacg ggcagtgcgc gacgtcctcc cccgcgcgca attcctcgag cgtgatttgg    225600
     aaaaagtccc cgcacgggca ctgatacgtg tacgccttga ggtcatcgcg ccactccatg    225660
     tcctccagat cgacttcatc gtacgccccg ctcatcgctc gcgcgccgac gcgcgcgtcg    225720
     tcgcgcgctc ggtggtccgc cgcgtcgcgc actgcgccgc cgacgcgtcc tcgcggcgcc    225780
     gtttcccggg gcgggctggg gtttagccaa tatttcgcga ggagggccac gagactcgta    225840
     ttcgaacacg atttaagtcg attcgagaca cgcatcacga gacacaaagc acgacgcacg    225900
     cccaccgtcc tcgaacgcgg tcgctcgcga cgcgcgcgtc gtcgaggccg tctctttctg    225960
     acgcgcgtcg tcggtcgtgt agtaggtgcg tccgtcgagg cgacgcgaac gcgcgcggaa    226020
     cgcatcgatg cccgcgatcg cgcgtcggcg cgcggtcgag cgcgacggag aacgacggcg    226080
     cggacgtcga gcgcgcgcat cgatcgcggg cgtgacccta ggcggcgtcg cgcgcgattc    226140
     gcgggaaggc atcgcgcgag gcgtcgacga ggggatcgag cgatcgatgc gtcggatgca    226200
     gacgaaatgt tcgcgtcgtg cgcgcgtcgt gtcgcgcgcg cgcgcgggat gcgcgcgatg    226260
     aggcgtcgtg acgcgtgttc gatcgcgttc ggaagcccta aggcgggagg accgggcgcg    226320
     acgcgcgggc gcgcggacga acgcgagcgt cgcggggacg cacggcgcga gcgaacgtgg    226380
     aaaatataat cactgtttgc gtccggcgcg cgaaccttgg acctcgaacg atgaaactga    226440
     ccagaacgcc tccttcctac gcgcagatag atgggtaacc aacgcgcccg atcgcgcggt    226500
     ttgcgccacg gcacccgcaa cttgttctcc cgtggtcacc gtgagcatgg tactttgaac    226560
     acgacgacgt acttgcgtac gttccgtgtc ggtgattacg tcgacattaa ggtgaactcg    226620
     gcgcaacaaa agggtatgcc gtacttgcag taccaaggca agacgggcat cgtgtggaac    226680
     gtgacgccgc gagctgtggg tgtggagatt aacaagacca tcggtggtcg catcgctcgt    226740
     aagcgcattc acgtgcgcgt tgagcacgtg caacactccc gatgccgtga ggatttcatc    226800
     gcccgtcgtg cggcgaacga caaggcgcac cacgaagcga agttggctgg aaagaagatc    226860
     gtgaccaagc gtccggtcac tggcgcgccg cgcacggggt ttgcgctcga gaacgtgaag    226920
     tcggaactct tgactccgat cccgtacgat atcttgcgcg aaggcatgaa gtactaaatc    226980
     ttagcatacg aatcggattg ggtttgtaaa ctgtaggtga gacctgctta aaaatttcaa    227040
     agctcccgtc gcgtcgcttg gcgtcctcac tatcacgctc tcgcgcgtct caacgcgtca    227100
     ccatgtcgct tcctcccgaa ttgctcgatt tctgcgtgtg caaaggtccg ggggacacga    227160
     tttctgaaca gcagctcgcc gacgcagggg tgaagcgcgc cgtcattcac ggagacgcgg    227220
     cgctggatac gaagaatgcg ctcgcagtca cgtcgttgtg caaagtcagg ttgaaatgga    227280
     agttcgacga tgaagagtgc tggaaacagg atgaattcgt cgtgtacgat ggaacagtac    227340
     cgagcggtgt cgaactggcg atcatgaatc ttcacgaggg cgaaagtgtc gccttcaacg    227400
     cgcgcggcga agcggcgctg actgatttcg agccgctgcc caaggcggac atctcacagg    227460
     tctttcggtc aggtcaagcg gaggtcttgg atgtcaaact cgagcgtaag gataagtttg    227520
     acatgagcgc gagcgacaaa atcgcattcg gcgaaaaaat gaatgagatt ggcaagaagt    227580
     tgttcgcgaa cggtcgactg gcgcgcgccg ctgaggtttg gaaacgagcc gccgaggttt    227640
     tcgcagtttt agagcccgaa gacgaggacg tgaatccgaa cgggatgaaa aataacgagg    227700
     catgtcacga agtagctcga aaagtctacc tgaatatggc tctcgtcatg tacaaactcg    227760
     aaaactttac tgaatgtgaa ttgtattgct gcgatgtatt ggacactcgc gtcgatgagc    227820
     cgacgtactc ccaaatcaaa tcgaaggcgc tgtttcgacg aggttgcgct cgactgaagc    227880
     tcagaaaagt ttcgcttgga tctagaatca ccgctgacac ggctgaggcg gatttcttcc    227940
     tcgccagcga gctcgattct agcatcgacg tcgccgcgca tttcgacgct tgcacggaac    228000
     tgcgagagca actcttggcg tctggagttg aaatcccgtc cgacgacgtc gaaacgccga    228060
     acgtcgaaga tgagatgaat cattacccta ccgatatcga acacgctttg cgccaaatcc    228120
     gacgcgaaaa tttacacgac gggttggcgt tcgaacatcc gcagaagcgc gcggcgattc    228180
     ttgaagagcg catgcgcgtc tacaggcgac tcatggatga aacgccttgg agcgcgcttc    228240
     gaggaacgat gttcgatgcg gactctgaag agctgcaaaa aaccgccacc actgcgcgcg    228300
     aggttgatac atgatttata acaaacaaca acgacattat taactgtttc tcattttcga    228360
     agccgcggcg tcgtcgacga tccatcgcac gtccccggtg accaaggcgg cgggcacgga    228420
     gccatcttgc ggcgcctctt ccaatattcg agccgtcatt tcggcttttc ccgcaccgga    228480
     ggcgacaaaa actttcgctc gagcggcgtt caccaagggc aaggagaacg tcacgcgttc    228540
     cggcggcggt ttcggcgagt cggcgattgg taaaatccat ccctcggtct cgcgcaacag    228600
     cgcgtggttt ggaaacagcg agcagatgtg accgtcgggc ccgaatccga gcaagagcat    228660
     gtcgaacacc ggcaatccat cttcgttcaa ctcgatcacg tccggcgtca gcgcgcgtaa    228720
     atctctctcg tacgcctccg cgcacggctt cgccgcgccc tcgttgcgtt cgcacagcgt    228780
     ctcgtcgacg gcgtacaacc gttctcgctt cacgctcacg tccccgaaca gcgcccgcat    228840
     cgcgcctcca aaattcgatt cctcgtcgtc ccacttcacg catcgctcgt ccacccaaaa    228900
     cactcgccat ttatcccact ccactcgccg cgtctcctcc cgcagcgctc cgagcgcctt    228960
     cgcgagcgac ccccccgcga gcgccaccgc gaacgtccct cgcttctcga tcgcttctct    229020
     cgacgccgtc tccaccgcgt ccgccagcgc cttcgcgcac gcgtcgttat cgcgcacgcg    229080
     ttccatcgtc accgaggtcg catccatcgc gtcccgacga cgatgtcccg cgcgacgacg    229140
     atgtcccgcg cgacgtcccg gtcgtcgctc gagcggtcga cgccgcgccg cgatcgtcgc    229200
     gcgcgagtcc gacgcccgcg cgcgtcgcat cggatcgatc gcgcgcgaac caccgcgtcg    229260
     cgcggtgcgc gcgtcgtcgc tcgcacggcg cgcatccatc ggtcgatgcg attcgattcg    229320
     acgcgacgcg cgcgcgcgcc gcactcgacg acgcgacgac ggcggatggc gactcgacgc    229380
     gcgctccgac cgctcatgga ccgcgtgctg gtggagcgca tcgcgcccgc gacgaaatcc    229440
     gtgggggggg tgctgctgcc ggagagcatg acggggaaca cggtgcgtcg acgacgagga    229500
     cgaaggctcg cgaaggatgg tcggcggcga cgcatgcgcg cacgcatgaa tgaatgaatg    229560
     aatgaatgaa tgaatgcgcg cgcgcgcgcg gacatcgacg acggtggcgg acgaaaaaac    229620
     aaaggatgaa agactgacgc ggagaatcgc gcgatgacga cgcggacgca gatgaacgag    229680
     gcgaaagtga tcgccgcggg accgggacga agaacgatga gcggcgagct cgtgccgttg    229740
     ggtgcgagac gcgacgcgcg cgcgcgatga aacgcgaaac ggacgcgaaa cgggacgaac    229800
     agacgacggt gacgacgatg acgacgacga tgactgacga aggaatcgat gacggttcgg    229860
     acgaggcgca gagattaagg tcggggacgt cgtcgcgctt ccggaattcg gcggcgccgc    229920
     ggtgaacgcg ggcgacggct cggggaagga gtactttatc tatcgcgaag aagagatcgt    229980
     gggcgtcgtg gagtgagcgc accgcgcgtg acgcgaattt agcatcgatc gacgcgcgcg    230040
     acgcgtcgtt taatccgaca ttacgggcat tcattcaaag tcgacgcgcg cgcctcgccc    230100
     cggcgggttt cgacgcgagc gacaatcgac gtcgcacaac gcgactcgcg ggtcgaccgc    230160
     gcgcgcgatc gcgcgtgatc gcgcgacgga ttcgtttaca cgtcacgtcg cgcgcgcgcg    230220
     aagcgcacgc gctcgtacgc gccgcgaacg cgcgaacggt gtcgattcga tttgaactct    230280
     cgacgcgacg ggattttgac tttgaaacgc gccgacgcgc gcgatgacgc gcgaggagcg    230340
     aggatcgtcg gcgaagaaga agcgtcgaac gtcaacgtcg agcgcgaagg gcgagagcgg    230400
     ggcgacgctc gacggacaac gcgaggcgcg cgcgctcggg ccgtggtcga cgacggcgcg    230460
     cgcgcgagag gaacgcgcgc gcgcgcgcgc gcacgcgagc gcgagcgcga gtgggaaacg    230520
     aacgagggag gaggaggaaa agggatcgtt tcgtggatta ttcgtggatt gtcggacggt    230580
     ggacgatgac gcggcgttcg aggcgtggga acgggagatg cgggcggtgg gcgaggcgct    230640
     gcgcgagtgc ccgtgtaccg agaaagactg ggagagcgtg ggggcgatgg agagtgcgca    230700
     aggcgaaggc gaaagtgatg cgtgggaaag cgagaagatt tggcttcata agatgtcacg    230760
     catcgcgttc tacgactcgc aaccgctgag cgagacgaac gcgtggccgt tcgcttcgag    230820
     aacgaagaag gacgctacaa agtcgacggt ggcgctcttc aaggcgagcg tctcggcttt    230880
     catcgcagcg aaaaatacgc agcgacttgc ggaagtggac tggaaattac aagaaaataa    230940
     attaatcaac agttggaaag aattgcttat gacccacacg cctcgtccgg gaggcttggc    231000
     agacgtgtcg tgcgagttca acgtgcacgt cacagcgctc gagcaagagt tggcgaagag    231060
     acaaaatgaa ggtgataaat cggatgaatt tggacggcgc atcaaacaca tcaaaatcat    231120
     gatacaggtg ttgcaaagca taaaggcgag cttccagtac tgcgccacgg cgctttatga    231180
     caccgtgttc gcgcctctga gagctttttc ttcggcgtcc attacgagtg aaaatttcga    231240
     atccggcgtg gagttcgtct catgggccag tcgctcggtg atgatcgcat ccgaactgtg    231300
     ccaaacgaaa gattcatatc acgttcgaat gacgcgatac accaaacacg agtttttgaa    231360
     ttggtcacga aaacttttgg acttcttcta ccaccaccta tcgtccgtga gaggttcgca    231420
     cattgtcgaa acactcgggt caggtagtga ttgtgcagaa ttaatgcagc tcatcaagtg    231480
     cttacccacc atgcgtctga cgctaccgtg caaagggact agccggcgtg ccacctatct    231540
     ttcggacaca agattttcgg acaaatttca acgaaagctg acacgattcg ctctcacggt    231600
     gatcggtgct gcaaagtctc aactttcgca gcacacacaa acgcacaaat taggcaaatt    231660
     tctgttcccg gagtggatcg agcatctcgt cgataccatc gagcacaata agagttacac    231720
     agtgaaagag ctagcccggg agattcttct ctcgttggat attgccaact tgctcgcaac    231780
     tcgtgtagaa gtgctcagcg taaaatctct cataaaattg tctgacgatg aattgtctgt    231840
     cgacgacgaa ttgtctgtcg actacgatga cgacgtaaaa gagctcaaag agttgttatc    231900
     atggcttcgc tcaatattaa gcgtgcatcc atccaagttg aggaacgtgg ctgacttggc    231960
     gaaggacttg atttccgtct ttggattctg tcgcctccga cgcgaaacac atggtgacaa    232020
     agttcaaaaa agtgggcatg atcatagttt agagtcggac atatgcagta tctttgcgtg    232080
     cctcgccgtc agtcgcgatc acgaccttga cgatgaagag aagctcaaat cttgtccgtg    232140
     tgagatggtc aagttgagat ctgaagacgc gagaaaaatg attcagcaat tggtgatgca    232200
     tgaagatcat ctcgacgatg tcgaggcggt gattttgaat atgctaacgc tggatcgaac    232260
     gagcatgtca gcgagcgata caaccatccc ttccgctttg gccgcgctga ctatgttggt    232320
     ccgaaaaaat tgtgtcctca gggagcgatt tttcaaatcg ggcgacacca ccaacacgtt    232380
     gttggagatt cttgagtgca agaatgcgaa cgtagcgcgc atcaccagcg cttgcattct    232440
     gtcattcgaa gagcatcatc ggctcgtgac tagtttgtac aaaccgaacg tgatcaccga    232500
     taaaaaaggc gagcaagtga ctgaaatatc tggttgggac gttgacacga ttcgtcagtc    232560
     gctcagagcc atctctgcgc tcgtcaaaga ctctaccgtg tcttcaatcg gtttcgatag    232620
     cgccattttg gaagtcatct gcactgatag gcgaatgctt gttcttacga acaagatcaa    232680
     ggcgacgata gaaaagaaga ttaacaagag tatggattat cccaactccc ggctctgctt    232740
     cccagaagct ctgcttgaag aatgggtgtt cgatctactc tgcatgagaa gcgatcttct    232800
     cactcaaatg gccactgcgg tcacaaacgg cggcggtgac ccgtggaaaa acttcaagcc    232860
     taaacatgaa gagttcgcga gtttcatcag tcgtgagttt gaagtcgcga acaccgacgc    232920
     gacgatacca ccggaggcgc acgcagaatg gtttcaagag gtcgtgacat tggtgacaac    232980
     tgtgcaagaa aaactcaaga aagacgagga aatctccgac gtctgcagta ttttgatgga    233040
     tggagacacc gatggtccat cttcccgtgt tggtatcgta gtccccatct taactctgtt    233100
     acacaaatgt cgcatcttgc aggagcacaa tttgatttcc gagctagaag tcgagggcat    233160
     cagcgatatt gaaaaagaag cgtgttacgt catcggctta ttagcgagta agcaaggaat    233220
     tcaagatcgt atcgcaagct ctttccttat cgaaggcaag aacggaatcg agcaattaat    233280
     tccgctcttg caacgatacc aacccagtgc gaaaaacgcc gcgaatgcca gtgttgcgag    233340
     acgcgcatcg gatgcaatca caaacttagc acacgagaac agtcgcatta aaacgatggt    233400
     tcgaaatgcg aatggcatcc ctcctctggt caatctattg gaatcgcaag agaaaaaagt    233460
     ccagaaggct gccgctagtg cgctcagaac tctggctttc aaaaatggtg aaaataaaaa    233520
     ccaaattgtc gagtgtggcg cacttccgaa gctcattttc atggctcgtt cagaggacgt    233580
     aatgattcac aaagaagcaa ttggtgtgat tggaaacttg gttcactctt cgccgcacat    233640
     caaacgacgc gccctcgacg aaggagcgct gcaacccgtg attgaattgc tcaagtctca    233700
     gtgttccgaa acgcagcgtg aggcggcgtt attgcttggt cagtttgccg cgcgccttga    233760
     gcctgcagcg ccgggtgatc cagactatcg gacaaaaata gtccagcgtg gagctgtaga    233820
     gccgttgatt aaaatgctcg gcggtcaatt tgtctatcgt gaacctggtc ttcgagagat    233880
     ggcagccttt gccctcggtc gacttgcgca acacggggat aatcaagtcg gaatctgcca    233940
     ttcggatgga ttacggccgt tgttgacgtt actcgaatca gagatagaag atatcgccga    234000
     aggacttcgt catcatagcg cttccgggaa gtctgatcac gagatcgatc tagacgccaa    234060
     gcgctttgct gaaaatttgc agcacaacgc tgcgtttgca ctctatggcc tagccgcgca    234120
     tcaagacaac gtgccaaaga tgctcaaaga gaacgccttc atgcggttga aattttctca    234180
     tctcatcgcc gaacagagca aacaatgtgt gaataaaacg ttaaagcggc tcgaggacgg    234240
     agtcagccgc agagatgtct tgacttatct cggtttcgtc ataagcactg gcaagccagt    234300
     cgaacgtcaa agagtaacgc tcgctctggc ttggctaatc aggaaagaaa accaagacta    234360
     tctgaaagac atgcgcgcgg ttttcataga caaaggtggt cttgacgtcc tttctggcgc    234420
     tttacttgat acgccggcgg agcccataga cttttctggg catacgagtg gtctcgccgg    234480
     tggcaaacgc attgtaaacg tgataatgga ggctctgaga gagattaagg acaagctggt    234540
     gtcacaggtt gtggtggaat ctcacatgat gccgccaccc tcgacgccaa cggccgagga    234600
     gcatatgcca gcgaacttca atgaccccga gctttcagac gtgacgttta ttgctcggga    234660
     tgatgaaggt gaaaagcgag agttcaatgc gcatagaatc gcttttacgc acgcctctga    234720
     tgcgttctta tcaacgctcg aagcgggtaa agctgatgtc gacgtttatc ccgccacata    234780
     caaggttgac ctcgaagacg tttgttggaa cgtgcttgag gcgatgatgg atttcattta    234840
     cacgggcact gtcggaccga tgtccagcct ccgagaccag gcgtttctcc agcatagatg    234900
     cgaggacgta ctctccgcca cgacacgctt cgaccttccc gggctcaagt atttgaccga    234960
     aaaacttttc atcgataacg tgaaaatgga tactttcaca ttcgcgagaa cgtgtgcatt    235020
     gtatcgcgcc gccgtggagc acgacgccgt ggcgatccag gaccacgtgc tgggctatgt    235080
     tctcgacaac tacgacaaac cttggattga cgacgatgtc acgatgaatt gtctcacttc    235140
     atacaaagcg cgcgtgaaag acatcgtcga atgcttcggg aaaggcttgg tgaaatacct    235200
     tgacaaactg ttgcgccgag agcgcgtcgc cgtcgtcgcg gacgcgcaag acgaatgatg    235260
     acagcatttg cacgcatcct aacattgtaa aacacacacg aacgattcat agtagtgaat    235320
     ctagaacaac gaattgaagc aaatactgcg tctgattaca caattggact aaaataatct    235380
     gccgtcaccg cgctacctaa ggttcgtctc gtcccgctta agaaatgatc agcgccttct    235440
     tgagcaaagc acccacggtc tccgacggtt gcgcaccctt ggcgatccaa tccttgatcg    235500
     ccggcgcatc caaagaggat tgcttgcgga tcggatcgta ccaccccaac tgttggattg    235560
     gcaaaccgtc gcggcgcgcg cgcgagtcga tggcgatgat gcgataaaac ggttccttct    235620
     tgcgacccat gcgagtgaat cgaatctata tcgcgtcgta atcgcgcaaa ctcgtcagtc    235680
     tcccgttcac actcccgttc actcctcgtt ctcgactctc cttcgcgtct ttcgcgttcg    235740
     aaatccccat cctcgcgttc gtctccccga ggtcaagccc tgaggaaata gggttcctcc    235800
     ctccctcgca tctcgcgcga cgtaccgcaa ctctgttctc cacgcgcagc gccgcgcgag    235860
     cgcccgtgat ggttctcttt tcaacctatc gtcgcgcgca tccaccgtcc gtcgtcagtc    235920
     gtcgcgttcg cgtcctcgtc gtccgccgtc gccgcgaccc cacccatcgt cgacggcgtc    235980
     gcgcgattcg gtcgtcccgc gtcccgccgt cgcgcttcgc gcgccgccgc gtcgtcgtcg    236040
     tcgtctcgac gattcaattt tacgcgacgc tcgcgcacct tgctctgcac gcgcgcgccg    236100
     ccgacgaggg cggcgctgaa cgtgaacgtg ctcgcgctca tgacggacgc ggtgtgccgc    236160
     gacgacgcgc gcgggggcgc tcgacgcgcg acgggctgtt ggtggcgtgc gatcgcatcg    236220
     cgcccgatgc gcgtccgtca tgggatctct cgcgcgcgga atacgcgatc ccgacgcctg    236280
     cgctcaaaaa atgcgaaaac gagacgtcac acggaccgcg aaccctcgcg ctcgaggtcg    236340
     cgcgatcgcg ctcgacgcgg cctctttcgt cgacgcgcgc gcgactcacg atgatcaacg    236400
     ccgacggtga aaatgtggac ctgtacatcc cgagaaagtg ctcgtggacg aaccgcctga    236460
     tcacggcgaa ggataaggcg tcggtgcagc tgaacgtcgg gcatctcgac gcgaacgggg    236520
     tgtacgacgg acggtacacg acggtcgcgc tcgcgggtta cgtgcgaagc aaggtgcgtg    236580
     cgcgcgctcg atgcgatggg gaagaaatgt ttgcgtcgcc cgggcgcggg cggcggcgat    236640
     gggggtcgac gatgcgcgcg cgacgcggcg atcgcgcggt ggtcgagcga ggctagggct    236700
     tttgagcgcg cgcgcgggcg acgaggcggg gcgcaggacg tcgagtgggg gcgacgaggc    236760
     gcgtttggga tggttaaggc gcgaagcgga gagatcgcgc gcgtggtgcg cgtgatgcgt    236820
     cgtgcgaacg cgtgtactga cgaatcgacg ctcgtttgtt tcccgcgaat agggcgaatc    236880
     cgactccgcc atcgacttgc tctggcaaaa gaagaaggcg gccatcaacc aagcgtaagc    236940
     gttcctgaat gcgtgcttca ttcgatggtt agcggagggt gtggcgacga tgatagacga    237000
     gaccagaccg gcgacgagct ggatatagac tttgcaaacc aatcacaggt ttcttacatt    237060
     tgagcgcgga gacggctcct cgcatcgcga cgaacgcgcc tcctcgcgac gaacgcgctt    237120
     cgcttcgctc gtcgtcatcg ttgttcgcat cacgcgtgcg ttatttttct gttcccacgt    237180
     cattattaca agttttattt gcccccattc tcgtcccgag cctcgtttcg agcgcgcgcg    237240
     ccgctccgcg cgcgctcgcg tccgtcgtcg cctcgacgtc gacgcacggt cgtcgtcgtc    237300
     gatcgaagtc gtcgatgtct gtcatccctc gactcagtct cgcttcaaca tgttcttcaa    237360
     tcccccggtc gtgctcgtgc cccagagcaa cagcgcgacg ttcacggcga cttgcagctt    237420
     ccaggtctgc gccacgaatt ccaccgtctg ccgcctcgcg tacgtgacgc gcgcgcagtc    237480
     gtagaacatt ttcagcgtga aggcgtggaa cgcgttgcac tgcttggcga acacggcgtt    237540
     ggacgtgccc aaacgcttgc ccaggacgag gattaaaaat ccgagtccag tcatgcgggc    237600
     gaagaacccg ctctgcgtcg tcgccgcgcc gacggcgttg aagtaacgca acggcatgac    237660
     gcccgcggtg gcgctccaga atttgtccgg gttgagaaac agcgtcacgc cgaacagcgt    237720
     gaagtagtgc tgcatcgcgg tcgcgtactg atcgacgtta cggaaattca tcgttgttgt    237780
     tcgtgtcggt tccgagagca agggtgcgac ggtgcgttgt cgcgcgacgt ggaatggcga    237840
     cgcgggaatc gaatcgaatc gcgacgtttc gttttcgcgg atcgagatta taaacttttt    237900
     ttgatgggtg tttcatgatg tattatgcgc gtttgtaatc acttttcgtg taaagctcgc    237960
     acgaggggaa agacgacgac gtggcgccga atgccagctg gcaccgggcc gcgggtcgaa    238020
     aggttcgtgt ttgaatcgtg tctgaatgtt ccgacgcgtc catcgcgtcg cccgttcgtc    238080
     acggcgaagg gcgcgctttt ttcgcgcgac caggcgagaa catgctcgag aggaaattct    238140
     tccttcgcgg cggcgtcgtt cgggcgaaga cgtcggtttt cgccgcgtct gcgtcgatgg    238200
     gtttcaacgc gacgtcgtcg tcatcgatta aatcgatcgt cagcacatca cgactgtcga    238260
     cggcgttttc gacggcattt gagatgggga cggcgtcgac gttgacggcg gccaacgcgt    238320
     cgtcgtccaa ttcgtcatct tcaaacgtcg gtgcttcaaa gactggtttt tttttgggtg    238380
     aaacaacttt cgtcaagaag ttcatcatga acgaacgctg cgccgaggta ccttgagctg    238440
     ccttgcctcg cctgtcgcca attttcagcg tcgtcttctt cgccgctcgc cgtggcgatt    238500
     caatcttaaa tttctggcgg gtgatagggt ttaattcacc ttccgctatg cgcctcgctt    238560
     catcgtcatc gaatttcggc ccgagaaaac tcaaatcgtt cgcgaactcg caatgctcgg    238620
     gaaccggcgt gaggtgtcga agcgcgccgg cgtgggggtc ccacaccaac gcgtgcttga    238680
     aaatcattcg tgcctttctc cactccactt cgtacccttc cgcgatcaaa tccttaattt    238740
     tttcattcgc cctcaattcg gcgaacaccg cgtcgacaca tcgatgtttg ttcaaaatat    238800
     tgtacatttt tttgataccc aagccgcgaa tgttgtccaa gaaatcgcac cccgacaaca    238860
     cgcacaagct tagaaataat tcgtagtccc acccagtgaa atccagcggc ggcggacctt    238920
     tgcttttcgg tttattcgct cgcccgatcg cgttgtcgtc gacgttttca tcgctcggcg    238980
     tttccgtagt cgtcgtcgtc gtcgcgcgcg cggcgccttc aaacaaactc gccaacctca    239040
     gctccttcgc atcgccggat ttttccaact taaacactac gcgcggacac ccgtacgcca    239100
     cgagatcgga atcttccgtg aacactaaat ctaccccccc ccgttccttc gccgtgagag    239160
     cgagcgacgc aatcgtcgcg tcagcctcgt acggcgcgac gacgaactcg aatttctccc    239220
     tcttcagcgc cacgatcagc tccctcgcca tctccggcgt cacatcgatc gcccccgaaa    239280
     acgcccgaaa cgctccctcc ttatcgcccg ccgcgcgcgc ccgctctcct cgctccaaca    239340
     gcgccgcccg tcgctcgcgt ctcgcgcgtt cctcgcctcg cttcgccggc gctctgtcgc    239400
     cgtcgaacac gatcaccggt tcgatcccgt gatgcctcag catgttcgct cggtgcacgg    239460
     cgtatttcac gtacggcgcc gtcgcgcccg gtcgtcgctc ccacgcgcga tcgcctccgg    239520
     gcgcgagcgc gtcgacgcac ccgaacgcgc ccttgtgcag ccagctgtag gcgtccaccg    239580
     cgcatcgcgt gccgggcgcg tattcaccga cgtgcacgcg ctcgcagtac ggctcgagga    239640
     cggcgggcag gcccttgatg cccatgcggc gcgttcgaac gcgcgcgtcg cgcggtgccg    239700
     acgaccggcg tcgcgacagc cgggacgcgc gttcgaacgc gcgacgcgcg agagatattt    239760
     cgcgtcggac tgtttgcgcg tacgtgcggt cggtcgccac gaatccgtct cacgtcgcgc    239820
     aaaatataca cacggacgca aacgcgattc cgccggcggc ggcgccgcgc gcctcgcgac    239880
     gacgcgcgac ggacgcgcgc gcgcgcgaac gcggcgcgga tcgctcgata cgcgaattcc    239940
     gcgacgtcga taacgcggcg aggcgcgaaa catggcgaag acgcgacgga gaaagcgacg    240000
     aacgcacgtg gacgcggacg cgggcggcgg gagcaaaggc aaagacgcgg acgcgccgcg    240060
     gacgttcgtg ttcacgcgag gacgcatggc ggacgcggtg aaggatctga gcgaggattt    240120
     gcgaaaggtg cgggaaatcg gggcgagagg agaggacgcg atcgggggag atggggacgc    240180
     gagcgcggcg agcgaggagg aacgcgcgga ctgacgagcg acgacgcgcg acgcaggtga    240240
     tggaaccgca cacggcgcgg aatttgaagg aatcgaagag caataagttg aaagatttcg    240300
     tgcaagtatc cggaccgctg gggatttcgc actttttgat gctcagttcg tcggacgcgt    240360
     ccaagtattt caagatttgt cgaacgccga gagggccgac gttgacgttt aagattcatt    240420
     cgttttccct gtcgaacgag gtcgcagcga cgcaaaagaa cccgaggaat ccagcgaagg    240480
     cgtttttgtc gcctccgctc gtgattttaa ataactttgg cgatgaagcg catcaaaagt    240540
     tggcgacgat tacgtttcag aatatgtttc cgcctatcaa cgtgcgcaag gtgaagcttt    240600
     caacgtgtca gcgcgccgtg ctcgtggatt acgacgccaa gacgaaaaga tttcagtttc    240660
     gtcactacag catcaacgcc gcgcccgtgg gggcgaataa aaaattgaag aagctcttac    240720
     agtcgagaaa cgcgcccgat ttgggggaca cgcaagacgt gagcgaattt ttcgacaaga    240780
     gagtcggcga cgcgagcgat agcgaaggct ccgacgacga aagtcgacga gtgcacttga    240840
     cgcaggactt caatcgcgtc gctcacgccg acagcacgtc caagattatc ctcaacgaaa    240900
     tcggtcctcg catggaactc gagctcgtca aggtcgagga aggcatgtgc gacggccgcg    240960
     tgttatacca cgcctacgtc aagaaaaccg cggaagaggt caaaactctc gagcagaaaa    241020
     aggtcgagcg cgaaaagtta cgaaaacgcc gacgagtaga gcaagaagcg aacgtcaagc    241080
     gcaaggcgcg cgagaaggaa atcaaagcgg acgccgagcg cgcccgtcaa ggcaaatcca    241140
     aaaagaaatc ctccgccgtg gacgagttcg ggaacgtccg cgacgtcgag ggtgaggcag    241200
     aagacgacgc caagtgggcc gccgcgttcg aacgcgaaga aaaagaatgg cgagagggcg    241260
     acgtgtacga cgagcgttcc ggaaagacaa agcgtaaacg ccacggcgac tagcgccgcg    241320
     acgccgcctc accgtcacca gtgtgttgta aacgtatcca ttagcacatc gttccatttc    241380
     ccaattcacc atctttaacg attgcgtcgt cgtcgtttcg ccgtccatct gaccgccctc    241440
     gtttcgcttt caatgcttag ggtttgagct ggagttttcc tacgagagcg cccgcgcgcg    241500
     gtgcgatcga cctctttcgt cggctcgata cgctaaggcg cgaacacacg cgcggctacg    241560
     aaacaagcac acacaagtaa acaaaacgta cgttcacgcg cccgcacgtg cgtcgcgctg    241620
     cacgcgtcgc acgcgcgacg ccgaggcgaa gatcgcgcgc gcgttgaaaa ccccaaaacg    241680
     catcgacgaa cgatcttcgt cgcgcgctgg ctcaacgttc gcgcccttcg acggcgtcga    241740
     gcgatgacga tcgtgacgat atatttcgtt cgcgttcgtt cgcgcgcggt gtcggcgatc    241800
     gcgcgtcgca cggcatagaa agcgaggacg ccgcgacgtc gctatgggtg ttcgaaccgc    241860
     gacgtcgagg gggtcatcga ggtcgacgcg cgaaggcggc gcgcgagcga tgggcttgag    241920
     agaacgaaag actgacgaaa gaatgtgttt cgctggaaca gaaataaaat gtctggtgat    241980
     ctcgcgtgca cgtacgcggc tctcatcctc cacgatgacg gtcaagaggt gacggctgac    242040
     aagatcagcg ctgtcgtctc tgcgagcggg ttggagctcg aaccgtactg gtccggtttg    242100
     ttcgccaagt tcctcgagca aaagtccgtg ggtgacctca tctccaacgt cggcgctggt    242160
     ggcggcggcg gtggcggcgg cggcgcggct gcgggcggcg acgccggcgg cgacgcggct    242220
     gctgctgctc cggaagaaga agaagaagaa gaagccgaaa tggacttcga cttgttcgat    242280
     taatcttctg aaacgtcaca cggcgatgaa gcgaccggct tcgctgatga acgattttag    242340
     gcttagctct ataaaggctt tcacgctttc cgcgacgcgt ttcgttgtaa cggcgtgaaa    242400
     tctcaaatcg ttttaacctc tttgcgccac acgttgagta aaatactatt acaatcgctg    242460
     aaaagatgcg tgggtggcgc ggtactagtg tacaaaacca tctattcctc gcacgtgtcc    242520
     gagcacttgt cggacgagcc aacacacgtg cccacgctgc aaccgcgaag cgcgttgacg    242580
     atgttgccgt cgtgcgcgat gttaaatacg acgactggga tatcgttctc ttcgcaaagc    242640
     gtgatggcag tttgatccat gacgcccaag ccgagacgac ggacggtttc gtacgtcagc    242700
     gtcttgtaga gtttggcgtt ggcgttcttc ttgggatcgc tgtcaaacac gccgtccacc    242760
     ttggtcgcct tcaagacgca ctgcgcgtta atttccgccg cacgaagcgc ggcgccggta    242820
     tcggtggtaa agaaagggtt ccccgtgccc gcaccgaaga tgaccactcg acccttttcc    242880
     aagtgtcgaa tcgcgcgacg gcgaatgtac ggctccgcca cttccttaat ttcgagcgcg    242940
     ctcatcactc gcgtcggcac ccctttggac tcgatcgccg cctgcaagtt taacgagttc    243000
     atcaccgtcg cgagcatccc catgtagtcc gcgctcgcgc gatccaaccc gtttccttcc    243060
     ttttcggcgc ctcgaaaaaa gttgcctccg ccgacgacca ccgccacctc gatccccgac    243120
     atcgccgcct gcgccacctc gctcgcgatc gacttcacca cgtccggcga gatcccaaat    243180
     ccatcctctc ccgccagcgc ttcccccgac accttcagca tcactcgacg ccacttccac    243240
     cgttcgaacc cgtcctcgtc ctcgtcgttc gcgctcgcct tctccccctt ccccttcttc    243300
     cgtccctcgc tcctcatcgc cgatatctcc agtccctcca tcgccgactt cgcgtcctcg    243360
     tcctcgcggt ccacgatcgc gcgcgctgtc gtcgttcctc cccgtcccct cgcgttcgtt    243420
     cgcgccgccg caattcttcc cctcggcgcg ttcgcgcgcg ccctcgttcg cgtcgtcgcg    243480
     cccgcgcgcg cgaatccgcg cgccgcggcg ttcgctcgcg tcatcgctcg cgttcgcgcg    243540
     cgcgcgcgtc gtcggcgtcg gcgtgtgcga cgcgcacgac gcgcgacgcg ttcgacaccg    243600
     tcggcgcgac gccgcgcgta tgcgcaaaca gtgagagacc gcgcaccacc gcgcgcgccg    243660
     gcattccgcg gtcgcccgat cgcgcgcgtc gcgccgcgcc gacggacgag cgctcgagcg    243720
     cccgcgcgat gcgcgcctcc gcgttcgatc gacgccgcgc gttcgcgcgc gcgcgcgcgc    243780
     gcgaggacgc gcgacgagac gcgcgcgcgt tcacggtgcg cggcggttgc gcggcgccgg    243840
     cggcgctgac gctgacgacg cgcgcgacgc gcgggcgcgc gcgcgacggc gcgcgcgcgg    243900
     aggggagacg ggcgagtaat cgcgcggtgc cggacgtcgc ggcgaaagcg aacgacgcgg    243960
     gacgaaagtc gcggaagagg gcgatgacgt gctacaggct cgcggcggag cgcgataacc    244020
     ctatagcgtg cgcgacgcac ctggtgaagc cggcggtggc gatgttcctc gcgggcggcg    244080
     tcgccggtgc gctggcgaag acgtgcacgg cgccgctgga tcggctgaag atcatcatgc    244140
     agacgtcggg ggcgtcgagg gcgagcgcgg cgagcgtggc ggcggcggac aaggggttgt    244200
     tggcggcgtt cgtggcgatc ggaaagacgg agggcgtggc gggatattgg cgaggaaacg    244260
     tgccgcaagt ggtgcgaatt ttgccgtatt cgagcgcgat gctgtactcg tacgaagcgt    244320
     acaagaaaaa gttgacgaat aaggaaaccg gggagttggc ggtgccggcg cgtttgctcg    244380
     cgggcgcggg cgcggcgtgc acggcgacca tcgtgacgta ccctctcgat atcattcgcc    244440
     ttcgattgag cgtggacacg agtgcgaaga gcatgggcga cgtcgcccgc accatcttgg    244500
     ccaacgaagg gccgctcggg ttcttcaagg gtttgcgagc gacgtgcatt tccatcgcgc    244560
     cgtacagcgc gctcaacttt tgcgcgtttg atttattcaa aaaggcgctc ccggaagaaa    244620
     ttcgcaacga agcgcaaggg atcgccacgg catcgcttat ggcgaccgcg ttggccacgg    244680
     gttcgatgta tccgctggat actattcgtc gtcaaatgca gcttcaaggg agcacgtacg    244740
     cgaacatgct cgacgccggt cgcggcatcg tcgccgccaa cggcgtcggt ggtctcttcc    244800
     gcggtttcat cccgaacgcg atgaaaaaca tgccgaacaa gtccatccag ctcaccacgt    244860
     tcgacgtcct gaagaagggc atcaggcgtt cagaggtgga gtacgccaaa gaggtcgcta    244920
     ttttagccgc cgaaaacaaa aaaatcaagt gatcgttcga tcgcatcttt ttccattgac    244980
     cccccgacac cgacaccgac ttcttcacat cgcgtcttcg ctctggcact cccatacgcg    245040
     agctgctccc gattctcgtt cggttgtaac actacgagaa tccgacggat ttctggaacg    245100
     cgagcgcgtc gcgtcgcgtc gaatcgcctt cgaacgttcc atcttcgctc accgtcgcac    245160
     tacaaaatta cacgcgctct cgcgctctac tacttacaat catccctgta ctcaaacaac    245220
     ccgcaatctc ctccccaggg aaactgctcg cgattgcgaa ttctcaggta cgagtacgcc    245280
     gggttctcgt gcccgtgtcc gtgcgccgcg ttggacagcg tgtacacccc gaacccagcg    245340
     cacgcgggta tgacgagcat ggagacggcg cgccatttat tcatctccgc tgtttcatcg    245400
     cgtcgatcgc gtttcagcgc gtcagtcgcg cgcgctcgtc gttttcgcgc gcgcatcgtc    245460
     gtcgcgtcgc gatcgttcgg ttcgcgcgtt cgttcgttcg cgcgcgcgac gcaccgatct    245520
     cttcctcgac gctcgcgccg gagctcatcg agcgggcgcg ggaaatttgt tcgacgcgtt    245580
     tgggcgatcg cgcggcgcgc gcgacgagtc gggcgagcat ggcgagcgcg cgtgtgtgcg    245640
     ggctggggtc gcgcgcgcgc gcgcggatcc ccgggtggga atccgaggtg gggtgatggt    245700
     acaaacctat gacgagctat gggatctaat gacgacgcga tcgcgacgat cgcgcgaggg    245760
     tgagagggaa aggacacgac gcgtgaccgg ggacgacggc gtggggctac ttttggacga    245820
     gcgacgcgcg ctcggcgacg tcgacgtcgt cgccgcgcac gcgagcgatg acaaagggac    245880
     cggcggcgcg cacgtgcgcg gcggtgcgat atcccttgtg ctggtggaac ttgagacaga    245940
     cgaagaaaat caacgtcgtg gcgaagaaga cgaggttgtg ccaagccaaa ctttcgaaac    246000
     ttttggcgaa atcaaacatg acgtacacgg ctttgcccgt ggcgtagaat cgataccagc    246060
     aaaagaagac gtacgcctga acgaagagga tggaccaacc gaagtctcgt cgacgcatgg    246120
     gtaaggcgcc gagtaaaaac tcaaggagta aaacgaccat attcccggcg tgttcgacca    246180
     ggcggtacca ctcgaggtag caatcgggat agttgtccac gccctcgagc gcccgacaca    246240
     tcggaaacgc gaagaacgag taccacgctc cagcgctcga taacacgttc gtcgtccacg    246300
     caacgccgta cgcgatcact aaaacatttg tcaaaccgtc taattccccc tcttctcgct    246360
     cagttctata catgttcatc cccagcgctc cctctaagac gaacaacaat aaaatcgtcc    246420
     agtcgctcag gtagtcgaac ccatccgtct ttcgaacctg catcgagtgc tcgtaaacca    246480
     tgtgatagca gaagaaaaac accccgaacg cgaacgtccc cattcgtaac gcgaacagcg    246540
     cggccctggt gcggaggaaa cgcgcgcgag tccgtcagtc aatgtcaatc ttcaaaccgc    246600
     gcgcttcgcc gcggaggcca acaccaaacg cgcgaggcga atccgaattc atcttccacg    246660
     aggcaacgcg ctcgctcgcg cgctcgctcg agaaaatgca cttcacgacg tactttggaa    246720
     cgaatcgcga cgacgaggag acgcgctcga agctcacgtt ggcgacgccg tcgattttcg    246780
     gcatggcgat cacgttgtgc gcagccaggg cgccccaagc gacgacgctc gtgatggtcg    246840
     ccgtcgtcgt ccactgcggt ggaggcttgc gtatgcgcag atcatcgaaa tctatgtcat    246900
     cttcctcgag ctcggcgcga tcgggcgccg cgcgaggcat tggagcgcgg acgcgagtcg    246960
     cgcactgcgg cgcgcggcgc agccgggaag gcggttgagg cgtaggacgt ctacgaaggc    247020
     ggtgcgttcg ttcgctcgcg tgctgtgcgt gctgcgctag ataattaatg atgatgctac    247080
     gtcgaaatta tggtcatcga tcacgcgcgt aagaccttga gccagcggtc gacgacggcg    247140
     tcgcttccgt accagtgaaa ctttgacggt tcgtcaaacg tgccgacggt ggacatcgag    247200
     tgccagcagg cgtcgatgac gatcatttcg gcgccctcta acgcaagtgc ggcgcagttt    247260
     ggtacgacag cgtcgccttc gacgccgtct ccgtcgccac cggcgacgac ggcgtaggaa    247320
     ccggctgcat atttgccgat ggttttcggc tccgccgacg cgtttccgac gacggcgcgt    247380
     cccgtgacgc agacgtactg aacatccggt tcaaagtacg cgccgggcca agtatcgttt    247440
     acccatttag atgccccgcg cgttggatct gacttcgcat cctgcgcgtg tggcgtccct    247500
     aagcatatca aacgtcgcac acgctcgtcc cgcttcaaga aatctccgga gcactctacc    247560
     tcgctcgcat tcatcgccag tgcgccgccg atgaacgccc gcgcgagcca cccaccggca    247620
     gagtgcgcga caatgtcaac gctcgtcgct tcagggttcg ctcgcaacgc ctctttcacg    247680
     cacgcgtcga cgcgttctaa ataccacccg tagctctctc gcgtcgtgca cgcgttcatc    247740
     caaaacccct tcgtgaagat ccctcgcaaa atccccacga accaatcttt tcgctcgacc    247800
     tcagcgacgt gcacgctgaa ccctctcgag cgcagtgact tcgccaggct cgcctcgtcg    247860
     ttcccaagcg cgtcctcgta gtcgctcgag cagttcccga acccgctcag cacgacgatc    247920
     ggattcgccg acgccgacgc tcgcacgcgc gtgtcgtcgc tcgatgcatc actgacgtcg    247980
     atgacgtccg ccgatgcgcg cgtgagcgtg agaaacgcgt ccgaacgcga cgctttcgcg    248040
     gcatccagac tttgtcccag tcccagcggc gcgagcctcg cgaggggcgg tttgctcgac    248100
     gcgcgcgctc gtaacggcga gaaagcggtg cgcgcggtcg aggacaacgc gtctgacgcg    248160
     cgcatcgcgg tcgatggacg ctcgcgcgcg gtggcgtcga gcgtcggcga gtgaggtcgg    248220
     agtgaaatat ctaagactat tttaagactg cgcgttcaac tgggccaata atttcgcttt    248280
     cttctccgcc aatagccgct caaggtcgat gacttcctcc tgatcctcga tggattcctt    248340
     ctgcttctta gtcgccggtt cgtcagcctc ggacgcttcc ggttcctccg cttcttctac    248400
     gtcttcatct gactcgacag cttcgggcgt ctgttcgcgt tcgacttcca cgcgcacgat    248460
     gtgattaccg atctttttcc cgtccttgat ccccttcccg tcgagcgtct tcgtatcccc    248520
     actcttcgtt tcttcgtcga aatacatcgt ttccactccg tgcacggtct cgacctcgaa    248580
     aaatccgccc tcgagcgcgt cctttgcgct cagcctcagc gtcgacgtca cgttcaaacc    248640
     atctctcgag aacactttac taggcaaaat ccgcaccctc acgtgttgcg tgcgaccact    248700
     aatgggtaat ctactcccat ccaacactcc cgccggcaca tgcacgcgtc catgaaagaa    248760
     atcatccttg acgccgtcgc cgccgcattt tcggcacgtc tcgggcttcc cgaatccccg    248820
     tccatcgcac gttccacacg tcccttggct ccccaccgct gttcctcccc gatttgcaca    248880
     cccctcgcac ttcaaacacg ccatccccac gccttgacag ctcgagcaca gcagcttaaa    248940
     cggtatcatc gccaactttg tcgtccccgt cacgctctcc ttaaagctca cattcaccag    249000
     cacgtcgtcc ctcttcgctc cgttcagctc gcacttttga tcgtacgccg cgcgtgagac    249060
     ttcatccttg agcacttcgt acgcgttcgc gacgtttcga aaccgcacgc gcgcctcgtc    249120
     gcgttcggca tccgttttcg tcgttcggga cactttgtcc gggtgcaatt gcagcgcgag    249180
     tttcttatac gcacgcttga tctcatccgt cgtcgccgcg ctttgcacgc ccaatatttc    249240
     atacgcgttc atcccgctcg cgcccgcgct cgtcgacgcc atcgcgcgct tcggtgcgtc    249300
     gatctctgcc gactcgaacg aaaagcgcgg tcccgcacac gacgacgcgc ggcatggcgc    249360
     aaccgagcgc gcttccgatc gcgagcgcgg acgtcaagcg agaactcgcg tcgagcgatg    249420
     atcgcgtcgt caccgccgcg gcgtccgcgc tcggtgcgct cgccgtgcgc gtgcagttgc    249480
     cgacagattt cgcagccctg gtggatgatt taatggacgc gctcgaacgc gatggcgcga    249540
     aaacggggaa gaaagacgct agaaaacttg cgagcgtgct agcggcgctg agtggactgt    249600
     gcgcgagcgt agatggggcg cggggaaggg cgctggatcg aggggcggcg gcgacggtga    249660
     cgcgagaggc gctcggcgcg aacgaggacg gtgcgaatga tgaagagacg gacgccgtgc    249720
     gcgtgaacgc gctggatttc tttcgattct tgcagcatga tgacgacagg cgaggttttg    249780
     aggcggtgcg aggggattcg agatgcatgg cgttcgtatt ggcgtcggcg cgcgagcgag    249840
     ggtcgcgcga gatggatttt atgaagcgcg tcggcggcgt ggatttagtg gtgaattttg    249900
     cacagcaagt ggcggcagac gacgagaaat ttgatgcact tattcgtgag ggcgcgtttg    249960
     aggtgttcac gcacgcgttg ctcgcagatg aggacgaggt caccgttcgc gggctcatcg    250020
     gactcgcttg cgcgctgccg agacgacggg cgctgcgcgt caaactcgct gaagacggcg    250080
     agtgcgtgcg acggctcgcg accctgatgg gatcatccac ggatgaaagt ctcaagggct    250140
     tcgccggggg tttgttccga gccttagcgc tcgatcccga gacgaaaggt ttagtcgaga    250200
     aggcgctgcg agaaggcggt gccggcgtgc tgcaaacagc ttgataaaca tcgatcccgg    250260
     ctcgccgccg cccgataccg ctcgtatttg atgtagtatt catttgccat tgtctaggat    250320
     gtttcccgtc gtcgcgcgcg cgtcatcgcc tcacttcgtc tctctctcgc ggcttcactt    250380
     cacttcgcgc ctcgcgctcc gcgctcgatg cctcctcgac gatcgacccg atcgcgatcg    250440
     ccctcgaaag aggcgcgaga cgcgatcaac aacgccgccg tcgcgtcatc cgcgcgcgcg    250500
     cccgcggaaa tgcgtcaaga cgacgcgcag aatgaaaaag aaggcggcgg cgcggtggaa    250560
     tccatgtcaa tcgaagcgac gaatgcgatg cgtttaaagc tcggtttagc gcccttgcgc    250620
     gaaggagcgt cgaagaaaac ccatgacgcg gacgctttac gtcgtgatga ggcgaaagcg    250680
     gcggaaacgg cggcgctggc ggagaagatt gctgcgagga agcgtcagag ggagattgaa    250740
     aagttgaacg cggcgactac aaagctcggc gacgcggacg atgaggagga agacgcggga    250800
     gcttggttgg cgaagagcaa aacgaagatg gcgacgaaag cgcaggagtt ggaacgcgcg    250860
     aaagcggcca aagttgcggc gatgttcgcg gagagggatg aggacgcgga ggcgagcgcg    250920
     tcggaggagg aggacgaggg ggcgaagaaa tcaaagtcgg cggcgtacac gtcgaaggat    250980
     ttgcgcggac tcaaggtgag gcacaccgcg gatgaaatta atgaaggtca agaggtggtg    251040
     ttgacgctga aggatacgag cgtgttggat gatgaggatg atgaattaga aaacgtctta    251100
     atcgccgagc gcaagtcgcg taaaaaggcg agaaaggagt caacgaagaa gagtgacgac    251160
     cctttcgggg agggcaagga tgtggaggcc aagaaaacgg tgttaggaaa gtacgacgct    251220
     catgatgagg atgcggcaat ggaactcgac ggtgagggtg gcctcgacgc ggctgaggag    251280
     aagcgaaagg cagaaatcaa ggcgcgactc gccgccgaac tctcgggatt gaagggtaaa    251340
     gcggaaaccg cggaagttgt caagggtgag caagctgatt ttcacaccca agaagagatg    251400
     caagctaagt ttgtgaagcg cgaaaagaag aagaagatgc gcaaaaaatt gagaaagaag    251460
     catatcgatg ctgcggagct cgagcaagac gcgctggcgc cagagtcgag cgatctcggt    251520
     tcacgacgct cgcgcggcga gtctagtgcc gaagctaagg ccacgactaa tgagaaagac    251580
     gcgaagttcg cgaatgcgtt gcaaaaagct cgtgaagtga ccgataagaa gattctcgct    251640
     gaactcgccg gcgaagcaga ggaagaggaa gacgacgagc tcgctcgtgc gctcgcaagg    251700
     agccggaaga tggcaaatat ttcgaacaaa gcagcgcgct cggcgccggc agacgtggtc    251760
     gcgcaagtgg cggcgcgtcg tcaagcagat gaggcgaagg ctcgagagaa cgccgcgaat    251820
     gtcgccgacg aatctctagt ttttacagac atgtctgagt ttgttcaagg catcaacact    251880
     caagacggcg cgctcgatga ggtctacgac gaagacgcag acactgagga aatgccagac    251940
     gtaccgccgc cgccaccacc gggcggtgaa gacgagccga tggacgatga aatgccagat    252000
     gtgccgccac cgccaccgca agaggaagtc gacgcgcacg ttaacatgcc cgtactcgcg    252060
     gaaaagcacg tcgtgcaaaa agggttggcg agcacactcg ctcttctcaa agacaaggct    252120
     caactcgatg atgcgcaaaa cacgcgctgg agtgggcgcg ccaacgacat gaaggatcga    252180
     ttcgacagac agcacgtgct cgaggcgcac gccatagaag aaaaagccgt cgacggctac    252240
     aagttcggtt tcaagctcga taagttggac gagttcggac ggaagctcac cccgaaagag    252300
     gcgtttagag agctttgcca tcgtttccac ggcatcgagc ctggcaaaat gaagcgcgaa    252360
     aagcgcctgc gacaattcca ggaggagcaa cagcgtctca aggcgtcaag cgtcatggac    252420
     gaccgcatca aggacgtaca gcgcgatcaa gcgacgcctt acgtcgtact tagcggtcac    252480
     gtgagggctg gacaggcgag aaacgctgat ccggtggcga cgatgaagcg cgaacaggaa    252540
     tccgcgcgcg ccacccccgc cgccgcgtcg cgcggtccat catcggcatc cggtctgaag    252600
     gcttccaacg cgacaaaagt ctcgtttgcg atgaaaccat cgaagaagta atccgtagca    252660
     cgcgtcatta gaatatcacg tgtagagcaa ttagtttgac gtcgccgcgc gcgcgccgag    252720
     atcgacgctt cactcttcgc ctcgctccga tgcccgcgaa accgaaatcg cgcgccaaag    252780
     agctcgccgc gcgcgacgac gcagacgatg gcaccgtcga cgccgtcgac gccggcgccc    252840
     tcgatcgcgc gtgcgctaca atcgcagaaa aggtacaaca cgcgcgcggt gccgactttc    252900
     aacattctca cgacgccgta ggtcccgaac gcgctcgcga aagcgcacga tgccgtcgaa    252960
     acgcgcgtgg cgacgtcgct acaaacagcc gaggcggaag aaacggaggc gacgcgcgcg    253020
     ttgaagcgag cgaagaaggc tttggaactc tctcgtcgcg tgtctgggaa actgcgacga    253080
     gacgacggcg tcgaatcgac ggcgacgact gtgtcaaatg aaatcataag agatcgcttt    253140
     ggacacttgg tgagcgattt aaaggagaga attgagaagc aggtgcgcgc gatcgaggtt    253200
     cgcgtgaagg aattagatga tgattaatgt agagccgcgt cgcggcgtca cgatcgatgc    253260
     gtgtgctgta cgatggaacc aacaactaaa ttgaaacgct agcaagaact cgccgctatt    253320
     gtcgtgatct aaatactatt gtgcatgcac ctttgtcgcg agaggctcgt accacaccgg    253380
     cgtgaagcca gccttggctc tggcctcgtc gttgaacggc ggtttgagcg cgccgtgaaa    253440
     atactcacgg acaatctcat ggaacgcctt caccacgccg ctctcctctg tttcttcacc    253500
     gacatcaccg ccgtcgactt cccgggcgtg caaatattta aaccagcgca gccccgaagc    253560
     gcagtgcgtg atctcctctg gataaatgac ggtttccaac aacgtcgccg acgcctcgtc    253620
     cccgttccga cgaaacttcc cgatcgtctg cggcaaaaca tccaaacccc gcgcttcgtg    253680
     cacgcagtgc tccaccgcga gcctcgcctc gagcgaatgc gccgtctctt tcgccgtccg    253740
     ccacagcccg tcgtgcgcct ccagctcgcc gaatcgcacg acgccgcact cgtccaatct    253800
     tcgcgacaac agcgcgaaat gccgcccttc atccgccgcg agctcgacga aatcatcata    253860
     aaactctttc ggcatatttc gagccacacc gaaccgctga atcgcgtccc aggccaagag    253920
     catcgcccag ctctctatgc tcgcgagcga gtgcaaaatc gccgagcgcg actgcgccgt    253980
     cccgccgttc ccgatccgtc gcgtctgccc tggatccacc acgcgcgata tctctcgcac    254040
     gggatcatcg acgacgttct gcgtgtcctc acgcgcgtac gacgtcgtcg tcgtcgcgtc    254100
     gtcgtcgtca ccgaaccacc accggtgcgt ttccgccgtc atcaccgcct tcttcgcgca    254160
     cgacggctcg agcatcacgc accgcgcgcg atgcacgagc tcgcgcactc tgcgcgcttc    254220
     gtcctccgtc atcgcgcgcg cggtcggcgc gcggtcggcg cgcggtcggc gcgcgtcgtc    254280
     caatggcgaa cccgtcggcg ccgcttcaaa tcgcgacgcg tcgacgcgcg cgacccgaaa    254340
     tgccgccgcg cgtgaagaaa atcaagcgcg agtacgccga cgccgatgcc ggcgacgcgg    254400
     actacgacgc ggtgtcctcg ggcgaggacg acgcggcgga gatcacgatg aagattacga    254460
     agaagaagcg ggcgcccaaa aaagttaaaa cggacgacgg cgacgccgag ggcggcgcgc    254520
     gggtcaaggc gaaggacgag aacgcgccgc agaagatcgg tttcgacatc accgccggac    254580
     cgattcagga cgagggcttg cacgcgaagt ataacgcgat gaatctggac gagctgaagc    254640
     agtacatgaa gatgaatcga atgccgagca gcgaggtggg acagaagaat aaacgaatcg    254700
     tgtataaaaa ggcggatctc gtggcgcact gcgtggatgg ggagaagtgg ggacggtatc    254760
     cgttgtgtcc gaattgtggg aaacgaggga cgacgacgct gcgggtgacg tatgcggatg    254820
     agaatcacgg aggtcaggga acgtggaagt gcgtcgggta ctacgatacg gttttgcaga    254880
     gcgtgacgcg gtgctcgttt aattacaagg aagataagga tgcaccgcgg gagcgattgc    254940
     cgtggcgtaa gcccggagat gagatgtcgg acgacgagca agatgacgtg caggcgggga    255000
     tggacaagcc cgtggtgttt ccggacgaca tgcacgcgat ggcgccgatg gagatgtcga    255060
     agaagatggt ggagatttgc cgcgagcacg ggttgcagtt acccaaggcg gagaacgaag    255120
     ctttacgaga gtgctacact aagctccagg cgtcgatgaa ttacgacgac gaatacgaca    255180
     tcaaaactgc gttcaatttg cttaaggagg cgtacccgcc gttgaccaag gagcaacaag    255240
     ccggcggcgc cgacgcgaag aatcccgcga atacgaagct atgccaagcg ctcgaagcca    255300
     tcttccaagc cgcgaagacc tcacccgaag aaccgatgaa gtcggcctcg tatcgcaaag    255360
     ccgcacagtc catccgtgag attgatttcg aagtcacgag tggcatcgcg attagcaaag    255420
     gcaaactcaa ggtgccaaac gtcggcccgt cgctcggcgc gcaaatcgag ttttggatca    255480
     agaatggcta cttcgagcgc atggaatact acgaacgagg agaaatcccg ccgtcgtcga    255540
     agaaatgaac acgaacatga cgcaaagcgc gcgctttact ctacaatacg gtacaacaaa    255600
     aatctcctag cgatgaaacg aaacgaaacg agtcctcgac catcaagcgc ctccatcgaa    255660
     actcttcgcc gcgtgcgtcc tcaacatctc caatcgatat tgggacaaat cgacgagcaa    255720
     cgactttttc atctcatccc aatcgaattc gtcgccaaac tctcgtcgca cctcgatgac    255780
     tctcgtcgcc gccagtcgca cgtccgcgtc ctcgcttcgc atcaaacttt cgataaactc    255840
     gcttcccgtc cccaccagcg gcgtcgtttc catctgcttc agcatcgccg ccgtgacgga    255900
     gctctgattg acgtcctccg agcactcgtt gccctgtccg tcgagctgcg ccatgacgat    255960
     tctgacgccc acgagcgtgt gcagcctgga aatcatctcc ttcgccttgt cccgcgggtc    256020
     gtacccgcac gccgtcgcgt actcgtccgc gctcgaagac gctcgcgcgc ggcgacgcct    256080
     tcgcgcgccg cgcggcgcga cgacgacgcg cgcggcggcg gtggacgcca ttcgcgcgcg    256140
     cgtcgaagag tgtcgtcgcg cgcatgtccc gcgcgtgcgc gtcgtcgcgc gtcgcgctcg    256200
     cgcgcgcgtc gcgcgcaccg acgcgcaaac gcgcgctcga ccgctcgacg cggtcgcgcg    256260
     ccgtcgcgac gcgcgacgac gcgcgcgcgg acgtcgagag cgacgcgtcg gcgttgtccc    256320
     gcgcgctgga atcgattcgc gacgccgacg tcaacgtcgt cgtcgtcgag cgcgacgacg    256380
     cgcggaagcg gttcgtcgag cgcgagtcgc tggtcgaggc gctgcgcgcg tcggcggcgt    256440
     tcgagcgcgc ggtgacgttt cgaaaagcgc cgacggtgga ggagacggcg cgcgcgctcg    256500
     ccgtcgcgga taacgcgctg gcgagggaca tcgcgacgtg cgtgagagcg ttcgtgaacg    256560
     tggtgccggg cgcggatcgg ggggtgaagg tgacactgag tctgttgcgc tcgacgctgt    256620
     gctcgcgatt acacgtcgac cacacgagcg ctcgaatgat ggtgacgttt tacggccgag    256680
     ggacggaaat ttgcgacgcg cgaacgagcg ccgcgatcgc gaaggcgaac gcggatggtg    256740
     gaaattttgt gaccgatgcg ttgaagacgt tggcggagaa gtttgcacct ccgagagaga    256800
     taagtacttg cgacgtggcg ctgttgaagg gcgagcgatg gacgtacgca gacggctcga    256860
     cgtcaaaagg taaagccatc gtgcatcgtt cgccgctcat cgacgagaac gagtggcgat    256920
     tgactttgaa agttgacgtg gtaaactttg gatgtgaatg cgaagaggag cactagaata    256980
     ggactagaaa gaatttgatg tacaacaaac gcggagagct tcagaagaat tgcggcgccg    257040
     tgaatcgcaa cgcggcgctt cgaaacacgt cgacgtgcgc gtctagactc ggctcgatgg    257100
     gcttagagta cccacctccc atggtgatca cgagagggac ctcacgggcg atgcacatcg    257160
     aatacacggc gttgtttcgt cgtagtaacc cttcgcggct catcgcgagt cgcccgaacg    257220
     aatcctcctt caaagcgtcg ataccagctt ggaaaaacac gatcgctggg tcgtaatcat    257280
     cgaataactt cggcagccac tgctcgagaa ggcttaaata ttcctcatcc tcgcaatcgt    257340
     ccggcaattc gacgtcgtgc gtcgatttct cccgcgtctt gatggggtag ttcttttcgc    257400
     cgtgcatgga aaacgtcacc acctgcgcgt cgccctcgaa aatttttgcc gtgccgttcc    257460
     cttgatgcac gtcaagatcg atgactaata ttttacgatc tcgcagcgag tccgcgaact    257520
     cgcgtctggc gacgttgatg gcgaccgcga cgtcgttgaa cacgcaaaag ccttcgcctc    257580
     tgtccctgta cgcgtggtgc gtcccccccg cgatctgcgc gctcgctcgc gcaccgctca    257640
     tcacctctcg catgcacgcc accgttcctc cggtgctcgc caacgagcgt tcgacgttct    257700
     gctgagccat ggggaagcca atctttcgca cctcgtcctc tcgcagcgtg agcgtcagca    257760
     cccgctgcac gtactccggg cagtgcgtca acagcagctc gctctcgatg tccactttcg    257820
     gagactccag aagtgtgatc ttgttcacca acgccgcgtc gcggcgcaga gcttcgcgcg    257880
     tgcgcgcgta cttgtccatc ggaaagcgat gtccgtctgg gaggtccacc cgcgcccagt    257940
     ccgcgaaaaa caccgagagc ggtctgggcg gcgacgcgcg cgtcgacgga gacgcggaag    258000
     ccgcggtaga caccgcgcgg tgcaggctcg ccgccagcgc ttgaccgcgc gggaaaagag    258060
     gggcgggacg catgccgcga ggcggcgtgt gcggcgcgac gactccgagt cttggatttc    258120
     aatccacgtc ggtgacgtga ctcgcgtgta ataaatccgg taaattcgtg agtgagtgct    258180
     ttttggcgta ttcccggcgt acggcgtcga tcgcggctcg ggctgatggg gaatcctcgc    258240
     cgaggacgca cacgacgccg ccggaaccgc cgccggtgat tttggcgccg aataacgcgt    258300
     ttctttccac gtcgacttcg cgaacgagtc gcactaaatc atcagtagcg gttgaaccta    258360
     agccgacgga gctgtaggag ctgtggctgg cgaacatgag atccccgagt cgtcggccaa    258420
     gttgtcgaac gtcgtcgtcg gcgcaaacgt cgtcgctcgg ccaatcttct aaaatactca    258480
     aaaattcgcg cacgcgtgcg tgctcgcgta cagcgtgact cacggttgca cgcaaggtat    258540
     acgttgagtc ggcgtcgatg gtggtgttcg gctcgtcgtc gtggctgatg tatcgcgcga    258600
     ggaacgattt gcccgtcatt tcctcgtcta cgtgctgcga ccacgacatc ggacttccag    258660
     cgctgccctc gtcccactgc cgagctgtga tgacaccaca cagatccact ttactcggca    258720
     cgacgtctct gttcaatcgc gcgttcattt cgttgatgag gatctttttg cccatgaacg    258780
     tgccgcatcg cacgcgcgcg taatctgaac cgcccgagtt cgagtgtcgc acgccagaat    258840
     cgatgcccca cacccgcagc tttcgcggca atggcaccag tcgatatatg tcttcagccc    258900
     cgtcgtgtga cgtgttggcc aaatcgcaat cgatggcgat gaaatttccg cgcgacgccg    258960
     aatcgacgga gtgaaagcac gcgtactgat ccatgaatcc gcaaggcgcc ccgacgacgt    259020
     cattttccgc ggtttgacaa tacagaggaa tcatcgccac atgcgcgcta aaccttcgag    259080
     cggcgtcgtc ttcggaaacc acgccagcgc gcagcgcgct cgccgccacg gctctcgcca    259140
     cggcgatttc caccgccgcc gaactcgcca cgcctttccc ttgcggcacg tccgagcgaa    259200
     tctcaatctc gcaatcgcat cgcgcgagct tcttcaccca cgctcgcgcg cgtttattcg    259260
     acgcgtccgc atcgctcgat atcgctcgca aaaactcccc catcgcgccg gcgacgtacg    259320
     ccgcccatcg ctcgttcgcc gcgctcggcg tcctctcaaa atattccctc gtcttccccg    259380
     catcgaacgt ctccgcgtcg aacacctcat cgaatcgcgc ttcaaaacat cgcgcgtcct    259440
     cttcctccgc gccgcgcgtc ccgatcgtca ccgttcgcgc tcgaaacgtc ccgctcgtcc    259500
     cgctcgccgc gtctcgaaac cgcgcgcgac actccgttcg ccgccctccg agccccaact    259560
     gcgcgaccgt cgcgccggag taatccgcga tccctcccat gacgtccacg cgtccgcgtc    259620
     cgacgccgac gcccgcgctc gcgccgtcgt cgtcgccacc gtcctcgaaa aatcgcgcga    259680
     tgtccccgtc accaacgaac tcgcgcgacg ttttcgtcgt cgtccgcgtc gacgcgcgcg    259740
     cgagcgccgc tcgaagcgct cgcgcgatcg cgtcgctacg catcgcgtca ccggccgtcg    259800
     cgcgcgtcgt cgtcgtcgtc gtctgacgcg ctcgacgtcg cgattcgcgt cgcgagcgcg    259860
     cctttgcggt gcactttttg agcgctcgat cggcatctta tccgtcgccc gcacacgcgc    259920
     gcgcgtcgcc acggcgcccg aatcgcgctc gatcgacgcc cgagatgtcg acgcgcgtcc    259980
     gcgacgcgcc gcgcgtcgcg acgcgcgcgc acgcgcggcg cgtcgggcgt aaaactcgaa    260040
     agagtgggac gtcatcgtcc gcgggacggc gacgtcgcga cggcgtcgcg cggtcgacgg    260100
     cggacgacgg cgaacgatcg acggcgcgcg aggcgcgcgg cgcgcagtcg cgtcgcgagg    260160
     cgctgctgcg cgcggcgagc gcgacggtga tggcgacgac gacgacgacg gcggacgcgg    260220
     cgcgcgcggc ggcgggcgcg gcgcggcgac tgcaggagac gtacttcgcg gcgacgtcga    260280
     aagcgatcgc gcccgagcgg tggtacccgt actggtgggc gctgccgctc gcgccgtacg    260340
     ggagcaaagc gacggcgctc gcggaggcgg tgccggggga ggtgtggacg ttcgatcagt    260400
     tgcaaggatt gctcgacgtg ctcgtcaacg tgcgaatgac ggtggcgcga ctggaggggg    260460
     gggggttgtg ggtgcacaac ccggtggcgc cgacgaagga gctggtgggg atggtgaagg    260520
     agctggagaa acgatacggc gccgtgaaac acatcgtcgt cgggagcgcg gcgatcgagc    260580
     ataagattta cagcgggccg ttcagcaagg cgtttccgaa cgccgacgtg tggttgccgc    260640
     cgaagaattg gacgtttccg gtggacgtgc ctctggagac gtacgtgccg ttttacccgc    260700
     aagggtcgcc gaagacgctt ccgatgcaat cgatcggagg cgaacaaaac gtgccgtggg    260760
     cgaacgagat tgaacacgcc gtgctgcaag tcggcggctc gtccctgcgc ggattcaagg    260820
     atccttggtt cgtcgacacc gcgttttatt tgaagcgcac gaaaacggtc gtgctcacgg    260880
     atgtcatgga aaaggtgagc caacaagcgc cgccggtgtg tcaaatcaac ccgcagccgc    260940
     tcttggtgcg cgcgatggat gagccggaca aggtgccggc gaacacatcg caggcgagaa    261000
     gcgacgggtg ggggaaaacc gtcttgtttg gtttgctctt caacccgaac gcggtggagt    261060
     ttgaatttag cggagacatc gccaacgatt tgctcgatgg gttcaagtgg gatccgagct    261120
     ggcgcgccga tttcgacgcc ctcgtcgcca agccgatgtt tgtgccgccc attttagccg    261180
     tcttggcgtt cccgcgtcgc cgcgacgaag tcaagcgttg gtcgaacatc gtcacctcgt    261240
     gggatttcac gtccatcatc ccgagccacc tcgacggtcc cttcaacgcg acgccggatg    261300
     aattcaccgc cgccatggac tttgccttga cggcgacgcc gtacgagcaa ttcggcgcca    261360
     acgcgcagag cttaatcgac gtcgacaaat tgagcgtcga tctcaagtct ctcgaagtgc    261420
     ccaagccgtt gagtccggag ctcatcactc ctcccaaacc agcgcaggaa gcggtggaaa    261480
     tcgtcctcga cgccgcgtcg gagcaataac tagcgagtct cgcgttttaa tcaaaccgtc    261540
     gcgaactacg gataagacct caaacctcac cgcgcgctcc catcgacgcg atgctcgccc    261600
     tcgcgagcgc atcgcgcgcg agcgcgtcac acgcgatgtc gcgcaccgcg cgcgcgccgc    261660
     tcgaccgctc tcgcgcgcga gcgccgtcgt cgtcgtcggt tttcacgcgt cgatcgagcg    261720
     cgtcccgctc gaccacgcac gtcgtccgcg ccgcgtcgga cgagcgcgtg gagacgcacg    261780
     cgttcttctc cccgtccaaa atcaacctgt tcttacgaat caccgcgcga agacccgatg    261840
     gattccacga cctcgcgtcg ctgttccacg tcatcgacct cggggacgac atgacgtttg    261900
     cgaagtcgtc gagcgagacg aaggacacgc tgatctgtaa cgaccccacg atcccgacgg    261960
     attcgtcgaa tttagtgatc aaggcgttgg atttgttccg cgcgaagacg ggcgtgcgac    262020
     agtacttttg gatcgagctg gataaaaagg tgccgcacgg cgccggactc ggcggcggga    262080
     gcggaaacgc ggcgacgacg ctcttcgccg cgaataagtt gtgtggatcg ccggcgacgg    262140
     aggcggaact gttggagtgg agtggggaaa taggaagcga tatttcggtg ttcttttcta    262200
     agggcgcggc gtattgcacg gggagagggg agattgtgga ggacgtggag ccgccgttgg    262260
     atttagccac gaagatgttg ctcgtgaagc cgccgatggg gtgctcgacg ccggctatat    262320
     ttaaggcgct cgatctcgat ggacgctcga aggcggaccc gttagagttg ttgaaacgca    262380
     tcggcgtcga tggatgctcg gagacggtgt gcatcaacga tctcgaggcg cccgcgttta    262440
     cggtgttgcc cgaactcgcc gagctcaagg aacggctcaa ggcggcgacg gcggataaaa    262500
     agacggtggt tttcatgtct ggtagcggta gcacgatcgt catcgtcggc gacgatgacg    262560
     ttcccgcgtt cgtggcgcga gacgacgccc tgttcaaggc gcccacgcga ttaatcacga    262620
     gaaagcccgg cgagtggtac gcgccgacgc ttcgccgagc gtaaacgtga atggtaataa    262680
     aatctctacg gcatagcgac aactactgaa cgactactgg ccgattctca gcccgatata    262740
     actgctcaca ctcggcgtat ccgcttcgaa ctgcctgaac gaatccacca tgacgtcgaa    262800
     tatcttggaa ttcttttcgt acgaagccgt cggcgactgc aaccgcaatt cgtacagctt    262860
     cccgttctcc gtcccgagcg cgcttcgcag cgtccgatcc cactccaacg tctgcggtcg    262920
     atcctccgcc gtcaacccgt actgattcct cgcgctataa ctcgaaatcc tcacctccac    262980
     gtcgtaatac actttcccat cgctcttcgt ccttcgcctc gcgtttaaaa tctccttctc    263040
     tcgccgcacc cccagccgcg tcgacatcag ctcgccgacg tactgttcca gcaccctctt    263100
     cgccgcgtcc tccgccgttc ccagatcttc cacgctctcg tacgcgctgc tcgacggcga    263160
     gctcaccgcg acgaacgcgt tcgtctcgac ctcgctcgcg tctcgaaaaa acacgtcgtt    263220
     cccgctcccc ctgacctcga cccacgcgct cggtcgatcg aatccgtacc catcgatcgc    263280
     gtccgtgtac cgcgcgaatc cgatcggcgg tcgttcgaac gcgcgcgcgg gcgtcgcgat    263340
     cgcgacgcgc gccagcgcca ccgcgctcag cgccgcgcgc atcgcgtcgc gccgcgtcgt    263400
     cgtcgtcgtc gtcgtcgatc gcgatcgcgc gtcgcatcgc gcgacgacgg cgcgttggat    263460
     cgccggcgcg cgtcgcggcg tcgacgcggg cgtcgcgcga tgcgtcgcga tcgacgacgc    263520
     gcgcgccatg gcgcgcgaac gacgacgacg atcgttcgcg cgtcgaggat tgccgacgac    263580
     gatcgatgcg tcgatcgcgc gcgacgcgcg cgcgacactc gcgcgcgctc gatcgcgcga    263640
     tcgcgcgacg cgcgcgcatg tcgcgcgccg gcgcggacgc cgcgcgcgcg tcgccgacgc    263700
     gcgggacgca ccgcggcgac gcgatggcgg tcggtgacga cgccgcgcgc gcgctcttcg    263760
     cgtgggggtg cggcgaggac gggcagctcg ggctcgacga cgcgcggtcg acggcgcgcg    263820
     aacgatgcgc ggcgtcgccg cggcgcgtgg cgctggaggc gacgacgccg gcgtcggcgt    263880
     cgcggcgggg cgaggcgacg ccgcgcgcgc cggcgtgcgg gtcgagaaac tcgatgtgcg    263940
     cgacgacgac gggggagctg tacgcgtggg ggtggaattc gcaccgagcg ctgtcgttcg    264000
     ggtggcagga gtgcgacgcg ctgttcgtgg acgcgccgag gcgaagtcga ctcgaggtgg    264060
     gcgagggggg gaggcggttg gaggtcgcgg cggcggcgag cggcggatgg cacgcgctgt    264120
     gcgtggacgc ggacggcgcg gtttgggggt ggggtgggaa tgagtacgcg caagcggggc    264180
     gcgcggacgc ggaggcggag gcgcggagcg cggcgattcc ggatcgagac tgggcgccgg    264240
     cgcgggcgtt gatttcgccg gcgcggatga ttccgctccc gttcgcggtg tccgcggtgt    264300
     cgtgcggagg gatgagctcg ttcgcgctct tgcgcgacgg aagggtgttc gagtggggtc    264360
     tgacgagcga agaggaggaa ccgcgagagg aacccgcgca cttgccgacg ctcgataaac    264420
     acgtcgtgga gatcgcggcg gggagctttc atttgctcat gcgcacgcgt aacggcgagg    264480
     tactgtcgta cgggaacgga atgtacggtc agctcggact cggggcgttc agcgccgcgg    264540
     ataagcctcg cgtgattgag actttcggcc gcgtcggcgt ggcgaaaatc gcggccggcg    264600
     gttggcactc cgccgccgtc accgccggcg gcttactgta cacttgggga cgcggtgagt    264660
     acggtcgact cgggcacggc gacgactgca aggacaaggt cgtcccgcaa ctcgtcgact    264720
     tgggcgaaga cgaatcaaac ttcatcgccg acgtcgccct cggcggttcg cactcctgcg    264780
     caatcacgtg cgaaggtcac gtcctcagtt gggggcgcaa caccttagga cgtctcggtc    264840
     gagtcgtttc cgatccatcc ccatcgtgcg gccaccccgg tcgcgtcgtt ttcccgcccc    264900
     tccccggcgg tagattttgg cgcgtcgaca aaatttcctg cggcggcagg cacaccctcg    264960
     ccgtcgccgt cgccgaaaac ctcccatccg ccgccgcgtg atcgcgcgcg cttctcttct    265020
     ccgtgtaatc acacgcgcgc gcacaattta gccctctttt ttgctcgccg tcgcgcttct    265080
     ccgcgccgcg agcgtcccgc gccctccgtc gcgtcggcgt cgccgtctcc ggcgcgatcc    265140
     accgcctcac ctaagaaggt cgacgtcacg gcgtcaaaaa gcgccgcctt cgtcgcccct    265200
     tcgtcgcgcg acgcgcgcga tcgcggtcga aacgctcgaa tcgagcgaaa cgcgcgcgat    265260
     ggcgttcgac gacgcgtcgc gcgtcgcgcc gcagccgcag cgcgccgagc gcgacggcga    265320
     cgacgcttcg gtcgtcggtc cgggacgaaa agcgcaatcg ctccaaacga aggattcgtc    265380
     gagcgaacgg acgcgaacgg gcgtcgcgaa ccgagtgaat gggtactttg gcgcgaagtt    265440
     tcatcgcctc gggcgattga gcgcgtcgag accttggacg gtgatgctgt gctcgatgtt    265500
     gttttgcatc ttgtgcgccg tcggcttggg ggcgccggga ttgaagaatg aaaagcgcgg    265560
     cgataagctt tgggtgccga ccgatacgcc ggcgcagggg gataagaatt acgtcgatgc    265620
     gaattttggc tcggagacgc gcttcgcgca ggtgatttta cgatcgacga cgaacggggc    265680
     gaacgtgctc acgccgacgg ggttggcggc gctggagaac gtcgcggcgc gagtgcggaa    265740
     cgcgaatatc gcgtgggaag gtgcgacgta tacttatgcg caacactgtt acaaaatggg    265800
     ggcgacgtgc tacgaaaaga gcgtgctgaa cgcgtttgcg aacgccacgg cgtacgggtc    265860
     gcagtcgcta atcgacgcgg cgctgagcgc gtccccgttg accagcgaga accccaacga    265920
     tggatctacg gtgttgttga agaacgtcgc cggtggaata accatgactg gtgccgtgcc    265980
     gagcgcctcg gcgatttctc tgacgtactt gttcaagaat aacgacgtgc tgaggaacgg    266040
     agattacgtc gatgaaaagg gcgacgcgtt tgatagcgtc gtgctcgata ttttcgccaa    266100
     tcctccgtcc ggtttcagcg cttcatacgt caccgaacga tcattttccg acgaatttgg    266160
     cagcacaatt caaagtgatt tgcaaaagct tcaaatcgcg ctgtttttga ttctcgccta    266220
     cgccgcgctc acgctcagca aatggaacat gggatgcgtc ggctctcgag tgggcgtcac    266280
     tctcgcgggt atcgtctcca tcggcatggc catcgcatct gcgtacggca tcggtgctta    266340
     ttgtggtctc ttcttctcgc cgttgatgaa tgttctgccg ttcttattgc tcggcatcgg    266400
     cgtcgacgac atgtttgtca tcgtaaactc gtacgacaac acggaggcgc gcgtcgaccc    266460
     ggtcgaacgc atggggcggt ctttgcgagt cgccgggatg agcatcacgg tcacatcggc    266520
     cacggatgtc atcgcctttc tcatcggttc gtccacgtcg ttgccagcgt tgaagaactt    266580
     ttgcttctac gcggcgctcg gcatcttctt tgactatctc taccaaatca ccttcttcac    266640
     cgctttcttg tccatcgacg agcgaagaaa gagcgaaaac aaagccgact gcttcttttg    266700
     cttggactgc cctcccgagg cgtgctgcgt gtgctgtacg ccgaaaaaaa tgccgaagtc    266760
     attgctgcaa atcgctttgg gcgatggtct cggtaagcaa ctcggaaaga agcccgtcaa    266820
     aatttttgtc ctcgcgttct tctccgccat caccgtcggc ggcatcatcg gttcgacgaa    266880
     gatgcaagtc gatgcggacg tgaacaattt catcccagat ggatcatact tgaagaactg    266940
     gttcgccgac acagacgcgt actttaccga gtacggtgac gcggtcgaga tctactccaa    267000
     gagcacgctc gatttgacga cggaagattc catcttgcgc gccgccacgg cggcgtttac    267060
     ggcgaatccg tacgtcatca acgaatccgt tcgttcttgg gttgacgact tttacacata    267120
     tcacaccact accaatggcg tgaccgtgac gtcgctcaac tatatcccat cgctcaagac    267180
     ctggctcagc accgctgctg ggtctcagta caaaaacgac gtcgtgtttg acgacgagac    267240
     gtcgccgacg gccatcgtca gcacgcgaat tcacggcaac cacataaaga cggacaagtc    267300
     gaacgtcaac gtgcaggcga tggatacgtt gcgcgccgcg attaacgctg tcagtggtaa    267360
     caacggtcga attttcgcct ttggtagtca gtggttgaat tacgagcagt acaagtcgat    267420
     cacgagcgaa gccatcagga atatttccat cactctcgcg gcgtgcttcg tcatcatcgc    267480
     catgctcgtc atcgagatta aaaccgtcgt gagcgtgtcc ttggcgctga cgatgatttt    267540
     tgtcaacatc gtcggttaca tgcacttctg gggtctcacc atcgattccg tgaccgtcat    267600
     catgctcgtc atcgctctcg gactcgccgt cgattactcg gcgcacatcg gtcgcgcgta    267660
     cttggaaaag actggcaccc cggacgaacg catcgttcgc acgctccagg acatgggtgt    267720
     cgccgtctgg aacggtgcga tgtccacctt catggctgtt ctcatcctcg gctcctccga    267780
     ttcgtacgtc ttccaaacct ttttcaagca gctcttcctg tgcatcgtcc tcggcttgat    267840
     gcacggcttg atcttccttc cggtggtgct ctccatgttg cgtcccgccg cgtacgccga    267900
     ggccacgtga ccgagctcac cgaaataatc ttattctttc gcatgctttc gtgcaatttg    267960
     ttccgttatc tccgtgtaaa atcactccga catatagaac gacctcacca ctcgcgctcg    268020
     ctcgacgacc gaccgaccga ccgaccgacc gaccgaccgc gtcacttcgc gccccacggc    268080
     gtcggcttcg tcgccggcgc gcgcgatgcg cacggcttcg tcgacttcgt cggcgtcgcg    268140
     ccgcgcgtcc ctgtctctct cgcgcgcgtc gtcggcgacg gttcgcgcgg cgaaccgacg    268200
     ttgcgatcgt cataacggtg tcgttcgttc gctcgaacgc gcgcgcggaa gcgcgcacgc    268260
     gacgcgcgcg acgccgcgat cgggcgatcg ggcgacgttt acggatgcgt acgcggtgga    268320
     cgcgagcttc ggtggctcgc tggacgcgtc gtcggatcga tgggacggaa cggcgctgtc    268380
     gtggagctct gagatggatt acgacgagga gttcggcgcg ccgtggtgga cgcccgaacg    268440
     cgtcgcgcgc gtgggacgaa cgatagaaag cgcggtgaat gacacgatgc gagagtggcc    268500
     ggacgaaggg ttgacggtcg agagattggt ggagacgctc gtgtcgagag gggcgcttcg    268560
     cgcggatgag cgcgcggcgc tcaggcagcg cgcgaaacgc gtcggcgagg attggacgcg    268620
     gtatgcgcaa gccgaggatc gcgcggtctt aaagctacga aggaagttgg taaagggcga    268680
     ggacattcgc gcgaatgcgt tgaagctgcc gaaaatcgac tcgacgtcga taaaagattg    268740
     gaccaagtcg gattgggaac gcttcttcaa ggtggttttg gcgtccgtca tcggcggtgc    268800
     cgcgttattt gcgagcggag ggaccgcgac accggcgcta gtggcggcaa tgcacggact    268860
     cgggctcggt gctgaagcgt tttcagcgtt cggtggtttg caatgtatgc tcggcgtcac    268920
     cggcgcgtcg ctgtgcgcgc aaaagatggc gaatcgcacc aagactgagc ttgaaaactt    268980
     cgacctcata ccgcttcgcg gcgcgcataa atcgtatgcc atgcatatat tcgttcctgg    269040
     gtttacgcgc gacgaccatg acttattagg cgcttggggt gcgacgaaca accaatacgt    269100
     ctccgtcgtg ccggaatccc gttccgtcgt ccccgacctg ggcatcgagt tcacgagtgg    269160
     cgcagatgga tcgatcatcg tacaggcgaa agacgattca atcgccaagc gtcatggtgt    269220
     tgtttctgga agcactctgc tgtcttatcg atcggttaaa aaacctggcg agccgagtgt    269280
     cgtgctctcc gaactcgtcg acatgccgac gtctgacgaa ttgtcgcgag tgccgcgccc    269340
     aatcgagatt cgactgcagc tccccgatcg cgatgatgag ctgaagaaag aaatgagcga    269400
     gctcgcgaac gaaatcaagt ctcaagtcgg taatcatagc aaggaagaac acttgccgac    269460
     cgctgaagcg gctattcgac ccgagcaacg gcgctggggc aatcgcacgg gcgagcaact    269520
     cgtgttgaat tgggagccgt ctacactcaa tgaactcggc gcgtgcatga catcctggaa    269580
     cgagacgtgc accgtcaact tttacttaac gcccgcagcg ttggctaaga ctgcgctcgg    269640
     agggatcgct gacgctatcg cttggccggc gacgcttctc tcgagcgcgg gtttcatcga    269700
     cgatccttgg gctttggtca aactgcgcgg aaaaatcgcg ggcgaagaac tcgcgcagag    269760
     cttgttagat ggccagcatg gtcatcgacc ggtgacgttc gtcgcgtaca gcgccggtgc    269820
     ttacgtcgtt cagagctgct tgcaaaagtt gtacgaagcc ggcgacagag gcaagaacat    269880
     cgtcgaccgc gcaatcttca tctcggcgcc gatttctacg tccaaggacg tttggcagcc    269940
     gatgcgtgag gtcgtctccg gtcgtctcgt taacgtccac tgccacacgg attggatttt    270000
     gcttctcatg tggcgcttca acatgctcga tcccatgacc agactcgcgg gcttgtccat    270060
     cgtcaagcgc gtgccgagcg tggaaaacta caacattaaa aatctccgtc acgcgcatct    270120
     ccccgacgaa atctcgcgcg tgctcgagga aatcgacctt caagagtaaa tattcctgta    270180
     attcctgtaa taacgatgca ctgaccctcg ccgccgcgcg tttcgctttg cctcgagtcg    270240
     gcgtccgcgg cgagcccaca cttcgtgcgg cgtccccaca cttcgtgccg tcgcgccatg    270300
     ccgcgaatcg tcgggctcgg cgaccccgtg actgatgtgg tgtatcacgc atctcgcgac    270360
     gcgatcgtcg cgctgttgcg cgacgcgcac gacgcacacg acgcggatga agttgaaatc    270420
     ggcggctgcg tcccagtgtc cgcgcgcgag ctgcgcgcgc tcgtgcgcgc gattcccgag    270480
     cgcgacgccg tcgtgagccc cggcggaagc gcggcgaacg ttctcaaagg catcgcacag    270540
     tgcgcggccg acgatgcgag ctcgacgacg tcgtgcgtgt tcgtagggac cgtggacggg    270600
     cgggacgacg tcggcgcggc gtacggggac gcgctgcgac gcgcgagagt tgaatcggcg    270660
     ctcatggcgt acgaaggcga tgatgcgagc gatgcagagg gagaaaatgg aataattgga    270720
     agcgcgcgat gcgtgtgctt ggtggacgat cgagggcaga gaacgatgcg gacgtatttg    270780
     ggggcgtcgg cgaagacgcg agcggacgat ttgccgagcg aggcgttgcg ctcggcggat    270840
     gtgttgcacg cggaggggta cgcgctgtat aaaccggatg ttttagcgcg cgcgtgcgcg    270900
     ctggccaagg aaaacggcgc gctcgtgagc ttagatttgg cgtcgtttga ggttgtgagg    270960
     cactgtcgag acgcgctgcg cgagacgctc gagtcgggcg tcgtcgacgt gatattttgc    271020
     aacgaagacg aggcgcgcga actcgtgcgt ggaatcgacg acgacggctg cgcgcgcgcg    271080
     caggagtcgc atccgcagtt gaacgggcgc gacgtcgagc gaccgagcga ggaaaccgag    271140
     ttggcggctt tggcgtattt attgcgttac gtcaaactgg ccgtgtgttc tcgcggcaag    271200
     cgcgggtgcg tcgcgatgaa cgctgaaggc gagcgaagcg aatctcgcgc cgaaggcgtg    271260
     gaagcgatcg acaccacggg cgcgggagac acgttcacga gcgggttctt gcacgcctat    271320
     ctcgccggtg gatcgttgcg acagtgcggc gacgccggtt gcgccgcggg ggcagaggtc    271380
     gttcaagttc gcggcgcgga gatggacgac gatcgctggc gtcgcgtgcg cgaaaagatt    271440
     gcgataattt taggcaagga gcgctcaccg agcgcgacga tgtagcgtta gcgataaaaa    271500
     tctggttgtc gtgttgttat tgattcatca tcacgaaatt cggccccaaa gtacttcacg    271560
     cgttctctcg ttcagatcgc gaaggtgccg acgggttctc gttgtcgata tttgcgcgct    271620
     cgaaggtgcc tctggtagca cgccgtgcac acggtgtgtt cgccagactt gcgccactgc    271680
     gatgattgct tcgtgcggtc gcacgacgga cagtgccgcg gcggcgcgga gctcggcttt    271740
     tgcgcctttt tcccgccgtt tttgtgcggc ggcatgcgct tgcgaggcgc gccggcggcg    271800
     ttcaaatccg ggtgattcgc gcggtcgctg aaacactggt gacacgtcca cacgggttcg    271860
     ccctcgggcc cggtttcttt cgatcggtac catcgcacgt cgggctcggt gcgcttcgcc    271920
     tttcggcaat ccgcgcacgt tcgttcgtcg cgcagtttcc gcatgcgatt cttcgttcgg    271980
     tgatagcact tgtggcagca cttccccccc gccgccgcgt cctccgacgg gtcgctcacc    272040
     aacagcatcc cgttcgcgga attcccgcac ttttcgcacc gcgtcagcgc gccctcgttc    272100
     tttctccgct ccttccgcgc gcgctcgtag cacttcgcgc accgcgtccc gagcgcgccg    272160
     ccctcgcgcc ccgtcgccgc ggtcccccgc gcgggatcgt ccgccgccac gcgcacccac    272220
     tcccccctgc acttcgtctc cccgcactcc acgcacgccc gcacgacgcc gtcgacgacg    272280
     tgctccgtcg tcgcgttcct ctttctccgc tctctctgaa agcacgcctt gcaccgaaac    272340
     cgcgtcgcgt cgcccccccc gtcatccatc cttcgccatc tcgacgtctt ctccgccccg    272400
     cacgtctcgc acgcccgccc atccgtcgcc ggtggtgcgc gcttctccgt cctctgcccc    272460
     ggcgtccctc gcgcgccctc cgcggtcgcc gccggtcgtt tccgcggcgt cccggtcgcg    272520
     cgtcccggtc gcgcgtcgag cgacccgagt ctcgccgtcg tctcgcgcgt cgtcgcctgc    272580
     acgcgcgcgc gatcgtcgct cggcgcgcgc accgaagcga cgagcgagcg ctcgcgcgtc    272640
     gcgcggcgcg acatcgttgt cgacggatcg cgcgccgggg cgtcgagagt cgcgcgcgtc    272700
     cgtgtgtgga tcgcgcaacg gtcgaatgcg atcgatggat gcgatcgatg cgatcgatcg    272760
     atcgatcgac gcgaggcgac ggcgcgatgc ggatgattcg gacgcgcgaa tcccatcgtt    272820
     cgcgcgcgcg cgcgttcgcg cgttcgcgcg ttcgcgcatt cgcgcgcatg cactcgcatt    272880
     catccgaggg ggacgacgac ggacgactgt gtcgttgtat catcgggtac gaagcccttg    272940
     gtatatgacc cagtgcgtcg tatacggtca cggttttcgc tatgtatcga aaatcagggt    273000
     tacgaagccc tcggtatgtg acccagtgcg tcgtatacgg gcacgaatat cgctgtgtat    273060
     acggacacga aaatcagggt ttagggttta gaagatgccg ccgacgcgcg accgcggcga    273120
     cgccgaccgt cgcgcgcatc gcgacgcgcg acgcgcgacg atcgcgccgt cgcgcgacgc    273180
     gcgatggcgc gggcgtcgac gcgcgacgcg cgcgacgcgc gcgacgcgcg acggcgcgac    273240
     ggcgcggtgc gtcgacgcgg gagacgcgcg gtgacggcga tgacgacgct cgcgatgatg    273300
     acgctcgcgg tgacgcgcgc gcgcgcggac ggcgcgacga cgacgacgac gacgacgacg    273360
     acggatcgcg cgagtcgcga gagcgcgatg ggcgacgcgg gagggccgag ggatgggatt    273420
     ccgcacccgg cggcggcggc ggcgcgcgaa cgcgaacgcg aacgcgagga cgaggacgcg    273480
     gcgcggacga cgggcgcgaa aacatcgcga gtggacgacg aacggaaaaa gtacgtcgat    273540
     gatttgctcg aggaggagtc ggtggacgat cgaaggcggg cgcggtcggc gagcgcgtcg    273600
     agggcgtcga gggcgcgagc gagacgcgcg gcggcggagt ggatcgaggc gtacgtcgag    273660
     ggcacggcga cgagagacgc gagcgggtgg gacgacggcg aggcgtggtt cgcgctcggg    273720
     cacgcgcgca ggtacgggtt gatcgaggga cgggagatgg acgagggggg ggcgatggag    273780
     tgcttgcggc gcgcggcgga gctgggggac gcggcggcgc acgacgagtt ggggttcacg    273840
     tacgcgagtg gatgggacgg cacgccgcgc gatggcgcga agagcgtgct gcactattac    273900
     ttcgccgcga acgcggggag cgtgcgagcg atgatggcgc tggggtatcg acacaagcac    273960
     ggcatcgacg ttcccgagtc gtgcgagacg gcggtgttgt actatcacga ggcggcgaaa    274020
     atcgtcgtgg aagaggcggc caaacgcacg ccgggggtgc tgccgtttca gattgaaaaa    274080
     caccgtctca gcgcggagat gagcgggagt aatctcgcgg cgaggcgcga gcgggatttg    274140
     gtgcagtatt atcgttacag cgccgacatg ggcaacgtgg acgcgcaggt gacgatgggt    274200
     cggttgtact cgctcggcgc ccgcgggttg cgcaaagacg tcggcgccgc gcgtaaatac    274260
     ttgacggacg ccgcgaacgc gggagacgcg acggcgatgg caaatttagg aaacatgtac    274320
     gccaacgggt tcggcgtcga cgtcgacaac gccacggcgt tgcactggtt tcgcaaggcg    274380
     gcgaagaaag gcaacgccat ggggcggtac gggctcgggt acatgacgct cgccggtcac    274440
     ggcgtggctc aagatcacgc gttggcggtg cagtacctga accaagccgc tgagcaaggg    274500
     ctttccgacg cgcgatactt tctcggcgtc ttgcacttgc gaggcatcgg cgtcaagcaa    274560
     gatttcacaa aggcgtatca tcacttcaac atcgcttcgc acgtcgggca cgaggttgcg    274620
     acgtataatt tggcgatgat gcagttgaac ggcatggggt ttccgtcgtc gtgcgcgtcc    274680
     gcgagcgcgt tactgaaaca actcgccgaa cgaggacact gggcgacgcc gatggagcac    274740
     gcgtacgcgg cgtacatgcg tcgtgactac cgcggcgcgc tcttgcgtta catgaaaatg    274800
     gcagagatgg gaatcgagat cgctcaagcc aacgccgcgt tcttgctcga acaaagactc    274860
     ggtgacgaag gtcgattccg cgaggacact caggtgaacc cagaggcgcc gagcacggcg    274920
     acgcgcgcgc tccactacca tcgactcgcg gcgacgcaag gtaacgtcaa gtcgcttctt    274980
     cgcatcggtg acgcgtatta ctgcggcaaa ggcgcgaacg tctcgctcac gaaatctatc    275040
     gccgcctatc gccaagcgag cgaacagaga aatccgcacg cgatgttcaa tctcgcgcac    275100
     atgcacgagc acggcatcgg catgcaaaaa gacttgcacc tcgccaagcg ttactacgac    275160
     atgatcctca acaacgcccc agacgccacc atcatcgtgc acctggccct caaaaagctc    275220
     gtgctccatc agtggatcat cgacaacaag gacaccatct tgcgcgtcgc caaagaaatc    275280
     cacgcgagtc cgacggcgca attcgtcgac ttcgtcgtcg tcgtcggcgc cgcggcgttg    275340
     ctttgtttcg tccttctcct tcgcgtcgga ctcgctcgcg ggtgaaaacg accgtcgctc    275400
     gctttgtaaa ccattcgtac gactagccat tccgccttcg cctcgccttc gccttcgcct    275460
     tcgccgttcg cgccgtcccc acaccgagtc gcgaccgatc gcgcgcgcgc tcgtccgcgg    275520
     ccgatcgttc gatgtccgcg ctcttcgact tcaagtcctt cctcaccacg ctcctgctct    275580
     tcatctgcgc gtgcacgtac gtcaaacttc gcgcgcccgg gttgttggat tctcaccgca    275640
     ccgggtttcg aggtgttttc tggaaagccg cgcgcgtggg cgagcgtcta tcgccgtggg    275700
     tcagcgtcgc gtgcgcgtac atgtcagtgc aaacgctgtt cgggtggtag tcgtcgagag    275760
     aggcggcgct gaggcacgcg ggacggttga gcggggacga gcgggacgga cgagcgcgcg    275820
     cggaacgacg cgcggcgagg cgaaggacga tgagcgccaa ggcgagcttg atgaagacgc    275880
     tcaaggcggc gaacgaggcg ttgaaagccg gggacgccgc gagcgcgcga ggtttggcga    275940
     aggaggcgat cgaggcggac ggggacgcgt acgaagcgtg ggtcatggat ggaaaggcgg    276000
     cgaacgcgct cggggcgctc gatgacgcgg tgaaatcgta cgagcgtgcg attgagatca    276060
     gaagcgagca tccagcggcg tatcaagggt tgaatgagac gttcgcggcg aaaggtgatg    276120
     tcgtggggcg gttgcgcgcg ttgcgagcgc tcgtcgacgc gcatcgagcg agcgggaagg    276180
     tggacaaact cgtcgagttt ttgaaacaag cgtgcgcgtg cgcgtgggaa aacgcgcaat    276240
     ggtcgcgcgt gattgagttc tgcggtgaga tgggcgagtt tcgcacggga gaggtggacg    276300
     aagtgacgcg cgttgagtcg gtcaaacgcg cgtgcgacgg cgcgttggct ttgcgcgacg    276360
     cgcgcgccgc cgaggcggga gaggcggcgg tgcaaatgct tcgttcgaag actattgcga    276420
     gtaaggctga agaagaagct gtgcgcaagt tgggtgcgcg agcgtcgcac gccgtggacg    276480
     acgaagactt ggcgacgacc ctgcgagctt ggctgagcga agacgtcgcc aacgcgtcgt    276540
     acgattcacg gacgcacgcc gcggaattgg atcgactcga cgcccgtctg gctgctgcgc    276600
     tttcgggatc ggtcgactgc gacttcgatg tcagagcgtg cgcacgtgag gcgctgactg    276660
     aggctactgt actcatcgat cgatggggcg aagtcgtcat tgatctcgtc gagccgctgt    276720
     gcgtggaaat cgtcgccgcg ctcgaactcg gtttagattg cgaagaagag ggatgggatg    276780
     ataacgaggt cgaggatgaa gatgaggcga aagtcatacg tttgctcgag cgcgtgctcg    276840
     ctttacgggc gaacacgatc gcgtcaggct ggctcgcgct cagggactcg cgtcgaagcg    276900
     gcgcatttac gcattcatgc cgtcccgcga ctcctcctcg agaagacgcc agaggtttgc    276960
     tgacgccgga gcttcgggac gaaattgtaa ccacgctcaa tcgcgatgac gagtcgaaag    277020
     tgagccatgc gtccgccgca atcggctggc ttgcgttggc ggagtccatg ctcgtcggcg    277080
     gcgagcgtgc ggacgtgcac gcgcttcagg ccgcgaccac ggcgatgaaa atcatgcgcg    277140
     aagacatcac aacagatgca ttaccgaaaa tgtcccgacg ggttttgatg gtgcacgctg    277200
     aggctatgct tcgcgtaggg atgtttcaag aggcgagggc tgcgtttgtc gtgcttgaag    277260
     gtccgcgagc ggcgcgagga ttggcgacgt acgcgttcaa cgcgcaccct cccgattacg    277320
     agcgcgcttt gcagttactc tccgacgccg ccgagactta ccctaacgtg cgacgcgtgg    277380
     gcgttgagct cggatggctc atgaccattg ctggatcttc agagcgtcga gccgaggggt    277440
     tggagacgct cgagcgagcg tgcggcgtaa agtcaggtga gccgttgtcg acgacgacgc    277500
     ccgctgatgc aagtgcgcga ctcggaatcg ctagatggcg cgctcaagtc tcagcggcga    277560
     aggggccagg gagcgcgcac gaggcgttac tcatcggcgc cgcgggcgat tcggcgcatc    277620
     gcgcggcggc tttcgcgcat ctcggtcttt cgtgcggtgc aagcggcgat gacgcgcgcg    277680
     cgcaaaagtg tcacgcgcgt gcgctggcac tcgacgctgc ggacccgaca tctgggcctg    277740
     tggcgtttac gaacgcgttg gacgcgaacg acgacgccaa ggcgacgtcc atttgccgcg    277800
     ctgcgctcgc cgtggattcg cggtgctcct gggcggcgaa cagactcgcg ccaatgtgcg    277860
     ctcgtatcgg tgatcacagc ggtgccattg gcgccttaca agtagtcttg cgtgtttctc    277920
     ctcgaaacgc cagcgcctgg gaagctttag gtgcgtcgta caacagtctc ggtaggcatt    277980
     ccgccgcgct caaagcattc gagcgagcga tggagttgag cgatgaagcg ggcgagggag    278040
     ttcgctcata cgcggcttcg caaacaggac acatttattt ggcgctagga tcctccgcag    278100
     acgctattga ggcttacgac aaagcactaa gcgatggcgt cgatcattta gccgccttgt    278160
     ttggttcggc gagcgctcac tcgtattacg ccaaaggcgc gttgcgctgg ggcgctccgg    278220
     gacgcgccgc ggtatcacta aaagccgcaa caaaagcagg gaaacgcgcg gtagaaatca    278280
     tgggcgacgg cgccaccgca acggtttgga agttgctagg ggacattcat cacctcgcag    278340
     cgcaagtcaa tgatccagcg ctcgggaagg acttcacatc catgcttgcc gcgcgaacga    278400
     ccgaagctcg cagcgcggtc gaggcgtacg gaaaggcatt gaacctaaaa cccgaccgtc    278460
     ccggtcgatg gcgtgacgtc gttgctgcgc tgcgattgca aaccgagatt cacaaacttt    278520
     caggcgacgt cgcagctgcg gaggcgagcg cggcaaaggc gtgggaacgc gccgcgggct    278580
     accttcgagt cgccccaggc gacccgttcg cctggttcgc cgcggcagcg atcgatgatc    278640
     ctgccgtaat ttcagacgct gtgcgcactg agcgaaaaat caccgcttta tctcgcgccg    278700
     tcgcactcaa tcccacgttt gctcaagcgt ggtgcgcgct gggccgtttg tatctatcat    278760
     cgggcgacgt cggcgaggcg actttatcgc ttgacagcgc gcgtatcgcc gacccaagca    278820
     gtggtgatgc gtggacagcg actgcagctt tgcacatagc cactggtaaa ttagctgaag    278880
     gacgcggcgc gttccgtatg gcggcggcgc ttggcgccgg cgcggaggca gatttgggat    278940
     gtgcgctcac ggcgtgcgct tctgggttga cttatgccaa agatgcttac gcggctgctc    279000
     gtcgggcgag tgaaagttta cccgttgatt ctacagcggc gatcgcactc gccctttgcg    279060
     ccgaatgccg agggttgttt gaggaagccg aagatgcagc ggcgcacgca gtggcgtcgc    279120
     tcgaaaacgt ccctgcgctg ggcggcgatc caaacgtcat acgaaccgtc gcagaagaat    279180
     gccgcgctcg agtgtcgcaa agacggttgg acgattccga ctcaaccgca tccacgagtg    279240
     ttgatggaga ctttgagaac acgcttgaac gcgccaaact tttggtgcat gcgcgacccg    279300
     gagatttgaa gatgcaggac gctttgacgc gcgtggcgtc gtgcgcccca gatcaccaaa    279360
     cagtcgtttc ggccctctct gcatgcccac catcttcacc aaacggtgac tatcgcgttc    279420
     aatcttcgct cgcgcgcgct gcggcggcgt gcgccttgaa cgcgtcgacc gttgtcggcg    279480
     acgccgaggg ctcggctcga gccaatcgat tcgttgcgcg cgcgacgatg ctcgatccat    279540
     cctctacaga gtccctcgaa ctgctcaaca tcgttctcga tcgacgtaag ggcatcgttc    279600
     gagaagccac gcaatcggaa gcacacgagc tccacgccgc gctcaagtct gccttgacgc    279660
     agagcgccgc cggcgattca gcctccgccg aagccgccgc gcgcgccgtc gtcaatcgcg    279720
     agcccatcac cgacgccgcg caagccgccg ctcgtctcat cctcgcttcg tttctcatcg    279780
     aacgctctcg acgcgacggc gacgccaaac cggcgaagga ggcgatcaag gtattggcga    279840
     agattccatc cgaagccggc gctcgagtcg ccgatctcgc ggcggcgctg gccgacgccg    279900
     tgtcgggatg atgctgcgtc accgtcgcac ttccgcgcgc gcgttcgtca gatgtcgaga    279960
     acgacgcacg tatgtctcgc gctctcaccg ctcgcggtgc gatcgcacgg tcgacaccgc    280020
     gtgccgacgg tgcataccgc gcgctcgcgc gtcgggacgc cgcggctttg gcttcgggac    280080
     gcgcgacgtc tcgcctcgct cgcatcgcgc gatgaagacg acgtcgttct cattgagtca    280140
     cagaacgtga atgatgaacg tgacgagagc gccgcgcgcg tcgcggcgac gccggtaccg    280200
     ccgcggtggg atgtcgccgt caacgcggag acgctcaaag aaatcgtaaa ctttggcttt    280260
     gagcgatttg gatttgaaga tgactcggat gcgttgaacg ctttggcgcg ggcgttgaac    280320
     tccaactgcg accgcggttt agaaacgatg ggtgacgtgg aaacgaaccg acgcgtatgg    280380
     ggcgcgaaca cgacgcgacc atacccgaca aagtcgattt gggattttgc gttcgaggcg    280440
     ctcgaggacg tcacgttgcg cgtactcgta atcagcggtg cgttgtcgct cgtgttggaa    280500
     acgtccatcg ggggcgatga ttcagagtat agttgggcga atggagctgc gatacttctc    280560
     gcggtgtgca tcatcgtcgt cgtggagtgc gtgaacaaca acgaaaaaca gagatcgttt    280620
     gtcaatctca acgcacgaag cgaacagaca aacgtcgcga gcattttacg cggtgggaat    280680
     cgtgagcttt tgaggaagag tgaagtcgtc gttggagacg tcgtggagct gcaagcggga    280740
     gacgttgcac cgtgtgatgg cttagtgatc gagagtgcgg cgtttttggt cgatcaaagt    280800
     cacattaccg gcgagagcga tgatattgaa aagaatcgtc aatcgataat tttcgctgga    280860
     agcaaagtca cgtctggacg cggatcgatc ctgtcgatcg gcgtcggtga gaattcgtct    280920
     agtggacaaa ttgcagagat gatcaatgtc ggtgccgaag agttcacgcc gctgcagttg    280980
     caactgcagg cgcttgccgt caaaattggt cgctggggca tcagcgccgc attggtcgtc    281040
     ggtttcattt taagctttac gctcgtattt gacgcaattc aagggactgg tccgcccatc    281100
     gaggcgctcg gtttggattt cttgcatatc gtcatcatcg ccatcaccat cgtcgtcgta    281160
     tcggtgcccg aggtgcgtgg gaaagcgttt ttcttttttt cgtgctcgag cgccggtggt    281220
     gttctgtgat gattgagtaa atttctctga attcgttgac gaaactactc tgtctgccga    281280
     cttccctctg agaacgccac cgaaaagctt tgagcgcgcg acttccattc atttctgtga    281340
     tgattgagta aagttctctg aattcattga cgaaactact ctgtctgccg acttccctct    281400
     gagatttgaa tggtcgtgac gcggattgac tttttcacgc gcaacctcga ctgacaatac    281460
     ctcgtttcct ttcgcaacac agggcttacc actcgccgtg acgctcgctc tggcattttc    281520
     cgtcaggcgc atgctcgagt tgtccatgct cgtccgcgtc ctaggctccg ccgaaaccac    281580
     aggcgaagtc acggctttgc tcatcgacaa gactgggacg gtgactgaaa acgaccaacg    281640
     cgttaatcgc gcgtggatcg cgggtgtaga tatcggacct ctaacgagca aaagcgtgac    281700
     gtgggcgagt gaaattgcaa acaagacgcg aaacgagcca acgctcgatc ctcgcgtggt    281760
     gaaactcctg tcgattttgc tcgcaatgaa ctcgaccata acctacgatg ccaaagggca    281820
     aattttgcga ggagcaaagg cggaaatcgc gctgttacga ttcgttaact caatgaacaa    281880
     cgacgaattg ttcgtcgcta cgattcgtaa gtacttccct ttggtcaagc tctttccatt    281940
     caacacttcc agaaagcgca tgtgcacgct cttcacactt cgcgacggca tcaacgacga    282000
     cgaaatggga gacgtgatcg ttcgtgcggt cacgaagggc gcatctcaag acatgttgaa    282060
     cttgtgttca tctgtcatgg acgaaaacgg cgcccatcat ccactcgacg ccgctacgaa    282120
     ggatcagctg tcgaaaaagt ttctcgaatg gcaagatgac gcggaaaggg tattactcgt    282180
     cgcgtataag gacatcgaac gcgatctcat cacaacgcat gaagcgacga atatttgcag    282240
     tcgaatgagc gccagcgacg ctgaatccga cctcacgctc gtcgcagcaa tcgggatgtg    282300
     cgaccctttg aggccagaat ccacgaagag cgtgcgttta tgtcgccgct ctggcgtcgc    282360
     agtgaagatg gtcactgggg attcgttgtc caccgctacc gcggtggcaa ggagatgcgg    282420
     aatactcgat gaaaaagaca tgagcaccga agcaacgatg acgggtgaag cgtttcgaga    282480
     agcaattcgt ggagaagagg gtcaagaaat cgatcaatcg aaactcgatg ccatttggcc    282540
     gaatttgcga gtgctcgctc gcgcgtcgcc acaagacaaa ttcatcctta ccgatggtat    282600
     acgcaacaca aagctatcgg gacgaaaaga agttgtaggg gttgtaggcg acggcacaaa    282660
     cgacgcgccc gcacttcgac gcgccaatgt cggtttcgct ttaggctcgg ggacggagtg    282720
     cgccagagat gcaagcgata ttgttcttct gcaggacgat ttttcttccg tcgtcgacgc    282780
     cattcgttac ggcaggaacg tgtttgaatc aatcgaaaag tttatcacgt tccaactgac    282840
     ggcgaattgt acgacaatca ttctgtccac cggctgcgca cttgtgtatg cgaagagccc    282900
     gctgaacgcc atcgagctat tgtttgtcaa tcttgtcatc gattcgttgg caagcttagc    282960
     gctcgcgacg gatgagccga gcgacgacgt gatgcgacag cctccgtcag atgcgagcaa    283020
     cctcatcacg tcaaccatgc ggctcaatat cttcacccaa gtttcgtatc agctcgccgt    283080
     catggcgtac ttgctcaacg aattcggccc ggaagacacc caaatctact gttgcttcgt    283140
     cttgcttcag ctcgcgaatc aaatcaactg tcgcaaagtt accacggagg tcaacgtttt    283200
     caagggtgcg acgaagaaca agctcttcgt gagcctcttg acgagcgaga ttttgctcca    283260
     tgtcgccatc gtgcaagcgg gcggcgcggt gtttcacacc tctccgctca atgcgggaga    283320
     gtggctgcga tgcaccgcgt tcgcgctcgg ggcgattcct ctgcgcgcat tgttcgtgac    283380
     attttttgtt tcactcttcg ccgcgtttcg ggaagaggac gcgttgcacc atcactagaa    283440
     tttttagatt acatcagaac tttcacgccg cgtcggcgaa cacaggtaac gcacagcgct    283500
     tccaatgatc gtcccacgtt tgctctcccc atttcgccgc gccgtgtttc aacgctctga    283560
     gcgtgaggcg ttcgtcgcca cggagaagtt tcgcgaacat cgccgcgagt tcggtggcgt    283620
     cggcaaagag cacgccgttg acgccctctt gcacgagctc tccgatgaca gcgtaccgca    283680
     tcgcggcgac gggtaacgat gccccaaaca tatccacaat tttcatcggt aaatctaaac    283740
     cgctgctcga ggtgtgcagg gagacgccca ggtgcgcgtt cgcgagcgcg cgcggatagt    283800
     cagcggcgtc gagccagacg gttcgaaacg ccacgtgctc gagcgcgagt tcgttaatct    283860
     tcttctcgta catcgtcttt cgtgggcctt gaccggtgat aattatgacg atgtcagggt    283920
     acgactttga cgcatgatcg cccttcgcgc gcttgcgcgc gtcgtacgcg acggcggcgt    283980
     caagcaaaac gccaaagtct tcatccggcg tccacgacgt cgaactcacg atgaacctcg    284040
     gcttattctt cgtcatattc tcgtgcgtgc cccgcaaaaa ccgatcgagc gcgtcctcac    284100
     tccgcgcgac gggcgaagcc tccagcgccg agcgcgcggg ttcgcttctc caaaattcca    284160
     acggcgtcgt cgcctcgcgc gccgcctctc gaaatcgctc cgccgcgcgg tcttccacga    284220
     cgcgcgcgcc ctcaatcttc cattctttct ccaaaaagtt tcccatcgcc ttcgtcacgc    284280
     acacgtgcgc gtctccccac atctttccct gcgtccgttc gtaccatttc aacattcgcg    284340
     tcgtcgcgct cgcgtcgccg cgcttcatcc cgaacagcgt gtacgcgaaa ttatgccagt    284400
     ccaccaccaa ccgcgtccgt cgcgcgcgac acacgattcc gcacaccaaa aacgtcggca    284460
     cgcacggcgg gttctgtatc agcatctctt cgcaccgctg catcgtcatc aggatccaaa    284520
     acaagtgcgc gcactgcgcc gcgacgcgcg tcccgagcgc gagcgcgagc gggacgcgcg    284580
     tcaaccaccg ccaccgacat cccacgacgt aacgcatcgt caccgcgtct tcgcgagaca    284640
     gcgcatcgat cggaggcgtg cccgagtaac acacgacgtc gacggcgcga tccgcgtcgc    284700
     gcgcgagcga cagcgcgtgg tattgcattc gaggcgaacg accaaagtcg cccaaaacca    284760
     cgagcgcggt gcgtcgtttc gtcatcgcgg cgcgcgcgcg ggcgcgagcg ggcgcgtcga    284820
     ggtcgcgcgc gcgcgcgggc cgcgtcggga cgcggcgaag acgcgcggtc gcgcgcggcg    284880
     agaagtgcgg cgccgcgctc gccagtgggc gagatattat tgataatctt tcgcatcgtc    284940
     gcgcgctctg gtcatcgacg ggcgaactta cccttaccgc gtccgccgcc gcgtccgccg    285000
     ccgcgtccgc cgccgcgtcc gccgcgacgg gcgtctcgcg cgtcttcaaa tttggcctcc    285060
     ttggcgttcg ccttgcgctt ggaccctggc aacgcgtcgc tgtcgtcgct gctgtcgtcg    285120
     ctgctatcgt cgtccgacgc atcgtcggat tcagattctt cttcgtctga atcgtcctgt    285180
     tcggaatcct cgctctcgct ctcgctctcg ctctcgctct cgtcttcgcc ttcgtcttcg    285240
     tcttcgtcgc tcgcctcggc tcgtctcgcc gccgccgccg ccttcgccat cgccttcgcc    285300
     ttcaccatca tgtcctcctc accgtcgctc tcactctcgc tatcatcgct ctcgccgtct    285360
     tcttcgccgt tactttcgct gttctcttcg ctctcatcgc tcgaatcgtc gccgccgagc    285420
     gacgccgtcg tcgcctcgac ccgccccgtg aggcacacct ccgcctcgcg tccgttgtgc    285480
     gacaccacca ctcgttcgcc gtcgccgaag cacagcccgg agcctccgat ggcgaactgt    285540
     tcgcgtccgg gcgcgtcgct cacgctgccg agcgcgatgg cgtcggtttt cccgtcgccg    285600
     ccgccacctc tggtcgcgac ttggacggtg attctttcgt ctttactcgc gcgtttcggg    285660
     ccctcgcacg tcagggcgac gtgggtgagg acgaccatgg acccgcgcga cggggtgaag    285720
     gcgcggccgg cgccggcggg gacgcggagt tggaagagtt ccatcgcggc ggcgtgtgcg    285780
     gcgcgagggc gagcgcgagg cggagacgcg cgttacataa ttatgcaaat ttagtgcgcg    285840
     cgacggcgcc ggcgaggaag gcggcgacga cggtggcgat gcgcttgatt ttatcgtctt    285900
     tgcccgcgcg tttggacgat gaggcgtcga tggcgtaacg catggaccat tggacgccgt    285960
     acgcgtcgag catgacggct tgcgtgagac gaaacaagtc gcgggcggct tctttttcgt    286020
     ttttgaagat gctcaccgac tccacggaga cgccgagggg aactttggat tgtttcgttt    286080
     cggcgatgat gcgctcgcac atggcgacga ggatttccac ggacttttgc gccgggttgt    286140
     cggcgccgag aatttcggct tcgacggctt ccgggacgga gcacccgagc cacttgatga    286200
     atttcatcgt tttttcgcgc ccacacgggg caaacgtgag cacgatgcgc ttgggttgga    286260
     tcccccgcct ctcacactcc gcaccgtaat cgttcacgag cttgatcgtc atatcagcgt    286320
     cgtaaatggc ttgagaaata aaccactccg cgcccgcatc cgtcttggcg cacagcgtct    286380
     cgtgctcgtt tcccttcttc gcgtgtctct ccgcgatcgt caccccaccg aacgcgcatc    286440
     ccctcttagt cttcctcaac atttccgccg cgcgctgaat cgtcggtccg gcgtactcct    286500
     gactcgaact cgcgcctccg acgagattat acgcgctcgt ctctcgcgtg gcttcgtcga    286560
     gccacgactg aaattcgccc tcgctcttcg tctccgccac gcacttgtac accacgctct    286620
     ccgtcccacc gctcgccttt cgcagcgccg cggcgaacgc gcccggatca tcgagctttc    286680
     gaaacggaaa cggtctcgcg tccgccgtgc gtccggcttc ttcttgaata tcgtacacga    286740
     tgtacccgtc gcacgccaac ccgcgcgact tttgcacaaa gttatccgcc gcgtccgcga    286800
     tggcgtccgc ggacgatcct tccagcggcg gcgtcacccc tgacggcgcg agcgcgcgtg    286860
     gcgatgcgcg tcagtcgccg cgacgcgcgt ttcgcgtttc gcggtcgatc gcgccgatgt    286920
     cgaacgtcga cgcgcgtccc gcgcgcggtt gaaaaagtga tcatccacgg cggcgacgcg    286980
     aatcgcgtcg cgcttcgcga gcggcgcgac gcgacggcga gcgcgacgca ccgaacagga    287040
     acacgggtcg cgaggtgtct tttaaggcgt cgacgagggt catggtgcgg gaaggcgcga    287100
     gtggggcggt ggacggcgcg tcccagtgtg aggtttggct tcgggacggg acgaggcgac    287160
     gcgcggcgag cgagcgagcg agcgagcgag cgaaaggaag aaatgcgtca tttgattgaa    287220
     atgcgatgcg atgcgatgcg atgtacgaat tatgcgggcg cgagaggagg gaaggcgtcg    287280
     tcgtcggcgc gcgcgggtcg gcgggtgaag gtggcggcga acctggcgcg gagggcgtcg    287340
     agggcgccgg cgagcgcggc ccaggcgagc aagccgacga tggagaggaa accgaagacg    287400
     ccgctggggg cggagagctt ggatcggagg agtaaaacgg cgatgcgtcg tcgtcgacgg    287460
     tccatttggg cgttgcaagc ggcacgctcg gatccttcgt agatctcgca cgccacgttc    287520
     tcggggccgg cgccgctgag cgcggcgcga gcgaaggcga acgaggcggc gaagaaagct    287580
     cggaaggaaa agtttgccat agagcgggcg aaagatgctc gagcgacctt gacgagctgt    287640
     gtgcgaatgc tcggcggagg cagcatacct tccggacgcg ccttcatcgc caaacgtcgc    287700
     aacgcgctcc cggcggacga gtccactaag tcgttcatca agcgattgat ggcgtccttg    287760
     gcgtgttcgt cggccgtgga cgccgcggcg ccgctttcac cttgctccgc cgccgtgttg    287820
     gcctgcgcgc tcaacgccac aagcttggac caattcacgt ccccatcttt atccaatagc    287880
     atttgttcca acgccttctt accgcgatcc gttcgcggcg acaaggcgcg gaaaatagcc    287940
     gtcggcgcgg cgacttcgta catgttacag ttggtgcgcg cggcggcgaa atccaacgtc    288000
     gtgagcgatc gaatgacgaa aaccatgtac ggcggaagat tgaaccgata ggccgtggaa    288060
     atcttcgtca aatccaacac gagctcggtg aagttggctc gcactttcgg gttaccctct    288120
     tcgccgtcca tgcacacttc aaacgcgcgc cggaactcgt cgtcggagat gactttccac    288180
     gaccccggac cgccttgcgt gtaatccgcc tggttgccgt tttcatctat ccacatctgc    288240
     ggttcttgag gtaacatatc cattattctc aagttatcga tcaactcccc ccactgactg    288300
     ttcaaaatgt tcaaaataca attcgccatg gcctcttgct ggtcgtcgtc gacgcggcaa    288360
     atgaggccaa agtcgagcaa cgcgagctta ccgtcgtcgg tgaacaacat gttcccttcg    288420
     tgcgggtcag cgtgcacgag tccggtgcga aacaactgcg cggaagaaca ctccactccc    288480
     atctgcacca tgagcttttg ctcttccaag ctgagcgact tcatcggtcg accttgaatc    288540
     cactgttgcg tgagcacctt cttcgtcgtc atgttcgcgt ggtgcctcgg gacgaagagg    288600
     tagtccaaaa atcgcaaaga ctttctaaac tcatccgcgt tgcgcgcctc gattgtgtaa    288660
     tcgagctcct gaaagatccc ggcgcctact tggtcgacaa tcttgtccaa atcctccgag    288720
     ccgttgagcc cggattcctc cacccaaccg aacccgaggc gaatgatgtg caaatccaac    288780
     gcgatcctcc tcgccatccc cggtcgctgc accttcaccg ccaccttact accatcatgc    288840
     aaccgtccag cgtacacttg cccgatgctc gccgccgcga tgggctccgg gctcaattcc    288900
     ttgtacaaac tatacgccgg tcccggcttg ctcgcgtctc gctcgcaaac cgcgccgtcc    288960
     caactcaact ctctcttaat gatcgcgtgc gcctcttccg tagaaaacgg cccgacttga    289020
     tcttgcaaca ccattaaatt atccgccgcc tcctcaccga ttatatccgg tctcgtgctc    289080
     agcgtctgcg ccatctttat aaacaccggt cccaaccgcg cgatgccgtc ccgcagcttc    289140
     ttccctcgcg ttcgccgctc caaaggaatc cccatccgtt cctcgtactg ccacgtcgcg    289200
     tacacccttc cgatcaccga caacacctcc gccatgcgtc ccgcgagttc ggtcgggctc    289260
     ttcgaaaagt acgctccgat atccagcatc tttcgcgtga acgagtagtc gccgcgaaag    289320
     tcgagcacga cgcgctccag ctcgtctcgc cccttcgcgc tcgtcgcctc caccgccgct    289380
     cgcgcctcgc gctcgagcgg taacagggca tcgttcgcgg cgtcttccga ctccgcgcgc    289440
     gggtccgcga tcgtccgcgc gcgcgtttta tcgccgcgtt tcgtcgcgaa cgacgggctc    289500
     gaggttatcc tcttcggcgc gcgcgttcga ggcgcgcgcg cgctgacgcg gacgtctcga    289560
     gggcgcgacg cgggcgcgcg ggcgcgcgcg tgacgcgcgc cgggctgggg cggcgcgcgc    289620
     gcgcgcgccg gagggacgtg cgcgcgcatc cgtcgcggtc tgacgaaatg tgcaacgtca    289680
     cgcgcggtgc gaggacgaat tggaggcgaa atcgacgcga gcgccgacgg cgggcgcgat    289740
     cgatgcgatg cgacgataca acggctaagg atcgatctta agtttttttg gggtgtcgaa    289800
     gacggcgtct gattcggcgt cgacgccggc ggcggcttcg cgggcggttt tggaagacgg    289860
     cttcgacgcg tttggtttcg atttcggcgt cgagcgaggg gtggcgacgc gctttggcgt    289920
     gcggagctct gcgggcaggg cgtctctgac gtgcttgagc tcggcgatga agagagcgtt    289980
     gtgggcccag ccgcagtaag ggccgaaaat ttccttcatc ttgacctcga tcgagcgcat    290040
     gacgcgaggg gtgacggatt tggcgtcgcg taattctggc atgtagtgct cgacggcgaa    290100
     ttgccacacg tgcgtgtcca ctgggatcgc ctcgtgcttg ttcagggaga acaagcacac    290160
     gcaagcggat actttgggac cgatccccgg gagcgtcatc agcgcggcgt gggcgtcgac    290220
     gtacggcgtt tcgtcgcgaa gcgcgcgcaa gaattcgtct ggagaagagc cgacggcgtc    290280
     gcccgcctcc cccaaagccg ccgcggagcc gacgatgaat ttggcgcgat aaccaaaacc    290340
     caacgctcgt aattcctcct ccgtcgcgcc gtcaagaatc tgcgcaacgc tcggaaacgc    290400
     ataaaatttc tccgcctcgg ccgccgccgc ggtctcttcg ccgccgttct cgtctccatc    290460
     atcatcatcc tcttctaaat cccgcgtcgt caccggcaac gcgtctccgt agtgtacaca    290520
     catcttattc accatcccgt gtatcctcga gatgtgatta ttgctcgaac aaataaaact    290580
     aaacaagcac tcgctcggat cctgccttaa catccgagcg ccgtccacgt gcgccgcgag    290640
     cgctcgaaac ctcccatcct tcgccgcaaa ctcctcgtac agcctctcca gcgacacgtc    290700
     cgcgttaaaa tattccctca tcacccttcg atcgtccgtc gcgctctccc atcgcggtcg    290760
     acagtacact ttatattcca cctcgcctcg ctcgccgtcg tcgacttccc gcactcgcac    290820
     cacgcgtcgt ccgacgacgc cgacgtactc tcgtccgtcc tcgcgacctc gcgcgcgcca    290880
     acggaagctc tgtcccgtgg gcagcgtgtg cttcagccga agttcgcgcg tcgcgagtcc    290940
     gagcggcgtc caggtcgcgt cgaggcactt cgccacgtcg ccgccgccgt cgccgtcgcg    291000
     cgcgtccatc gtcgtcgcgc gctcggtcgc gcgcgacgcc gcgcggcgac gcgcgctcgg    291060
     tcgcgcgcgc gcgatcgacc gggcgagcgc gagcggccgc gcgcgcatgc gcgtcggcgt    291120
     gtgcgacgca ccgcggtcgc gcgatgaatc ggcaacggaa tcagcccgtc gcgacgatcg    291180
     cgcgcgcgcg tcgtcgtcgt cgcgccgacg cgattcggaa ccgaccgaga ccgcgaacac    291240
     aaattttcgc gagcccgacc gcgcgcgcgc gcgccgacgc gacgcgaggg cggtgttaac    291300
     gcgcgcgctt tcgcgagcct cgcgaaaaga tgggaaaaac gcacgaaacg gcgcgctcga    291360
     gacgacacac ggcgacgcgc ggtgcgcgac gacgacgaga gacgatgccg gtggcgcaaa    291420
     taaaggtgcg cgcgcgtcgt cgagcgcgcg tcgtcgagtg cgcgcgcgtc gtcgtcgact    291480
     cggtggattg aacgcgcgtc gtctctgtgc gcctcgagac tgacgattcg tttctcgcga    291540
     aaatatcgca gatgattcac gccggaccgt ggggcaagag cgggtcgatc attcacgtga    291600
     acgtggaaca cgacgatttt aagtcggaca tcaagcgcag ggtgtcgaac gcgacgggga    291660
     ttccggtgcc ggagttgaaa ttaatcatgg cttctcccac gcagatcgcg gcggggagca    291720
     agagatgtcc ggggttggcg tacggaaact gcggcgtcgt cgataaggtt ggcttagccg    291780
     tggtgcaggc agaaagcggg gagaacccgt tcgtcccgaa gttgtcgccg aaccgcgtgg    291840
     acaataaagg gaactggacg agcgttgatt gaaccgaggc gtcttattcg aaagtagatt    291900
     acatctcgtc cgtttgcgtt cgttcgttca tcgtctattc gtgatcgtac tggtaatctt    291960
     caaagtcatt gtacatcagc ttcccatcca cgtcgcaatg cacggcgtcg aagcaaagct    292020
     tgcagaaaaa gctcgggctc tccgccgcga gtttgtcgcc gtacgtgacg tgagagctat    292080
     cgaacacgcc gcacacggag catcctcgtc tatacacgcg cccttcgcga atgactaaag    292140
     gaaacatttc gttccgcgtt tcgtcgtccg aatgcggcat gcgcacgtct cgaacgcgcc    292200
     atttgtgctc gcatttgcct tgatgcgtca tcacgtacgg gcgcccaatc gtcagcggca    292260
     cttggctgaa cttcacccct tccatgtctc gcgcggtgaa ccccttgccc tcgttgttca    292320
     tcttaaccgg cgctcccggc gccatgagcg cgtttttctt ttgaaattct atgagatgct    292380
     cggagtaatc agtcgcgccc ggcgtccgca tgtcgttgta aaacacgcct tcgatgaaga    292440
     gaaatccatt cttcgacggc ggatgcccct cgcgcgcggc ttggacgtct ctgaggcagt    292500
     atatcatatc cttgaacgcc gccaacggcg tggacccgcg cacgatgacg tccatcagca    292560
     agtatccctg tttgaccggg tgatacagtt cgatccaaat catcgcctcc tcccccgtcg    292620
     gcgtcgccgc ggcgtcgtgg cgaacaccgc caacctcgca atcaaacagc tcgcgcgcct    292680
     tccacatcac ctgcgtcacg tccacttctt ttcgcaacag cgcccgtttg taatctctcg    292740
     cctccaattg cttatgttcc aactcaacct cccgcatcga cgccaacggt gccatggccg    292800
     tctgctcgct cagatgcttc gtcatcaacc gcgctttctc cgccttctgc gcctcctcct    292860
     gaaacgtcaa ctgatgattc ttcgcccccg tccctcgatg attccgcgcg cggcccgcgt    292920
     cctcctccac cgacggcacg ctcggcatca acgactcgat cgcccgctcc agcgtcaccg    292980
     cgcgatgcgt ttccatctcg atatcatcct cctcgatcgc cgttcgacgc ttccgtccct    293040
     ttcccgcctt tttcgtcctc gcgctcgcct cgcgcgccgc gctcgacgcc tccgccgcgt    293100
     cccgcaaccg tttcaccgcc cgatgcgcct cctcgcagaa ccgtttcgcg tccttcgtcc    293160
     gctcggccgc tcgcccgatc gtcagtcttc gctcgcgtcg cctctccgcg tcgctctcgc    293220
     gccctcgcgc gtccgcgagc cgcgtcgaaa gattcgaatt cgccgttcgg tcgtcgcacc    293280
     tcaatctcct ctcccggctt cgcgtgcggc gcctcgggcg ggcagtgccg cgccagccgc    293340
     gcgcgcgact ccgcgtggtg tcgcagcgcg tcgctcgggg tgacgatggt cgtgtccgcg    293400
     atcgcgcgcg acatcgagcg cgtcgaggcg tgacgatcga tggtcgacgc ggcgccgatc    293460
     gtcacctcgc gacgcgaact cccgtcgacg acgcgcgagc gacgcgcgac gcgacgcgcg    293520
     acgacggcgc ggatggacgc gagcgtcgtg cgcctggacg cggcgatccg cgcgtgggtg    293580
     ctgctgccga tcacgctcgc gatgttcctc gtcggcgcgc tgcgacacca cgcgatgcga    293640
     ctgacgcgcg acggcggcgc ggcggacgtc gtcgcgcttc gcgaggcgaa cgtcgcgcga    293700
     cgcgcggagc ggtgccggca gttcgcggga tacctgcgac cgggggcgtt cgcggcgagg    293760
     cggacgtttt actgcgcggc ggacggcggc gcgctgcgaa agaagagcga aaaagcgtcg    293820
     ccgcacgcgg cgatgctgag cgatccgacg gtgatgacga aaatgatgac gaagaatgcg    293880
     atgatgatgg cgccgaacat gctgacggcg gcgtgggtga attttttctt cgcgggattc    293940
     gtggtggggc ggacgccgtt tccgctgacg cagcggtttc gggggatgct gcagcgaggg    294000
     gtggcgctgc agagcctgga cgtgacgtac gtgtcgagct tgtcgtggta tttcttgaat    294060
     ttttttgggt tggggggggt gtttcagttg gttttggggg ataacgagtt ggacgacgcg    294120
     gcggcgatgc aaaacgcgtt cgcgagcggg ctcaacgcgg acaaggcgtt cgcgcacgcg    294180
     ttggaggggt tggaggcgtt gaaacacgag tacatgatgc acatcgccga cgcgcgcgcg    294240
     acggcgatgc tgcgcgcgct gaacgagggt aagagtccgc gcgaggcgag actggcggcg    294300
     gcggcggcgc gatgaaaatc ccaaaggcta cactcgcgtc tccgacgcgc gcgcgcggcg    294360
     cgatcgcgag taatcgatgt aacttagttt aactccatcc atcgcgcgtc cgtcgatcgt    294420
     tcgtttggaa tctgtcgcgt cgcgctccgc gtccgcgcct cgcgccgtcg ctcgcgccgc    294480
     agtcatcgac gcgcggcgtc cgcgcgcgcg cgacggtcgt ccgccgtcgt ccggcgacgc    294540
     accgtcgcgg cgtcgatgtc cgacaacccc gacggcgcgt ccgacgacga gagcgcgcgc    294600
     tgtccgcact tttcttacgc cagagccaat ccatcgctcg cgcaacaatc cgcgtcgacg    294660
     agcgcgaaag acgcgtccgt gacgctcgtc gtcgcgcgaa acgatcgctg cgtcatcgcg    294720
     tacgacgatg ggtgcgtgct cgtcgcgagc gcgcgagacg cgcgacgggt gatctggagg    294780
     acgcgaacgc ggcgcgcggc gtcggcgttg gcgacggacg gcgcgagcgc gcacgtgctc    294840
     gtcgccgacg ctcgaggcga gatcgcggtg cacgagctgc cgatagacga tggaatggac    294900
     gcgagcgaac gcgcgggcgg ggcgcgcggg ctgggggacg ggtgcgaggt gatgcggacg    294960
     acgcacgcgc gcggcgtgac atgcgcggcg ctcgagcgcg actacggcgc gcgcggacgc    295020
     ggaagaggcg gcgtggcgta cggagacgat cgcggtgggg tgtacgtgcg cgtgagcacg    295080
     ctcttgggac ataaaacgtt gacgctgagc gcggccggag ggagcgatcg cggggcggcg    295140
     cgcgcgatgg aatggagctc gcgcggcgtc ttggcgtggg cgtgcgacga aggcgtgaag    295200
     ctgtacgacg tgggacggga tgaaaaggtg gcgctcgtcg agcgaccgcg aggaagtccg    295260
     gcggcgggga tgtacgcgcc gcacttgacg tggaacgaga cgtcggacat ggggaagacg    295320
     ttgctcgtgg gatgggcgga ttgcgtcaag gttgttagga ttcagaagca ggacgcgccg    295380
     gattcgagcg tcgcggcgaa acttttgcga gataagccga ctcgcggcgc aacgcgcgaa    295440
     attactcggg cggattcgtt tgcgaatggg ggctcgagcg agggagataa cgcgtcggcg    295500
     agcgaggcgt cgtcggcgag agtttacgtc gcgcgcgtga cgtcgatgtt tcagacggag    295560
     tattacgtcg cgggcattca accgttcggg gatttattgg cgattttagg ttggtccacg    295620
     gatggcgatc gcaaaaccgg ggcgcatccg gagttgcacc tcgtcacgca cgcgaatgtc    295680
     acgcaaaata tcgacgtcat cgcgacgcga gacgatccga caacgctcgg atgcaacgcg    295740
     tacgggttgg cgtgcgcgca acctatgctc gataacggga gctttgatcg atgtaaacac    295800
     gtcggcgatc atagatggtg gaagatcgga ctcgagccac gattttacgt gtactctccg    295860
     aaagatctca tcgtggccaa ggcgacgggc gcgagagagt ccatcgattg gttgtcgaaa    295920
     caggaagact acgtcaagct gctcgacgtg tgcgagttgg cgtcgcgata cggccacatc    295980
     gatgggagtg tgcgggatat tggacatagt gttttgcagc gcacgtttga cgagcgagat    296040
     tacgcgcaaa cggcagcttt gtgctcgaaa ttgttgcgca aagacgccgc cgcgtgggaa    296100
     acgtggattg aaaagttcat gctggctcgc aagctcgcgg agttacagcc gtatattccc    296160
     acggatgacc cgacgctgag cgtgcacacg tacgaagtgg tgttgaacgc gtttctagcg    296220
     gaagcagagc atcattcgcg ctttctcgcc tccgtcaagg cgtggccggc gcgtttgtat    296280
     tcgcctcagt ttctcatacc cgtcgttaag agcaagctcg cgtcgttgaa caccaacgcg    296340
     ggaagcccgt cggtggcgtc atcggtgtca tcggtggtac tgaaagaagc gctcgcggag    296400
     ctgtatctca acgatggtca acgcgaacgg gcgttgaact tgtacctgga catcggtcgg    296460
     ccgtctgtgt tgagcttcat cgctcgtcac gacttgctct ctttcgtcgc tcgcaacaag    296520
     ctttctctct tggcgcaact cgatattgac gcggcgatgt cgcttttcgt gcagaagcga    296580
     gaaagcttgc cgccgcgagt cgtgattccc gagcttttgg gtcaaggcgg cttcggcgct    296640
     cgagagttga cgcacgcgta catgtcggct ctcttcgacg aagacccgac gtgcttcgaa    296700
     gagttccacg acaaactgta cgagttacac ctggagttca acccaaaggc actgatgaac    296760
     tttttgaaga agagcgcgtc gtatgacgtc gcgcgcgcgt gcgccttact cacgggcaac    296820
     aaagcgctca tcttcgagcg cgtgtttctg ctctccaaac ttggttcgca cgaagaagcc    296880
     gtgcgcgtgc tcgtgacgga cgccaaggac ctatcgggcg ccataaagct tgcgagtgag    296940
     ctggacaacc ccgtcgagct ctggaacgtc atcatcaaag tctcaaccga ctcgaaggat    297000
     ttcatggcga cgcttctcgc gcacgccaaa aatctcgccg gcgaccccaa cgccatcgcc    297060
     ctcatccacg ccctgcgcga aggcgtctcc atcgacaacc tcaaatctcg cctcgtcgat    297120
     ctcatggacg aaaacatcgc cctcacgcgt tcgctgcgaa cgtcgtacgc atctgaatcc    297180
     aagcgcgctc gggaatcgta cgagcgcaaa accaaagtcg aaacgcgcgc gctccgccgc    297240
     catcaaatcc acgtcagccg caagcgatga gcgcgcgcgt cgagtcaaat ccatcgttcg    297300
     tgtctttcaa tagccgtagc catagtttct agccgtagcg tgtagatcga attccgaatt    297360
     cgagaacgcg tctcgccgcg cgtctctcgg tcgcctctcg acctccagtc acgtcgcttt    297420
     caccactcgc ccgcgcgtcg cgcgcgcgtc acgctcgcgc cgacccgcgc gcgcgacgca    297480
     ccgtcgaact ccgcgcccct ggccgcgttc tcacgcgcgc gcaccctcac cgcgcgcgaa    297540
     aatccgccgt tcgttcgagt ccaattcgcg cggtcgaatc gagtttcaaa atggttgata    297600
     acggcgcgat aaaaaccatc ggcgacgtcg agacggtcgt cctgagcgcg ctggaactca    297660
     tggaagataa agtcacgcga tcgtagcgcg cgctggagaa aaaactggag gaattagagc    297720
     gggaatgcgc gaggagacac gaggagttga agcagttgtt gacggggaag cgcgcgaacg    297780
     acgcgacggc gacgaagagc gcgaagagaa cgtcgagaga cgacgacgcg gtggcgacga    297840
     taatatcgat ggatttatcg cgaccgacgc cggcgacggc ggagaagcag gcgacgcgtg    297900
     agggggtacg tgagatgaac gcgcgcgcgc cgcaaaagaa actaaaggcg agcccgttgg    297960
     cgacggcgtc gatgaacgcg agcctgcaaa agtcggtgaa gaagaaaccg tccgcggcgt    298020
     cgccggaaaa atcgaagcgg agtaagaata gcgcggatct ctgcgcgcac atcacggatt    298080
     tgaccgcgga cgaacggttg ctcgtggaga cgggcaaggg gcggcgaggc gagcccatgc    298140
     ccacgcctct cggctgggcg tattggacgg cgacgagcca cgagacgctg cgcacgatcg    298200
     gcaacaaaat tggcctcgaa ccgttgacgt tatacagcat gaatcgttgg caccataagc    298260
     tcaagaatta cgacatcgat caagagttca ccgcgaactc caagctcagt ctcccggtgc    298320
     cgccgtttga ggactgggag acggagtaca tcgcggccga ccgcacaaag attttcacgc    298380
     gcctgctcga ccgcatcgac gaagtctggc ccgaggtttt gagaaacgcc gaacctctgc    298440
     gttcgctgaa gagggagcag ttgaaaacgt accccgactc gggcacgttg tatcgccagt    298500
     tgcgcgagac gttggacaac gccgaagccg ccgcgaaaaa attcaacgac ggcgacgaga    298560
     ctctccggga cgtccagcag tgtcgaaagc agctcgtaac gcgttggcat cgcgacgggt    298620
     tcttgctccc ggacgagatc gcgttcaaag ccgacgacca gtagccggat gtaaacgcaa    298680
     cgagcgaacg cgacgacggt cgtcgcgcga cgcgaccccc aaccgtcccg cacactcgga    298740
     cgcatgctcg ccgccgccct ccgcgcgtcg tcccgccgcg cgcgcgtccc gtcaacgtcg    298800
     acgtcgacgt cgctcgcgcg cgcgctctcg tccgcgtccg aggcgtcgga cgcgagaaaa    298860
     ccaaagacga atgcagaaat cgccgtgctc gccgtcggtt tcgccggtct cgcgctcggc    298920
     gcgtacaccg cggacgacgc cctgcgcgcg cgcggcggcg aagcgcgcgc gcgagatccc    298980
     gccgcggacg cgtgcgcgcg ggacgacgcg aacgcgcgcg ggagacggtt gcggcggtgg    299040
     gcggagacgc acggcgcgac gttcgcgagg agcgacgttc gggacggcgg cgcgcgcgag    299100
     ggcgcgggcg cgttccacag ggaaaacgat ggcgagagca tcgcgccgag aggattgcga    299160
     ttgcgaaagc gcgagagggc gctgatgacg ataccggacg cggcggtggt gaactggaac    299220
     acggcggcgg cgcacccgac gctcggatcg acgttcgagt cgctgttgcg gcgaggcgtc    299280
     gtcgacgaaa ggttggcggt gatgtgtttc ttcatgattg agcggagacg cggggaggag    299340
     agcgcgtgga aagagtacat agactcgttg ccgcgcgcgt acgacgcgcc gctgagcttt    299400
     agcgatgaag agttggagag ggagttgtcg gggacgacgg tgtacgcgcc ggtgaaggcg    299460
     caaaaggcac acgtgaagaa gatgtttgaa gagtgcgtgc gtccggcgat gcgagagttg    299520
     acgcaggcgg ataacgccgc gggatcgtcg ttgcacatgc tgccggacgt gagcgagaag    299580
     gagtttgcgt gggcgtttca gacgttttgg tctcgcgcgc tggcgattcc ggtcggcgcc    299640
     ggcggttctg tgaccgtcga tagcgtggtg ccgggcgtgg acatggtcaa tcatgcgccg    299700
     cgcgcgcgtg cgaacgcgag atgggaacac gtggaagatt catcgcgtcc ggatggtggt    299760
     tacgtcgcgc tcgtgtcggc gccgccgaat cgcactatga aagatggcga agaaattttc    299820
     atcaattacg gcgacaagtc caacgaggag ctgttgttca cctacggctt cgcgttgaaa    299880
     gataacgccg ttgaagaacg aatggtattc tttccgccct gggcgggcga cgcagagcat    299940
     tcggaagacg tcacgcgccg gatcgaactc cttcgtgcga agggactgcc gcagcacgtc    300000
     gtcttgccca cgacaccacc gaagcggggc ttcagagaca tggatgctac ggtccaagaa    300060
     acgttacgaa tttggtgcgc agacgttaaa gatttagact ctcgtcgccg cgtcgacgac    300120
     gcgacgcgac gaaagattca caacgtctta cgcgcgtcca tcggcgcgca atcgcacgca    300180
     ctacgcgatg tcgaacgcga ggttgatcac tccatcgcga gcgcgagaga gatcgcgtgc    300240
     gatgtctacc gacgagacat tcgccgtttg tacgacaatt acatcgaagc cgccgcgcgc    300300
     tgggagtcgt gaacgtcagc tagcaacttg tattatatac atcgtcgagc aatcgacgag    300360
     cgagactaaa tttgatcgta aattttatcg cggtggtatt aaaataactc tacactggcg    300420
     gattacccct ttaaatacgt tatgatccac gcactaaata tacgatatag tgctaaagta    300480
     ccctagaata tgataaatta taaaacccta ggaacaaaaa cagcctggcg aaagccctgg    300540
     ctggcgacgc gaccgacgtc actcgcgcgc gcacgcgtgc ggcgcgcgcc tcactcgcac    300600
     gcgcatcgca cgcgacgcga cgctcagacg cccacgatgc gacgcaccgc cgtcgcgagc    300660
     gcgcccgcgc gcgcccccgc gtcgcgcgcg gcgccgcgga cacacgccgc caatcgcagc    300720
     gccgcgtcga cgaaattcgc gcgcgcgcgc cgcgcgccgc gcgcggttcg ccagcccgac    300780
     gcgtcggagt acgtcgatcc gtcgcagttc accgaactcg agctgtccac ggcgcagatg    300840
     acggcgtacg cgagcaaacg accgagaggg cagttcgcgt cgaggttcgc ggacgacgag    300900
     ccgcgcaagg ggtcggacat cctggtcgag gcgctcgagc gcgagggcgt ggactgcgtg    300960
     ttcgcgtacc cgggaggggc gtcgatggag attcatcaaa gcctgacgaa gagcgcgacg    301020
     gggatacgga acgtgctgtg ccgacacgaa caaggggagg ttttcgcggc ggagggatac    301080
     gcgaaggcga cgggtaaggt gggcgtgtgc atcgcgacca gcggaccggg ggcgacgaat    301140
     ttggtcacgg ggttggcaga tgcgctgttg gactcggtgc cgatggtggc gatcacggga    301200
     caggtgccgc gaccgatgat cgggacggac gcgtttcaag agacgcccat cgtggagatc    301260
     acgagacaga tcacgaagca caactatttg gtgatgaacg tcgaggaaat tccgcgaatc    301320
     gtgcgcgaag cgttcttttt ggccgcttca ggacgtccgg gcccggtttt gatcgatatt    301380
     ccaaaggatg tgcagcagca gttggcggtt ccgtattggg agcccaaggt ttcgctcaac    301440
     ggttacttga gccgtctgcc cgcgccgccg acgtcgccgc agctccaaca agttttggat    301500
     ttgattaagg actcaaagcg tccggtggtg tacgccggcg gtggatgctt ggacgccgac    301560
     ttagagctgg ttgaattctg ccgcgcgacg gggattcccg tgacgaacac gctcatgggt    301620
     ctcggtacgt tcccgcagag cgacgatttg agcctgagca tgcttggcat gcacggtgcg    301680
     gtgtatgcca actatgcgat cgacagcgct gatttgttgc tcgcttttgg cgtgcgattc    301740
     gacgatcgtg tgaccggtaa gttggcggaa ttcgccaagc gcgccgccat tgtgcacatc    301800
     gacattgatc cggcggagct cggtaagaac aagaagccgt tctgctccat ctttagcaac    301860
     atcaagcccg cgttgaagac tttgaacaag ttgatcgcgc tcgagaagga tatgcccgat    301920
     ttctcggagt ggcgcgcggc tattgacgtg cagcgcaaaa agttcccgtt tccgattccc    301980
     gagcaagtcg gcgacgtcat cgctccgcag gcggcgatcg agctgttgtg caagatgacc    302040
     gaaggtaagg cgatcatctc cactggtgtc ggtcagcacc aaatgtgggc ggctcagcac    302100
     tacaagtttg acgagcctcg caactggctc acgtctggtg gtttgggttc gatgggcttc    302160
     ggcttgcccg ccgccatcgg cgccgccgcg gcgcgtcctg gcgatctggt cgtcgacatc    302220
     gacggcgatg gctcgttcgt catgaatatt caagaactcg cgaccttgca cgcggaaaac    302280
     ttgccggtga agtgcttcat cttgaacaac cagtacctcg gcatggtcgt gcagtgggag    302340
     gatcgatttt acaaggcgaa tcgcggtcac acgtacctcg gctccccgaa tgacgatttc    302400
     caagtctcca aggaagaggc gcacattttc cccgattttg tcaccatctc acagggcttc    302460
     cgcgtccccg ccgaacgcgt gatgcgcatg agcgatctcg aaggcgcgat caagcgcatg    302520
     attgaagccg acggtccgta cttgctcgac gtcatggtgc cgcacgtcga gcacgtgttg    302580
     cccatggtcc ccggcggcgg tacgttcgcc gacaccatca ccacgggtga cgggagaagc    302640
     ccggaagaga aggacatgaa aaccttgtaa gatgtttatg ttacgacgta ttagcaacgg    302700
     gcgcaaatat tttaatggat ggctaaattc tcaacaacaa aattctgaac aacgcgcgaa    302760
     aacttaacca aagaagacaa ctaaagattc atcaaacaca aacatcaagg agcggtttct    302820
     tctcctcgct cgatcacctc ctcgtcgacc accttccgct tcgccgcctc ggccgccgcg    302880
     taccgacccg tcatccacga caggacgccg ttccaggcga tgccgatggc gttcatccac    302940
     ggaatggtca aatgcttcgg tactacggca aagttgatcg cctgcgcggg cacccacacc    303000
     aaccaaagcg cagtcatcgt ttccggccca gtttgtttcc acttggcgaa tatttcgctc    303060
     ggaagatcta acagacgcgt cccgccttcg ctcacgacgc gaatgccgag aaacgtgggc    303120
     aggtagagaa acggctgcac gaaggcttgg tcgatggcga cgacggcgcc cgtggagagc    303180
     gccaagccgt attttggccg ccaaacatca ttcaacggtt tcaaccaatg attatacaaa    303240
     cgatattgaa acgcccccac gtacgttacg ccgaggacga agaaggacgc cacgcgattc    303300
     caatccaact caaagaaact cttctcctcc agcaccatct ggacgaaaat atccgagctc    303360
     acgcacttgg tgacggacga aaacatcgcc gtcgagaacg gatgccgcac caccgtgcgc    303420
     acgtacgcgg caacgacgcg cgcccagtaa tactcgcgca ccttttcgtg cgtcaacgcc    303480
     gcgaatcgac tcgcccccgc gtgtcgcagc gacccaaacg gatcgatgac gtccctcgcc    303540
     ttcgccttcg ctctcgcctc cgccgcatcg atcgcgcctt gcctcaacca caccggctga    303600
     aacggcctcg ccagcgtctt cccgagctgc gtcttaaact ccggatgcgt caacacgtcc    303660
     aaccacgacc ctccggcgtg tcgcagcgcc gcgctcggcg tcaccggcgc ctctcgccgc    303720
     caccgcttca gcgtcgccca cgcccgtcgc gccgcccgtc ccggcgcccg aggaaaccgc    303780
     gttcctatct tcgcgcccgc cacgaacgcg ctcgcgatct cgtctcgcgc ctcgcgctgt    303840
     ttaaacacct cgtaccacgt cgcgcccgcg tgtcgaagcg cgtccaccct cgacaccccg    303900
     cgcggcgcct cctcccgcgc cgtcccgccc tctcgcgcgc gcgcctgtcg tcgacacgcg    303960
     ccgaggggtt tttgccgcgc gtacgaccgc gcgtgtcgcg ccacggcgcc cgtcgcgctc    304020
     ccgcggcgtc gcatttctcg tcgaatcgcg cgtcccgtcg cggcgaccca catcgccgcg    304080
     cgtcgcgtct cggtcgcgcg cgcgtcgacg ctcaccgcgc gcgcgcgtct cgcatcgtcg    304140
     tcgcgcctcg gtcgcgtcgg gatgtgcgcg caacgattcg tgggtgttac agtgtagtcg    304200
     tactttggag gagcgagaaa attcgaaaga cgcgcgcgga ctcaagcggc gacgcacgtg    304260
     cgaccggtga accaattcct ctccgttttg accgcgccgc ttatttcgga cgccaccgcg    304320
     ccgccttccg cccagccgcc ggttttagag acttggagcg ctttgaagcg tcccatgttc    304380
     gcgccttcga cgccgaaagc cgcggggaga ttaccggtga aatcggcggc gcgagtgggc    304440
     tcgccgtgcg ttttcaagga gtgaccgatc cataacgatg tgtcgccggt tcgcctgacg    304500
     cgaagggtga aggtgacgtt gcgccaagcg tatcgtccgt acggcgatcc agcgctaccg    304560
     agccacgagt tggcgttcat ccactgcccg ttcgcgcttc tgtagccaac ttgtgttctg    304620
     aaccccgcat tagcgacgag atccgccgct tcggggctac tgctgtcttc cacgacgatg    304680
     gaaatataca ccgttttacc gtaggccgtg caacagctac cggcgccatc cccattcaca    304740
     cggtcgaagg tgcagtatct gcccgccgaa tatctgtcga gttgacatct atcgtccata    304800
     gtggcgccta tccaagcctc gttccaatca ttggcgtcgt ccaatgcagg gtgaaagaca    304860
     tcctccgcgg cggcggtgcc ggtgactcca tacccgtgtc caaaatagat catggggtag    304920
     ccattttcaa atactggttg cgagtacctc gacagcgcgt cctctgacgt gtcgaactca    304980
     tcaaagtcac tcggctgcac gttcaccaga cgtttcgagc ccccagaccg aaatccactc    305040
     gggcacgcgg cgagacactc gccattgtga aggaatttcc tgttggtaca ctcagtacac    305100
     tgaccgttca gacacttgtt gcagttagtt gggcactgcg tgcaccgtcg cgtcgttgga    305160
     gtcgacccac taccgccgta acccggcgga cacgcgagag aacacgtgcc acccagatac    305220
     caagagcctt cagggcacca aaactcggga atcgggcacg aagcagcgca cccaccgaag    305280
     acgtacgaaa tgtctttcgc gttgcgttcg agcgtcacga ttctgttcca gaacgcgccg    305340
     aactgttggg tatcgtgaca ttttctttca aaaagtggag cgccgttacc gccgatttcg    305400
     tacagcgcct ttccattttc actcttcaca acgaatccaa actcatagtt gagacccctc    305460
     gtagtgactt cgaagatgcc atctgaagtc gggcagacga gtcccagctt cgtagaaaca    305520
     catttcaaga aattcacggc gccgttgatc atctcttcac cttcgtgaag ttcaaagaat    305580
     ccgtggttcg gatcgttatc gtgcatattg tggtgaacga cgtacgcgtg cgtcagcgtc    305640
     tcgtcggggc caaaaatttc gggccacttg ttcctgattt tggcgtcgat gcagctcgtg    305700
     tgcagcgtga acctccgctc ctcgcgtctc tcgcgtctgc tcggcaatct cgcgaccgaa    305760
     tagtcccact tcccgaggcg accgaccccg ggcgaacggt acgcgctccg attcactgga    305820
     ttcaacgcgg cggtttcctc gctccgcgcg acgcggcgcg gcgcgagacg gtacgtcccc    305880
     agagacgtcg gccccggctc gacgacgttt tctcgcccca acgccgccga gctcgcggac    305940
     gccggatctg cttccaacgc atccgggcag tgatgttgta tcgcctccac cacgcgcgtg    306000
     tcccccggcc cgcacgccgg ttccgtgaac acgcactgct gttcctccgt cgtctgaatc    306060
     gccgcgcaat ccatcggctc cgcctcgagc gcgctcacga gcgtcggcgt ggcgttccga    306120
     cacgcctcca ggcacgccac gggaacgtcc gtgaacgccc cgagcgcggc gcgccccgtc    306180
     gcgccgtcgc cgccgaccag cgcgagcgcc gcgacgccga acgcgacgcc aacacccatc    306240
     gcgagccaca gcttcgactt cgcgccgccg cgcgcgcgcg cgccgtcgcc gtcgagcaac    306300
     cgcgcgcgct cggcgtcgcg catcgcgcct cgatccatcg cgcgcgcgct cgaacgcgcc    306360
     gcgcgcgtcg cagtcgcgtc gccgcgcgcg cgaaggatgg cacgatcgat cgacgcgcgt    306420
     cgaccctcgc gccgtcgatc gatcgacgcg cgtcgaccct cgcgccgtcg atcgatcgcg    306480
     cgcgtcgacc ctcgcgccgt cgatcgaccg atcgatcgat cgaccgatcg acgaaaaagc    306540
     gcgggaaaag gcgattgcga atcgacgcga cattcgcgcg ctccgggacg cggcgcgcgc    306600
     gcgtcgacga cggtgatgtc gacgatcgat ccgacggcgc gcctggacgc gcgcgggacg    306660
     cacgcgagag cggatgaggt gcgagcgctg gcgaaggatt tgaccgagac ggcgacgcgg    306720
     acgcgagggg cgagcgcgga cgcggacgcg gacgcggtga atcgcgcggc gagggcgtgc    306780
     gggacgttcg cggcgctggg attggtggac gccgaggacg tcgtgaggga cgggaagaga    306840
     ggcggggcgg tggacgcggc ggcgcgcggc gcgggggacg tgacggcgat actggaggag    306900
     cacgagacga cgttggtggc ggtgttggac gcgttgcccg agtttttaaa cgcggcggcg    306960
     cgcgcgctcg cgatgcgatt gcgcagtcac gcgcccgcgg gatcgtcgac ggtggcggag    307020
     gtggagcgtg tgttgaagat tcgcgaattg cgcagcgcgt ttgcgtttaa caaggtgatt    307080
     gcgaagaagt ttcacgagtt tatgcgcgtg catttcgacg ccgactcccc cgcgggcgtg    307140
     gcggtggcca agctcgggtg ggcgctttac gtgtgcgcca agtgcgagtc tttaccgacg    307200
     tttccagatt tgtactcgtg ctaccacttg ctcgtcgccg tggaggcgtt tttgttaatc    307260
     aacgccccgc gagagtcgtt gagaacgtcg ctgaagaata tggtgagcat gacggccaag    307320
     gacgagacga cgaagcttcc agatccgctt gccagtctca gtttggcgtc gaaagccaag    307380
     aaggataccg tgcgcgcgat gtcagacgcc gtgctcaagg tggtgaaagc gtcgttcccg    307440
     gaggctacga tggatgcgtc gaaacacttt gacgacgtcg cgccgagcga catgtgcgca    307500
     caaggcgtct tcgacggcga acgggacgtg tctgcatccg tcgtcgagcg ttactctcgc    307560
     gtcgcgtcgg aaacgtttgg ccgtctcgcc gttgacgaga cgttgtactt gtacacggag    307620
     atgacgagcg cagagtcgcg aggaaggaaa atcatcggcg atctcgccga ttgcaagacg    307680
     acaacgacgt acggatcgat ggccacgccc gctcgtcgca agcgcgtggc gcctttctcg    307740
     ccaatcagac cgaagaaaat tcccatacac ggcgtcccgc cgagtccgat gcactcgttg    307800
     cgcgggatca tggcgagcgg cgttggcggc gtcgccgcga cgccgattag tcaagccatg    307860
     gcgagcgcat cgtggttaca agacgtcgtg tgtggcagct cagatctcga gacgaaaact    307920
     gcagagttac aacgcttcgt tccggacaat cccgaaatcg tgcaagcgtt gaagaaaaaa    307980
     gtcacaaact ttgggcaaag aataggacaa gcgatccgcg aggacgcgct ggtgacgact    308040
     atgcgcacgg acatcagtcc gcacagcacg gtgatggatg agttagtcaa acagcgaaca    308100
     tccgaggtgt cgcacgtctt cttttacttt ttgaatcgca ttttgaagga cgaactcgag    308160
     cgaatcgccg gggacaagaa ggatgtcaac tttaccacct tgctcgcgag cgaccgcttc    308220
     acaaagtcgt tggtgacgtg ctgcatggaa gtcgtcgttt ccacgtacaa gacgtccacg    308280
     ttggcgtttc cggcgacgac acacttgatg ggaattcacc cgttcgattt agcgaccatc    308340
     atcgaaccct ttgtgcgcgc agacatgagc atgccgcgcg agattcagcg acacttcaac    308400
     tcgctcgagg aaaagacgct cgagcgcctg gcgtggtgca agggatcgac gttgtttgag    308460
     tttttgaaaa cgtttcacga gagcgcgcgt ggcagtggtg gagcgtcgac ggcattgccg    308520
     ggacgaacgg cgcctaggtc accgcaagcg cccaaacgcg tgagcacacc cgtcttgaac    308580
     gtggcgtctg tggcggaggt cgcggcgatt ggcggcaccg agcgcgaagg ctcgtcgggc    308640
     gatgacgcag acctcgtcat ggcgcagtgt caatcgccag tgcgacgcgc accgacgagc    308700
     gcgttttcag cgttttcgtc tcctttgcgt ggtgcgacga cgccgcgtcg gcgggtgtct    308760
     cgaggcgaac cgttgcccgt gcgtttcgcc gccgttcgaa atcacaccgt cgaacagccg    308820
     agtgggtgcg acgtgtgtgc gttcaaggcg ctccgaatgt tctttgccaa ggttatgcat    308880
     cttgcggcga gacgtttagg ggacttggcg tcgagattaa acttgtcaac ggacgtcacg    308940
     cgcgacattt acgcattgat tgaacacgtc gtgtacgaac agactaatct cgtgtacaac    309000
     aggcacatcg atcaaatcat cttggtctcg gtctacggtg tgtgcaaggc gagcgctggg    309060
     atttcctcga actcgctgca gttcaaggat atcatatacc aatactccaa gcagccgcaa    309120
     tcgagcgaag agatattctg ggccgtggtg ttggagcaaa acgaccccga gctcgaagtc    309180
     gtcaatcggg gcgacatcat ttccttttac aacaaggtct tcgtcgggcg ggttaaggag    309240
     tttttgttga cgctccgcga gcgccctgcg cgagatacga ccaatctaga taccgatggt    309300
     ggcgagcaag gaaataccgt gagcgtagac gacgcgcttc cgtttgggtt gtcgtcgcct    309360
     cggcggcgtt tacccatcga caaccaaaac atttacgtgt cgccaatgcg tcccgaacgc    309420
     gttgccagca tgctccacga aggcgcaccg ccaacgccac gcacgcgaag cctgtttgcc    309480
     actatcggtg agagcgtgta cgcatataca tcaccgtcaa gtgactttga agcaatcaat    309540
     cgcaagctac tgatggacaa gccgaaaccg ccgaagggac gcttcgcccc gaacgtcccg    309600
     aaattcggtg aacacgatcg ttgaggtttt gtctcttgaa tcggagttgt tttagaactg    309660
     tacaatacac gtcttccgta aacacaatcg ccctcgagtc ttcgctctcg agcgcttcgt    309720
     ctcgtcctcg tgtgactgtt cacgttcctc gggcgaggag aagtgtcact cgccacttca    309780
     ccgcgcgcga gcagacgcag aacgaacacc atgaagcttc aaaaaatcgc attgacgacg    309840
     tgcgcgacgc tcttgatggc cacgagcgct atcggcgccg agatgcgtgg tacgacggct    309900
     tcgagcgcgc ggcgactgct gcaacaagca gagaccaacg acgccgacgc tgattctcaa    309960
     gcgcgcatcg atcgcatcaa ttggctcggt cgcgctgtgg tagaaaatgg cgcgttccag    310020
     ttttggacca agaacgcctc tgggtactac accgccgtca acgactacta tgtcaaatct    310080
     ttcgagctcg aatccgacgc cgacgtcgtc ggcaagacgg acgtccaact gatcgtgctt    310140
     gtcgccggcg atcgcacgat cgaggacttt gaagacgcca aacccgatga aacactcgac    310200
     tccatcgctt ctgcgtaccg cgaacacgat atgatggtac aggaaaccgg aaaagcgact    310260
     cgattcaacg agcgcgtgat cgcggacgac cgcgtgtacg acgtcgtcgc catcaaagct    310320
     ccattcgaag gcgggacggt cgggatcgct atcccgcgca acgccgatga cgacatcaac    310380
     gtcgtcgtca cgagcgaatc cgacgacgac gaatccgacg acgacgaatc cgacgacgac    310440
     gaatccgacg acgacgacta gtccagtcgc cgaccgacgc gccaaccgtc gcgccggctc    310500
     gatcgcgcaa gactctcgat cgcgctcgcc gctcgaacga atcgaatcga atcacgacga    310560
     aatcaatccg cgagatctcc gcaccgcgcc tcgcggcgtc ttcgctcgtc gtcgcgtcgc    310620
     cgcgccgcac accgccgctc gcgtcatgct cgaaaccctc ggcgtcgcgc tcgacgccga    310680
     cgcgcgccac ccggcgcgcg cgctcgccat cgtcgaccac ctggacgccc ccgggacgtg    310740
     gctcttcgcc tcgttcgtcg cgtacgcgtg cgaacgaagc ccggtggtgg tgctctgcgt    310800
     ggagcaccac ccgagtgaaa tcaccgcgct ggcgcgtaaa atcgcgcgcg gcgcgcgaga    310860
     ttcggtgtca aacgccctct cgcgcggctc gtgcgcgttc gtggacgcgt tcacgacggc    310920
     gaggacgacg acgggggacg ggttgacggg gacgctgcgg gacgttcggg acgcggcggc    310980
     ggcgacgacg cgcgcggcgg gatcgggacg cgtctgcgtc tgcgtcgatg ggctcgatgg    311040
     gctggttatg agcgaatgcg cggatgatgc gatggagttg gagcggttct tggacgcggt    311100
     ctcgcgcgag gcgggggagg aggttgattt ggtgacgctg tcgcactggg acgtcggcgc    311160
     ggtcgaggcg tggttggcgg agagcgcgga ttgtgagatt cgcttggagc ctttgcgtac    311220
     ggggagcgcg gaagacgcgc agggaatgtg tcagacgacg cataggaata gcgcgtggcg    311280
     tgcgaaaggg gcggcgagac gctcgagggc gggattcgcg ttgacggagc tcggcgccaa    311340
     gttggagcgt cggcgttgat gtcgtcgtag tgttgtaaaa tacaagctgt aggaattcgt    311400
     ttgctagtga ttacgcttct tcttctgcag cctcgggttc gacgttttcg tccgcagcag    311460
     tcttcgaggg cgtcgccttg agcaccgagg gcggcgcgtc gacgtccatg ggatcgtcgt    311520
     tcatctccaa ctcttggagc ggcgtctctt ctcgggcatc caactcgacg ggtgcggcga    311580
     cggtggccgg ttcttcgacg acctgcgacg tcgtcgtcgt ggtcgtggtc gcttcggcag    311640
     cgtcgtgtac tctagtgaaa tccgtgttca attcgacgac gtcctcgagc tcgctcacgt    311700
     cgagcggcgc ctcttcgacg actcgctctt cttcaatgga cctcgcaccc tcctcttccg    311760
     cctcggcggc ggcctccgcc gcgagctcgg ccgctaattc acgctctact tccgccacgg    311820
     cttcatccgc ttcgcgctcg gcctgacgtt ccacttcgtc gtcatccaat tcttccgtgg    311880
     cgacgacgac ctccgcctcg atgacatcct tactagcttg cgcctcgtcc tccgcgattt    311940
     cttctggcga gcggttggcg gcgatgacgt tgctcatgat attcgccacc gttgacgcga    312000
     cgaacgcttc gttcgcggct cgctcttcag cctccttgat agcctttggc ttgcgtccgc    312060
     gtttcttttg cttctttgcg ccgccgcgaa gagcgtcttc gtcgacgtct tcttcgcgca    312120
     tcaaaggcac accgcgacca ggggcaggag caatgctcgt cgacagcgga ttgatgccgt    312180
     acctctccgc ccacgacgct ggtggcggcg gcggcatcaa gccgtaacgc acgccgcgac    312240
     gatccaaagg cgaggggtcg ggaagactgc cgccgagatc gcgcagcgcc tccgccgggc    312300
     gaagtcgcga cacgcggaac ggttgcgaag gaccacccgg ggtcttacgc ggccaaatcg    312360
     ggtttgccgt gcgtcgttcg atctgcgtga ccgtgggcaa ggagttgtgg actcgttggt    312420
     acaccttggt ctctccgcgc caatactcga gtggcttgga tcgttgacgc gtcgatcgtc    312480
     gcacgccacc ctcggttgct tgtaaaccgg ccaaggcgag cgacttgcgg cgctccatct    312540
     cggcgcgaag gcgcttgtgc ggcacacctg cggtggtgcg cttgcgcggc gccggtggtt    312600
     cgggaaatcc gtcgtcgtcg tacgccgcga cgtcgtcgta gccgagatcc atatcctcct    312660
     cgccgtaaaa gtccgcgagc ggcggttcgt cgcgctgcga attggcgaag tgtgacacgc    312720
     cctgcatctc ttccggcaac ccctcggggt attcggcgtg catcatcatc gccaacgcct    312780
     cggccgcgtt cggcgtaccc gcgctcgaca gccgtcccgc ctttgacttg gacccgttcg    312840
     gcgtcgccgc cgcgtcgtgc aaaatgtgcg tcgacggcct gaacatcggt cgcgggccgt    312900
     ccatcgaacc ggtgttcacc gtaaacggat tcacattcga cccaccgctg ccgctaccgc    312960
     tccccgcgct cgcgtgcgaa tcctctccaa tctccacgat gctcacgccg ttcggcgccg    313020
     aaaacgcctc cccgccgctc ccgttcgaca cgtccatatc gctcgaactt ttctgcttca    313080
     tgatccccgg aatgttcacc ctgatcacga acggtcgcgc gcgcacctcc cgcccggttc    313140
     cacgtcgcaa ccgcagccgt tcccgtcgac tcgctcgcgg cgcgtacgcg cccgccggct    313200
     tgcctcccgc cgccgccgcc gccgccgccg ccgcgcgcgc cgcgcgcaac tgcgccaacc    313260
     gcgtcgtcgt gcctaccgcg ccatcgcccc gcgcgagcgt tttcgtcagt cctcgttcct    313320
     cgcgctcgtc ccgccccgtc gcgtccgtcg catcgttctc cgcaccatcc ttcgcgcgcg    313380
     tctcgcctcg cgccgttttt aaatcaacgg tcggcgccac ctcgccccgg tcatccatcg    313440
     tcttgaacga cacccgtcgc ggccgcgacg cgcgtcgcgc gcgcgcgtcg tcgacgtcgg    313500
     cgtcgaaacg cttttcgcgc gttcccgcgt cgtcgccgcg ggcgttcgcg tcgcgcggcg    313560
     cgagcggcgt cgacatgaag tcggatcgtc gaccgacaga cgggtcgaat tcaaacgtcg    313620
     cgcgacgtcg cgcgcgcgcg gtgggaggcg cgagggcgcg cgggcgcgtc ggagacgcgc    313680
     ggcgtggcgt cgcggatcga tgcgcgacgc gggacgcgcg acgcgatggg cgtcgaggtg    313740
     tggggggcga cgacgcgacg cgcggcgcga tgggagggga accaacggaa tcgcggagga    313800
     cgaagcgctc gcgccgagga ggttgatttg gattaaaact aaggtggcta agggcgcgaa    313860
     acgcgcgatg tgggcgagaa ataatgtatt ttattcgcgc gcggtcgagg acgaagcgcc    313920
     gccgaagccg aaaaatttgc ccagacggga cgccgaggag gcggcttcgg cgcgctcgcg    313980
     atcggctcgg ctgggagcgc gcgcgaacgc gcgaggtcgg gcgacgcttt cgtcgtcgac    314040
     gacggtcgtg gtgaccttgc ggactcgagc gatgcgctcg cgctcgggct ttggcggcgg    314100
     tggcgaagat ggggtgaaag cgcgtggttt ggcgatgggc gcgtcgtcgt cgacgcgcct    314160
     cttggtcacc ttgcgaacgc gagcgacgcg ttggcgttgc gccttctcaa ttttgggttt    314220
     ggtgaacgcc ggagcggacg ggtagtcctc atcgtcgatg tcatcgtcga gtgcttcgtc    314280
     ggggaagcac tcggcgcagt agacgttgcc gtctggaccg ggcatgacgt cctccggttc    314340
     catctcacgc gagcagttcg gacactcgaa gggcgccggc gccttggacg aagcttgtct    314400
     tggcgcttcg tccatctcag gttcttcctc gggtacgcac cgcgggcagt aatccttccc    314460
     gcctggaccc gtgatgatat cgttcaacgt acacggtgcg tcgcaattcg gacacgtggg    314520
     gattgagcgt tttcgctgtg gcgaccaaca tttcggacag aattgcccac cgtcgacctt    314580
     gatgacgtct tcgggctcgc acggcgtctc gcagttcggg cacacgaacg gctccggcgc    314640
     gcaacgcggg cagtgtttct tgccgtcgac gtcgctgatc gcgacttctt cgggctcgca    314700
     cggcgtctcg cagttcgggc acacgaacgg ctccggcgcg caacgcgggc agtgtttctt    314760
     gccgtcgacg tcgctgatcg cgacttcttc gggctcgcac ggcgtctcgc agttcgggca    314820
     cacgaacggc tccggcgcgc aacgcgggca gtgtttcttg ccgtcgacgt cgctgatcgc    314880
     gacttcttcg ggctcgcacg gcgtctcgca gttcgggcac acgaacggct ccggcgcgca    314940
     acgcgggcag tgtttcttgc cgtcgacgtc gctgatcgcg acttcttcgg gctcgcacgg    315000
     cgtctcgcag ttcgggcaca cgaacggctc cggcgcgcaa cgcgggcagt gtttcttgcc    315060
     gtcgacgtcg ctgatcgcga cttcttcggg ctcgcacggc gtctcgcagt tcgggcacac    315120
     gaacggctcc ggcgcgcaac gcgggcagtg tttcttgccg tcgacgtcgc tgatcgcgac    315180
     ttcttcgggc tcgcacggcg tctcgcagtt cgggcacacg aacggctccg gcgcgcaacg    315240
     cgggcagtgt ttcttgccgt cgacgtcgct gatcgcgact tcttcgggct cgcacggcgt    315300
     ctcgcagttc gggcacacga acggctcgtc ttccggtaca tcctcccgca agcactcgtt    315360
     gcaatattcc aaatcatccg gaccgatgac gattttattc ggcggctcta cggtgattcc    315420
     gcaatttgga cagttgacat cctttttgcg aggacaattt ggcgcttcat gatccgtcat    315480
     accgcagatg gagcagcgcg aatccggcat gacgaggttc ttgcgcgcca actcatcgct    315540
     cggctcttcg agcaccgcat gcacactcgg cgactccgcg agcggttttc tctcttgtgc    315600
     ttgtttgaat tgtgcttgaa gcgcttccga tggctttacg gttggattcg cgcggaagca    315660
     gaaatcgcca aacgcgagca taaacttctt cgcgtccagc cggctccctt ggcagcacaa    315720
     gtacccgtca ggtttttcat cgatggcgtg cacccagcca tgtcgagcgc cgtggtacac    315780
     ccaatcagga gtcgacgttg agaaatcgct gtaggttcgg aagaccaatt caccaaactt    315840
     gttcaatgga ctctcggcac cgacggccca cattgttgca gccttgaact ccatcactcc    315900
     catgccatcc ttgtcggtga aagccttgta cacagtgctc acagcgcgga tgtcctcgtc    315960
     agacgatttg ccttgcttct tcatagccgt cgcaaatctc gcttgtgctt cgtatgcttc    316020
     gacgatatga tgcgccttag ggcgaagtat gcgttcaatc agccagcgcg ttgcgcgagc    316080
     gacgcctcta tctgtcaatg gcacgcgatg accgtagatg atccaagcca tgaagacgag    316140
     ggaagtgagg aattcatcca ggtgcattcc ccaagcgtgc ttgatacgca gctccaacct    316200
     cggaccttcg ctcggacata gcgatccttc aactgagcca gtctctcgat cgagtgtgag    316260
     acacttggcg agaagctcgg gcgccttgac ggtatcgaat accgatcgaa cgacggctga    316320
     gagctgattg tactgcgagt tcggtagttt gtcctcaatc ttgcaactcg agatgaggta    316380
     catgaactga cggtaagaca tgagcaagtg atcatccgca ccgacgcgcg tttcgttgtc    316440
     actcggacca gacggaatcg acgcgtatgt tttgaacaaa ccctccaaaa atgtccagtg    316500
     attgcgaatc tcgctccaga cgtaatagtt gccatcttcg ggctcgaaag aagtcagcac    316560
     atggttcggt ttgctgatac ccttgcgagt aagcggagcg gcatcttgga tgagctcctt    316620
     accattgttg cggtaacgca gaatcgttcg ttcaagaggt tttgaattgc tgtccgcaag    316680
     cattctgcgc aagtcgagca ccgtcatttc cggattttcg tgaacaagat tagattggag    316740
     caccggttgc gccaacactg gcccttcttc aatatccggt cgagcgtaca ttcgttcatc    316800
     ttcatcggga tcccttgcct cttctgggtc atcttgaaga atcaaccacg ctgtcgtctt    316860
     ggccaaatta ccgcggcggt tctcgagctg cacctccgcc ttccattgaa gattctcgag    316920
     cttcactgtg ttgtgagtgt cgagcagctt gcctttgtgc gagatatcaa atttacttcc    316980
     agtgacagca ggaagctcgt cttcacctgc gaactcgccc cgatcgcgca tgtctcgcaa    317040
     ttctgtggcg agcttggtgt gaacgcttga gacttcctcc ttgagacgaa cggggacgta    317100
     cacgttccat cctaaatctc tcgatcgatc cgggtcttct tcctgaatga tgatggtttc    317160
     tctcgtacgg aagtgtcgtt ctcgctcttg tttaattcgc gacacctctt cgtcgtcttg    317220
     ctggatgacg acgtacaagt tgccgtgacg agcgcagcgc tctccgggct cgcattcgca    317280
     gaggcaacag aaatcgtcgt agacgtcgtc gaggtcaagg tgccacggca acacgtcacc    317340
     gtcttcatcc tgcgcctctg ctttcgcttt tgcgagactt tcatcgtaag catcccaatc    317400
     agggtgaata tcaccaaagt aaccctggaa ccgaacaaag tgcgtgcgtc cactgacttc    317460
     ggatgtttgg aaaaagagct cctcttggtc caagtctgcc gcgtcgttca catccgtttg    317520
     aaaggctctt cgaacgttgt cagcttgttg aagtacctca tactcagcga gttgcttctc    317580
     ttcgtcctcc ttctctttct cttgcgtagc gtgcgacttc gcacgggcga gagtggagtc    317640
     tcgaagtaaa aagcgttcga ccgacgggtt gtgagcgcct gagacgccgc gtaaatcttt    317700
     ttgagcctgt ctgtaaaact tgcgatagaa gttgtatctc ttttgaatca tcttattctc    317760
     gatgaagagt tgcacttgtc gattcatgtc ccgattgtcc accgccgcgg cgcgaatcag    317820
     gctttgacgc accgggcgcg agagcatctt gtagaaagat ttggctctgt cgtcatgggt    317880
     acccagaatg gtctccacag tcttgtgtcg ccagagcgag cgaattcctc gagcgaattc    317940
     cattcgcagg tgcatgtcga aattaccact gaaatacaat ccttgatcac cttccgcgga    318000
     ctcaagctga agaatcgcgc ccgcactggg gttgagcagc gaaagtgtcg gtttccattc    318060
     gacccacttg cgttcgcgta gccactgcga tgagcggtgc tcactcacga caatactgat    318120
     gacacgagcg ataaaattct tgtaggcccg tcgaaggtgc cagtcagctc tcttgaacca    318180
     ttccgcgctg ctataggctt cgtaaaaaat ccctgcgcag aaaacaaaga cagccaccgc    318240
     aatggtttgc cacacggcat ttctggcgtt gtcctttgtc ctttggttga tgatgtacga    318300
     caccggcgct attgaaatga ctgaaagcat cagtacgagc accatggcga gcaaatgtaa    318360
     gccaagatac cgttttgctt cgctcgtttt aaaaggtcgc aaaatgacgg tcgcgaacga    318420
     cacagatatt acgagtagag cggtgagcgc ctgcacgaca ccgttgccat ttctgagctc    318480
     gtagcctaga agttgaatca agcacaacgc caatattcgt gccatctcgt tcacacgata    318540
     ccaaacgtag tcatctgtga actggaacgt tgcaaatcca atcaaatctc gtttccacag    318600
     cttttcccat cctcccatgg cgtactttat tacccaatac atgatggcaa agaaaccgat    318660
     cgggtacaga agcagggcga tcaaggcgag cgggaacagc tgttgccatt tcgtgcttcc    318720
     agtcgtcgat gagaaatatc cgaatcgcaa gttcggctgc gcacgaatgt acccaaactt    318780
     gtccgtcact gaacgatgaa atatgaaaaa gtcaaatgtc gcgatgatga cggcgacata    318840
     agtaatttga atgacgttca aaatacttcg aagcattaaa acccatcgcc tttgaccgtt    318900
     gcgaaccacc tcgacactcg gctgcgtttt gatgtaaaat ttaccccaaa tgtaggcgta    318960
     cagctgtgcg atgccgtaca tcagcgcaag tccaatcgcc ggcatggcca ttaatgagtt    319020
     ccagcgtgcc acaaaatcgt attcagtcaa acattcgagg ccgatgactt cggggttgag    319080
     ctgcagtatg tagcatagct gtagcagcaa agtcaagccg ggataatcgt tccagccaag    319140
     attgtatctc ccaataatcc caacttcttg cagaaacaca acgagcgata atatacgaca    319200
     atagacgatg tatcgaaagc tctgctcgtc gatgagccag ggcatcaaaa tcgccgaaag    319260
     catcaccaag ccgacgcccg caccatacag cgtgtgcccc aaagcagatc cgcacttcaa    319320
     acactgacca ttgagacggt agtagcccgt aacacacgtc tcacacgcgt cgtgaacata    319380
     tccctctgcg cactgcacgg catccgcact cgatccgccc gcggcgatgg cgtccacttg    319440
     cgccgagcca gcgatgcctt tcacaccggg acacgcctta tgggggaagc actgtcgcat    319500
     ggagatgggt tgcttgtacg agcgcgtttc aggagacacg acgtagaaac caggctgcgg    319560
     ataaggcacc gtgagattcg tctcagcaca atacgtccaa cgttcgggcg ctccgtagga    319620
     gtcgctgtac tctgggcaag gaaagcaata tcccggcacg ccgtaccaac cgatgttgca    319680
     gaaacattgg tcccttgacg ttgcgccttg aacagaggta ctcccagcgg gacatgaaat    319740
     gcaagtttca agtcccgggg tgtcggaata atacccattg ctgcatcggg tacagaagcc    319800
     tcgttgcacg gttccgccag ccatacccac cgggcaggca cgacaggtgt gcgagttgat    319860
     ggcgtcggtg acttgaccaa gcggacaaat cgtgcacgtg ccgtaagtct ttgcgtttga    319920
     cgcatcacca acggcgcttg ctgactctgt tgtgtaacct agcgcacaac caacatgaat    319980
     attcaatgtt gcctccgcac tcaccaggct gccgtcgtcg actacgcgaa tcgcgtactt    320040
     ctctaaagga ttctgccgaa ccaacgtggt cgacggaaag aatccgtaga gtaatggcgg    320100
     cgccaaataa taaagcgtga tcgatgtccc gttgttcagc agaccaacct gatcgagcgt    320160
     tgctgccgta atttcgtcca ccggtcgtcc aaatctgtcg attgatttgt accatcgacc    320220
     tctcctacgc gtcgcccaat cgctttgtgt gacgatcggt ttccacgtca agaaaagtct    320280
     aaagtatgga ccagcgtcga cgtcgtaagg cgaaaacgta atcggggtca aatctgcatc    320340
     tcctaagtca tccgccgctc ggtctctatt catcaccgcg ttcacctcca tgtttgccaa    320400
     aaatgggggg tcattcacag gtctgatcgt cacgttgact gaggcggacg ccgcgagagt    320460
     cgagtcgtaa ctggacacga tagagaactc aatactgtcg gtcccggtga aattcgcgct    320520
     cggcgtatag ttgaagtact gaaaattgag atttccgtca tcagtgttga cagaacaatt    320580
     ccaccaatac tgcacctcca cgtcattgca cagctttgtc acggtgccat tctgcacgcc    320640
     cgcattcgtt acggtgtaag ttaaagtgcc ggcatactcc gaagccatga tcgttcgccc    320700
     gaatcgaccc gtcattgtcg tatcttcatc cacccaatag tgcgagacta cgccgacggg    320760
     ctttccggtg gcggatccga cggctacgac gacgctggcc acgtcgtaca aagtcgtatc    320820
     gggcgtgtta tccaaactgt catccacact gtaaatgaaa taatcatacc cagtaaaatt    320880
     aatgtctggt atatactcga acgtcgacga ataagcgacg ggaccggccg gaagctcgag    320940
     ggttccgtgc gccggctgtt gacgaattgt ccacgtgagt ctgtcgccgt cgatatcagt    321000
     cgccgtcata gggcggctca acttgctgcc cgtcgcggtc gcatcaacct gcgtacgcat    321060
     tggaataata tcagccgttg actcgtagct caatatttgc tcaccgcccg cggcgactgg    321120
     tgcgtcgttg cgtttcgcga tatccactcg cgcctccttg atatccgtcg tgcagctatt    321180
     gtcgtacaac gccagcacgg cgggactaca atcgactgtg ccatcggtgt cgagaccgag    321240
     cgcttgtgcg acggtatatt caaccgttcc gcgaaaggtg aatacgtcta cgccgttttc    321300
     attcggtttg ggttgatacg acacgacgcc gtatccggcg ttcatctcga cttggaaagt    321360
     agcctcgact gctttccgag gatcacagac ggtgaatatg ttcgccacaa acggaatacc    321420
     cgagcgactc gtgaacaaag ggagctctcg ctgccagaga ggcccatctt cgtacgtgta    321480
     aaagttgact acgtttccgg acgagttgct cgtcaccgcc aactgcgtcg cgtacgtcac    321540
     cgtaatcgat tctaatgcta gtatgtccgt cggtatgtgt cctacttgat ctgcgccgat    321600
     gaacgtggag tccgtcccga acgttgcatt cgtgttcacc gtgttttgcg cgttcagtaa    321660
     atcaatccat gccgctggtg gcggtggtgg atacgcaggc gacggcggcg ggctgggtgg    321720
     cggtgggaac ggtggcggac taaagggcgt gggtgatggt ggcggcggtg gtgatggaat    321780
     ccccgaatca ttctttctat cccacgacca agtcgacgca cagagcgata acgaaagtat    321840
     gaagaagaaa tacaggcaga agatgatgac gttgtcgctg aagatgtaac gcaagcgctt    321900
     cagtgccttc ttctttgacg tgtacttgtg cgtctcatgg ttgccgcgaa gcttcaggtg    321960
     cacgtgacac gtctgtgcaa cgttgattcc atcgcctaag cgccaaccag gatcgacgag    322020
     acatcccaaa tagaacaaat ccacgctgtc cggatccggc tgatgtttca agcgccgaca    322080
     aaccattcgc ttcacctttt ggaagttgtc cgtcaacttg caagtcaagc taatggtctg    322140
     catctcgttc acgtcatcga tgtttcgcat gaaaagtgaa tctcgcaacc gcacgatagt    322200
     gggcaatcgg accaccacgg tgcacgtcgg gtctggatgt cctgaaatcg ccgcgatgat    322260
     cgcggccgat aagtacatgc ctaggaaaaa caacagcaac cccaggaaca ccaaaaaccc    322320
     atcgtctctg ctctctaccg gacacttcgt cgtatccgct ggcgctatca cgcattgtcc    322380
     ggcgttcagc gaccccgatg gacattcaat gtaactatac gggcaacagc ccgtcttgtt    322440
     cgtgttcaac aacgcgtccg gataaggata actcaccaaa gattgcgaca ggcacgagca    322500
     tgactctccg gcgaacccta aatcgcacac acacgtgcca tctcgctcgg agcaatagcc    322560
     gttaccgttg caatccaccg acggcgaaca cgaaaatttg caccgattgt ccccgacgcc    322620
     cacccatcct cgatcgcaca cgcaatcctt cgccgtggcg tcccacgtcc cgtgtccatt    322680
     acacgcgtcc cgaccgttgt tcgtcgtggt gttgaactgg cacagactac ccgtgaaggc    322740
     atcagggcaa atgcactcct tgctcgtcgc cgcgcacacg ccgttattct cgcacccgca    322800
     cgttgcgcac ccatccccag tcatcgcccc cacgcacgtc ggcgtcggcg cactgtacgt    322860
     ccaattatac gcacacgttc tacacggtcc gttatacacg cttccgctca tgcacgtcga    322920
     cgacgccgcg caccatccgc agccgtccgc tttcgcgcag tgctccgcgt tcccaatcgc    322980
     cgcgcacctc ggatcgcacg gtatctcaat ctcattcgtc accgcgttca ccactcgcgg    323040
     cgcgttcatc accggcggca aatgcgacac gcacagcgcg gcgtcgagca aggagtagca    323100
     cgtcgggttg tgtccgtcca cgtcgcgcga gtcgcaccac ccgcacccga cctcctgcac    323160
     gcactccccg aacaccgccc gtcgctggca ccgcagcggg ctcacgatgc tctcatcgct    323220
     cgcgttccac gccgtgagcg cgtcgtcgtg cgccgcctcg gtcgttcgca cgccgagcgc    323280
     gcgtcgcgcg tcgcgcgcgc gcgcgccccg agcgcccgcg gcttcgcttc ccggcgcgct    323340
     cgcgctcgag cgcgggctcg gcgcgagcgc gaacagcgcg agggcgacgc gaacgagcgt    323400
     tcgcaatcgc gcgtcgcgcg cgcgatcgcc gacgcgcatg gcgccgcgtt ctgcggtcga    323460
     cgcatccgcg gtgccgttca aatcgagggt gttacgccct ataaatatac gtgatacctt    323520
     aaaaacacac acactactag ggtttaacgc agaccaaacg tttatttcaa acgcggtcga    323580
     acgcggtcgg ccgcgcgcgc gcgcgtcgct cgcacaactc cgcgcgcgca tcgccgcgcc    323640
     ccgaacgcgc gagcgtcgcg cgacgcggcg cgatcggcgc gcgcgcgatg tcgacgcggc    323700
     gcgtcgacgc gcgcgcgacg acgacgacgc gacgacgacg acgacgacga cgacgacgcg    323760
     aggtgttgga cgacgcgatg gcgacggcga cggcgccgac gccgacgcga agcgcgcgaa    323820
     cgccgagcgc gtggacgcgg acggcgatga tcgcgatcgc gctcttcgcg gcgctcggcg    323880
     gcgcgacgcc gggccgcgcg gcgttcacgg cggacgtgtg ttacggcgcg tcgtgggagc    323940
     cgacggcgac ggcgacgaag gcgtccatag ggaaaaccgt caaaccggtc accgcggtgc    324000
     cgaaagagca cccgctgttc gtggacgcgt tcgcgaaggc gtgcttggac gtggggaacg    324060
     cggcggggaa cacgtcggcg gcgacgacgg tgcgattgcc gaagcggacg aacgcgggga    324120
     acgagaccta ttggtcgaac gcggcggggg cgtgcgcgac gtcgccgacg gtgagcgcgg    324180
     gacagttgtt ttataatcga gcggagatgg gatcgacgtt gtcgtacgcg gattcgaaca    324240
     cgggactgga gaaggataag acggttagga ttgtgttcgt gaacgacgac ggaaagggcg    324300
     cgcacgtggt ggtgttggcg ggcgcgaggg cggcgacggg gtcgagctct cccgaggttg    324360
     ggctgatgat ggagggtggt tcgttgaaaa actcggcgaa cgtggtgata gaggaacctc    324420
     ggggattgac gaacgtggtg acgagtggaa gcggatgcga cccgtcggtt tcgtcggcga    324480
     gcgattgcta cgagttggac acggatttgg gtcttggcaa gtttcgctgg ggatcgggat    324540
     cggatcaacg cggtatcgtc atcggccacg tcgccgatgt gaactcagag tttgcgatga    324600
     agttcacgct gctcgaacgc atcgattcgg tggagattgg gtcgtttgac gacgcgacgt    324660
     ttgcgatgtc gtgggagacg attccgacgg cgagcgcgtt gagaggtttc aagattcgca    324720
     gcgcaacttg cacgaatcac tgcgctttgc acgcaacgtg cgcgtcgtgc gccacggatg    324780
     acgcgtgcgg gtactgctcg gcgacgaaga cgtgcacgaa gattgatggt tcgtgctcga    324840
     gcggcttcga cgtcatcggc gagtgcctcg atacgtgcgg cgcggcgttg acgtgcggcg    324900
     agtgcgccga tcagagcgga tgtgggtggt gccacaccac tggtcggtgt accgcggcgc    324960
     agctcgacgg tagtgctccg caagatggta attgctccgc gtttagcgtg ggatcgagcg    325020
     cacagtgcgc cacgtgtccg ggcgccgtca cctcaactat gttgcccgct tacgtagatg    325080
     tcgaccgcgt cagcgcgttt tgcaacggca gggggacgtg tgataacatc acgcgcacgt    325140
     gtacgtgctc gagcggttac ggtggagacg gatgcgagaa gatgtgcccc ggcggcgcga    325200
     gcaatccgtg ctcgagaaac ggtttatgcg actcggcgtc gggaagttgc ttctgtaatc    325260
     ctggctacgt cggctcgcga tgtaacgccg ccacgatagt cgggacgtgc gaatgtggct    325320
     cagcgcacac atacttgaag tcggacggca cgcagcagcg cgtgtgctct ggtcgtctcg    325380
     attcgagcgg ctcgtgcgtg tgcctcgagg gatggtcggg tgtaaactgc accgtcgcgt    325440
     gcgccggcac cttgaccgtc ggcaccgagg tgtgtggtgg acacggtacg tgcaatgttg    325500
     gaaccggtca gtgcgattgt gagccgtgtt attcgcggga cgccacttca gggctttgcg    325560
     tgcaagacac ttgctcaacg tgcgactcta gcaatggagt gtgttcgtgc gtgagcggaa    325620
     gtatgcaatg cgcctgtcgg ggcgccttcg atgggtacgc gtgcgatcag tgcaagtgtg    325680
     gcgaccacgg tcgttgcaac gcactctcgg gcgagtgcga gtgcgacgca ggatacgctg    325740
     gcgagctctg tgagcgactc attgagccgc agccgacgtg cgccaacggc ggcacctgga    325800
     acgcggccct caagcgatgc gagtgcgcgg gcggatacac gggcactctt tgcgatgcag    325860
     cgtgcacgac gaacccgtgt aatgatcttt gcagtgggca tggtaccgtg aacgtcgatg    325920
     ggacctcgtg tacgtgtttc actggattct cggggagcac ttgcaacact tgcgccacag    325980
     gctacggccc gtatcccaag tgcggcgcga cgcttgcaaa cggagaatgt acagataata    326040
     tcgtagctta cactgggacc acaaacgtga cgatttcggg caaacagtgc cagtcgtggt    326100
     cgtcccaatc gccgttcgcg cacacgtacg cgtcgtcttc gggatcgacg agcaatgagt    326160
     gtcgtaatcc gtcgtctgac gcgcacccgt ggtgctacgt cgatcacacc gccatcaccg    326220
     ggtcgtacac ccgaggcgaa cctcgatggg agttttgttc agtaccgacg tgtaagtcgg    326280
     catacgtcaa cccacagaag atttgtggcg ttttcggtgg tgaaacagtc gtgacgtttg    326340
     acaaggactc cacctcggga gcgctcaacg ctgtcagcca acaggcgctg acgacgacga    326400
     acgacgcagt ggacaagacg aactgtggcg caatgaatct gactaataac gatatcacct    326460
     tgcacgcgaa cgccgcggcg catggagact ttgtcgctcg gttcgccgaa gactccggca    326520
     cgggttatgc gagacgcatc atcacgcaca tcggtctcaa agcatccgtt tcgccggcgc    326580
     acgatagcgt cgaagtgcac gccgatggca ccgtgaaagt caacagtgtt accaaaacga    326640
     atgatctgcc atactccgac ggctccactg gtgttttgtg cgtgtctgac tggatgcccg    326700
     tgagctcggg cttggcgagc acggagcttt tacaaataac gatttcagag acgacggtgg    326760
     caaacatcac caagtttacc gcttgcacgg gatgcgcggc gcagctcatc gtggtcataa    326820
     gtgtcccaaa tagtgttaca tcgacaggca tatgcgccac ggcgggctcg gcgaccagcg    326880
     taaacttcga cgagaacgca gaaggaagcg cgccgtgggg cgtcggcgcg gcgctcaacg    326940
     ccgcttgcgg gaccgacacg cacgaccctg gtagcgtctc aacggtgcaa gcgaagtggt    327000
     gcgaccagtg ccagtatctg ggtgaagtgt acgattcgtg cgtcgctcag atggcgaacg    327060
     aagggttcaa ctttgcccgc gccgccgtaa tagagggctg tcgcatggcg tttgtggcaa    327120
     tctacggata cgaccgcacg attccctcat atctcacggc gacggcgtcg acgggcgcca    327180
     cattagcgga caccgtgtac ccgtatagaa gctacactcc gtctgatgtg cagtttaagt    327240
     cactctccga caatcgctta gcttttgacg tgctagacgt cacggaaacc ttgccggaat    327300
     acatcgtcgg tacgacgaga acggatgggt cgcgcacgcg aatgactggt ttgccacgag    327360
     agtttacagg cgagaccgat acgacgcaag tgttcccgtt ccctagaatt gaagactcgt    327420
     gcagaaccgc gagtgatata ggatcaacat ctgggtatcg cgtgtacact atgaattacg    327480
     cttcggcgac ggatgaagct ctggagatta cgatgtgcgg ctccgccacg ggaaccaacg    327540
     tgggcgtcta cacaaaagac tttgtagaca tcccgtcggc ggattggacg cacaatacta    327600
     caagtgcgaa tgggaatatc actttcacat tcaccccgtg gatcgatggc ttggccacgt    327660
     atgaggctcg tttcgagtac tctttggcgt ccaccaagaa aaacgtgacg tttgacgtca    327720
     ctcgcacctc tgcaaacgtc aacattggct cgtttgaatt ctacccgccg acggcgtcgg    327780
     attcgtacgg ctctgttggc tttgagttta gcgttcccag tgcggaagcc gccgccacgg    327840
     tttcgttcac aatgtcaccc actggcactg gtgactcaac ggcggcgaac tctgcgttta    327900
     tctcgcttac cgcggttttc attcacgcga agaactacgc gcaagcgagt ttgaattacc    327960
     cgccattcgg tgggttcaag caagtctcgt gcgccaactt ccaagcggca tcctgtgggt    328020
     cgctgaagtt cacggcgacg caaaagacat attacatcgt cgtctctgga caaaaattcg    328080
     tctcgggggc gtacagcatg caaataaaaa agttgagcgc ggatttgaca accgtgtaca    328140
     cggtgagcag caacgcagcg acgtctttgg tgaggccgtt gacgggattg gatggcgcag    328200
     ccgatggcac gttgacgccg tacaaggtgg caaagtatgg cgataatatt cgcgtcgtcg    328260
     tgcgcgcgtc gcacgcaata gatagaccaa gaatcacgtt gggcaattac gcggttccga    328320
     gctcgaagat tgtctctgca ggtgccggcg cggagtattc agcgacggtg accgtcagcg    328380
     ctagcatggc gacttctgga cacatcacgg taaaggttga gcaggcgagt acgctcacct    328440
     cagcatcgta tgggtttaag acgtccactc atccgttggg ttctgacatc gcgctcgtcg    328500
     tgttggacaa caccgcgcct actgtcagtc acgcctgggt cgtcaatcca tcctacatgc    328560
     tcgcgccgtc gtcggcgcca tcgtcctgta cgaatcttac gacgtccacg ggtaaggatg    328620
     taaacgttac ggcggcaaag tacgcaaaag cgggagatta catcgccgtc atctttacgc    328680
     cgtcggaaaa cgtcgccacc atcggcggta ccatcggcgg tcaagctgcg acgaaatggg    328740
     tgcgagcaac cgcgccgcgc gacgtcacgc tcgcgatcga tgcttataaa atcacgatgt    328800
     ccgcggccta cgtcgatgcc gcgtacgcgc tcgtcaatga catcacactc agcgatggag    328860
     ttttaccgtt ttccattacg tttacggacg ccgttggcaa cgtcgggacg acaattaact    328920
     cggcgatcaa ctccctgacc ggtgtcaccg cgagttcacc tttggccgat cgactcagcg    328980
     ccgctcgatt attgtatgat aagtcaccac cgcgaccgga ctcatggtca ctgaggtacg    329040
     ctagttcttc ggagatgact gggaaccaag gttccaagcc agtgtattat cacggctttg    329100
     acaacgtggc ctcgagcgcc aaagagtatc gcatcggtga cacgctcgta ttaactggca    329160
     cttggaccga atatgtctct cgtccgtacg gcgcgtacat gcgctcgagc gcttcaagtg    329220
     gcgtgcacgt tccgcaatca gccattacga tcacggagca aggcggaaaa ctcaccggca    329280
     agttggagtg catggcgaag gagttccgtc cgcgagcgca agaagccgtg agcaccgcgc    329340
     aaggtttcgg tggaaccagt tacgtgacat cgacatatca caaatcatgg aaagtggaag    329400
     cgaacacgat cgatccatgt gatatcgtcg gtaaaggtgc gttggcgtgg agcgctcgcg    329460
     cggattgcca agcggagcac tacgccggga actcgttgtg gattcctctc tggtctgcgt    329520
     ggtgtcgtca cggttggggt accttgggtt acgccgtact cggaggcgtc gaccccgctg    329580
     gtaattcggc gacggcgttg cgccaagtga gcaaatctcc gaacaacgcc gacgctacag    329640
     ttgtgattgc ctcgtccgcg gtggcgggcg acgcgattat tcgcacgccg attcccatcg    329700
     ccgggaagat tgtgccaagc tggatgaact cagtccctag aggtgactgg accgcagacc    329760
     cgaaggtgat tgaagtgtac atcgagccgc aaaacgtgag atggaacgag tataggcgcg    329820
     tcgtcaaggt tggcgacatg ctgcagattc aattctacac tgaccaaccg gtgaagggcg    329880
     tgcgcgcgct catcggagac gataaagccc ttccgcctgc gacacattcc gaagtcgcga    329940
     gcgccatgaa cgtcgagcga ccgtgctcaa gcgatccgga catgcaaact tggctcggcg    330000
     cgcgcggctt gctcgcgctc gccgccgaag agtacaacga cggatcgcag ttttcgaacg    330060
     acgacgattg gttcgattgg ttggttcaga cgtcttacaa ctatcgccaa cccgtgccca    330120
     atgtgccgaa ttaccccaac gccgctgtta cgtgcactgg attctgggtc caacgcgggt    330180
     tacgacccaa cggtaagcgt tattcggtgc gccgtttgtg cccgaatagg tactacttgc    330240
     gacgaagctc gttcgccgct caggcgccgc ttacgtgctc ggatccaaat gatcgaatct    330300
     acaaagccac agacgcgtac aactattggg tgatcaactt tagatacgtc acatcgcatc    330360
     aagtcgtcaa tggcgacgga gcgcttcaaa tcaagtggca gttgaccacg atggacgacc    330420
     gcgtgttgcc gacgggtggc ggttggcaga cctctgcagc cttcttcacc tctgcggaca    330480
     cctctgcgga tgtcaatcat ctcaaaccaa cgtcaactga tgccgtcggc gctgcgtttg    330540
     atcccgcgat tagctgcggg cgcaacgcgg ataccgcgtt caatcaagcc gggtcggcag    330600
     tctgggccgt ccaagatacg ctggcgcctt cgtgcgcgag ctttgtcacg gatggttcgt    330660
     gcgcgagcac gactgtcgcc cgtgtcgcta acagtagcgg tacgacgttc cccaccgtca    330720
     cgaatccggc gaccaatgtc gccgagcacg tggccgtcgt tggtgattat atcacgctca    330780
     tcatcacttt tgacgagcat attgcagctg gagtgtacgt gactttgaac gacggggttc    330840
     tcaccgctcg agcgacgaaa gttgacaagt actcggcgac gttcaccttt gaggtgacgc    330900
     agacgctcgc ggctctgaat acgtttttgg agtacaaagt gtacaatctg aaggatattc    330960
     aggaagcgaa cacggcgacg gcgacgttta cgacgaacgt cttcaacgct gaaaagattc    331020
     ggttgcaaag cgcgagcgaa ttgacggcgt tttcgctcac caatggcgcg tgctcaacca    331080
     ctagtaacaa cgtgaataat cagtacgcca aaaatgggaa tacagtcaac gtctcagtga    331140
     cgctgccgct gccaccgagt agcgccaaca ccgtgctgac catccacgaa tccaaacttg    331200
     cgggcgtcta cgtcacgccg ccgacgccca catgcgtggg tacaccgaat gcgtgcacga    331260
     taaccatggc gcgtacggtt gacagtctct cagcggactt cgtcgatggt agcgtcgtgt    331320
     cttggtcact ggtggttatc ggtacgacca agtgtgcgca ccacgcttca agcttgtgca    331380
     tcacacgctt caagctcacg tcgtgtcgcc cgacgtttgc gtctgaagtc gtcttggatt    331440
     ttacgccgcc gtctctgact tcggtgcgtt tgagcgagcc tgtcacctca gcctcgctcg    331500
     tcaatggcac tggtcaagtg aaagttgacg tcgtatcgag cgaacaattg tatacgctga    331560
     cgtacacatt ggatacgcga ggccccctgt gcacgtacga ctttggcatg gtctccgccc    331620
     agtcgatgac gttgacgacg gatggtactc tcacgggtac gcacacaaaa accatcaccg    331680
     ccacgtataa ctccgcatcg cttcattgcg tgctcgaagt catctgtatc acgtttgtcg    331740
     gcgaagatat ggctggacac aagctcacga atccgacgac gtgtcgaagc ttttctccga    331800
     cggattccga agactatcca ggatggttca tgcttcacaa cgtcggcacg ggcccaagtt    331860
     ctgtctcgct cgcccgacct ctcgggttac actgcatgga tagttccgtg gacacgcagg    331920
     catgcgctaa cagcgcaagc gtgacttcga cgacgctcga gtacgggaat tatctcgctc    331980
     tcgacgtgtc gtcggggtac cctatcggca ttactgacat ttccgtggac ggccattccg    332040
     tctacgcggc gactggcttt ggctcgtcta cgttccaaaa tgataacgcg tggacgatcg    332100
     attgctctga tttggttcgc gacgacttgt gcgtgcgctt tgccacgagc gcgacgtgcc    332160
     aggcgtactt atgcccgacg tgccagtacg ccggtatgtg tgacttttcg tgcggctact    332220
     gcgatagccg tcgagccttc tcgaaaactc acaaactaac gctgaagacg accgatttcg    332280
     gattacccgc gaccgatttc actaacgaag tcgtcacagt ttcgtatcga acgaatccgg    332340
     cgattgcgcc ggcggcgacg atgaactcga cggatactct tacgtacacg gcgcccacga    332400
     cgagttcgtg tgctggtcga tgtggaggta cagcgccatc tggctgcgaa tgcaacccga    332460
     cttgcaaatc tcggggcacg tgctgcgctg atgccggcca ctgttgtacc gtcggtttgc    332520
     cgtccacagg cgctctcaac gtcgacggtg gatgtcttcg accaaacgcc gtgacgctca    332580
     gcgtcaccaa agagtcttgg ggggtggaca cgaaaggcgt gcgaaaatct aacgttaacc    332640
     gatactccac gatttacatt aaactgactg gaaacaagcc gattgacgtg cgacgtgtgc    332700
     tcatcggtgg cgtccttgtt ccagattcgg acgtcgccat cgagtacaac tcgcagacgt    332760
     ccgcgcgaca gtctctcaac gaagcgctcg tggcgtacgg caacggcaat gatgctcagt    332820
     tcacgtcgaa gagtgcagcg ttcgcgggga gtctagcgac cctcccaagc gctgcctatt    332880
     cgtgggatgg caatgagttt tcaatagcgt tcccggacat tccaagtacg ctcgtcgcca    332940
     ccattcgcgt caacggcgca aacctggttc cgcaacctga cggcgcgttg acgtatgagg    333000
     tagtgtaccg cgaacgttcg ggtgcgcctt actttacgga caacaccgag ctcaccctca    333060
     ccggaactgg tccgacgtgg ttgaatccgc cgtccatctc aagtgtctct tacgttctct    333120
     tgaacagcag ctcgacctgc gacttgtcca ctccgggcac accggtgacc gcggcaggca    333180
     acggtttgac aaagattgaa atcggtcatc aactccgaac cgtagtgacg ttcagttcgc    333240
     cggtcgtcgt tcgcaagtgg accgtggaag gtgcggaaac aaattgctac ggcacgtgtc    333300
     atctccacgg attgtgcaaa cttgacccgc acattttgcc gcccgacgaa cacgatgaag    333360
     ctgaatacat caccacctgg acgagctgcc gtactttcga tgccaaagaa atgaccacac    333420
     tcgagaatct tgaatgtggt gttcgcgaat tcattcgcgc cgtcgacagg tcaggtaacc    333480
     tcgtcatggg tgagcgatgg aacaacttgt attgcttcac attgccgccg gcgattccga    333540
     gtcaaggttt gataaaagta cgcggtctaa cgtcttgcta ccgaagtacg acgacgaaaa    333600
     agtttggccc aggttgtatc gctaccatcc acatcgaagc cgacggcgaa atcatggagc    333660
     caacggtgaa gtggtggaac acagcgacca acgcgtacgc aaactttcct tctgcgtgcg    333720
     tcatgacggc gacggatccg acgtctccaa gctcgttggt ttggacactc acatgtgcgg    333780
     gtacagccgc ggcgacattc ccacccagta actcttacac gttacagctt gaagtcagcg    333840
     acgtgcgagc cacggacgag tcaaccttta cgggcacggc gcgagacacg gacgacggat    333900
     acctaggctc agacaaggac ccgatcatcg tcgataacct cgcacccacg ccgactgcca    333960
     ctgtcccgct ttcgtgtgcg ttagtcatag gaagccaatc tacgataacc gtcacgtatg    334020
     cggtggaacc atcatggcgc ccgactgtga gcgcgtttgg cgcgcaggtt ggcggcgtca    334080
     ttgcgcaaac cggcgcgttg agcggatttc acaccgtttg gattgcaccg atcacagtcc    334140
     cctccgactg gttaggcggt agcccgatgc ctttcgtgat tacgaacggc gaggatgagt    334200
     acggcaacat cgacacgacg tcgcacggga actacttgtc caatgacaac gtgctcactg    334260
     gggatgtgaa ttgttcagtg aatgtcgatg cgccgcgagt cacgtctgcg acgtgcgcta    334320
     gcccgtcacc gagggtcgtc aaaccaggcg gaagtgtgac ggttgatttc tccaccaatg    334380
     ttgcagtgac gattccgtcg ggttgcgtca agatttccgg tgtcacggtg acgcccacgg    334440
     atctgggagg ctcgaaaaag agctggagag ccacggcgac cattccgtca gacccccccg    334500
     cttgcgacgg cgaagtcgct ctcagcatct gtgctgaaat caccgatacc ggaaataaca    334560
     ccggcgttga agtagtaacg cagttttttg gccccgaaag cgaagcttgt ctcatcgacg    334620
     gcacagcgcc ggtgctacag ttgattgatt tcaccagcga caacacgtac gattcaaaac    334680
     tggccaccgt cggtgacact gttcgactgt actttgaagc gagcgaaatg atcaccgcgc    334740
     ctacaattac gctattcgcg accgcaacgc cgtctgcaac ggcggttgaa acatcgggac    334800
     cgagtcgtcg acgattccca tcgacggtgc ttaatgcagg aggaacgcag tacgcgacaa    334860
     tatggacggc tgaatacgtc gtcgacggga ccacgccggt aggcgcgctc acatgggatg    334920
     cgactggatt catggatcgc gcgacgaatg atggcactaa aagtgcgtgc gcggattgga    334980
     acccgccatc ttgttcaatc gtgcacgctg cgcagacgac tgcgcaacga gctctcgaac    335040
     caagtatcaa ctttgtcggc gacgtcgttc aaacgttcaa caactttttg acgacgtcac    335100
     cgagcggtaa cgtgtccaca ctgttttcgt gctacgccaa ctcatcatcg acatcgctgt    335160
     cggcgttaaa tctggcaatc ttgaagacag atttgtcgcg gcacgatatc gtcgctggtg    335220
     ggatattcca acatcatctc atgacggctc aagatttgtg gtggcaacgc ggtggcgcgt    335280
     gtggcaccgc caatggtctc atgtgtcggt cgacatgcgg acggtgtaac gatgccgccg    335340
     tcgtggtaca ccgcacgaca accacgctca ctgttgcaaa cgtcaccgcc ggtggtaccg    335400
     ccattccggg agaccaatgt ccaggaggtg tgggtacgtg catgtgcaac ccaacgctcg    335460
     gcgatcaatc cgaagcccgc tatatcgtga gcacctcggc ccgcgatctt gtctcgaaac    335520
     caaccatcag atttaacgac actagcggca cggtgtatac cgtacccgag gccaacatcg    335580
     tggcggtgag tcctgtcatg tggcccacgc tcccgacggt ggattgtctg tccgaatcga    335640
     cggtgcgcga cggcgtctgc gacccatccg ccacgttgaa caatcgcgac ggatgctggg    335700
     acggtggcga ttgctgccaa gacacgtgcc ggcaagtctt tagtgacggc gcatattgcc    335760
     aggcgcaaga ttgccgggat cactcaatct caccagtgac agggcgaccg acatctgggt    335820
     tctggagctc gtacaacgcc aaggcgctcg tcgctcggga actctctgtg gagtggaagg    335880
     tgacgtttcc agtagatgac actcttccgt tgattgatgg cgttctcacc ggtaccgcgt    335940
     gctgcatgca agacaagagc ggcttggacg tgttgcacgc aaataagggt acattcgtcg    336000
     cgggtgcgcc gtgcctggac gctgtcttga ctcgcgacac gagctgtttg cttcgcgccg    336060
     cgcttacggc ggacaacggc gaattcgtcg tcaaggaaaa ccagcccgta tcgcttacgc    336120
     tcgaatttga agggaaccct cgcgggatga attgcacaat cggcggcgaa tcggtgacga    336180
     tgacgcagac acgcgccgcg agctctggcg tcaccgcgct gtggtcaacc acacggactt    336240
     cggtgaatgc agtcgacacc gcgattgcga cgcgcattgc ggcgtctgag gagcagaagc    336300
     gacgtcacga acttttgccc gaggttttcg aattaaatct gtgggcgaat tgttcacgag    336360
     gcgtcacgat tccgtttgag tgttccattt cggattgcgg tggcaacttg tttgagatta    336420
     ccgacgccgt cgacccgact tcagatgtgt gctttgacta cgtgcgcccg gacgcgacca    336480
     gcattgggca gacgagttcg aacacgtgca gcaacgcata cgccaaagtt ggcgatacgc    336540
     tgatactcaa cgttacgatg gatgcggacg tttccaatcc cactgcgtac accctcgctg    336600
     gcgaagcgtg cacgttgaga actttcggta cgaatgcgtt tacgtgtgac gtcgtcgtgt    336660
     cgtcgacgac gattgaagga cccgcaaact tcacgtttga cggcatcaaa agctctgtgc    336720
     ccgcgtatct cgacgccgtc aacacgagct acactgaact gaagacgtta tctccagatg    336780
     gcgtcgtcac gctcggtggg gatcgcgtca tcatcgatcg gactgcgccg acttttgact    336840
     ctttggcgat gtacagcctc gaagtcgcta acaagacgtg tcagaagcgg tgtaccgttc    336900
     gcgtcgccat cgacgccgcg gaagagttga gtagctgcac ggcaactatc ggtggcatca    336960
     ctgcaaacat caccggcacg ggctccgaac gcgtggcgga ggcgtacatt gatgagaaca    337020
     gtggtatagc ggcgggcgag attaccttct ccgtcatctg cctggatctc gcgtgcaact    337080
     cggtgacgac atcgacgctc gttggtgata cggacgccgt gatttattct ttagaccggg    337140
     acattccatt ggaagtcttg ttctacagcg atcgaccggg gcacttggaa attgggaacg    337200
     aaaacgactg tctcatgatg gagatgaggt ttcttctcgc cgtcgaactg aaagccatcg    337260
     tcatgggcaa tattacgaac aacgcattga gtctgtggaa catcaccaca accggtggcg    337320
     ccttggtagt cccgggtacg acccacacct attatctcat cactcactgc atcacggatg    337380
     cgtggggtac ggaggactgg ccagtcgttc cttggagttt tacgtacgac gatggattgc    337440
     aagacgttgt gtggaacacg acttttacgt ctgacgtaaa ctttccgcga gtggtccgac    337500
     tcgatttgga agacccagtc gcgacgtacg tctacgcctt caccactggc gctaatgatc    337560
     catcggctgg tctcggcgac gcgctgtact tggatatcat cgccagcgaa gcagttgtgg    337620
     cgccgacggt gacgtttggc ggcgtaacgc tcaacgccac cgatgtctcg caagtgggta    337680
     cgtctagcga gtggcgcgcg ggtccctaca tcgtgaagaa ttcgacggat gacccgaaca    337740
     ttctgaagga tatcaacgat tgtttcttat tcagcgtgac gctgaaggac ttagtcgatc    337800
     acacatccat attgtactcg cagcaagtca acgccacggg ctcgctcaat tgcgtcacgc    337860
     aacgcgttga cattgatcaa gatgcgccca ccatcgtttg gttgcaaact gagtacgtca    337920
     ccgctaccac cgtagacttt acctttgccg tagacgaact ctccaacgtc agctacgtcg    337980
     tcttgccgag aggtgcggtg gagccgacgc ctttggaagt tcaagcaggc accggagcag    338040
     cgggtactgg cgctgtggcc agcggtgtta aggaatatct tggatcatcc acgccttctc    338100
     cgggagctgg tgcgggtggc aagggccaag atgtgttaaa catcactggt cttctcgcgg    338160
     gtacgaacta cgacgtatgg ttcgtgcctt tcgatcgatt cggcaactcc caaaccgagg    338220
     cgcaaagtcg atggatacga accgttgggt tggacatgct catcaactcg cttgcgacgc    338280
     aagagggcgg ttacacggat gtcattcagg tgaagctcac gcaagtcccg accgcagatg    338340
     tttcggtgac gatcagtgaa cgcagtggta tcgggaacgt cgtcctcgtt gatcaggcgc    338400
     tgagtcttac ggattacgtc tcctcggtga cgctagtctt cacgcccatc acgtggaacg    338460
     tagcgcaaga agtcggtgtc aaggcggttg atgacattta tgtcgaagat caacacacag    338520
     aagagttgaa gtttgacgta cgatcgcttg atgtacgcta tgacgcgctc gtcgatccaa    338580
     accgtacggt cgtcatcgca gataacgacg agtgtggcgt catcgtgtat gaccccaaca    338640
     atcgaccctt ggagcgcact ctctcgtgca gcgcgaatgc agtgatcgct ttgttgaact    338700
     attccgtcgc tgaagatacg acggtatacg cagatatcta cttgcaagcg gcggtgcgag    338760
     gcgatgacgt gcgcgtgacg ctgacgagct ctgatttgac gcaaatttca tctccagcgt    338820
     ccgtcactct gacgttcaac gaaaccaact acaatttggc gcaacgtgtc ccaatcattc    338880
     cggtgtattc gtgcgtcgcc gcgcttgatc gctacgttcc gatcgcagtg agcgtagaat    338940
     ccgcgacgac gtgcggcgat ctcgtcgtac cagaaattcc tgtgtacgtg acagatttgc    339000
     aaaaggttgg attagcgttt accaaggcgc aaatcaccgg cccccccggg agcaactacg    339060
     agtttgacat gtatttaacg tctcaaccga catcagacgt tcaagtgtcc ttagcaacgc    339120
     taccagacgc tttcggagcc gacttgtacg gcagcgcgtc gttcaattgc ggtgcccaag    339180
     gtcctgtttg gacgtttagt gctgatgagt gctcggtgcc ggtgacttgc atcgtcacgc    339240
     tcgtcggcga cgacaccaag tgcggagatg tgacgttgca agttggcgcc aaagtcactt    339300
     ccttggattc aatgtacaac ggcatctcga gttcgccgcc gaatatgacc atcctcgaaa    339360
     ccgccaacgc cgcgggatgg tacattcgaa atgctgacaa cacagaattc atcgtgacgc    339420
     cgccagatgc gccaaacggc acgttgccgc tcgaaccgtg gaaggtgaat gaacagattg    339480
     aaacgggtat ttacaccatc acaccgacta cggcgttgtg caaaacagtg acccttcgac    339540
     cgtatattcc agacacagat tacgctcgat acgccaccat ctctccgaga caggtgacac    339600
     ttgaggctgg attctttggt ccgacgaagt tcaaagtcat cttcccgcgt aactacaacg    339660
     tgcccgtgac gaacgacatc gttcaaattt ggcacgatgt ggtgtacggc actgatgatc    339720
     cggattacct cgcattgagc ccgaatctcg gtggtagtgc cctgccggtc gaaatcgtcg    339780
     agtacgacgt cgccggttta ttgctcggca acggcgcgga gaacactgtt ctcatcgatg    339840
     agccgtgctc gacagatgtg acgacacagg tctcatcttt gggattcacg ctgtcaagtg    339900
     caccctctgc aactgtcgtc gtttcgctca gcgaaatgaa ttacaacgcg actcaactcg    339960
     cgattctgaa ggcgaataaa caccttgtgt tggggacaac gtcgctgagt tttacgccca    340020
     acaattggaa cattccgcag ccggtgatgg tctccgccat cagctatgac aacctgacgg    340080
     aagcccgcac ggcatatgta tgtggagata tgacttcaga tgatgatgtg tatcaagcac    340140
     tgaatcaaac gtgctacccc gtgcatattt gtgattgctc cggttcatgc ggtctcatct    340200
     cgtttgatga tcacgcgaat tgtactttcg ccgctgacca attaaacaac acggagataa    340260
     cgttcccgcc tagtatgaag caactttcat cttgttggaa catcagtgcc acctgtggcg    340320
     gtattcaggt cgcgagttta agcgctgccg gtcacgatcc ggtcatgacg aactttacga    340380
     cgctgccaga ttctgaagcg tactcggtga gtttggacaa agtacaacgg ttattttaca    340440
     ccacgcagtg gtctgtcatc gataaactcg agctaccgct atcgctaatc gatggtggta    340500
     tgcaaggctt gacggacgct tctggtacct attgcctcgg tatctcatca tcgagctttg    340560
     tcgtcaacaa cacagccaat ggtggcttgt ttgttgaaaa ggccgccccg atgagcgcct    340620
     ttgcgaattc tttcgaaatc ctcccggcag cggcgaatac atttgattcg gacgtgtaca    340680
     tccttgaggt gagagttctt gccggtgcat cgccgttgac tgattcgtat tcgctcaatt    340740
     gcacggatgg aggcaacttc tctgcaccag gcggatgtat catcggtccc agtcttcgag    340800
     ggtatttcaa taacgcaacg caagtcatga cgttcacgaa cacggcatat ctcccggaag    340860
     cagatttggc caacgcagct ggtagaaaat tacttggaaa gtacccatac ccatcacaac    340920
     gccgtcgcct gttgcaggca ccggctgcac cggctcctgc atcgacttct caatttgtgt    340980
     gggctgtgaa caacataacg ttttcggaca tcagtctaga tcccaccggt gcgacgcgaa    341040
     tgatgaacac tcgagtggtg gatcagttcg gggccatcgt cgaaggacca attctaaata    341100
     tcgataccga aggtgtgaac gatccaccga ttatcgatat cgacttgccg ctcatttaca    341160
     cagagaaaga gagtctgacg ctcaacgcac cgcttcaagc ctatgacgtt gacaattata    341220
     attggacgca gtgtgtcgtg aacatcacgg atatcgcaaa caacttcatg gctggagata    341280
     cattctcgta taacaaaacg gcaatcgtcg aatactatca gtattggaac acatctttgc    341340
     cagccggttt cgtggacatt gacgccacgt tcaccgactc tcagcgtaca gtgactttcg    341400
     ccggcctggc gccgccggcg gcgtacttgc gtgcgatgcg aaacctggtg ctgttgaatg    341460
     ctggaccggc aatgacagcg gatgatcgat acatcatgtt ctgctgtcaa gatccggaag    341520
     cgctcaacaa caaagggtgc ggtttgcaac gtgttgtgtt ccaacccgtc aacgaccccc    341580
     cgctagctga gaacaagatt gtgtatcttg ctgatcctcg cgtcggaggg ttaaccggtg    341640
     aaactgttcc aggatcagat cctgatggcg atacgttcac gttcaatatt tcatgcttac    341700
     cgaacaaggg tgacttgacg ttcaacaccg ccaccggaca gtttgattat gccccgtatc    341760
     caaacatgat cggcgacgac agattcgtgt actttacgtg ggatggatac accggtccaa    341820
     acgaacgccc gttgcagtcg aaatacgcca ctgtagagat tcgcatcggc aacggcgaga    341880
     cgaatcccgt ggcgcaagat attaacgtcg atgtgtggga gaactctgct gagtatttca    341940
     cgttcagcgc caccgatgca gattccacca acacggagat gacgaacgat attcttcgat    342000
     atcaaatctt tgaagaaccg gagctgaatg ttgcgggtat tcagcttgac actcagcaaa    342060
     tgagtggagg gaagcgatat tccgaaaatg caacgttcca gtacacggcg ttctcgagtt    342120
     ctgatctcgt caggcgcgtg tcagagcgta tggcgaacta cggcaccaac ttcgatttca    342180
     acactcttgc gcgagaaaat catccgggat tcaacgtgac gtccttcaaa tatgtcgcta    342240
     tcgatttatc tggtcgcgtt tccaacgtcg caaacgcctg ggtctgggtt cgactcacct    342300
     cagagacgaa ttctcgaccg agtgccaacg cgatgacgtt caccacgcct gaatctgtcg    342360
     gcgtggcgag caatttcgac acggcggatt ccgaatcccc gttgcaactg agacacacgc    342420
     tcccatcgct cgcgttacag ccgacgctcg gcgtcgctgc gcaagtcggt atcgctgcct    342480
     caccctacgg caaggcgttc acatatgaac cgtttccatt ctattacggc gttgatgtgt    342540
     tcgaatacct cgtcaccgat ccacacgggt ctacttctga tctcaccact atcaccgtca    342600
     cggtctcgca agtcgatcag ccgccacaag gcgcatgcgg agtgaactct actcttaagt    342660
     cctcagccga tccgacgtac gatctcaaag gacgaacggc ggaactgagc gtgctcatgg    342720
     gttatcaaat tatccgcgcc aagacgatgc gatatttgat caatcccgag cgaagagact    342780
     tggagtttta caattacttg ccctttatca atgatttgtc caagtttgac agcgtcatcg    342840
     atcatcaaaa tatatttttg tcatgtgggt cgacttcagc tttgacaacg gctgctattt    342900
     atcacgacca agtgaccgcg gtggcgctct tggcgtacga tgtcgaccaa gctgtgaacg    342960
     acacaatacg gtacgtacta agtgaactgc cgactatagc gtcgtcagat gcagcacgag    343020
     gtacagctgg gtacgctggt actctttatc gatacgtcgc cccgaatggc acatattaca    343080
     actccaccgg gacgacagtg tactcttaca catcagattc cgtcaccgga ctcacgccgc    343140
     tcgccgctgg tgataccatc ggtgacgccg cgaatggggc tgtaatgctg cttttcaagc    343200
     ctcgagaata catccacgga ccaatcacgt tcaaatggca tgcggtagat acaacgacgt    343260
     cggcgcgagg cgacgacgtc gcgatgacaa tcagtgccat gtgcagagga ggtgaaagcg    343320
     tcaacgctga ccatggagaa acgtgcgatt tgtgcccagt tggttcattc aactcggcga    343380
     acatagccga tcaacaaagc tgcgtgcagt gcccggcggg gagttacacc tccgccacgg    343440
     gctcgactat ttgcgtgcca tgtcccgcgg atacgtacgc gagcaccgcc ggatcgcaag    343500
     tctgtacacc atgcccagcg aacacgcgtt caccatcagg aagcgacgac gtttcagatt    343560
     gcctgtgcga tatcggtttt gtcgtttcga acagcccgca gtgccatcct tgcgcgctcg    343620
     atcgcgtcaa atgtaccgaa ctcggtcagt acacacctct tccgtacgat ggattttggc    343680
     aagatagcac aaatggaaaa cgaaacctca cctgtatccc gggcttggct tgtcaagaga    343740
     agtttgataa ggacgaagta cgcactggtg catgtgcgca acctcggttc tacgccaata    343800
     atgtgacaaa ttctcccgcg tacgtcggag atggttgctc aaagtgtgcg aaagatcact    343860
     atcgttacgc gtccttctgc gaagcgtgtg acccagtgca agaagtaaga atcttcttcg    343920
     tgatactggc gtactgcgtt gcgctttacg ccatgttcga actcgcaaca cacccagcta    343980
     ttccttcttt gacgattttg ctgtcattca cgcaaatcac tgctcaaatg cagtactttg    344040
     aaattccgtg gccgaaagcg ctcgcgcgtt ggatgcaagt cgcgtcgctc gccgtggcag    344100
     acttacaaat ccttggttta gattgcgttt cgacctggga ctacttcacg cgattcgcga    344160
     cgaccatgtt cgcacctttt gtttgggtgt tcgtcctcgg catcgccatc attttacgct    344220
     gctggagaga gattgcgaat caagcttatg cgaacgtgca gcgacggcga ctgattgagc    344280
     gtcgaagact gctccacgaa tttgacgtcg acgccaaaaa atggactgat ctcgccatcg    344340
     ctcgcgatgg gttaccgttt gatcgccccg atttgaaggg caaaggagac gactacaacg    344400
     cacttgagct gcatctgtac ggcaatacta aaaacgaagg gttgcgaaaa agagtcttca    344460
     aagagggcgt cgaagagtta cgcaaggcgg atttgcgggc gaaaagctcg caagaacagt    344520
     ccaagactga gcgaaagctg aggcaaacca aggatgaaat agaagagctc gaaaagcaaa    344580
     aggctgtgag cgccagaatc atccgggata acgtcaaccg cgccattcct tcgctcgtca    344640
     tcgtcatgtg gtggggttac atgctcttga gccgcaccgc gatcgagtac tttgaatgca    344700
     aagataacac tgagtcggtg ttattggtgg cggatccaca gataagatgc aattttgata    344760
     agcacttgca gtggaagcct gttgcgttga ttggtttcat tctctatccg gttggtttgt    344820
     tccttgccgc atttggctgg ctttacgtcc atcgatcaag ctcaaagacg cgaccgcgcg    344880
     tgcacgtctt ggccacgaga gcgtctcaga ttgagaaggc tcgcgccgat caggttgaac    344940
     aattcaatgc acgttacggt atgatgtaca actgccttcg tccacaattt tatctatgga    345000
     tatgtgttga cctaggcaaa aagttttcca tcgttggcgt caaggttttg ttcccgaacg    345060
     acattttgtt gcaatcattc gtctcgatgg ttgtcttcgt aactttcggg atcatgagca    345120
     cgaggaatcc ttacgtgagt gtgaacttga acgtagcgga aatgcttgcg acattcatga    345180
     actcaatcac gctcatcgca gggttctact tccagcttgg tatcatggat gacgtgtcta    345240
     cgcagatcgc cacgtacgtt atcatcagtg gtttggctgg cacgacgatt gtcttgaccg    345300
     tcatcgtcgt cgtcgagttt ttcccatgga tgaagcgctt gtttttcttg ctcaagtaca    345360
     acacgcaaac cgatatttac aaaccagata aaatcggcac gcacgaaagt ggaccgcaag    345420
     gaacttcgtg ctacattttt gcttcagatt cagcgttcag atactggtgc tggcgcacag    345480
     ttcgtcatcc agtttttgac cgtctcatca cagccaccgt gatgatgagc gtcggttgtc    345540
     tcatttcgga gtctgtctta tacgacgaaa ctttcacgtc atctgcgtac gtgcgcatcg    345600
     tgtggttcaa ttcgttcatg aacggtatct ttgttttgga agctgccgtg aaaatcattg    345660
     ccatgggttt catccttggc gatggcgcgt acctgcgcga tactttcaac tgcatcgact    345720
     ttttagtcat catgttgcag ttcattctct tcgcagtgaa catcacgacg aatgtcaccg    345780
     gtgcgagaag tgcgagattt gtcaaattcg cgcgcgtggc gaaggtcaga gtcattcgcg    345840
     tcttccgaag attcctgcag tttaacgccg tccgcggcga gaaattccgt ctgatgctac    345900
     ttgaggcgaa ggcggaggac acgcccgcgc tcagcgagag catcgagcga cttcgcgtgg    345960
     tttttgaacc acgcagtgcc gagacgatgg aatacaactt gcgggtgcta cagcccgatg    346020
     ttttgcgcgt cgcccaagga ctgattgacg agctttacca agaaaagttt gatcctgaat    346080
     tggtcgccgt gtacgaatct caaaccgacg ccgtgcatca gatggtgcag aagcaatatc    346140
     acgacatcgt gtacgaatgg ctcgctttcg tggcagaacc tgggcaaaag cgcgcatttt    346200
     tggccacgct gaagaacatc cgagacgtcg ccctggatct cggtcctgag ggcatcgcca    346260
     aagaaatgct tcgtcaaaag tacgacatcg ccgccattct caacacggcg ttgtacaagg    346320
     ttccagccga tgtcaagacg gacacgcgag cgtataaacg aaagattgcg aaagacgcca    346380
     agtcattcac cagcacaaag gcaaccatca gcaaacaatt caacgccttc caggcttcca    346440
     tgcaaagtga cgaccgcgtc gaagatgcac tcaaccagtt gccgctgcac tcggtggagg    346500
     aagacagcgc tctcgccaaa cggcgcgccg agaacgcgag cgtgcgcatt cgtaaccgct    346560
     cgctcaatgc gagtgcaaaa gagaaaatca tccaagatga tcttcaacag aaaacctcag    346620
     gcgcgggcga gctcctcgca gcggcgtcta gcgtcgtcgc tgaagacgac gtcgctcccg    346680
     ccgcgccggc accggtgaaa tcgtccggat tgttggcgcg tttccgaaag aaaaagacgt    346740
     gatcgtcatc aaacaaagtt caattattaa tttaccccac tagcggcgct tgggatcacg    346800
     acattagcgc cttgatcctt gttataacgc accacagtta taccgcgccg acgcgccgca    346860
     cacgccgcct cgctcgacgc acccgatggc gtgaatcccg gaatgtcgcc ccccacgctc    346920
     gacgccgcgc ttcgtcgcaa cgcacgcgag cgcccgagcg ccatcgcgtg cgtcctcgtc    346980
     ccgaacgcgc gcgagaagaa ccgaaagtgc ttcttcactt gggacgagtt acacggcgtc    347040
     gtcgacgccc tcgcgcgcgt cttgcgcgcc gaccgccatc cgcgcgttct gagcttttgt    347100
     cgcgacggcg tcgaggcgtt cgtggcgctg cacgcgtgcg cgcgggcgcg gaagagtttg    347160
     gtgaacgtgg acgcggcgac gccggcgagc aggattcggg acgtcgcgcg ggacgcgaac    347220
     gcgacgacgt gtctgtgcgc gaacgacggc gatgaagact cggtaaaatc ggtgttagga    347280
     gaagacggtg tcgcggtgcg cgtgtgggag gtgattaatg cgggcgcgga ggcgatcgag    347340
     gcggaagagg acgagacgcg agaggacgac gaaatttgga ttgcgtacac gagcgggacg    347400
     acgggaaaat gcaagggcgc cgcggcgacg catcgacgcg cgatggcgta cgcacgggcg    347460
     aagtgtgagg tggaagagat cgacgcgtgc tcgcgggtgt gcttggcgtc gaacgcgacg    347520
     ttcgatttgt ggcacggcga cgcgtgcgcg gcggcggcgg cgggcgccgc cgtcgtcgtc    347580
     gcgtctcgcg cgacttttca acacgatttc gcgagagtgt tgcgagaggg cgaagtcacg    347640
     cacgtgtgtt gcacgccgac gatgttctcg ctggcgcgac ttccgcgtgg gatcgtggac    347700
     gcaccgaagt tgcgatgcgt atcgctggcg ggggagcgca tgcgcgagag cacaatcgca    347760
     ctatgggccg acgacgtggc gttgtacaac gtgtacggtg ccacggaaac gactgtggtg    347820
     caaacgtacg caagaatgcg caatgcagaa gacgaaagca cgaatcgggc ggggaaagcg    347880
     tacgaaggat ttgccagcgt gttcgtcgtg gatgaaatgc gcgaaggcga attggcggtg    347940
     caatccttcg cgcagagacg cggcgtcgaa ggcgaagttg ccatcggcgg tatttgcgtc    348000
     gcagacgggt atttgaacga ccccgaacgc acggcacgtg cgttcgttca ctcaccattc    348060
     ggtaccgtct atctcacggg cgatcgcggg tacatcgatg acgcaggcga tttgtatttg    348120
     cgcggtagac tcgatcgcca agtcaagatt cgcggtcatc gcgtcgagtt ggatgaaatc    348180
     gaagccgcgc ttcgttcgtg ccccgcacta tgcgacgacg ccgtcgtgtt ctacgatgcc    348240
     aatgagggag tgctgacttc ccacgcacga gcagcttcgc cgacgttcga cgcgtcgagc    348300
     gatgcagatt tatacgcgtt cgcgctcgaa cgcgtcgtcg agctacgatt gccgcgacac    348360
     atggtgcctc gtcgacacgt cttcatcgag cacgcgcgat ggcctttgac ttcgagtgga    348420
     aaaacgaatc gtcagatact gcttcaatgg tttgcgagcg gcgagacgaa ggcgtttcga    348480
     cctaagcgtg agaaaccgca agcgggattg gaaacagtcg tcgcgaacgc ttgggctgtc    348540
     gcgctggggc acggcgacgc gagcgatatc ggcgccctcg acgcgttcga tgcgctcggt    348600
     ggaacctcac tcaacgttct cgcagtttca aaagcgctgg cgagcgacga cggaatcgtg    348660
     cgctcgcgcg ataccgcgcg tggcgaaatt gtgcgcgaag cgcgaattgg tttacgcgac    348720
     ggcgaagctg cggcgctgct caacgacggc gaagaacccg cggcgtgcgc gttcgacgtc    348780
     atcgacggcc cgttcgcacc gtgcgaaata ttcgcgagac ccgtgcttcg cgattacgtt    348840
     gattatttgc gagcgcaagg tatagacgcc gacgtgaacg ctcccgcgtc caccgccgtc    348900
     gagccacagc gagatacatc tgcgaatcgt cgcatgctcg cggcgtgcgg tcgcggcgtc    348960
     gcccccgtcg ttcgcgcttt gctcgcgacc ggcgtcgaag catcgggcga gcaccttcga    349020
     gccgccgccg cgagcctcgc cgacgaagcc gtggacgtag tgcaaacttt actcgccgcc    349080
     ggtgcggatg caagttcatc atccgccaca gccggtacgc tcgcgacgca cgtcgccgcc    349140
     gctcgcggga actctgaaat gttagaaatg ttgctcgccg ccggcgctcc agcgggagcg    349200
     aaggacgcgg ataagcaaac gatttgtcac ttagcagtgc ggagcgggga tgtgagtacc    349260
     gtgcgcgtcg cggcaaacgc gtgtaaacac ttgaagacac gcaaaggtgg cttggagtcg    349320
     tgggatcgtt ggaagcgcac gcccgcagcg tgggcgctcg tcgcgggatc gagtgaaatt    349380
     ttagccgagt tgcgagatgc cggggcgaat ttaacatcgc ttgaaactga cgtctccaac    349440
     gcctgggtgc acggttcgct gagcgcaaag agcgaggtgc agttggcgca tcgcccggtt    349500
     cgcaagcgag gtgccgcggc ggaggtgttg agcgcgctcg cggctagatt ggacgccgca    349560
     aacgtcgaga gcgaacgtat tgaagcggcg acggcgattc gcgagctcgt gtgcgcaaac    349620
     gcagagaatc gagaaaaggc gcgaacgatc ggtttggtgc caaaactgtg cgaactcgcg    349680
     cgcgatcgtc actgcgttga agccatcggc gcgttgagaa atttagccac caacacgagc    349740
     gcggcagggg cggctggcga cgccggagct atggaaatcc tcggtgatgt cattcgcgct    349800
     cgtgctaaat taaaagacag cgagctgagt gctgacgata ggcgagtagt gtacgctgcg    349860
     gcgagcgcga tgcgcgcgtt ggcggtgaag cacgacgcga atgccgcgcg attgcgcgcg    349920
     tcgagagacg tcgcggacgt cgtcagtcga ttgtgcgaag gcatgcgatt agagtagata    349980
     tatgtagcga aactatagcg tctattgaaa caatttagca aatttgcgca cgcgtttgaa    350040
     gcaagacgat gcgatcgccc acgacggcgc cttcgatgtc ttgcggcgag cctcgatagc    350100
     tctccaccga cttggcgatg tcggagattc gtctaatcat cgcttcgcgc gcgagggagt    350160
     tccacacgat agacgacgcg gtgtagtcca ccacgcgttc ttccgtaggc tcggcggtga    350220
     tgctgtcgta gagaccagcg ccggcgaaat tttccaagtc ttcaccgttc gagtcgcttc    350280
     tcgcgatgac ggtaccgccg gatggcgcaa agtgcccgca gagcttactc ggaagcgaac    350340
     gaagcgtgac ctcacccgtt gtcttgctca ccgtaaatcc gagcgcacta ccagcgtcgt    350400
     taccgaccaa agtttccccg agaccgacgc aaatctcacc aaagatttca tccgcgtcgc    350460
     cggtgacagg gttggcggtg tgcaccacga aggcgaattc ggcgtccacg agttccatga    350520
     gaagcacggc gacgttgaga tccttgtcgt cgatgccgca ggatttacgc gacaaccacg    350580
     cacgctctgt ccattttgac gcccatacac cgcaaacggc gtcccagagt cgcgggaggt    350640
     cgacggatgg tgaaagcttc gccgccgctt cgtcgagcgc ggattccaaa ccttgcgggc    350700
     acacgagacg ggtggcgatg atttctcgcg catccgcgag cgccgcacgg cggtcttcgg    350760
     cggtagtcgc tgtctcaatg gcggcaacgg ctgcttcgag cgcagtacga gtgtcgacgt    350820
     cttcctcgag ggcgcgttca aaggtgccaa atggaagcgc gtacgatcct ggcacgtcga    350880
     cgttcgcaat gttcattgcg gcgagttcct tggccatttc cgaaagactg ttgctcttgc    350940
     cgccgacaat atcgctgctg tacgcgtcag gagtaatcag ccacgcgtca gagggcttgt    351000
     aaggggcgat agacaccttg gtcgtcgcct tggcgctcgc cgtcgtcgtc gcgtcggaga    351060
     cgttggcttt atcaatctgc acatcttcac ccgcgataga gaatcgcacg ttttcacccg    351120
     ccatctctag gactttgttc caaagtacgt catctgcgac gctcgcgaga agcacgttcg    351180
     tgtttctcgc tcgaatggcg atgtgactga gcagatcgac cggcgccttg gtgacgacgg    351240
     ccttgacgcc cgcgggaatg tcttccaacc caccgagcgt ttcggtgaag caaaccatgg    351300
     gagtggacga aaaatcttcg ccttgaatct cactgagcgt ttgaactttc gccatcccgg    351360
     cgtacgtctc gaggctggcg tcgccgacgc tgacaatttg ccaaggcgag cgacccgcgg    351420
     cggctcgaac cgccggacga agcgtcgaaa tcaattgcga gacgacaaac aggctgtgtg    351480
     agcgcacgtt ttcttcccca aagttgatca agtacttggg atcagccttg gtggacttag    351540
     acgcgatgat atctgcagcg ttttgcgtag cgcggcacaa aaagtccata tcgctctcca    351600
     tggcgagagc gcagaaatcg agcgcggcgt ccatggtctt cgaccagtcc gcgccccagc    351660
     gttcgccgtg accgtcaccc atggcgactt ggagaaattt taagccctcg ccgatgcgcg    351720
     tggactcgtt cgtcagcgcg acgttcgtca aagaaagctc gagaagcgaa agcaaatcat    351780
     ccgaggacat tgcgccgtaa tcgacggctt ccaccttggt tctgaaaaac ttttccaacg    351840
     tcgcgtcgag catgacgacg tctcggttcg ggctgtcgtg ttgccaaact ccgagaagct    351900
     tcttacgaac ttcgataatt ttccccggca cccaccacgc gtcgcggttt tgcagcaaat    351960
     cgtccacctc ccacgccaag tcgccgggca aaccgtttct ggcaaagttc atggcgctgt    352020
     ccacgtcccc gcccgagtgc gtggtcttta aaacccacaa gtaatgtttg aaagaatcga    352080
     tcatttgcgg catgtggaac gcggggccgt ggatgccgtc cgagcgccaa cccgccttca    352140
     taccggccaa atcttctcgc gtcaagccgg cgttatccca caagtgcgcc cagaaatcgt    352200
     cccagttacc ggtgtgcaaa aagtgcaggt atgcctcgca aatcttcaca tcatcgggcg    352260
     tggtgttaga gtgaagcttt tgatgccact gcgcgatgaa cggatcctcg attcccggac    352320
     gatgtccctc tttgatgccg tgcgttcgca tgatgttcaa gatgcccatg cgaatatcgt    352380
     cgccgttgcc tcctccgcgc ggtaagaatg cgagcgaggc gcgcatgagt ccgcgcgacg    352440
     tggcgtccgg cgccgtcgtc gccgcgtgcg cgatgcgtcc cgccaagcgc tcttgcttgc    352500
     tcgccatgtc cttgccctgg taattgttcc cggcgtacca gtgcaactgg cgcagcgagc    352560
     tcaggcgcaa ccacgcgtag acgagcgccg caccctcggg cccgatcgcc aacgcggcgt    352620
     ccagggcgtc gtcaaccatg caaaatcgcg tgaacaagtt cacgctccca ccctcgtgct    352680
     cggcggcgcg tcgcgccaac gattccgcgc ccgccgcgcc gccgccgccg cccgccgcgg    352740
     attctctcac cctcatctcc acgtccccgt cctccgcgtg cgcccaaaac tctccgcaca    352800
     cgacgatccc gacgatcgac ccaacgtttc tcaacccctc gacgtcccct tcgctcgcgt    352860
     tcgagcaatc catctccaac gtcagcgtcc cgctcgcgtc gaacgcgctc ctcgacgcga    352920
     tcccgtcccc gaaatcccta ctccccgtcc tcgcctccag cccgcgcggc gccttcgccc    352980
     acgacccatc gccatcgacc gcccgcgtcg cccagtgcag ttcgacctcg cctctcgcgc    353040
     accgctccag gagcgcgtcg tccgccgccc gcagcgtcgc cgtcgtcgtc ccgttcgcgc    353100
     gcgtccgcgt ctccactcgc accgcgtgcc cccccgcgag cgcgtgcgtc gtctcgcgga    353160
     ccacgtccgg gacgtccgcc tttttttcgc gcgcgccggc gcctcgtccg acgcgcgcgc    353220
     gcgtcccggc gtcgatcgcg ccgcgcgccg tggatagcgt tcctcgcgaa gatcgcgtcg    353280
     cgcggcgcgc cgtcgcgcgg tcgatcgtcg cgcgcgccgc gtccgcgcgc gcgaacgtcg    353340
     cgcgcgtcgc gtcgcgcgcg agagagacgc gcatcgcgcg cgcgcgcgtc gtcggtcgcg    353400
     gtgtgacgat tcgcttcgac gaatcgaatc gtcagagcgc gacgccgcgc cgcgcggacg    353460
     cgtcgacgcg cggcgcgacg cgacggcgac gcgcgcggtc ctccgcggcg tttcgcatgt    353520
     gcggcgcgtg ccgcgcgcgg cgcgcgagcg cgagagagac gacgacgcgc gcggaattct    353580
     gcgcgccgtg tcgcgacggc gcgagagcga cgacgacgcg cgcgacgcgc gtcgcggacg    353640
     gggcgtcgtt cgacgtcgtc gtgtgcggcg cgggcgcggc ggggacgtcg ttcgcgcgga    353700
     cgtacctgga gacgacggcg cggggtggcg acggcgacgg cgacggcgac ggcgacggcg    353760
     acggcgcgcg cggcgcgagg ctgctgctgc tcgatcgcgg cggatgcgcg aagacggtcg    353820
     agcgcgtgga gcgcgtgacg cggcgggcgt cggtgtacgg cgcgcgggag agcgcgctgg    353880
     gggcgctgga ggcgctgggg gcgcggacgg cgacggcgag cgtcgcggcg tgcgacgccg    353940
     agtcgaagac gttgacgctg gacgacggcg cgcgcgtgcg gtacggcgcg ctgtgcgtcg    354000
     ccacgggggc gacgccgcga tgtccgctgc cggaggcgag cgatggagcg gtcgacgcgc    354060
     acgaggtgcg agacgtggag agcgcggacg cgctggcgag acggttgagc tcgatgacgg    354120
     cgacggcgag cgcggattcg gattcaaaga cgaaacggat cgcgatcgcg gggaacggag    354180
     ggatcgcgct cgagctcgtc gacgcgctct gtgtgcgagg tttgcgcgcg cgagggttgg    354240
     aggcgtgcga attggtgtgg ttggtgaaac acggcgaagt cggcgacgcc tttttcgacg    354300
     tcgacgccgc ggatttcttg ctgcgcgcgc tcgacgcgag acggcgagac ggcgaggcga    354360
     aagacgacga cggcgcggac gtggactggg actcaccgac gcccgaacgc ggtgccggac    354420
     gatcgacgaa gaagcgcgcg cgagggcgcg aatcaggcgc cgccgccggt ccggattggc    354480
     tcgacagatt tagagcgaag agcgcggcgg acgacgcgcg cgcgcctctc agccgcatga    354540
     agcttcgcgt gctgaaaaat gtgtgcatac gcgaagcgcg taaagacgca aacaccggcg    354600
     tcaacgtatt gacgctgagc gatgggacga cgatcgaggt ggacgccgtc gtcgccgccg    354660
     cgggcgtcga gccgagatgc gattggctcg acgaagtcgc cgcgccgagg tcgaaatcag    354720
     acggcggtat actcgtcgat gcgtgcatgc gcaccgtagg accgtacggc gactcaatat    354780
     ttgccgtcgg cgacgcgtgc acgatgtcgg cgcgcgcgtc gaacccagag acgccgtggt    354840
     ttcaaatgcg actgtggagc caggcggcgc aaacaggcgc cttcgccgcg aaagtcgccg    354900
     tgggcgtctg cgacgccgac gccctcggat tcaatttcga aatctttacc cacgtcacca    354960
     ggtttttcgg tctcaaagtc atcttgctcg ggctgtacaa cgcccagaag ctcgacgacg    355020
     tcccggcgaa cgaggtgacg acgtaccagc gcgagtcgct cgccgacgcg acgtacgtgc    355080
     gcgtgctcct cgtccgcggt cgcatgatgg gcgccgtgct cgtcggcgac accgatctcg    355140
     aggaaacttt cgaaaaccta atcttagacg gcgtcgatct atcgcgtttc ggtccgagtt    355200
     tactcgatcc cgagctcgac ttggaggatt atttcgactg acgcgacgcg cgagacgagc    355260
     gagaaacgaa tgaaatcaaa tgacaatcaa ccctagacaa ctaccaccgt ccgacgcccg    355320
     cgctcagtgc ggtttcggca cgaacccgtc caccgcgaaa ttccgcgtcg cgcgcggtaa    355380
     aatcacgacg catccctcca acgctccgcg ctccagcgtc acctgacacc ccaacctcga    355440
     cgtcgccgtc aacccgtacg ccaaatctaa catgtcgttc tcgtcgtcgc acgcctccgg    355500
     cagcgtctcg aacacttttt cgtcctcgaa cacgacgtgg cacgtggaac acgcgagcga    355560
     gccctcgcac gcgccctcga gctcgacgtc gtgccggtgc gccgtctcca gcaggttctc    355620
     gccaatcaat ccgcgcaccg cgcgtcgctc accgtcgcgc tcgacgaacg tcacctcgat    355680
     cgagttctcg ggcgtgagtt tcgtcttttt gtccgcgccg tgcgcgaccg tgatcccggc    355740
     tcgtccacgt ggcgcgtacg aataagaatg agaatgagaa tgcgcggcga tcgagcgtct    355800
     tcgttcgcgc ggtcgcgtcc ccgcgctcgg ccgctcgtgc gttcgcgcgc gttcgcggtc    355860
     gagtcgatca ccggacgacg cgttcgttcg cgcgtcgtcg agtgcggcga ccgagggccg    355920
     tcgcgcccgg tgatgcgatg tccacgtggg atcgtggaat atctggctgt gtgcgtaaac    355980
     agtgacgggg ggcttctcgg atcgaccccg cggcccgtgg ggagaggggc atggtgttgg    356040
     atggtgtgta cgcgaaacgt gtgtgcatca tacgtatatt gacccaaagg tatctatcac    356100
     gtgtaaaggt actaatgtgt gtgtgaaatt caatgatggg tcatgactcg agaacggggg    356160
     ggggaggcac acccgggatg cgcgccgatt cttatcgaca gaggaggacg aggaggacga    356220
     ttggcgcgcg cgtcgcgttc gatggaaaac cgatgtcgta tgacaaacag ataaaaacgt    356280
     tatttagtgc gcgtgcccgt gcgagtggcc gccgccgccg ccggctgtgc agtgcttgtg    356340
     gttgaggagc acgagactga cggcgacgac gccgacgacg aacgtcaaga ggctcgccgc    356400
     gcgaagacga gacgtagtgg cgctcaccga aactcgcggc atacactccg cggcagcgat    356460
     ttgtagatag attccagcgc caaaggcgag caaaagtccg tgccagaagt cgttgttact    356520
     tccagatcca acgctgatga gaacgccgag gatgacgctc acgccggaga tgaagttcat    356580
     gaacagcgag cgaaacggcg tgagatcgcc ctggaaggga tccgtgagta ccaaatagtc    356640
     ggcgagctct tgcgcgattt cgtgatagac ggtcgcggcg gtgatcgacc atcccatggt    356700
     ctttccacag ttcaggaaac cgaatccgat gaagatgcca tccacgaggt tgtgcatgaa    356760
     atctccgagg atgatgccgc ttcgaacgcg atacttgtgc gagtggcacg tttcgcaatc    356820
     ttcttgaacg cctttgatcg cgttctccgc gtcgatcgtc ttcgtctcgg ctaaacgaga    356880
     agggaacgcg atggagatgc ccaaatcgat gatgtacgcc acgagaaagc caaagacgga    356940
     cgcggacgcc caccacgcgg tttgttgcga ctcatccgaa ccggcgggtt tgatcaaatg    357000
     cgtggcttcg tacaacatca gatagaacgc agccgaaaga agtgcaccgg cggcaaagga    357060
     gttaatgatg caactcacga attcggggta cgctttctgc ttcttcgcga agctcggaga    357120
     gagaaagatg acgccggaaa gcgtgacgat gttgacgatg atcgccgccc cgatggcgtc    357180
     ggaccacggt tttgatttct ttgtagtcac cgtttcggga agcgaagcca ctggctccac    357240
     gtcatccccg ttgacatcct tgagatagtg cgtatcgcgc tcgaactcgg tgggaacgtg    357300
     ctcggcgaaa atcgagacgg cggcgacgcc agtcgtatca atcttaaacg acgacgtgtg    357360
     ccaagcgtta tcaaattgaa gtttgacgca tccactcccg ggcgtcaaaa cgctgtttcg    357420
     cgttttaacc gtcgtgcacg ccgtctcgag cgcggcctcg cccgcgtcct cgcgagcctc    357480
     gagctcttcg tgtccggcgg cggtttcggc gtagatgacc atcttcatgg tcgcgtccgc    357540
     gtactggtcc ttcacctttt ccgcctgcca cacgtacgca tcgtccggag tctcaaagat    357600
     ccccgcccat tcgaacgagt gcgcgtgcgc gccggacgcg agcgcgccgc gcgccgcgag    357660
     cgcgctcgag acgaccgccg cgcctccgag cgcggcgccc atcctccatc cgcctcctcg    357720
     tcgtcgtcgt cgtcgtcccg cgcccgcggt cgcgtctcgc gtcgtcatcg cgtcgcgcat    357780
     cgtctcgtct atcgtctcgt gcatcgtctc gttcgtcgtc gtcgtcgtcg tcgcgcgtcg    357840
     tcgagtgcgg cgaccgcgcg cgccggcatc gcgacgagac gactcgaacc ggcgcgaggg    357900
     gggtacttct cgagtcatga ctcgatattc atgagaacac catgtgtcga cacctcgcga    357960
     ggtgtcgaca cgcgtgtctt cgtacgtccg cgcgcgacga cgacgacgac gacgaggatg    358020
     acgaccgtcg gcggcgccgc gcgacgtgac gatcgaggct cggcgttgcc tccgcgatgc    358080
     gtcgagatcg cgcgcgagtc gccgtcggcg tcgccgtctc gaaggaaaac gcccgcgaac    358140
     gatcgcgccg tcaatcgcgc cgccgtgcga cggtaccgcg agcgcaaacg aatggacgag    358200
     aaggagagaa tcgaggagtg cgaacggttg cgcggggaga acgagacgtt gagactggcg    358260
     ttggagacgt cacgagcgga gttgaaacat tcgaggtggt tgttgcgcgt cgtcgcgtgg    358320
     aagtacgact tagacttggc ggatattccg acggagaaac cgtcgacgtc gacgatgccg    358380
     caagggaggg tgagaggaag cgatgcaaac gcggtgtttc ccgcgggtgg ggtccccgcg    358440
     cggaacgaca tcgcgcgacc gttcgccgcg cgcggcgtcg ccgagacgcg gcctcggaaa    358500
     attcctcgcg cagccgacga cgacgcgaaa ccggcgggcg cgcctgatga actcgagctc    358560
     aaagatttct tggaggaata cttcacgcac ggcgacgcgt gcccgtgcta cgagatcacg    358620
     gacgcggacg cgcgcgcggc gccgacgcgc ggcgccgacg cgcggcacgc gtggttctag    358680
     gtatgacgac acatttacgt cacacggtga aacgttttac gcttctaata ttatattata    358740
     aagttagtca acctatatag ttacacgcac cacatgatgt cacacgtgat gtgcacacgc    358800
     gtatgtattc gtactgtgag tacaataagc ctaacattgt gtaaaatccc gtgcccacga    358860
     tgatcgcgcg tgtcgacacg aacagacggt tggccgaaaa ggcgaaaggg tcggcggctg    358920
     tcgtcatctc tcgacgaacg ttggcgctcg acatggcgga cgagcaagac cagacctcgc    358980
     gcgtgccggt gaccattctc accggatttc tcggttccgg gaagacgacg ctcctcaatg    359040
     aaatcttgga atccgaaacg cacggattgc gcttcgcggt gattgaaaat gaattcggag    359100
     aggtgggcgt cgacgagagg attctgtcgg agaaggcgga cgaagagatc atcgaggtca    359160
     tgaacggttg catctgctgc acggtgcgcg gtgatctcgt ggtggcgctg aaaaagctct    359220
     actcgaagat cgcgcagttc gacgccgtca tcatcgagac gacgggtttg gcggatccgg    359280
     cgccggtggc gcagacgttc ttcgtcgacg atgacattcg agaaaagttt gtgctcgacg    359340
     gaatcatcac ggtcacggac gcgaagcaca tcctcacgcg gctcgatgat gaaaaacccg    359400
     agggtgtgga gaatgaagcc gccgaacagg tcgcttttgc cgatcggata ctcctcaaca    359460
     agaccgactt ggtgtccgaa gacgaactcg aaaccatcac gggccggatc aagcaaatta    359520
     atccgagcgc cgatatcttc cgatgccagt attccaaggt tgatccgaaa aatttgatcg    359580
     gaatcaattc cttctcgctc gagaagacct taaaaatgga tcccgaattc ctcaacacgg    359640
     agggcgagca tgaacacgac ccaaccgtgt cttcgacgag cacaaaattc tctgggcacc    359700
     tcaacatcaa taaattagaa cgctggatag gcgaaataat tcaaacaatg ggtgcggact    359760
     tgtttcggta caagggtgtt ctttccgttg cgggcatgga tcaaaagttt gttttccagg    359820
     gcgtcggcat gcttttctcc ggcggcttcg tcgacgccaa gtggggagcc gacgaggagc    359880
     gcgaatgccg cttcgtcttc atcggtaaaa atctggacaa agacgccctc atcaacggtt    359940
     tcatggattg caagtgttcc tcgaagcttc gcttcaaggt gggcgacgcg gttctcgcgc    360000
     aggtgggcgc cgccgacaac gacggctact gccgcggcac cgtccgtaag acgtgggact    360060
     cgggcaaccc gtaccagatc gaacttgaag acggtaaaaa gacaaaagtg tggggacccg    360120
     tcgacgaaga cgagttcgtc aaagcttcgc tcagcgccac cgcgtaaatg tcgttttgta    360180
     tgaaatcaaa tcaaaatttt gaccagtcat gaaccttcgt gtacacactc ctcctttagc    360240
     gcgaacacac acgcatagta tagatacaaa aagacaaggt aaaacccatc caacgcactc    360300
     gcaccggctc gccggctcgc ctcgtccgac gcgcgcgcgc gtcccggcgt cgatcgcgcc    360360
     gcgcgccgtg gatagcgttc ctcgcgaaga tcgcgtcgcg cggcgcgccg tcgcgcggtc    360420
     gatcgtcgcg cgcgccgcgt ccgcgcgcgc gaacgtcgcg cgcgtcgcgt cgcgcgcgag    360480
     agagacgcgc atcgcgcgcg cgcgcgtcgt cggtcgcggt gtgacgattc gcttcgacga    360540
     atcgaatcgt cagagcgcga cgccgcgccg cgcggacgcg tcgacgcgcg gcgcgacgcg    360600
     acggcgacgc gcgcggtcct ccgcggcgtt tcgcatgtgc ggcgcgtgcc gcgcgcggcg    360660
     cgcgagcgcg agagagacga cgacgcgcgc ggaattctgc gcgccgtgtc gcgacggcgc    360720
     gagagcgacg acgacgcgcg cgacgcgcgt cgcggacggg gcgtcgttcg acgtcgtcgt    360780
     gtgcggcgcg ggcgcggcgg ggacgtcgtt cgcgcggacg tacctggaga cgacggcgcg    360840
     gggtggcgac ggcgacggcg acggcgacgg cgacggcgac ggcgcgcgcg gcgcgaggct    360900
     gctgctgctc gatcgcggcg gatgcgcgaa gacggtcgag cgcgtggagc gcgtgacgcg    360960
     gcgggcgtcg gtgtacggcg cgcgggagga cgcgctgggg gcgctggagg cgctgggggc    361020
     gcggacggcg acggcgagcg tcgcggcgtg cgacgccgag tcgaagacgt tgacgctgga    361080
     cgacggcgcg cgcgtgcggt acggcgcgct gtgcgtcgcc acgggggcga cgccgcgatg    361140
     tccactgccg gaggcgagcg atggagcggt cgacgcgcac gaggtgcgag acgtggagag    361200
     cgcggacgcg ctggcgagac ggttgagctc gatgacggcg acggcgagcg cggattcgga    361260
     ttcaaagacg aaacggatcg cgatcgcggg gaacggaggg atcgcgctcg agctcgtcga    361320
     cgcgctatgt gtgcgaggtt tgcgcgcgcg agggttggag gcgtgtgaat tggtgtggtt    361380
     ggtgaaacac ggcgaagtcg gcgacgcctt tttcgacgtc gacgccgcgg atttcttgct    361440
     gcgcgcgctc gacgcgagac ggcgagacgg cgaggcgaaa gacgacgacg gcgcggacgt    361500
     ggactgggac tcaccgacgc ccgaacgcgg tgccggacga tcgacgaaga agcgcgcgcg    361560
     agggcgcgaa tcaggcgccg ccgccggtcc ggattggctc gacagattta gagcgaagag    361620
     cgcggcggac gacgcgcgcg cgcctctcag ccgcatgaag cttcgcgtgc tgaaaaatgt    361680
     gtgcatacgc gaagcgcgta aagacgcaaa caccggcgtc aacgtattga cgctgagcga    361740
     tgggacgacg atcgaggtgg acgccgtcgt cgccgccgcg ggcgtcgagc cgagatgcga    361800
     ttggctcgac gaagtcgccg cgccgaggtc gaaatcagac ggcggtatac tcgtcgatgc    361860
     gtgcatgcgc accgtaggac cgtacggcga ctcaatattt gccgtcggcg acgcgtgcac    361920
     gatgtcggcg cgcgcgtcga acccagagac gccgtggttt caaatgcgac tgtggagcca    361980
     ggcggcgcaa acaggcgcct tcgccgcgaa agtcgccgcg ggcgtctgcg acgccgacgc    362040
     cctcggattc aatttcgaaa tctttaccca cgtcaccagg tttttcggtc tcaaagtcat    362100
     cttgctcggg ctgtacaacg cccagaagct cgacgacgtc ccggcgaacg aggtgacgac    362160
     gtaccagcgc gagtcgctcg ccgacgcgac gtacgtgcgc gtgctcctcg tccgcggtcg    362220
     catgatgggc gccgtgctcg tcggcgacac cgatctcgag gaaactttcg aaaacctaat    362280
     cttagacggc gtcgatctat cgcgtttcgg tccgagttta ctcgatcccg agctcgactt    362340
     ggaggattat ttcgactgac gcgacgcgcg agacgagcga gaaacgaatg aaatcaaatg    362400
     acaatcaacc ctagacaact accaccgtcc gacgcccgcg ctcagtgcgg tttcggcacg    362460
     aacccgtcca ccgcgaaatt ccgcgtcgcg cgcggtaaaa tcacgacgca tccctccaac    362520
     gctccgcgct ccagcgtcac ctgacacccc aacctcgacg tcgccgtcaa cccgtacgcc    362580
     aaatctaaca tgtcgttctc gtcgtcgcac gcctccggca gcgtctcgaa cactttttcg    362640
     tcctcgaaca cgacgtggca cgtggaacac gcgagcgagc cctcgcacgc gccctcgagc    362700
     tcgacgtcgt gccggtgcgc cgtctccagc aggttctcgc caatcaatcc gcgcaccgcg    362760
     cgtcgctcac cgtcgcgctc gacgaacgtc acctcgatcg agttctcggg cgtgagtttc    362820
     gtctttttgt ccgcgccgtg cgcgatccgc ggcgacgcgg agacgccgcg agcgacgtaa    362880
     agctgggcag gtttctggga cgcgcgcggc gcggcgtccc ggggacgcga cgccgacgcg    362940
     cgcgggaggg cggtcgaggc gaaacacgcg gtcgacgacg acgacgacga cgacgacgcg    363000
     catcgcgcgc tcgcggcggc gcacgcgcgc gcgagacggc gaaacatcgg cgcggtggga    363060
     cctcgcgagg cgcgaagtga agccgaggcg aagacaaagt tgaaagtcga attgcaacgc    363120
     ggcggcgcct cgcggcggcg cgagggcccg cgcgcgacgt gtaagtgtta atgttggtta    363180
     atagtcggtg gatcattcgt cgacgtccag ggcgcgcgcg cggttcgacg ccgctcggcc    363240
     gaggttttgt tcaaacagac gcgaagagcg gcgcgagcgc gacttcgccg ctcgcccccc    363300
     ctgcggacga gggcgtcggg cgcgcgtaaa agaatcattc gttcgggtaa agttccctct    363360
     caaactcctc caaagttgct aaatcgctcg gtttgagctt aatgcccttg tgtccgcgcg    363420
     ggtatcggcg ctccagcgcc cgcatcgcgt cctccaattt cctccgctcg ctatacatca    363480
     gatacgccac ggcgacgctc ggcgcgcgcg agtgcccgct catgcagtac accagcaccc    363540
     tattcggcac cccagcctca tccgcgcgct tcgccttgac gtgtaattgc tctaacttcc    363600
     tcaccgtctc ccctaaatcc aatttcgtac cgtcattcgc gtttcgcggc gccgtgaaga    363660
     cgtctatttg cctagagcta cagcacggcg tgcactgcgg cacgctctgt tcgttcgcgc    363720
     gcgtcgcgcc gttcgtcagt caccgcgctt cgcgcccgcc gatcgcgtcc acccatccca    363780
     catcgtcccc aaaccgtcgt ctcgcgcctt cgatctcgtc ccctccattc gcgctcgcct    363840
     cctcctcgtc tctccgcgcg cgtcccgctc gcgcgcgggc cccccaagtc ccgcgccctt    363900
     ccccgcgctc ccgtcccgtc gcctctctct tcccgcgctc gcgtcgttcg cccgccgcgc    363960
     tcgcccgctc gaaacgcacg ttcatcaccg ttcgtatccc gcacgccagc agcacgtcct    364020
     ccttgctcgt gtgttcgaac gcgccgaggc acaaaaactt gtcgatgact tcgatgattg    364080
     gttcgtcgtg ccccaatcgc ggtctcggga ggtcgtcgag gtcgtcgtcg acgcgtcggt    364140
     ggtggccgca gacgccgcac gtcgtgcccg gcgcgtggtc gtggccgcac gcgcggcacc    364200
     aggcggcgcg cggcggcggg gcgtcgtcgt cgctgtcgac gacgtgcggc atcgtgtgcg    364260
     cgcgtggggg ggtcgggggc gatgctttgc gtgtgattgt cgcgcattcg gcgtgtctaa    364320
     tacggggttg aggtgcgtat tggggggggc gttcgcgttg attaggttag gcgatttttg    364380
     tgtccgtgtt tttatggagg tgattgattc tttgggtgcg cgcgtcccgg attcggcgtg    364440
     tacaatacgg ggtttaggtg cgtattgcgg gggaccgtga tcgggcgatt tttgtgtccg    364500
     tgtttatatg tagtctcaca ctgacctcgg cggtcgatcg cgcgccgtcg tcggttcgaa    364560
     acgcgccgca acgccacgcg cgtcgccata tcgcgcgatg ctcgacttga tcgaccacgt    364620
     cgatgagcgc tcggtggagt gcctgaacgc gctgacggac gagagctggc gcaacgcgct    364680
     gtggcccgga ccgcgggatc gggcgtcgtc gacgctcgtg agcgacgacg acgaggagct    364740
     catcctgcgc gtggagttca cgtccaacgt gcgaccgcgc gcggtgaaaa tcgcgggcgc    364800
     gagcgcgacg cacgcgcgcg aggacgcgag cgcgccgcgg gtggtgaaga tattcgtgaa    364860
     cgcgccgagt ctgagctttg agaatgcggc caagcggcgc gcggcgcaag tcgtcgagct    364920
     cgacggcgac gacgaggtcg agctcgacgt gacggcgttt gagaacgtgc gcgtgatgac    364980
     gttttacgtg gagagcaacg tgggcgggac ggcgcggacg gagatcggga ggatcgatat    365040
     caagggcgag ctctcgggcg agctgcgaga cgtgtcggag ctcaagccgt gctgaggacg    365100
     gtaggattcg tcgtcaccga cgatggatcc ggccccgaac gatgcggtta cgatacgact    365160
     gaatgttttt acgcgcgtcg gtgccgggca ccgacgggag cggtggattt ttaccgggtc    365220
     aaggcgtcgg cggcgctcga aacgaattcg agcgccgccg acccgcgtga cgacgcgcgg    365280
     cgaaagctcg cacctcgagc cgccgcgcgt ccgattttcc ggttcaaaaa tgccattcac    365340
     gaatcaaacc aacatactag actatagcgt atagcctcgc gctgtgtaat atagagcatg    365400
     tgtacccgac gccgcgtctg tacccgacgc cgcggcgccg cattgaccga ctcgcgcgcg    365460
     cgccgtcatg tcctccgcgc ccgcgccgcc cgtgcgcgtc ggtcacgcgc tgagtgggat    365520
     attcgtcatc aacctgcgcg gagacgtgct gctgatgcgc gcgtaccgcg aagacatcga    365580
     gcgacacgtg ttggatgcat ttcgcacgca gatcctgaat ccgcgcggtg gcgcgcgacg    365640
     cgacgcgcga tcgacgcctc gacgcggacg caaagacgac ggattcgcca cggaagcgcc    365700
     ggtgcgaaga atcgggagcg tgacgtacat gatgaaacgg tcgagagacg tgtacgtggt    365760
     ggggatcgcg cgcgggcaag gcgaacgggg cggaccgggc gacgcgaatt taatgctcgg    365820
     attcacgttc ctgggacacg tcgtgcggct gtgcaatcaa tactttggcg cgtgcgatga    365880
     aaacgcgatc cgtgggaact ttgtgctgat gtacgagctg ctggatgaga tttgcgacga    365940
     cgggtatccg cagataaccg ctggggagac gctgaagacg tacatcacgc agaagggttc    366000
     taaacttgaa ggtgcgatcg gaaaagaggc gatggaacgg agcgcggcgg aggaccaacg    366060
     ccgggcgatg gaggcggcga aacaggtgac gagcgcggtg caatggcgaa gagaggggtt    366120
     atcgtataag aagaatgaag tgtatttgga catcgtggag agcgtgaatc tgatgatgag    366180
     cgcggaaggc acggtattgc gagcgaacgt gcagggttcg atttacatga ggacttttct    366240
     gagtgggatg ccaaacctca gcgtcgggct gaacgatcgc ctcggggaga cgacgcgcgt    366300
     gacgtcgcgc ggcgaagacg ccgagacgag cgcggctcgc gatcgaaggc tgatcgacct    366360
     ggacgattta cagtttcatc agtgcgtgcg actggataaa tttagcgcgg aaaaagtgat    366420
     cgagttcacc ccgcccgatg gcgagttcga gctcgtcaag tatcgcgtgt cggataacat    366480
     cacgcttccg ttcaagctca tgcccgtagt gaaggaactc ggtagaacgc gtctggccgt    366540
     caccgtcaac ctacgctcgc tctacggtcc cacgaccgtg gcgaacgaaa ttaaagtgcg    366600
     aatccccgtc cccaagctca ccgcgcgggc gacgatcaac gtgagcgggg gcaaggccaa    366660
     gtacgtaccc gaggagggct gtcttcgctg gaaaatcaaa aagtgcgcgg gtcacgagga    366720
     ataccagctc gacgccgagg tcttactcgc caacacgctg gaggaccaca aaccttgggt    366780
     gcaaccgccg ataaacatcg cgtttcacgt cccgatgttc accgcctcgg gcttgcgagt    366840
     gcgctttctc gaagtcaagg aggcgtccaa ctacgacgtc gtcaggtggg tgcgatactt    366900
     gtgccagagc ggcggttcgt cgtcgtcgtc gtacgagatt agatgcgcgt gaaatgtcgg    366960
     ttataattca catcccgctt tagccatccc gtcaccgcgc tgtttttatc gtcgcgaagc    367020
     tgtcgtcccg ctcgcgtctg ggacagactc ctcagatacc gcctcgccgc ccgtcgtctc    367080
     gccacctcgc gcggtaccgg cgtcacgcga tgtccatgtt taccacacgc gcgtcgagct    367140
     tcgccgtagg cttcgccgtg gcttccgcgg gtggctttta cgtcatcaaa gaggagattc    367200
     agaagaatca cgaggcgttg gcgcgtgagt gttcgacgct gtgcgatcgc gtcaaggctc    367260
     tcgaggcgcg cgtggggaag taatagcata gccgatgcca ccgcatcgtt gtagtagcgc    367320
     acggatatca cgtcgtgtat ctgacaagtc accgcggttc cacggatggc gtcgagagaa    367380
     gcgtttcgcg aagcgtcgga aacgcgtcga cgcacagagc gcggtgcgtc ggccaggata    367440
     acctctgaca cgcggatgaa cagtaaatct cgcttttgca tcgcgcgcag cgtttcggcg    367500
     acgtcgtcag acggaaacat cccgcgcacg tcttcggctt tcgaggaagc tgggcaagat    367560
     cgaagtgccg cgcacagagc gcagaggcgg caccgatggc gctcgcgatg tctgcgtcgg    367620
     tgtctcgttc gcgcgtgcct aaaacgtcgc ctctttcgat cgggtcgggc catgatcgat    367680
     gttttcgggg tgtgtcgatg ctcgccgcga gaagcgcctc gccagattgg ccgtcattgt    367740
     cgacgatttc cctcacgacg cggatgacat cgaactcttt caaaacttcg agcgcctctg    367800
     tcgcgttgcg atgacacgcc cagtggtacg ccgtacgccc gcgcgaatcg acaagtgcgg    367860
     tgagtttcgc cggatctttc gctcgtcgta aaatcattcg agccagcggc gcgttggagt    367920
     gcgcgcacgc gagcatcaac aacgtttgcc cgctcgaaca ccgcacttcg tcgtctccgt    367980
     cgttctcatg cgcatcgagt gcgaatgtca tcaacttcat gcggctcgcg agcatctcag    368040
     tggcgcgtcc tggttgtctg acggcgtcgc gagtcatgct atccgcgaga tagtgcacgg    368100
     gcaaccaccc gtggggtcta caacgcacgt tcaagtcgcc gccggctgcg cacagagctt    368160
     ctaccgttcg tagctctact ccgaatccga aagccgtgtg aagcgcgaaa tcgtccaccc    368220
     tgatacccgg ggttcgcaag agcgcttcta cgatagaatg ccggccgatc ctgcaagcat    368280
     gctgaagcac gctgccgtgc gctcccttcg cgttgacatc ggcgccaagg tgtatcagaa    368340
     actcgacaaa atccacatct tgtctaccat cgatcgcgta catcagcggc gtcctctgaa    368400
     gactatctct gcgattgacg acgcatcgcg ccgattcgaa cggttgccga tttccgacga    368460
     acgccgcgac gtgcgacgtc gatcggtcgg cgtcccctac ttcatccaat atactttcga    368520
     tccacgtctc attccatcga tctatatcca tcgcaaacgt tgcgttcgcg atgcgtcgac    368580
     gaacgggcga cccgatcgtt ttctcgccgt cggcgagtcg catcaagatg tcacatcgtt    368640
     gccatcgcgc cgcgcaatcc actaaatgaa tctgcttcga cggcgtgttc gcggccctca    368700
     cgaccgtctc aacgatcata tcggatgttt ttgcgtcgca gcacacgagc atggcggcgg    368760
     aaacaccgat gggtgagact ttgaacgcgt cgcaaccgtt cgcgagcaac cacagcgtcg    368820
     tgctcggcga ggcgaaggga gagagcacag aaacggaaag cgcatcaagg ccatccacgc    368880
     acgccagcgc gggatcgatc ttcccttcca acgacagcgc tatgacgtcg tccaactggt    368940
     cgtgataaac cgcgatgagg aagattttat tgatggacat cgagaggcga ggcgaggagt    369000
     ggaggttcgt tcttcgtttc gtactacaga ctaaagttaa agtgtaaaaa gcgtcgccct    369060
     agttcatgct cgccatgcga gccgccacgt ccgccatcaa atctcttcgt ttcttcaacc    369120
     gatcggtggc gtcgtacacg atcgtctcgc acccgttctt atcgacaatc ttgaccaaat    369180
     aatccgtcgg cgcggtgacc aagcgctcgc acacctcgcc gacgcacaaa tccaccaaat    369240
     ccatcgcctg cgccctcgac atgttcggca cccagtgctt atcgaacaac gacaagcaaa    369300
     acatcccccc gtacccgtgt cctccggtgt tcacccgatg acacgtcgcc aagtaatcca    369360
     taaaatgcaa ctcgggttcg tttttcaatt tatcaaaccc cgcgagcaag cagttcacct    369420
     gatacggtcc gctcctcagc gcctccgcga gttcattcct cgcgtaatgc gccgtcgcgc    369480
     tcacgtccaa ctcgtgtcca tatttcaacc ggtacaaccg cacgttcgcg cgcaggtact    369540
     ctccgaacgc gacgcagtcg cccttcggtc cgctcagcgc catgatcttc gtcgagtcca    369600
     gctccacgat cttgtcctcg tccagttttt gcactatgat ttgctgcgtc gccgcgcggt    369660
     cggcgaccag cacggcgaag tcgtatccca cgaatccgaa caccacgtcc atcgcgcgtc    369720
     gtcgtcgttt ctattcgttg aatgaatgaa tgaacgctcg cgcgcgatcg atctgtgatt    369780
     cgcgacttta accgtctccg cgcgcgcgcg atcgcgtccc gctcgaccgc gtcccgctcg    369840
     accgcgtcgc gcgcaccgtt ccgcgctttc ggcgctcgct cgctcgacgc gcggactcga    369900
     cgcgtcgacg tgtgcggcgc cgaaagcgcc aatcgtcaac gacgcgtcaa cgaccgacgc    369960
     gcggcgacac ttcgcgtcgc gcgctcgcgt cgcgccgctc tcgacatgtc cgccgagcgc    370020
     aagcgctacg ccgtggtgtg cgcggcgaac tttaaccgct ccatggaggc gcacaaggtg    370080
     ctcgccgagc gcggactcga cgtcgcgagt ttcggcgcgg cgtcgcgcgt caagctcccg    370140
     ggggcgtccc gggacgaccc gaacgtgtac gatttcgatt cgatcacgta cgaggacatc    370200
     gcgagcgatc tggagcgaca accgcgggag acggtggaga attacgaggc gagagggatg    370260
     tttgagatgc tgcggcgaaa cgcgaagatc aaaccggcgc cgcagcgatg gcagacgcac    370320
     agcgatcgag agcggttcga cgtggtcgtg tgcttcgagg agagggtgtt cgatctcgtg    370380
     atggaggatc tgcgagcgaa gggaggggcg cgggaggggg tgctggtggt gaatttggac    370440
     gtgcgagact cgcacgattc gagcgtggac gcggcgccga gggcgttgcg gttgtgcgag    370500
     gcgttggagg cgagcgagga ttgggagagc gaggtggatg agatcatgaa tgcgttcgaa    370560
     gaggcggagg ggatgcgacc gttgtacggc gtgtgttatt attgatggat gattgtacag    370620
     cgcgccggcg acgcgctcgt attttacaac tcgctaacgc aaaagggtgt agatgacgct    370680
     gtcgcacacc tcttgacgcg ctttcgggga cgaaataggt tcaccgttga aatcggtgag    370740
     taaaaatctg tgcacttcat cttggatgaa gttctcgacc gtgcgcgggt cgatcaaaat    370800
     atccgccttg aaaaccatga cgttgagcgc ttgcagcgcc tcggtgacgt cgagcaacac    370860
     gcgaggtcgg gtgtggccgg agatatccag cggcgcgacg actcgaagct cgctcgtcat    370920
     gctctcgcct ttgtgacaca gcatctcgac cttgagcgga cgatcgacgt gttccttgta    370980
     cttggcgcag aggtattcca tttgctcttc gttttcgatg tttcgcgtga acagggcgac    371040
     ttcgcaaatg gagtcgtcga cgatttcaat cttggcgtag ctcacggaga ctttcaaatc    371100
     cttcgacacg cgcaagcaat cgtacaacaa gccttgcctg tctcgagtgc ggatttgaaa    371160
     caccgtgtgc gcgggactca tgaggttatc cacctccacg gttgtttcgt aatcgaacac    371220
     cggcggtttg gcttcggtga cgatcatccc ggacgactcg cgcaaggttt tcgtgcgacc    371280
     ttgtcgagtg acgaacgacg gcgcggggtg aaccaatata ttgacccgat tcaacgcctc    371340
     gggcgttcgc gcgacgacgg gtttgacgcg tcgggaaata tcgccgacgc gcgacggatt    371400
     cggcagctcg tgtaaatcat ccgtcacgta gaatagatcc accgccttgc cgcacggcgc    371460
     cgtcgtgacg tgcgcgcgat gcacggtgag ctgaagctcc cacaacgcga gcgtgacgtc    371520
     gtgcaacagc cccacgcgat cgtgcgcctc gacttgtaaa atatacagac tctgattcgc    371580
     gtgcatctgc tccaacatct caaacgactc gacggatgga atcgtgctaa tcgtgctctt    371640
     gtgcggacac agcaactcta accgctgcct cagcagctcc caatccacga cgcacgtccg    371700
     aggcgctatg gactcctcga gctcggccaa cgccgcgttc ccgccgtgcg cgctcccctc    371760
     gaaccgtcgc aatttcggcg aactcatcga cgccggcatc ggcgaccccg tcgccgccgc    371820
     gcgctcccga cccagccccc ggtccacgct cgccccccta tccccactcc cactcacccc    371880
     accgtctttc gcgcgcccat ctcgcccgcg cgcccctaac caagccttcc tcgcgacgtc    371940
     gccgacgcgt ctcgcgattt ctcccgctcg cctcgcgact cgcctcgcca ctcctccgac    372000
     ccccgtttcc tcgctcgccg cgcccgcgcc cgcgcccgcg ccctcgcgcg ccgcgttctc    372060
     atccatcagc gatccgtggc tcacgcctcg atcgagcgcg cccgcgcgca ccgtgagcaa    372120
     caccagcgcc cacacgccgt ccgtcgtaaa gtcgccgcgc gtcaccacga gcccgaattc    372180
     aaacaccacc ctgcagatgt ccgccccgag ccccgtcttg tccgggcacg tcactcgaaa    372240
     ctccgcgcac ggcaccgcgt ccgcgccgtc gtccagcgcg gcgtacgcga cgcaccgctc    372300
     gtcgtccgcc gcgtcgtcgg cgatcgtcgc cgcgcgcgcg cgcgccgacg cgtcgcgcgc    372360
     gcgcggcgcg gacggcgcgc gcgacatgcc ggcgacgcga cgaaccgcgg gcgcgacgct    372420
     cgaccgacgc gtcggcgcgc gcgcgacgcc cctcgagcgc gcgcggcgcg tcgatgagtg    372480
     acgcatcgcg atggcgaatc gcgatcgcga atcgcgtcgc cacagcgcga tgcgcgcggt    372540
     cgcgcggtcg ctcctgctct ggctgacgct cgcgccgacc ctggcgcgcg cgtcggcgca    372600
     cgcgtacgcg cgcgactcgc tgtacgcgac gaacgacgcg gcgatcctcg tcgcgggcgc    372660
     ggagggcgtc ttcgcgtcgc gcgtgcgcct cgagcgcgag acgacggacg tccgaaagcg    372720
     atggctcggc gcgaatccgc gcgtcgcgga cgggcgcgcg tacgtccgac tggacgcgct    372780
     gacgttcgag cggccgcggg agacggcgcg ggcgaggggc gcgacggggg gggcgagcgg    372840
     cttggtcgag gcggcgacgt ttaaacgcga ggacgtcgat cggatcggcg tgtgggacga    372900
     cgaggcgggc gcgaggaagt tttgttgcac gggtgacatg gcgaagcgag ggctgtgcga    372960
     gaagggagag gtgggacgat tggtggtgcg agggcggggc gacggcggcg cgacggcgcc    373020
     gtggaagacg gagatttggt tcgagggcga cgacgtcgag gcgaggagcg atgtgcaggc    373080
     ggtgagcgtg cgggagacgg ggatgtatta catgtggttc gtggtgtgcg atccggagca    373140
     cgcgggggtg acggtgagcg ggaggacgct ttggaagaat ccggatggat atctgccggg    373200
     ggcgaagacg gcgctgttgc cgttttacgg cttcgcggcg atggcgtacc tcgggttggg    373260
     gttcgcgtgg gcgatggcgt acgtggggaa ttggcgacac gttttagagc tgcataattg    373320
     catcaccgtc gtgctggcgc tgtcgatgtg cgagacggcg gtgtggtatt tcgattacgc    373380
     caactggaac gccacgggct atcgcccgta cgtgttcacc gtggtcgccg tcttgctcgg    373440
     cagtcttcgc acgacgctca gtcgcacgct cgtgctcatg atgtccatgg ggtacggcgt    373500
     cgttcgcccc accctcggcg ggttgaacgc caaagtggtg tcgttgagcg tttgctatct    373560
     cttctccacc gccgtcaagg acgtcgtcga gcacgtcgga tcggtggatg acttgaaacc    373620
     cggcgcgagg ttgtttttgg tgctgccggt gtcggtgttt gattccgtgt tcttgatttg    373680
     gatcttcaac tcgctgtcga ggacgctcac gcagctcgtg ttgagacaac aaaagcaaaa    373740
     gctgtcgctc taccgcgcgt tcaccaatct cttggcggcg aacgtcgtgc tctcggtcgg    373800
     ttggctcgcg tacgagatgt ggttcaagag cacggacatg attgaagaga agtgggagtc    373860
     ggtgtggatg ttgactgcgt tttggcaagc gttatccttc ggtttactcg ccggcatttg    373920
     ctttttatgg cgccccgcga gcgagtcgac gcagtacgcc tacagcgagc tcgcgaacga    373980
     catctccgaa gacgcgtggt ggggcgagct catcaccaac gacgacatcg agcaattcgc    374040
     ggggtcgtcg aaaatgtcca agtcaccgcg cgtgatgaat agtgcgaaga agacgcgagc    374100
     gatgaacgac ttttcgctcg acgccgacga cgactcggcg gcggaaatcg aaatggaaat    374160
     gggaaagatt gactgattga ttgaatcgat cgacgcacgc gtccttcgct tcaacgctgt    374220
     aatttgaatt gacacgcaat cgcgcgctct ctatttgcta aacggcaatc accgtacttt    374280
     acttgcgtcc gccctttcgc gacgccccgc gcgcgtccga gagcgcctgc agcgtctcgt    374340
     caaagtgccc gagcgcctct tcgcgtttca ccggcggcgg cgaatccggt tcgtcggtga    374400
     atacttttga cttgttcgcg cgcgccttga acggcgaaaa caaacctccg cgctccttcg    374460
     cggacgccga cggcggcggc ggctccgcgg ctttggtctt gatcgccctc ggcgccttcg    374520
     gcgtcttcgg cgccgttttc tccctatccg gcgcgtacgc ctccggcagc cgacacaacc    374580
     gacacacgct ggtgcgaacc tgaatatcgc tcccgtcctc cccccgctct atcgccgccg    374640
     ccctcgcgtc cgccgcgatc gcccgctccg cgacgatgta ctcgtacgtc gacatccgcc    374700
     tccaacacag cgtcgcgtga aacgcgaaca actcccccac cacgtacaac agccccatcc    374760
     cgagcgccac gtacgcgcac actcccacga tcaacgacgc gtgcgtcacc ccgttccccg    374820
     cgtaccgcgc ccgctcgttc acgtacctct tcgcctcgtc tccgttcgcc gccaaccacg    374880
     ccgcgagaca cgcgccgcac gccgtctgcc ccccgatctg caccgtcgcg ctcgtcacca    374940
     gcgccaagaa cgccccgtaa ttccgtccac cgacgcaatt attcaaccac ttgcagtgat    375000
     gatcgaaatc gtccacgcac ttatcgcagt cccggcagtg cttcgcgcgt cgcccgacgc    375060
     tcgcgtcgca gcgcccgcaa tacagcgccg cgtcgtccgt cgcgcgcgcg cccgggtcga    375120
     tcgccgtcgc gcgcgcgaac gcgcacgtca cgaacgcgca cgcgcacgcg tacgcgatga    375180
     tcgcgccgcg tcgcgagcgc gcgtcggcga tcgacggcgc gagcagcagg taaaatccga    375240
     gcgcttcgca cgtccacacg acgatcgccg tcgtttggtg cgcgttgagc gccgcgcgcc    375300
     cgcgcgcgtc gacgaatccg ttgcgccgcg tcggcggcat cgttcgtccg cgcccgcgcg    375360
     cgatcgagcg cggttcgggc ttcgcgcggc gtcgatgagt gtcgaaaacg acccgcgcgg    375420
     attaccattc gccgcagaaa tcgccgcgaa ttcgcgatgc gcgcgcccgc gtcggcgctc    375480
     gcgacgacgg agacgcgaga cgacgcgttg gcgctcgcga tcgcggacgc gtcgaacgcg    375540
     ccggacgatc gcgcgcggcg ggaggcggac gcgaaggtgc tggaactgaa gctcggcgcg    375600
     attcgcgacg acgtcagggc gtcgacgctc ggccgcgacg tgcagggctc gcaggcgggc    375660
     gcggggtcgg gggagtttca caagtatcgc gagcggcgac ggcgcgagcg cgcgcggttg    375720
     gaggcgatgg aggcggcgga cgcggcgcgg gtcgaagcgg aggcgcgcgc gcggcgagcg    375780
     gcggcggcga gcgaggcgag cgaggcgaag acggcgaaga acagggcgaa gcgagcgaag    375840
     gcgaaggcga agcgagcggc gaaacggcga cgggggggag ggggggcgac gatcggggag    375900
     gcgaaggcgg acgaggagga ggaggaggag gaggcggagg cgacggcgac ggcgctcgat    375960
     tgacgggacg cgcgcgatcg gtgggcgcgc gaatcggtgg gcgcgcgaat tataatacaa    376020
     tctcgtgatg ggttcggcgg tggcgtcacg cggccggggt ggtggtggtg gttgtggggt    376080
     ctcgcgcgtc gtccgcggag gcgtcgtcgg cgtcggtttt cgacgcctcg gtcttcgtgt    376140
     cggcgaagac gccggcgaac ttgtccgcga tcgcttgttc catctccatg cgctcgggcg    376200
     agcctttgtt gatgatggcg ttcacgaaat cctcgggatc gaccttgagc agctggaacg    376260
     cgaacaggat cagtaacggc aaatcgcttc ccgtggcgag cgtcgcgccg aacgcgacga    376320
     agccgacgat gagattgacg cgcttcttcc tcttctcctt ggcgatttgt tcgggcgtct    376380
     tgtttttatc ctcctcgctc gtctccgcga tcggcgcgtc gtcgagcgtg ttcgtccacg    376440
     cgcgcgctat ggcgcgcggg agcaaacacg ccggcgcgac gtaaaacacg tacgccatcg    376500
     ccatcgcgaa cgggcccaag atgaatccga ccgcgccacc gccgcgaagc gcgccgagcg    376560
     ccttggtcaa cgtcgtcgac gtagacagca gcagcgtcgc caatccgacg acgccgaaca    376620
     cgaccacgca cgcgcgccgc gccgttttga aaatcttccc tcggcgtccg ccgagccatc    376680
     gcagcgccat caaaatcggc gccgtcatca cccaccaact gctcccttcg ccgccgtacg    376740
     cccccgcggg gacgagcaac atgtaaccga cgtgaaaatc taaccacgcg ctccgacacg    376800
     cgcgattaaa cgcgaacggt cgatgctccc cttcgtgcct cggcgacgtc ttgttctcgt    376860
     accaccaccg ccgcagcgcg tacagcgcgc cgaacgtcgg cagcaccacg agcaacagcc    376920
     actgcgcgcc gatgatcggc gcctccctcg attccctgag catcgctccc gtgtagaaca    376980
     gcagcacggc ggtgagcggg ttcagccgac cgaagaacgt cggcaccgcg tcgagcgcgc    377040
     gcggatacag cgcgtcgctc agcggcgcga tggtgtcctc gagctccggg cgcgcgtcct    377100
     cgccgtcgcg cgccgccggg tcctccgacg acgccgtcgc gcgccgccgc gtcgacggac    377160
     gctcgcgtcg cgcgcgggac gccgcggggc gcgcgcgcgg cgacgcatcg catccgaccg    377220
     cggcgcgcgc gtcggcgaac gatcgcgcgc cgcgacgtcc cgcggacgcc tcgacgcgcg    377280
     atgacgcgcg tttgagacgc gcgcgatgcc cgcgatcgat cgcgcgcggc gcgagggcgc    377340
     gcgcggcgaa cgcacgcatc gcggcgcgcg cgcgagtgag gacgggacgc ggaaaatatc    377400
     tttcgggacg cgccgacgcg ggcttcgcga gacgcgcgag ggcgagtcgc cgcgccgccg    377460
     cgccgccgcg acgggatttc gatggaaata aatagtgatg gattaaacgc gggtcgaacg    377520
     cgcgtgggcg cgagcgaggg actggcgcga gagagacgcg cggtcggtcg gtcggcgact    377580
     acaagccgtc gaacgcgggc gtctccgcgc cttcggggaa caacatcgcg agcttgaccg    377640
     cgccgagatc gttgacgacc ttgctcgcgc cttcgcccat gaaatcggcg ccgatgttgc    377700
     tgccgcacgg ggtgatgaga caggccatgt cggcgccgac ggcggcgcgc aagccgacga    377760
     tggaatcttc cacgacgagg cacttgctcg cgggcaagcc aaccttgtct ctggcgaggt    377820
     tgtagatcaa gggatcgggc ttcttgcgcg tgacgtcgtc accagccatg agcacgtcga    377880
     gcttgctcaa acgctcgacg ccgacgacgg agttgacaac cttttcgaag cccgccttgg    377940
     tcgccgcgct gcaaatcccc accgcgatgg agggatcggc gatcgcctcg tccatgagcg    378000
     cgagcacccc aggtcgcgcc acagccactt cttcgacgat ctttttataa atttccgtct    378060
     tcttgtcctg caacgcgtcg atgagcgcgt ctcgatccgc gtcgctcgac ggcgcctccg    378120
     cgaacatcgt cgacgtcggc cacgcctttt tatcctcgtt aaaatgccat cgcatcttcg    378180
     gcttcccccc gcccacggta ttttgcagca cgtcgtaata tttcaccacc cactccacgc    378240
     cctcgccgtc gattttcaaa tcaaacgcct cgaacgcgcc gttgtacgcc aaccggtgca    378300
     gctcctccgt ctccacgatg acgccgtcgc aatcaaacaa aagcgcgaat cgcgcgttct    378360
     tcgtgttcga tcccgcgttc gcgcgcgtcg tcgtcgcgcg tcgcgtcgtc ttcgtcgtct    378420
     tcttcgccgc cgtcgtcctc gcgccgcgtt caacgcgcgt cgacgtcgtc atcgccgtca    378480
     tcgccatcga atccgtccct cttatcgatg acgcgtcttt ttcgtcgtcg cgccggcgtc    378540
     gcgcgttcgc gcgtccgaaa cgccgcccga gcgcgttcga cgcgcgtccg ctcgcgaatc    378600
     cgagagcgcg tcgccgtcgt cgcgtccgcg tcgcggtgtg cgcgtcccga atcgcgccgt    378660
     cccaggcccc tcttcgtcgc acttcgccgc gcgacgcgaa tgcgcgcgtc gcgcggcgac    378720
     gacgcgccgg cgctcccggg acgcgcggtc gcggtggacg aagacaaaaa atcgatcgac    378780
     aacgacgcga acaagcgcgc cgtcaagcgc taccgcgatc gtcagcgcga cgcgaagatg    378840
     aagttggaat ccgaaaacgc ggcgctgcga gtggagacga cgcggttggc gacggagctc    378900
     gcgcacgcgc gatgggtgct cgacgcggtg gcgtcgcggt gcgggatgaa gcgacgcgcg    378960
     acggggcgcg acgcggacgc ggcgctgcgc cgaagcgtcg cgcgcgtgat ccacggcgcg    379020
     gggtgcccgc tgggacatca ggggcgggac aggccgtttc gattggacgc gacggaggcg    379080
     aggcgacgcg aggacgagga cgaggacgag ttggcggcgt ttttgaagga gtttttggtg    379140
     cacgaggacg ggaagtgtcc gtgcccgggg cgcgcgcgcg atgggggcga gtagaggata    379200
     gttgtgttgt atgaatagtg atgtggcgtg acgaacggat gcgtgtgatc tgctgcccct    379260
     caaccggtct cttgagtccg tactgtagcg cggaaattta gtaattcaga atgaattaac    379320
     tgtctcaacg cctgatgcgt tcagcgttcc actgctaagc gtatctctac ctgatggggt    379380
     ccgaggcctc gaagtcctag gccgaaggag attgaaggca attcgcgtgc gattcgtgaa    379440
     agcaaatgtg cgtcttataa acaaccccgt cggtaaggga cgggtctaac aagtgacgcg    379500
     cgcaaaggag cagttgcgcg tgtcgtcgct ttatttgctg acatttttta tatagcgtaa    379560
     ttggaggtat tctagtacct cagagttcat ataaggacga tgcgtatacc tatttaccat    379620
     agaaatggct aaggcccttt cgtcagcgtg cgcgacgacg cgcgccgcgg cgttactagt    379680
     gcgcgtgctc gacgccgagt tgcgcgagcg cgatgacgag aacgccggcg gtgtaacaca    379740
     cgaacttgta aatgcgcatg ccgcgcgcgg gcgcttcgtg cacggtgtgc gtgtgcggag    379800
     cgagtttatg gtcgtgaccg tgctcgtctt cgcacgattg cgtttgcgtc tcgaactcgt    379860
     cgccgatgac ttccacggta ccgacgtaaa tgaacgtacc ggcggcgatg ccctcgagga    379920
     cggcggagac ggctgggctg tgtgcgcttt ccgccgcgca cccgatcaag atcccgatcg    379980
     gggttatgaa cgaaaacgcc gtcatgaaaa tgaagagcgt ctgcggattc gtcatgccgc    380040
     agcgcaaaaa cgcgcacccg atgctgaacg cggccgcggc tttgtgcgac gcgatggcgg    380100
     tgaaaatcgc gtacacactg tttcgatcgc tttgaagccc gagggagaca cccgcgagag    380160
     aggcgtgcaa cgcgacgccc gccatgaaga gcaaagccgt tctcgtctgc gcgaagatgg    380220
     acacgtgacg acccttctcg tcgtgcgcgc acgtgtcgca cgcgtcggtc gacgccttgt    380280
     ccacgacgac gacgacggcc gcatcgacgt gatgttcttt actttgtccg tgtccgtgtc    380340
     cgtgtccgtg gccgtgctct ccgtcgccct cgctctccgt cacgtgcgag tgcgtgtgaa    380400
     acacgacgcg ttcgacgaag aacgcgatga gaaatcccag catgaccatg accatggcga    380460
     aaggatactc cttcgccgta ccgatgcgtg cctccgtcgc gctctcgagc gcgtgcggga    380520
     cgaggtgcac gaacccagac gcgagaaaca atcccccgct gaacgcgttc ataaactcca    380580
     acgcgctctg catcttcggc agcgttctca cgaacagcga cggcaacatt cctcccgcca    380640
     aaccttcaaa aaacacagcc accatgagac ccatcttgag tttgaaatgc ttcaacccac    380700
     ccgtcgccgc cgccgcgctt tccgcctcgc tcgcgatgaa cgtgcacgtc gactcgctca    380760
     ggcaccgcgc cgccaaactc agcgccgaga gcaactcggt ctcgttcaac ttttgatccg    380820
     cgcccgcgta cgtcgtgatc acgtccgccg acgacacgtt cgtcagcgtc tcctccgcgc    380880
     tcgcgtgcgc gtgtccagcg ctcgcgtgcg cgtgtccagc gtgcgaatcc gcgcccgcgc    380940
     ccgcgccgct cgtcctcgcc gcgaaccgct cgaacaattc gctcagctcg tgagcgtcca    381000
     tcgtcgcgtc gtcgttgtcg tcgttgtacg tctccaagat gtgatccacc ggcgtctcgt    381060
     cgcctctcgc gacgcgcgcc atcgcgcacg cgcacgcgca caccgtcagc gccgtcgcga    381120
     atcgcgcgcg cgcccgtcga caccgccgcc ggtcgttcgc cgtcatcttg tctcgcgccg    381180
     tcgcgaatcg cgcgcgcgtc gagtcccggt ctcgacgccc gcgcccggtt cgccccggtt    381240
     cgagcgcgcg cgaacgagcc gaagaggcgt cgcgaagtgc ggcgatgcgc gcgcgtcgtg    381300
     cacgtgtcga cgattcgcgt cgtgcacgtg tcgaggatcg tcgtacgcga cgccccgcga    381360
     agcccatcac ggatcgcgtc gcgacgcgcg tcgtaaacat gtcgacacgc atgtcgacat    381420
     atttacccac gcgcgtgtac gcattgaacc ccgtgatgca tctatatacg aaaaacgtct    381480
     cgacgcacat gtcgacatat ttaccccacg cgcgtgtacg cattgaaccc cgtgatgcat    381540
     ctatatacga aacagataaa tgcacgaaat acacggtggt aaacagaccc cgaatgcgat    381600
     gcgcacggac gttcgagcgc gcaaaaagcg cgatcgagcg agcgatccga tccgcgcgcg    381660
     atcgctcgct cgatcgcgcg cgtcgccaca cgccgacgac gcgcgcgcac tcgcgatgtt    381720
     caagacgaaa gcccccgcgc cgaagacggc ggtgaagaaa tccgcgccgg cgaagaaggc    381780
     gccggcgaag aaggcgccgg cgaagaaggt cgcggcgaag aaggcgcccg ttcgcaaggc    381840
     gggcgacgac gaggtgcgac gcgaacgacg acgatcgcga cgaccgggcg cgcgcgacga    381900
     cgcgatggcg cgcgcgacga cgcgattgaa tgggaagaat attcgcggcg cgcgtcgggc    381960
     ggggacggcg cgacgcgcgg cgggagggga gacgggaagg cgatggatgc gcggacgggg    382020
     acgatatcct ggagatatgg tttgacgcgc gcgacgcggg cgcgagacgc gagggcggcg    382080
     cgcggcgcga gacggtcgcg aacgatcgag agggagagaa atcgtggacg cgcgcgcggt    382140
     gcgggacgga tcggcgggtc gacgcgcgcg gtgggcgacg cgggagggcg cgacgcgaag    382200
     acgacgagac gacgcgagac ggaggactga cggcgaacgc tcgcgttctc gcgcgatagc    382260
     tctggcgtcc gggtgccgtg cgaccggcgt ggttggatgg ctctctcccg ggtgaccgtg    382320
     gattcgatcc gttcaacttg tccaagtgcg tgtggcgacg tgacgcgatg cgacgcgagc    382380
     gcgcgagacg cgtcgacgaa tcgcagactg acggcgtttg tttcgcaggc cgattgaata    382440
     cgttcaattc gatcttgacg ctctcgatgg ctccgccgcg acgaacccgg cgggtcgggt    382500
     gatcggtaag ctcaagaaga ccgacaacaa gccgaaggcg cgcgcgatcg tgccgtacga    382560
     cgagtccttc gacatcatgc gcttccgcga gtgcgaactc ttgcactctc gctgggccat    382620
     gctcggcttg gtcggcgcca ccgccgcgga agccgccacg ggtatctcct gggccgacgc    382680
     cggtaaggtt gaacttgaac aaccgcaata cctcggcttc ccgctcccgg gcttgtccgt    382740
     cgcctccttg acggcgattg aagtgctcgc gatgggttac ctcgaagtcg cccgctcggc    382800
     ggagctcgac caaaacaagc gcatgtaccc gggcggcgcg ttcgacccgc tcggctacgt    382860
     cgccaacgcc gacgccgagg aggaattccg cctcaagacg gctgaactca agcacggtcg    382920
     cttggcaatg gtgggcatgt tgatcatctc catcgaagcc gcggccggcc acggcgtgct    382980
     tccgtaagcg agcgatgtga gctgttgaac atcgaagcgc gcgacgattc aaatccgccg    383040
     aaactcgcga gggtcgacgc cgatcgcgac gccgcgcgcg tcaattagcg aatcatcatc    383100
     atttacctta gcaccttcgt catgtatcgc aggaagacgc acgattaatc gctcgacgct    383160
     ttcgctcgtc gcgcgcgcaa acctcgtcgt cgcgcgagct aaccctcggc gcgcacgccc    383220
     cgcacacccg cgcgacgcac catgctcgcg cgcgcgtgcg gcttcccccg agcgagcgcg    383280
     cgattctgtc accgcgcgtc cgcgtcgtcc tcgcgcgcgt cgcgcgcgcg cgcgcgcgtc    383340
     ggcgtcgccg tttccgcgcg cgtcgtggcg aacgaccgcg aacgacgcgc gtctttcgac    383400
     gccgatgacg cctcgcgcga cggcgcgcgc gcgacgcgac ggcgctcgaa cgaacgaccg    383460
     cgacgacgcg ccgtcgcgcg cgcggcgagc gggacggacg acgagccacc ggcgccgctg    383520
     tacgtcaaga taccgctggg cttcgcgtac gcggcgctca cgtacgcggc ggcgtgcaac    383580
     gccttcatgt ggacgctcga tctgagcgcg ccgatcatcg agggaccgac gagcttggtg    383640
     gttggacgac tgtgcgtcgc cctcggggcg acgctgctcg cgggattgaa cttttggccg    383700
     caggcggaga aacagttggg acggtgcgcg cgaacgttcg cgtcgaagga atcgagcgaa    383760
     cgattaaagg cggacgccgc gaagttcgcc gccatggtcg cgatgaagat ggggtttgag    383820
     ttttacgcgt attggaaggc gctgacgtcg ttcacgccgt gcagtcaatc gctcgagttg    383880
     ccggcgtggt acgggttggc gttcgtcggg cacgcgacct tcgtcgccgc gagctcaaag    383940
     attctcggcc cgggcggcgc gtccacggag gacgtgccgt tacagatgcg caaactcatc    384000
     ggcgggttcg atgttttgct ggcgttggcg tgcgtgggga cgagtaagct cgcgatggct    384060
     gggtacggcg ttccgagcgc ggcgctcggt ttcgtcttca tgctcgccgc gacgtacttt    384120
     acgtttgaaa acaagctccc atccaaaaag acgccgagtt ccggcgccgc ggcgtgacgc    384180
     ccttcgcgaa tctattcgcg cctcgaacac gtagcacacc attgttagaa cacccgagac    384240
     gatcgtcttc tcgcgcgtct cgcccgcgtc gccgcactcg cgcgctcgcc ctcgcgtcgc    384300
     ccccatgcgc gtccccagcg ccgcgaaaaa cattcgcaac gccgccgccc ggcttctcag    384360
     cgccgaacca ccgccttcgg tcgcgtcctc ggtcgtcgat ccgttcgcgc tccctcccgt    384420
     ggacgtcgcc tacgacgtcg agagcgccga gcgcgcgctc gccctgcgcg gcttcgcgcc    384480
     ctccgcggcg cccggagcgc cgcgtttcat cggtttcgac gtcgagacga agccgaattt    384540
     cacgaaaaac gtcgccaacg tcaacgcgcc ggcgctggtg cagctggcga acgagcgcgg    384600
     gtgcgtgctg gtgcacctgg cgagcatgcg cggggagacg ccgccgacgc tgcgagcgct    384660
     gtgcgaggac gcggggtcga tattcgtcgg gaacggggtg tggtcggaca tgcgggacgt    384720
     cgactgggcg ttcgggacga aatcgcgagg gtacgtcgac gtgggggtga tcgcgcagac    384780
     gtttggacac tcgagacacg ggttgaaggc gatgagcgcg agatacggat acgacgccga    384840
     aaagccgaaa tccgtgcaga cgtcgaattg ggaaaaaagc cccctggagg cgaagcagat    384900
     cgattacggg gcgaaggacg cggcgttggg gttgtgggtg ctgaaacagt tgtacgcgga    384960
     gtacgcggga ggggaggtgt cgctcgagga ttgggcgatg gcgtttggaa acgcgtcgca    385020
     gccgaaggag gcgtttcggt cggcgcgagc gaacgcgaag acgacgccgg agtgcgtgat    385080
     gaaggcgttc gagagattcg atcagaagaa tcgagagttg gtgaaagagg cgtggttggt    385140
     tcgtcagatg aaaaaggccc agcgcgtcgt gaaacagatg gcggagggcg cgttgcatcc    385200
     ggtgagcgcg acgcacgcgt tgatggatat tttgcatgcg cccaagtcga agcgcaaagt    385260
     cgtcgagtgg gtgggaagtg gtagtaaagg tggcggactg ttcgagatcg agctcaaact    385320
     gggctcgtcc gtgcgcgcgc gcggtgaagg gcgcacggtg aaggcggcga aattcgaagc    385380
     cgctcgaggc gcgttcgccg ccttaaaaga cggggacgcc gccgacgcga cgatttggat    385440
     caagcgcgag ttagagcacg cttggtcgca gtagaagtgt tgtagtggca ttttgtacaa    385500
     aactattgaa actattggat gaacgcgtta caccagtgag tttccatccg ggcgaccgta    385560
     catcatcggc gcgttcggcg tttggaacac gacgcccgga tccgaccggg cggtcggcgg    385620
     cggacgctgc gctcgctgcg ccgccgccac cgcgacgtcg ggcgccctcg tcttttccgt    385680
     gacctcgtcg tagatggcga caatttcggg cttggtgatc atgttctcgt ccttgtctcg    385740
     ggcgtagcaa atgaacacgg cgtcgatgca cgtcaagagg acggagaaca aaaatgacaa    385800
     aatcacaatc gaagagacgc ccgcgcacgc gccgacaatt gcaccgacgt tgtgagccaa    385860
     atcatcgtca ccggttgata cttgcacacc tacgtgcacg gaaatcccca cgacgacgcc    385920
     gtagaagatg gcgaagaaga gcgcggtcat gttcaaaatc atctccggta accaccacac    385980
     gcgcagggcg ctcaaaaagt tatccttcag caatcgcgtg acttcgcgac cggattccaa    386040
     caacgattca cccgtgatgg cgcactggat ggtcgcaaac ttggtgatgg tttcaatgat    386100
     ttcggcgata cagtccatga cggcggtgac gatgcacgca agaatagcca tgaagccgcg    386160
     cgattcgcgt cgcaatcttt cattcaagtt gcgcaaaatg gtcacacctg tcaaaactaa    386220
     cccgccgaac gccaacgagc cgaacgatgc gccgaaggcg tggccgatga actcgcgcgt    386280
     cgttcccacg aacgccgtcg ttcccgccgg ggcaaagtac cagcgcgaga ttgacccgcc    386340
     gatgacgaat gtgcgcatct ccgccgcgat catgtgtgac cagagccaca cgagcaaggc    386400
     gaaaacgacg tacgggccca cccagctgtc ggtttgccat tcgcaacacg gaacgacttc    386460
     ctcgccgtag tagcatttcc cgccagtgta gtgctcgtaa tcgctcggcg cgatcgagcc    386520
     gttcatgtac gccccccaca cgcacgtgaa aaacatgatc gaggacacga tgacggccaa    386580
     accggcgaag acgctcgtgg tgatgagatg aggattatcc ttcaacgccg tcgacgcggc    386640
     gccgagaagc ttcgcgacga gctccacccg gtcgcgcgtc gcgtgcatcc aatacgcgaa    386700
     aaacgcagcg aacaacgcga acagaataca cggaaacgcc atcctttcaa tcgcgaacgc    386760
     gatcgacaac gcgaagcaac ttccgatttt cacgtaaatc atcgaccacg tggcgaatcg    386820
     agggtgtcgc ttaaacgccg tcaaagccaa cgctcccatc gcgcacgccc cgagcatcgc    386880
     catcacgacg tacggtctcg ccttcgtcaa cgccgtcgcc gcgtcttcgt ccgcgccgtc    386940
     ctccaacagc gtccttcgtc gcgcgccgac gccgttcgcc gcgtgacaac tctcgtactt    387000
     gttcagcgtc tccgcctccg tcaacacgtg cgcgtccgcg gagacgcgcg agagcgccaa    387060
     aagtccgcac aggatcgtca ccgcgagcga cgtcgcgaac gcgcgcttga acgcgacgtc    387120
     gcggtgcggt cgcgcggcga gatttccgtc gttttcattc gcgatttcgt gacgttccga    387180
     cgacgtaaag agcgcgctgt cgtcgtcctc gcgcgcgtgg tcggccatcg ccgcgttcga    387240
     cgttcgcggt tcgttcgcct cgcgcgcggt cgcgacgagg cgcgacgcgc gcggtcgcga    387300
     cgaggcgcga agtgacgcga gggcaccaga tccagagtcg ccggcgccgc gggtgccgag    387360
     tttacgcaaa cgccgcgacg gcgcgtggat tacaacgtcg gcgccgagga ggagcgcttt    387420
     tctaagaacg gcgcggtttc gccgagcgtc gcgcgacgct cggcgaggtg ctcgcggacg    387480
     gtgatgttgt ctaaagcctt ggcgtgattg aaggcgacga aaccggcggt ggcgacggcg    387540
     tagccgacga tttcggtgac gctcacctcg tcgccgtata agaacatggc ggcgccgatg    387600
     acggcaacgt tcttcaattg tgacatcgtc ttcaccatga gcgatcccgc gtgtttgacg    387660
     acgccgaggc agacgtaatt gacggcgaag ccgaacgtcg cgcaaataaa gaataggtac    387720
     caataccggg taaacgtggc gatattttcg gtgcgaaaca attcctcgcg ctcgaaaatc    387780
     aagctcaacg ccatcaaaaa cactaacgtc gccggggaga agtaatacat cccgttgaac    387840
     agcgaaaact ttttgttgct gatcaagtat tgaatcccga cgctcctaaa cgcctcggcg    387900
     atttccgccg tcagcatgca cgccaaacca aacatcgtca cgtgcgcctc tccccacgcc    387960
     gcgatgaaac atcctatcat caccacgctc aacgtggcga tgattctgcc gctccatcgg    388020
     tctaaaccga acgccaccaa agtgaaatag cacaccaccg gcgcgaacgc cttgagcatc    388080
     tgaataaacg acagcgacaa atacgaatac gccacgttcg ccgccgcgag cgacagcgcg    388140
     gtgcaaaacc cgatcggcag tatgttcgcc gtccactccc tcgcgctcaa ccggtgcgac    388200
     atgcgcttcg ggtcgagttt tatcgccgcc gccgcgaccc cccagccgaa ccagctcccc    388260
     agcgagctca cgaacaccgg gcagttgaac gacgtctccg tgatcaggtg cttattcgcc    388320
     aggatcaaca ccgtggcgac gagcagatac gccaccgcgt acgccatcgc gtacgccgcg    388380
     ccctcctcgc cgtacgtcga cagttccatc gcttcgtcgt gtcaacaccc tcagcgcgtt    388440
     cgcgcgttcg cgccgcgcgt cgatcgccga cgattcgcgc gattcgcgcg attcgcgatt    388500
     cgcgattcgc gtcgtcgcgt cgtcgcgtcg tcgcgtcgtc gcgtcgtcgc gacgcgcgcg    388560
     cgagtgtcga ttcgcgtcgc gtttgacgcg cgcgtcggtg cgcgccgaac cgaatcgtca    388620
     gacatgcgcg cgacgcccgc gattcgcgcg ctcccgtcgg cgtcggcgcg cgcgtcggcg    388680
     agcgcgtcgg cgcctcgcgc ggtcgatcgc gcgcgacgcg cggttcgatc gacggcgcgc    388740
     ggcgcgagag acggcgcgcg agcgatggcg gcggcgacgc gcgtgtcgcg cgcgacggcg    388800
     cgagagagcg cgagaggtgc gcgcgcgctc gcgagaggga cgtgggacga cgcgcgcgcg    388860
     attcgcgcgc tcgcgggcga cgaacggcgc gcgggcggcg cggggagggg gcgcggggtg    388920
     gtgagcgcga gcgcggcgag cggcgcgagc ggcgcgagcg agcgagaggt gcgagaagga    388980
     gggggagagc gatcgcgcgc gagatctcga acgccgatga tgcttaatac tgcgttatct    389040
     tccttattag agcgccgcga cgggtctctc ggggcgcggg cgcggcgaaa tctgtgaggc    389100
     aactcaacaa ctacctgagg cgtttgaggt cgagcgagtt ttgattttaa gttttttttt    389160
     gtgttttggg cggtcgagag gcgcggacga ggcgcgcgcg cgctagagac tgacgattcg    389220
     cgtgcgtttc ttgcgcagat cgcttcggcg cagacggtgc acgcgaaggt gcggtgggcg    389280
     ctgaagaatt tgggattcga gacgctgacg gagattcaag ccgccgcggt gccggcggcg    389340
     gcggagaaca gcgacgttgt catcgcggcg gagactggga gcggtaaaac cttgagttat    389400
     ttgattccga tttggagtaa tctcctcgag cgcggcgtcg gaggacgaga cgacgacgac    389460
     ggctcgcgcg agacgggggc gttgatttta tgcccgaacg cgacgctgtg cgaacaagtc    389520
     gcgcgcgtcg cgaattcgct cgtcgacgag ggcacgggcg aaccgctgtt gcgaacgtac    389580
     gcgctgacgc cggaaacggg aacgccgttt cacgccccgg acgtgtacgt caccacgccg    389640
     gcgcgcgcgg tggacgactt gttacgattt cgcgagggcg cgtggcgacg cggctcgttc    389700
     agtccgacgg cgcgcacgct tcggcacgtc gtcttcgacg aggccgacat gttgttttcg    389760
     ggagggtact tgaaaccgct ccgcatgtgc ttcgacgtgc tgtatcgcga agaaaagctc    389820
     gcgagcgagg ggttttacct cccgggcact gggaacgagg acgccgccgc ggagtgggac    389880
     ggcgacgtcg atcgcgacgc gtcgtcgttc gagcgggatt ggcgcaaaga ccacgacggc    389940
     ccgcggaagc gtggaccagc gctcggaggc aagggtaaag ttggtttagg tgacggtaga    390000
     gactttagac gacagtacat cttcgccgcg gcgacggtga tgagcaacgg gaagaagacg    390060
     ccgggggcga tgatcaagta cggcttccct gacgccaagt ggatcgaggg acgacgatta    390120
     caccgctccg tggagagcgt gaatcagacg tgggtggaag cgactttgga aacgcgcgcc    390180
     atggcgctcg cggacgccgt cggattgacg tccgccggcg cttcggcgga gaagactatg    390240
     attttcgtca acaccgcggc ggcggcggat gaaatcgctc gcgagttcaa cgcgctcggc    390300
     ttgcgcgccg ccgcgttcca cgccgacatg gcttcgcacg aacgcgccat gcgcctgaaa    390360
     gatttcgccg acggcgtcat cacggcgttg gtgtgcacgg acagcgcggc tcgaggcgtg    390420
     gacattccgg gcgtgacgca cgtcgtccaa gccgaattcg cgggcaacgc cgtcgattat    390480
     ctccatcgca tcggccgcac cgcgcgcgcg ggcgctaccg gtcgcgtcac aaacatatgt    390540
     ttacccggaa gcgccgatct cgtacgcgcc gtgcgcgacg ccgaggcgaa cggcgatccc    390600
     gtcgagagcg cgttcagccg aaagcgatcg tttcgcaaaa aaaccaaaaa atacggcccg    390660
     tccagaaaag gcgtcgccga tctctccctc aggcgcgccc gcgatcaacg ttcgtaatga    390720
     ttgtacattt tattttccga cgcgccgccg actgaaaact ccttgaacgc gccgaccgca    390780
     cacgcccgcg caccgcgccg cggagatgcc cgcgcgcgcg ccgcgccgcg cgatggacgt    390840
     cgacgccctc gacgtcgatc tgcgcgtgcc ggacgatcgc gaggtgcgac gacgacgcga    390900
     cgggacgcga cgaaacgcga cgcgacagct cgagacgaat ttgaattcga aattgaaacg    390960
     aacgactgac gacgcgatgc gacgccgacg acagggcctg acgcgacgag cgaaagaatt    391020
     gcgcgagctg cgagcgacgc tggcgcggga actcgcgcgg cgacggcgag aggcgttcgg    391080
     ggaggatgac gagacggcgg cgccgagcgg cgcgaaggag gaggaggaga acgacgacga    391140
     cgacgacgtg agaggcgacg acgcgcgcgg tgaagaatgc gtgttcgagg atgatgatgc    391200
     gacggtgccg aacgcgcgat cgttgtcgga tggggaggag tacgcggcgg cggtcgcggc    391260
     ggcgctagaa ccgacgattc cgcagagcga cgatttcgcg gcggcaggcg acgatggggg    391320
     cgacgatggc gtcgacgcgc acgatggggg agggcgttcg atacccacgg tgctcgatga    391380
     agacgatgag gcgttggcga cgctggaggc gttgggcgtg gcgagcgaga gcgagacgcg    391440
     cgggacggat tcgaagagga aacgcgggag gatcgaggag acgccgatgg cggtgggcgc    391500
     ggacgagggc gtcgatgcgc gcgatcgcgt cgcggaaagc ccgggacggg tgttgcgatt    391560
     cagcgtcggg gcgagtttgg ggttggatga tgacgatctc atcgccgccg cggaggcgcg    391620
     cgaacgcgcg gcggcgacgc ccgcgaagga cgcgtcgatg gcgtacgtgc gcgccatgac    391680
     gactcgattc gacggtggtg cgcccgttcg cgtcgtgttt tcggacacca tgcgcggtgc    391740
     gaacgcggct cagcacttgg tcgtcgtcgt ggagacttcg ggcggcgcgt cgatggacgc    391800
     gttggtgttt cgcgtcgacg tcgacgaggc gacgtgcgtg ggctcgtgtt cgctgcacga    391860
     gacgcgcagt tcgccgagtc agcgtgcgac gcgccggcgt ccgtccatcg gcgccaccgc    391920
     gagcgccgca tcggcgccgc cgagcccgga cgccgtgcgc gtgagtccga acgggcgttt    391980
     cgtcttcgcg gcgcacgccg aagacggcgt gcgtttgctc gccgtgcgcg acggcgacgc    392040
     acccgcgtcg aagaacacgt cgacgtccag tgacgtggtg aaacatctgg ggtgtgggtt    392100
     caaagtgacg cgcgtggcga cgacgatggg ggagtctgga tttcttctcg ccgccgcggg    392160
     cgaaccggga cgatgcgtcg tgtggtcctg gtcggtgaac gacgctaacg acgacgagtt    392220
     cttgctcaaa gaacacgtga cttgcgatga gatgcccgcg atgaactatc gaggcgtcgt    392280
     gcccaagccg ggcactccca cgagtctgca gtggctcgac gtcgatcgca atccaaaaat    392340
     cgtcgccgtc gtcgacgaag gtttgaccta cgtgtggaac gtcttggaga aggcgcgcga    392400
     tcgctcgtcg tacgcgatcg accacggcat tcgatcattg attccggttc actgcgaagg    392460
     cgtgccatcg cgtggccccg ccgaagacga gcccttggcc gcagtggcgc tcgcgcgtcg    392520
     caagcgcgcg ccgcttttgg atctcgagtc gaaagactcc tccgacgact ctctgtcgag    392580
     cgagcgcgga gaatcgtgcg cgatcggtgc cgcactcatt cgtgttcacg gtttatccat    392640
     cggcgagtcg ttattcgcct cggagtcgtc cacggcggta tcgttggcgt gcgcgggcga    392700
     agacgcgtgc ttcggcgcgc gagacggcgc gttcgtcgcc tggaacatag ccaccggcga    392760
     gtgcgcgctc aaggtgctgc tcgccgtacc ggcaagtggt gaactcaccg acgaccagga    392820
     cctcgccgtg cgctcggtgg cgtgcgctga gaggcacgtc gccgcgtgtt gcggcgacgg    392880
     cgtcttcgtc ttcgccaaat ccgcgccgcg cgcgagctaa cgctcgagcc gacgcgcgcg    392940
     agtcgttcgc gcgcgaatcg atcgatcggc accgcgtcgc cgtttccgcc gccgcgatgg    393000
     cgcagctcgt tgtatctaca gatttcgata gaattacacg cggttcctcg tttctccgct    393060
     cgctcgccag cctaccacac cggccgtctc cccggcacgt cgtcccccgt ctgattcgcg    393120
     tccgcgtacg ccaactgcga cttctccctc agccaatacc gatcgctctt cgtcggctga    393180
     tcccaattat ccttcctgcg cgcgaatccc gagccgcgat ccctctcgtc agtcgccgtc    393240
     cgcgccgtcg tcgccgcaaa ccctcgcgtc gtcgtcgccg cgccgcgatc ccgccgcgtc    393300
     gtccgccgcg cgctcgccgc cacggcgagt ccgcgcgcgc tcgccgcgcg cgaccgcgtc    393360
     gcgatccgga atccccgtcg acgcgccgcc tcggcgtctc gcgcgcgcgc gccgtcgttc    393420
     gcgcgccgcg cgatcgtcat cgtcttcatc gcgcgtcggc gtcgtcttca tcgcgcgcgt    393480
     cgcgtcgcgc gcacgcacag cgtcgcgcac ttcgcgctcg tcttctcgag gtgcttctcg    393540
     agcgcgcgct gccgctcgac gccgtcgtcg atgccgctcg cgatgaatcg cgtgagaaat    393600
     cccatggcgc gtcggtctgt gacggcacag cgtcgcgcga tgctcgacga ggcgcgcgac    393660
     gcgcgcgcga gcgtcgacgc gcgcgttcgc gcgtgcgcgg cgacgctcga gcggtgcgcg    393720
     cgcggcgacg acgagagcga cgcgcgatgg cgcgcgcggt gtcgagacat ttgtgaaaaa    393780
     atgacgcgcg cgtgcgcgcc gacgacgcgc gacgacggcg agtgccgcgc gaggatgctc    393840
     gagtgcgcgt tcgcggcgtg cgcggcgacg ggagggcggt gcgagcgcgg gcgcgcggcg    393900
     gtggaggcgt tggcggcggc ggcgcgcggg gacggcgaac gcgcgagcga cgcgctggac    393960
     gcgctgtcga ggacgacgat cggagcgtgg gacgaggcga gcgatgcgat ggtgcgtcga    394020
     agcgtcgcgg acgcggcgtt cggggcgatg gagacggcga tcggggcggg cgggaggacg    394080
     tgggcgcggg cgacgagcgc gctgtgtcga acggcggcgc ggttggacgc gcgcgatacg    394140
     gaggatggga aacggtacct cgacgaatcg ttgcggctgc tcgagacgag ggagagcgag    394200
     cgcgggagtg gggacgcgga cgcgcgcgcg agagcggcga tgtgcgcgcg attgagcggc    394260
     gcgcgggtgt tgggatcgat gggctcggcg gcgaaggaga gcgcgagagg cgcgttcgac    394320
     gagacgggcg cgcttcgagg cgagttcttc gcgcgcgccg ttcccgcgct gttggaacat    394380
     tcgtataaag ataaagcggg aagcgtgcgg cgggcgtgcg cggaggcgct cgggcgcgtg    394440
     ggagggttga agacgacgga cgttcgccag ctcggacgcg cgttgggcga taagcgcgac    394500
     gacgtgcgaa cggcggcgac gcggtcagtc ggcgcgcagg gtggagtggc gaagttttta    394560
     gtgcccaaac tcgtcgagaa cgcgaggcgc gatgatccag agttgcgtca aaccacgtgc    394620
     gaggcgctgg agagcgtgtg gaaaggacgc caaggcgatc ccgcgcaaga cggttcggag    394680
     gacgttcttt tgtttcaaac cgcggagtgt atgggcgaac tcacgaatga tgcagacgct    394740
     ggcgtgcgcg cggcggcgac gaggtgctta ggtcaccttc gaggcgccgc ggcggcgaaa    394800
     gtgagcttga ttaacaagcg cgtagacgat agcgatgaag gcgtgcgaga cgccgcggcg    394860
     gagactttaa tcaagctcgg attcatcaat ccgagcacgg gcacgctacg aaacaagggc    394920
     aactaccgca cgtcaaagtt ttcggcgaat aaaaacttat tcgccgtcct gactggcaag    394980
     caagattccc tcgcgacgac gtcgcgcgtc aacgttcccg cgggagccat cgtgcgcgtg    395040
     tggtggcctc tggatgagtg ctactacgaa gcaaaggtca agggatacga caagtcaacg    395100
     cgcaagtaca ggcttctata cctagacgac aacgtagaag aagaggtgaa ctttaggaag    395160
     gaaaaggttg acttgaagca caagccgacg aagaacgcca gggcgacgtg gatcccgtgc    395220
     ggcgcggtgc agcgcaagcc aaagtcgaag gacaaggatc aaccaaaaca caaaatagcg    395280
     cgaaagcgat cgtcggcgac gagcgcgtgg gtggattacg acgccgaaga gcaaaaacgg    395340
     atcggtcgcg aagcgctcgt cggtcgtcga atgaaagttt ggtggccaga cgacaaggcg    395400
     tggtacgccg gcgagattcg tcgcttcagc gccgacacgg gcaagtatac ggtgttttac    395460
     ttcgaggacg gcgaagagga agatttagat ttcgacaaag aagagcgcgc gccaaagatt    395520
     tacgaacctg ttcaagacga atccgcgacg cctacgattc acggtttgga accgcggcga    395580
     ctgcccgttc gctctggcga aaaggacgcg ctgtacgaac cgggatgttt ccgcgggagc    395640
     gagtgctgca gcttcgtgaa cgaagagggc gagaaaacaa caatgttgtg ctcggacttt    395700
     gacaaaatgt acggcggcgg aagtcgctgg cgacgttcca tcgtcgtgac ttccgaaacc    395760
     ggcgccgagc cgattgacac cttcttccgc gtcaacggcg agcgctgggg gaacgccgtc    395820
     ttaggttatg agttcgatat ggacgtcgcc gtcgacatgc gagactttcc cgtcgatcga    395880
     cagcccgtcg aaccgtcttg gcaacgcgtg aaaatcatct cgtacaaccc gacgagcggc    395940
     gagcaccaat gcgtcgacat caaggacgac ggcgagcccg atcccagtcg cgccgtgtgg    396000
     cttccgctct gcatgcaacg cacgcgcgcg cgcgccgccg ccgacgacga cgacggtgaa    396060
     gattcgattt ctgacatcat tagttcatag aattttgtaa ctctgcgcct cccgcgagcg    396120
     cgtcgcccgc actcaccgac gcgacgtctt gaaaccgcga cgccgcgcgc gcaaagctca    396180
     acgaaaacgc atccgcgcca tcggcgtcgc gtttttggtc gttctcgccg cgcgcgcgcc    396240
     gcattccctc gcgccgtcgc gtcatgcaca aaacctgcgc cttccaacga acgctcgcgc    396300
     gcggcgtcct cacggcgcgc gcgccgcgaa cgagcgcgga cgcaccgcgc tcgagtcgta    396360
     gaatcaccgc gcacgcgcag acgcgccgcg agtcccatcg gaaagtcgat gggaacggtg    396420
     gcaaggatta cgcgcaagtc cggcaccaac cagatccgag cgcgcatccg acgcacttga    396480
     ttccggatga tttacgcgcg cccgacgtcg acgacgcgcg gaaaaagaaa ccagtggcga    396540
     ttgttttggc gtacgtcggg caagggtaca aagggaacac gcacaacgcg caggcgccgc    396600
     gagggacgac ggtggacgac gtcgtcgagg acgcgctctt cgcgtggggc gggattttaa    396660
     tgccaaatta tcgcagtcgc gggttgcagc ggttgaagtg gagtcggagc agtcgcacgg    396720
     ataaaggagt gagttcgttg tgcacggtgg tgagtttgcg ggcggagatc gatccggagg    396780
     tgtggacgaa ggacgtcgag gcgagggaga cggcgagaga aatcacgaaa catttgccag    396840
     aagacgtgga gtgtttcgcg gtgtacaaca cgccgaaatc gtttcaagcg cgaagagagt    396900
     gcatcatgcg cacgtacgag tacttgcttc cggcgcgggt gttagattta gagcgcggtg    396960
     tgctcgatgc gagcgatgcc gagcgattgg aactgttttc aaaggcgctc gcggcgttcg    397020
     tcggcgcgca cccgtttcac aattatacga aacggaagca gtacacgcga gaggcgatag    397080
     gaaagtacag cgcgaaacgg cgagacgcgc gcggtaagtt ggcatggaaa gggcaagagg    397140
     gtgcggtcat ggacgatgga tcggacgaag acgtggaagg ggagcacggc gaggaggacg    397200
     aggaggagaa cgtcgtcgcg tcgacgtccg ccgccgaaca cgacgacggg tttccaaaac    397260
     acgtcggtga acgcaggcga ggcacgtatt ggttgtacga aagcgacccg aacgacaaaa    397320
     tcggcccgtc gcactttcga aggattcaca actttaccgc gggcgcggat gtcgagcgta    397380
     tggaaatcac gaacgacgac ggatcgaaga cgacgagcga accgtttatt cgcgtctccg    397440
     ttcgagggga gtcgttcatg ctgtaccaga ttcgcaaaat gatcgccagc gccgtggcgg    397500
     tgagtctcgg tcattgtcca ctcgagttcc ttcccgcgtc gctctctcga ccgtgccgcg    397560
     cggcgatgcc gctcgcgccc gcgtccacgc tctacctcta cgacgtcgaa ttcatgaagt    397620
     ttcgcgtcaa tcacgacccg tcgcagccga accgtttaga acggctcgag ccgtccgaga    397680
     gcgtgcgcgc ggacttggcg cgtttccaac gcgaaaagct cgagcccgcg ctcgcgcccg    397740
     cgctgctgaa cgacgaatgg gacgacttta aggaaaactt gaagcaaggc aacgtcacgc    397800
     ccgagctctc gcgcgacatc ttagccgcgt acgagacgta caaggcgaac agagacgagg    397860
     cgcgcgcgtt acaggacgcc gaagaagccg cggcggcggc ggcggcggcg gcggcggcgg    397920
     cggattcgcc atgataaaag cggcgcgcgc ggtacacatt aatatttcaa catcgctctc    397980
     tagccgtcga cgaagcgacg aagcgaccga ctcctcgaca tcgctctact gcaacaccga    398040
     gtccagcgag tgattacccg tgacgacgac ccacagcgcc cccagcgccg cgctcacgat    398100
     gatcgcgtcg agccacagcg gcacctcttg ccgaagcgcc gtcgtcacca gacgatacgc    398160
     caccagcggc gaagccaaat ccaccgccaa atccggcgtc tgatacgcgt aatcctcctc    398220
     cgcgaacgac ggcgcgcccg cgaatccatc gccgccgccc accgcgaacg atgccgcgcc    398280
     cgcgacgtcc gcgtgcgcca gcgcgagcgt cgcgagcgcg cacgcgcgcg tcaccgcgcg    398340
     aatcttcatc ttcaccgccg cgtcccggtc gccgtcgggc gccgcgcgcg cgcgcgtcgc    398400
     gcgccgacga cgcgcgcgcg tcgtccggcg cgcgccgacc gacgcgcgcg cgtccgcgcg    398460
     gcgcgcggcg agcgccatcg cgtcgcgaag tcgcgctcgt tggatgccgg ccgcgtcgcc    398520
     atcgcgcgac gcgcggcgcg cgtcatgtcg gcgacgcagc tcgagcacgc gcgacgagcg    398580
     cacgaagaga tcgagcggct ggagcgtcgc gcggcgcgcg cgctgagcga cggcgcgccg    398640
     acgacgcacc gggcgcgatt gacgcagaat cgaatcgtcg acgcgatttt aacggcgagc    398700
     gtcgacaggg cgaagcgatt ggtgcgtcga tcgagcgacg cgcgcgtcgg cgcggtttcg    398760
     cgcgcgcgcg cggcgttcgg gcgcgcgaga cgcgccggga ggggtgaaag acgacggatg    398820
     gggcgttagg gcaatttgga cgcgcgagcg cgactgacga acgaacgcga acgcgaacga    398880
     acgcgcgcag cgacgaacgt acgcggacga cgatggatcg atgcgggaag aggcggagag    398940
     catgggcgac ggtgaggacg tcgagagggc gctgcgaggg ttctatgagg cggtgaagga    399000
     gacgcggcgg tcgcacgcgg cgcgcgcggg ggcggtggcg gaggcgggcg gagcgttcgc    399060
     ggaggaaatc gtagaagagg cggagcgcgc ggtcggtggg gtgtttagtg gagaggagaa    399120
     tagtgggagg tatttggatt tgcacgaatc gcacatgacg tacgcgaacg cgacgttcgg    399180
     ggagaggtgc gattattcag agtatttgga acggtgcggg aatttcgccg agacgccgag    399240
     gtcgaagaag ttttgcgcgg cgtacaccga ttatttggac gcgttgttgg cgtacttgcg    399300
     atcgtttcat gagcgcgcga ttcctctgca gttcgttcac aaggcgttag cgcaagacgc    399360
     ggaggagttt gagcgccgat ggaaaaaggg cgagtgtccg gggtgggaag acggcggcgt    399420
     gcgcgccgtg gacgaaaaga ccctcgagtc gagcgcggtg gatctctcgg cgttcaagtc    399480
     tttgaaagac atggaaaagg cgctcgacgt cgatgcgatc aaatccgccc tcgggtcctt    399540
     gggtctgaag gcgggaggca cgcccgagca gcgcgccgag cgattgtgga gcgtcaaggg    399600
     caaaaagctg agcgacatcg accgaaagct cttcgccaag ggtgtagtcc tcggttctgc    399660
     gtcgtcgacg tcaaagaaga aaaagtcaca aaacggtgaa gacggcgacg cgaaagtcaa    399720
     ggctgaaaac cgcgcgcgcg ccatcgcctt caaagagagc cagtgcgcgc tcgtgttgaa    399780
     gctcctcggc aagcaactcg acgcgacgcg caccaacgtg gagaagaaat ccacgctttc    399840
     gctcgcagag cttcaagccg aggccgagga agacgatgat ttctccgacg cggaaacgga    399900
     tgaggacgaa gaaatttaca acccgttgaa gttaccgttg gggtgggacg ggaaaccgat    399960
     tccgtactgg ctttacaagc ttcacggttt gaacatggag tacacgtgcg agatttgcgg    400020
     taattactct tattggggac gacgcgcctt cgagcgccat ttcaccgagt ggcgacatca    400080
     gcacggcatg cggtgcttga aaatcccgta cacgaaagcc ttcaacgaag tgacgtccat    400140
     cgccgacgcc gcggcgttgc acaaaaattt gtcccaacgc gaggtgggaa ccttcaacgt    400200
     caagctcgat gccgaagtgg aagacgcaca aggaaacgtg tacaacaaga agacgtacga    400260
     agatttacag cgtcaaggct tactttagcg cgtcgcggtt gtgattgaac gaaacgtcga    400320
     caaaacgacg tcgtcgatgt gcgagcgcgc tcgcattata agctaatcgc agctaatact    400380
     actgttcacc gtttgcgttt cttgtgctcg tcgtgcgaaa gcttgagcgc ggcgcaaatt    400440
     gtgacgtacg cgccctccgg gatatcgcgg gcgatttcgt ccagcgccga catcgcgtcg    400500
     tcgagctttg attcttccgc gtctttcagc gtgagcatgt acgtcaggca cgcggtaaag    400560
     tgcaatctac gcgcggcgtc gatgcactgg tctttgtccc aaggacaccc gtgctcgtgc    400620
     gcgtacttca aacactccaa ctgtccatca taggcggcat cacggcacgt atcctcgttc    400680
     caaggacacc cgcgctcgtg cgcgtacttc aaacactcca agcttccact cccggcggca    400740
     cgtgcgcacg tctcctcgtg ccaaggacac ccgttctcgt gcgcgtactt caaacactcc    400800
     aaatgtccat tcaaggcggc aaatgagcac gtcctctcgt tccaaggaca tccgtgctcg    400860
     cgcgcgtact tcaaacactc caaatgtcca ttcgaggcgg caaccgcgca cgttttctcg    400920
     tcccaaggac acccgcgctc gtgcaagtac ttcaaacact ccaactgtcc tttccaggcg    400980
     gcagagatgc acgtctcttc gtcccaatca cacccttgct cgtgcgcgta cttcaaacac    401040
     tccaactgtc cattcgaagc ggcattattg cacgtcctca ggttccaatc gcatccgtgc    401100
     tcgcgcgcgt acttcaaaca ctccaactgt ccatgcgaag cggcagcgtt gcacgtccct    401160
     ttgtcccaag gacacccgtg ctcgtgcgcg tacttcaaac actccaaatg tccactatag    401220
     gcggcacatg cgcacgtatc ctcgtgccaa ggacacccgt tctcgtgcgc gtacttcaaa    401280
     cactccaaat gtccattcga ggcggcagac ttgcacgtcc aagcgttcca acgacacccg    401340
     cgctcgcgca agtactttaa acattccaaa tgtccagtcg aagcggcttc cgcgcagtcc    401400
     ggcgccgtga acgcgagcgc gagcaagcgc atataacttt catgtccatt caaagcggct    401460
     tccgcgatgt gcgacgccgc gaacgcgcgc tcgcgcaagc gcgccaacgc ggtcgcctcc    401520
     tcgctcgacg ccatcggcgc cgatcgtcgc gcctcaccgt cgcgcgcgcg tcggcgtcga    401580
     cgccgcgcgt cacactctgc cgcgatggtc gagcgcgcgc cgcgtcgtcg tcgcgcgcgc    401640
     tcgcccgtcg cgcgtcgcgc gcgtcgcgcg ctcgatcgat tccgcgatga actcggcggt    401700
     cccgcgccgt cggcgtcgat cgcgacgtcg cgcgcggcgc cgagcgacga ggacgacgcc    401760
     gacgcggaat cgcgaccgcg ccgggacgac gccgccgccg acgcgcgcgg cgcggacgtc    401820
     gcggcgctgc gaagcgcgct gacgtgcgtg atcacgaacg cgctgttcgt ggacccggtg    401880
     acgacggcgt gcggacacac gttcgagcgg gacgcgctcg cgaggtggct cacgcgaggc    401940
     gagcgagaac gcgcggcggg acgagacgga cgcggacgcg tcgcgagcgg ggaggcgccg    402000
     gcgagctgcc cgcagtgtcg atcgccgctg tatcacgaat tgccgcacga gtggccggtg    402060
     aacacgacgg tgcgggagtg cgtggaggcg acgttcggaa gggaggcggc gctgggagag    402120
     gcggaggcga gacgcgaggc gaacgcgcga ggcgaacgcg aggacgatcg acgagggcgc    402180
     gacggcggcg agggaacgag acgacgacgc gcgcaggatg aggcgtgggt gtcgacgcga    402240
     gggaacgtga acgtcgtggg accgacgtac gagcttccga tgttttttct cgaggcgttg    402300
     gtgccggggc aggaggtcac gctgaacgtg ttcgaggcca agtataaggt gctggtgcga    402360
     cgatgtttga gcggatcgag gaagtttttg atgatgacga acgaggatag caacgaggaa    402420
     cattatttgg aggacttgga agacgacgac gcgacggcgg ccgtctctcg aggcgtggcg    402480
     gatgggtacg gattgacgga tgtcgatttg gcgcagtttg ggcgattttg cgccgagtgt    402540
     caaatcgtga cgtgtcaaga gctcgtcgat gggcggtttt tggtgcgcat tcgcgccatg    402600
     cgacacgtct tcgtgcacag cgcggtgaag gatccatctg ggttcatcgt cgccaggtgc    402660
     tcgcgcgttc gcgacgaaat caacgcggat ctgagcgtgc tcgacaacag gggcttcaaa    402720
     gacgacagcg aactgcggaa agccaacgcg gcggcggtga agctcgaact tcgcatagat    402780
     cgcgtgctag agcttttcga cgtgtgggtc gcgatgacga tcggctcgcg ttggttgtac    402840
     aattacggcg gatcgatgag ccaattgctt caagccgtcg gcccgtctcc gcgcagggaa    402900
     tctccgagcg atctcgcgtg gtggatcgtg cgcgtgctca atccactgcc gacgatcgac    402960
     ggcacgatcg agatgcgatc gatttgcttg aacacgtcgc acatcgacac gcggtttcaa    403020
     gtcatagcgc aaatgctgat ttattcgctc tccctcgtgc agcgcatcaa cgttcgcgac    403080
     tggaccaagc gcgagcacgt cgtggcggtg agcgtatgca acgaattatt cgcggtactc    403140
     agcgaatcac ccagtgatgc cgccggcgat ttacgtcgcg aacgattggt ggaggacatc    403200
     tatgaattgc tctacgacgt ggactttatc gagcacgaag cgtacgaagg cttacgcatt    403260
     tgccctccgg gctacgacga cccccaaggc gtggccgcaa aatcctttct cttagaaaag    403320
     agcaagagac cggatccatc gaaacaaacc gatagcaaaa aggcgcagtc tgaacagacg    403380
     aagtggagcg attaccctcc tccggtgttc gacgcagtga tggaccgctt gatatgggag    403440
     cacggttacg gcgcgttggc gctcgcggcg tggcgcgcgc tgtcggatta cgagtgcggc    403500
     gaccccaaac tcaagcgatg gaacgagcgc cttctcgcgc attgcccgag cagcatcaat    403560
     gtcgggacgc acgtgaagga cacgaacgag ctgttgcgat tatcccgcaa gttcagcaag    403620
     tgtcttcgcc gcgacatgcg atgcggcttt tacaaatttt tatacctctt cgacttgtgt    403680
     cgaatgctcg tctatttagt ctaccgcgtc ctcgtgttgg tcatcttcgc cctcggattc    403740
     ttgttcgagc tcgccttcga ccgtgagttc cacggtgggc acagaaccgc cgcacgcggg    403800
     ctcttcatgg ctgtcgcaat cggcgcggcg agcggcttgt tcgctcgaag ctcgctcgac    403860
     gcgtacttgg gtcgcgttcg gagcgaatga atgagtcatt tgatgtaagc ataacagtaa    403920
     atctaccccc gcttctggcg cttattatcc aacaccgcct tcgtcgccac cacgcgcccg    403980
     ctccgaccgt acctccaccg ctcgtactcc gcctgcgcca tccttcccgc gtcccaaatc    404040
     ctccgctcct cgcgcgacag caaccgctcc gtcttatcgt cgtcgcctac ccttccgatc    404100
     gaatccacca gcacttcccg ccaccgtcgc tccaacgcat cacttatctt ttccttcaac    404160
     tcgatcaccg gttccatcgc ctccgcgtcg tctcccgcgt ctcgttcgag cgcgtccaac    404220
     gtcgccctcg cgaatccaaa gtacgactcg cacgtcgtcc tcaagtttgt gatcttcgcc    404280
     ccgtcctccg ccttcaacag cgcgaacacg tcgtccgcga acgccgcggg cgtctcacaa    404340
     atgtacacgt ccttcgccat ctccccgtcc agccaccaca gcggcacggg cgcgcgatgc    404400
     tccttcggga cgtcggcgcg accgtttgaa tccttcttcg ccttgggacc gatgacttcc    404460
     gggccgaccg tcgccgcgcc ccacgcgaac tccaccgtga ccgcgtgttc gcgcgctaag    404520
     aaatcatcga tgtcgtagta atcccgccgc atctcgcccg cgcgatcgac gcgcgcgtcg    404580
     cgaagtgtcg ccgagccgtc gcgcgccgtc ccgaaaagcg caccggccgc acacgatgac    404640
     gcccgcagac gtcgaagcga cgtcgttcga cgacgtcgac gcgctcgtgt tcgactgcga    404700
     tggaacgctg atcgacacca tgggattgtt ttacgtcgcc gacgtccggg cgtgcgacga    404760
     ggtcggggtg aagatgtcga aggggacgtt ttacgagctc gcgggcgtcc ccatacggga    404820
     catattccgt aaactgtgcg tcgaacaggg cgcggcgagc gacgacgcga cgctggacgc    404880
     gatggtgcgg tcgtgcggcg cgcacgcgcg cgcgctcggg ccgccgaagg cgatcgagtg    404940
     cgtcgtggag gtggcgagga acgcgaaggc gcgcgggaaa cgcgtcgccg tggcgtcgag    405000
     cggcgtcaag acgaccgtgc tcgagcacct cgagcaccac ggattattag atttattcga    405060
     agtcgtcgtc acgtgcgagg acgtgacgcg cgggaagccc gcgccggatc tgtacgcgct    405120
     cgcggcggaa aaattaggcg tcgcgcccga gcggtgctgc gcgtacgagg acgccgtcct    405180
     cggcgtggag agcgcgcgcg ccgcggggta caagcgcgtc gtggacgttc gcgcgatgtc    405240
     tgggtaccat ccgacggatt atttatgctc gaacgagccg tagcgcgcgc tgtattcttt    405300
     ccctcgcgtc tcgcgttcct tcgtcggcgg cacacctcga cgcgagcgat gcgcgcggcc    405360
     gcggcgtccg tcgtcgccgt tcgcgtcctc gcgcgcgcgt cgtcctcgcg cgcgcgcgcg    405420
     tcgttctcgc gcgcgcgcgc gatgtcgcgc gcgtcgccga cgttcgtgga cacgcacgcg    405480
     cacgtcgacg tcgtgctgga taaactcggc ctgccctccg cggatgcgta cctcgagtac    405540
     gccgacgcgt tcgcgcgcga gcacggcgcc gcggccgcgc tcgaggcgtg cgtcacgatc    405600
     ggatgctcgg agaagagcct cgcgagcgcg gcggcggtcg tggacgggag cgagagaatg    405660
     ttcggcgcgt acgggtgtca cccgctgagc gcgcgagagt ggacgaggac gaggacgcgc    405720
     gttcgcgaga tgttgaccac gggcgcgcgc gtcgtcgcgg tcggagagac gggattggat    405780
     tatcacagga tccgcgacga cgcggaggac ggggaggacg cggaggcgta caagacgacg    405840
     caaagggacg cgttcgcgga gcaaatgcgc ttggcgacgg aactcgggct gccgctcatc    405900
     gtgcacacgc gagaggccga gacggacacc gtcgcgatga tgaaggaaca tttacccgcg    405960
     gacgcgcgcg tgcacgtgca ctgcttcacg tcgagcgtcg ggatggcgat ggaattgttg    406020
     cgcgcgtttc caaatttgtg cctcggcttc accggcgtat cgacgtttaa aaacgggcag    406080
     gacgttcgcg acacgatcaa agaggtaccg ctcgatcgca ttttgctcga aaccgactcg    406140
     ccgtacatgg cgccggttcc attcagaggg caaacgtgcc accccgcgat gggcgagcgc    406200
     gtcgcgcacg ccgtcgccgc cgtgcacgaa gtcgacgtcg aggaagtctt cgcgcgatgc    406260
     cgcgagaaca cgaggcgcgt gtacggcatt taagtgtatt cctagaacca tcagccattg    406320
     catccgattc atcattaacc gtaatctttc gccgcgtccc gcgttcgcgt cccgcgttcg    406380
     cgtcccgcgc ggcattccgc gcccctcggc cgtcgtcatg ccgcgcccgc gcctcgtcga    406440
     gaccatgctc gacgccgaca acgcgtccac gcgcgcgcgc gccttcgaac gcggcgcgac    406500
     gctccagccc gaatacgatt cgttctcttg gctcaagact gcgctcctcg cgacgcctcg    406560
     cgcgcgcggc ttgcgcgcgt tcgcctggcc ctggctctgt atcaacggcg tgagcgtgtt    406620
     gtggacgtcg ctctacgagc tcgcgctgcc caagcggacg tcgtcgctcg gaagcttcgg    406680
     catggtgtac cagctcgtgt tctcgacgat gggatttctg ttggtttttc ggttgagccg    406740
     agcggcggtg cggttctggg attgccgcgc ggcgttcggg aactttaacg tcggcgtgcg    406800
     aaggctcgtg gacgtggcgc tggtgcacgg gaaaggacga gacgcgcggg cgctggatga    406860
     tgtgtgcgcg tgggcgtgcg cgttcgtcgt ggcgagtaaa cagtttttgc gaggcgtgaa    406920
     gacgatttcg gcggaggagg tgatggggat tctgagcgac gatgaccgga agcgagtgga    406980
     gaacgcgaga catccgccgt tgtattgcgc gtcgatgctc agacgggcga ttcatcgcgc    407040
     gttcggggtg gatgagaaag gcgggacgac gagcgatacg attcgactcg agtcgcgctt    407100
     gcggcagttg cacgagcagt gtgatttttt aatcaccaac gagggcgcgt tagagcgatt    407160
     gcgagggacc aagttgccga tgatctacgt gatgcatttg agaacgtttt taatggcgta    407220
     ttgcgtctct atgccgttcg tgttcgtaaa ccagtggcgc tgggggacaa tcgtcgccgt    407280
     cgccgtcgtg tccttcgcgc tgttgggcat cgagggcgcg gcgacggagt gcgagattcc    407340
     attctctgcc gaccacgcga atcacttgcg gatggatcag tacgcgcaag cgtgtctttt    407400
     gagcgttggt gcgtacttgg cgtggaacga gcggctcgag ggagcaaacg atttcggtca    407460
     tcgcgagggc aacgtctcgt gcgcgtcgct cgaagattta gtcatcgacg tcgatacgaa    407520
     cgtctagagc acctgaatgt cggtagaagt atacttatta ttaaacgcaa gagcatgcaa    407580
     gagcgcgcgc gcgatcactt ggcgaagccg ccgtagattt ctttgacgtt ctcgatcgcg    407640
     tacacttcgc cgtgttcggg gaggacgcca aaggacaaat caaacgacac gacgccgcag    407700
     ttgacgattt tcttcttctt tcccgggcac gtcgagtcga agggtaaata cgtcttgaag    407760
     aactcgcgga accagatgga gtgaccgccg gcgatgacga cgtcggcgtc ctgattcatc    407820
     acccacgcgg cgaactctcg catggagtcg cggccttttc ggttgagctt cttctgaccg    407880
     gcgttcgacg acgcgtcgaa gagtttagct tcgtcgacgc tggacacgcc gagttctttc    407940
     gcgagcgttt gtgtcggcac aaaatcgccc ttcttacacg ccaacgcata cgtgtcgacg    408000
     ttgcgcgcca tctcttgcaa agcgctgtga atgattattt tatcgttcgc cttcgcgttc    408060
     gacaaccggc accacagcgc gtgcgcagtg gtgttcaccg ctcgccgcaa attactgctc    408120
     gcgatgaccg atttacctcg aagccccaac atgacgtcca cgacgtcacc gacgtatcct    408180
     ttcgtctggc tcttcgccgc gcgagacgcc gattccgtcg cgaagtgcgc gcgcagcgcc    408240
     tgcgcctgcg ccacccccgt cgcgctcagc ggcgaatcca aaaaaaacga atctcgcgcg    408300
     aaaaacttcc ccagctccgc gatgacgccc ccgatcagtc gcactggaaa cgtgtgatca    408360
     aactttcgat tgaacacctc gttccacgtg ctctcaccgt gtcgaatgaa gacgacggtg    408420
     cgcgtcttcg tcgcccgcgt cgccagcgtc ttcgggtcca ccttcgaccg cttccatcgc    408480
     ttctcatcgc tcgccaccag gtgcgcgttc gcgcgcaccg cgtcgtgcac ctttcgcacg    408540
     ccgcgtttcg cgcgcttatc gacgagcgac gcgcagagca gggcgccgta cgcggtgagc    408600
     agcgcgcgca gaatcatcgc aatcgtcgcc gcgcgcgccc cgctcgtcgc gctcgagccc    408660
     gcgtccgcga accgcagcgc gccgaacagc gcgtccgcga gcgcgcgcgc gatcgaacgc    408720
     tcgatcggcg gcggcgcgcg cgagaacatg cgcgtcgaag agtgccgcgg tcgtctgccg    408780
     tcgtccttcg tccttcgtca ttcgccgacg gccgtcgacg cgacgctcga cggttcgcgc    408840
     gacgcgcgcg acgcgcgcgc ggcgacgcgc gatgcccgag cgacgcgcgg acgcgcgcgg    408900
     gcggcgcgcg cggacgattg tatccgtcgt tcgcgatggc tgtcgtcgct tcatcgcgcg    408960
     cgcgctccgc gccggcccga tcccgcggca cgtggcggtg atcatggatg ggaatcgtcg    409020
     gttcgcttgc gcgagcggcg tggcgctggc gcgcgggcac gcgcgcggcg cggacgtgct    409080
     cagggaggcg tgcgcgtggt gcttcgagct cggcgtggag acgctgagcg tctacgcgct    409140
     gagcacggag aatttcaagc gctcggagcg cgagctcgag gcgttgttcg atttggcgtg    409200
     cggggaaatc ggaacgctga tcgacgacga agggttgcga cttagagagg cgcgcgtgca    409260
     cgtgagcggg gatttggacg cgctgccgaa gcgcgtgcga gacaaggcga aggaggcgat    409320
     ggaaaagacg aaggataatc gaggaccgat gttgaacgtg tgcatggcgt acacggggcg    409380
     agaggatatc gcgcgcgcgg tgatgaagac gcgggaagac gtccggggag gagcgttgga    409440
     cgcgagcgag gtggacgaac gcgcggtggc gtcgcgattg cacggcgccg agcgggaaat    409500
     cgagctcgga gcaggcatgc cggaggttga tttgctcgtg cgcacgagcg gggaaacgcg    409560
     gttgagcgat tttatgctct tcaacgcgcg attcgcgaag ttggtgttcg tggaggtgtt    409620
     gtggccggat ttcacgttta tggattttgt gcacgcggtt tggcagtatc agctcggggc    409680
     gaaggatttg aaacggtcga gacaggcgta cggcgacgcg aatgcgatcg aggcggaatc    409740
     tgccgtcgtc gccgaggttc gcgttcagcc ggggcgcgtg gcgaaagggg cgaagcgtag    409800
     tgtgtagtct agtttgtgtg caattgtagt tgttagatga tgattcgcga cgacgaggga    409860
     tgtacgtgac gcgcgaaccc gtcgcactcg tcgacgcgcg ctcggtcgat gcgcgcgagt    409920
     ctcttgcgcg cgacgacagt tgttctcctg ttatatgcat cgaccgtggc gaacgcggcg    409980
     tcgcttaatg ctttcggtca ggacggtttg tttgagttcg acaccgtgac ggttgccatc    410040
     ccatccgcgt cggctcgcga gggaggggaa atcgtcgtca cgcatcccac gggcgtgatg    410100
     gatgaacccg cgccgctcgt gctcttcatg tttccaatac acggttttcc gttctcgaca    410160
     tggcgaacgc tcatggcgaa cgtcattcgc gcgcttgcgt ccaacggctt tgccgtcgcg    410220
     acgccggcga gtatcgaccc gaacgggaat cgcccgatcc aaggaggcat gttcccagga    410280
     accacttcga cggtgagcgg catcgatctt cgcgagatgg cgacgcgcta tctgaatttt    410340
     ttcacgcacg cgagcaggta cttggtcgac ctcgcgcagt cggatccgag cttcgcgttg    410400
     cacggcaagc tcgatacgtc tcgcatcggc acgatgggct tcagcgtcgg cggcgctcta    410460
     tcgcaatacc tcgctcagcg gctagatgcg gagctccccg gaagagtggt agcagaagtc    410520
     gcgctcgcgc ctaccatcgg cacggaagtt cccttcacag gcgtcgacga catcggcgcc    410580
     gaattgtttc gcgagttcgc gagctcgatg acggtcccaa ccgtctttgt cgccggagaa    410640
     aacgatggaa tgggtggtct gcgagattcg gcgatttact acgaccaatc gcgcgcaccg    410700
     agagtgcgtg tgactgctgg taatggcgcc acgcattgtc acgccatcgt gccgatgagc    410760
     gaatgcgatc tcgttcaagg caccagaggt ttacagagct tggactccat catcgcgcac    410820
     gcgatgatga cgctgtatct tcggccagac acgccacgtt ggcgcgacga acgtgagtta    410880
     gcgacggaaa tcatatggcg tgatggtctc gaggcgcttc acgcgcaaat ggtgacgccg    410940
     ctcgcgccgc cgaaccgcgc gtgggagatt agaaaagtcg aacgcgatcc cgagttgtct    411000
     ttgacgatga acgcgtattc ggtcgccgca ccgctcgcgc cgcaatcggt cgagctcatc    411060
     gctgtggtgc gttcatcgtc gcgcgccgac gaatgcgacg aagtgcaggt gacggtggag    411120
     aacgttccag tcggcatcga ggcgacggtg acgcgattat cgccgacaga gtttggagtc    411180
     gacgtgcgat ggacgacggt gccacagcgc gcgcgcggcg cacaaacgcg acagtttctc    411240
     ggaaacttgc tcaacgcgag atcaaacagg cgtccagtcc aggtgtcgag cgagttcgga    411300
     cctcgcgtcg gcttcgccgc gccctcgcag agcgtgttga cgattcaggc gaaacacgcg    411360
     tgcgtgcgat ccggcttcgc cttcgcggac gtcttcgtga accagccgta cgcgtattga    411420
     tgagacgcaa atgatataaa gtggcatcac aacatcataa tttcacacgc gcgcgccgct    411480
     cgcctaacga atgtggtgcc taaaagactc aattatcgac gccgactcgc ccgtcgaatc    411540
     cgtcgagcgc ccccccccac gaatcgaccg gcggtaactc caccgcgaat cgattgaacg    411600
     gcacgcgccc ggtgcccgac gagcgcactc gaccgtccat tcgcaaccca acgtaaaccc    411660
     ctttatcgtc gctcaccttt gacatcttct tctgttccgc gacccactcc aaccaatcgt    411720
     tcgcgcgcag cggcgtgcat cgaaacttgc gatcctcggc gctcggcgcc tcgatcgcgc    411780
     cgtctcctcg aatcaccggc accacgagca ccccgcgctc gatcaacgcc tccctgacgt    411840
     cctccgcgtc ctccagcgcg gttcgcgcgt acgcctcgtc cccgctcacc acgactaccc    411900
     tcgaaaacga ccgcaaatcc tccaaccgca ccgtcttccc ccccgcgagc tccacccgca    411960
     atcgccccaa cctctcctcg cgcccgatcc tcgccatctg tcgctcgcgc gccgcctcct    412020
     ctcgcgcgta cagccacgcg aacgtcgcca gcgccgcgcc gtcgatcgcc aaattctcca    412080
     gcgatccctc cagcggcggc gcgttcggcg cccccgccgc cttcgtcgcc gcctggatcg    412140
     tcgcgatccc gaatccgatc gtcgccgacg ccgcgcacgc gccgtagagg aactgtcgag    412200
     ccacgcgaaa cggcgcctgc gcctcgcttc gcagtttcgt ctcgttcgag taccgcgcgt    412260
     cgtcgtcctc gagcgcgcgt cgcggcgtcg tcgtcgcgcg tcgcgccggc cgtcgcgccg    412320
     cgcgtcgcgc cgtcggtcgc gccgccggtc gcgcgctcga ccgcgccggc gccgtcgcca    412380
     tcgccatcgc cgcgcgtcgt cgtcccccgt cgacgcagtg cgcggtcttc gagcatcgta    412440
     cccggtccgt gtttttaatc gacgaaccgc gagactcggg ttcgaatccc acgatccgcg    412500
     tcagcgtcgc ggacgcgcga caccgccgcg acgacgcgac gccgcgacga cgcgcgcgcg    412560
     cgacgcgacg cgcgcgccga cgacgacgac gaccgcgacg acgacgaccg cgcgcgaatc    412620
     tcgacgcgat ggcgcgcggc gcggcgacga cgcgcggcgt cgcatccgac gcggcgacga    412680
     cgacgggacg cgcgcgacgc gcgcgaatgg cgcggcgcgg cgtcgcgcgc gcgacgcgag    412740
     gacgcgcggc gatgacgacg acggaggacg aggacgcgcg cgcggcgcgg ttggaggcgc    412800
     tcagggcgaa gtcggtggag ctgctggaga agcggcgcgc gctgacggag aggttggaac    412860
     ggcgacgcgc ggcgcgggaa gagaagagcg cgtacggggg gggggggaag ccggcgttcg    412920
     aggacgcgtc ggcgttcgtg gagcgcgcgg gaagcggggg gggtgggacg gcgtcggagg    412980
     cggcggtcgc ggaggcggcg gtcgcggagg cggcggtcgc ggaggcggcg gcggtcgcgg    413040
     cggcggcggc ggaagcggag gcggaacgtg aagcgccggc ggcgccgaaa tgtcgagagc    413100
     ggctgaacat catcatggtc gcgagcgagt gcgcgccgtt tagtaagact ggcggtcttg    413160
     gtgacgtcat gcagtcgctt ccgaaggcgc tcgccgggcg aggccatcgc gtgatggtcg    413220
     tcgcgccgag gtataaagag tacgaagaag tgtacgacac cgacgttcgg ttgacgttaa    413280
     acattctcgg gagtcaagtg gaggttgggt actttcactc gtaccgcgat ggggtggatt    413340
     ttgtgttcgt cgatcacggc gcctatcact ttgtgcgcga caacatttac gcgggcgaac    413400
     gctcggacgc gatgtttcgc aacgcgatgc tgtgtcaagc cgctttagag gcggtgtggc    413460
     acgtgccgtg cggaggtgtg ccgtatggag atgaaaattt aatattcgtc gccaacgatt    413520
     ggcacgcggc gttgcttccg gtgtacttgc aggcgtacta tcgcgatcac ggcaagtttg    413580
     agttcgcgcg ctcgtgcttc gttattcaca acatggcgca ccagggtcgc ggacctttag    413640
     tcgaattcaa caacttgcag cttccagatc attacaagca ccacttcttg ctcgacgatc    413700
     cgatgggcgg tgaatgcatg aacatcatgc aagccggatt gcgtctcgcc accaaagtca    413760
     tcgccgtgag cgaagggtac gcgtgggaga tcacgacgga catgggcggc tgggggctcg    413820
     cgccgacgat tcgcgaattc ggcgagcaca agctcagtgg catcgtcaac ggcatcgact    413880
     tgaacgagtg gtcgcccgac attgatcatc atttggacgg cgacggatac gcgagatacg    413940
     agccgcgcgc cggcgcgttt gaggacggca agcgcgcgtg caaactcgcg cttcagcgcc    414000
     aactcgggtt ggccgaacgc gaagacgtgc ctattttagc attcatcggg cgtctcgatg    414060
     accagaaagg cgtagacttg atcgccgaag ctgaaggatg gttgatgagc caagacgtgc    414120
     aactcatcat gttgggcagc gggcggggcg atttggaaga cgctctgcgg gggatggaga    414180
     gccgacatca cgacaaatgt cgcgcctggg ttgggttttc ggtgcaaatg gcgcatcgaa    414240
     tcaccgccgg ggcggacatt ctgttgatgc cctcccgatt cgagccgtgc ggattgaacc    414300
     aactgtacgc gatgcggtac ggcaccgtgc ccgtcgtcca cgccgtcggc ggcttacgag    414360
     acacggtgaa gcaatacgac ccgttcaatg acaccggtaa cggttggact tttgatagcg    414420
     cggaaacgaa caagctcatc gacgccatgg gccacgcgat tacaacctat cgcgatcacc    414480
     gggacgcgtt tcgccgtatt caagcgcgcg gtttcgagcg cgatttgggt tgggatcgcg    414540
     ccgccgagct ctacgaagac cgtttcatcg acgccaagta ctcgtggtga tcacgtcgtc    414600
     tcgttttacc cttgtaacgc acgcgacagc gtttctagcc acgcgtctcg ttccgtcgcc    414660
     cgacgttcgc gtctcgctcg cctccgcgcg gcgtcaaccc tccgcgcggc gcgtgccact    414720
     ccccgcacac gcccgcgcgt ccgtcgtcgc accgcgcgcg cggttcggcg acatggaaga    414780
     ccttcgcgcc gcactcgctg ggtcagtgag cgccgatgag ggcacgcgcg tcgccgccga    414840
     cgcgttttta aaatccgccg ccgcccgcag cggcgccgcg ctcggccttc tcggcctcgc    414900
     gagcgacgcc gcgacggaga tgggcacgcg gcagagcgcg agcatttact tcaagcatct    414960
     cgtcaataag tcgtggacgc agcgcgaagg cgcgacggcg acgacggaga cgaatccgat    415020
     cttggacgag ggcgacaaag cggcggttcg acgcgtcgcg ctggaggcga tcgcgaacac    415080
     gccgagcaag gtgcgaagtc agctcgtgga ggcggtgcga gtgatcgttc atcatgattt    415140
     ccccgggcgt tggccggagg tggcgaatca ggtgctggat gggttgaacg ccgcgtcgtc    415200
     gagcgagagc ggaaagctgt gcgggacggt gttggtgttg cacgcgctgt gtcgaaagta    415260
     tgagttcaag gcggtggatg agcgagcaga catcgaagag atgatacgcg tggtgtttcc    415320
     aaagttgctg gagattttga aggcgttgct tgcgtatcaa ggcccgccgg acacggaatt    415380
     ggaggagttg aagaaggcga tttgcaagac gtacttgagc gcaacgtatc ttaacgtcgg    415440
     accgtctttg cgcgaggaag ggacgtttcg ggaatggatg gcggcgtttc acgcgatcat    415500
     caccgcgcca gtgccgacag agaatatgcc gacggacgat aagactgagt tgaaacattg    415560
     gccgtggtgg aagacgaaga agtgggcgat gcacgtcgtc aatcggatgt tcaatagata    415620
     cggcaacttg aaaaagtgcc aacctcacga caaggctcaa gcgacggtgt atcgtgacaa    415680
     atacgctgga cactttgtga cagtatacat ccaattactg agctccctcg ccacgggtgc    415740
     ggtgatgccc gaccgagtcg tcaatctcgc cgtgcaccat ctctccacgg cgttgggggt    415800
     tccgacgatg tacaagcaca tggagccgca cctcgatgca atcttccagc aaatcgtatt    415860
     tccaatgcta tgtttcagcg ctgaggacga cgagctgtgg aaggatgatc cccaagagta    415920
     cgttcgaaaa tcacaagatc tcatagaaga catgtattcg ccacgaaccg cggcgtgcag    415980
     ttacacacaa gaattggtga ttaccggcag gcgtctgaag gaaaacttgc caaaggtgtt    416040
     aggcgcgatg gttcaaatat tcaccaaaaa ctcttccagc gtcagatccg ggccgatgga    416100
     cgctagagcg cgatacgaac tcgatggcgc gctgctcgtc atcaccaccc tgtcgcaact    416160
     tttatccacg cacccggatt acgcaaagga aatcgaaggt atgctcatga cgcatgttgt    416220
     tccggcattt ggttgtgtac atggtcatat tcgcgccaag gcggtatcgt gcgtatcaaa    416280
     gtattcggat atcacgttcc gagaccagaa taactttatg cagctgtttt cgagcgtcgt    416340
     aaatgcgatg aaggatcccg aaattccggt gaggttcgag gcagtcgttg ggctcggagc    416400
     ttttgtgcaa gccacagacg acgtgagcgc gctgaagggt attctaccac agttgttaga    416460
     cgagtttttc aagctcatga acgaagtgga gtcggaagat gttgtgtaca cgcttgaaac    416520
     aatcaccgaa aagtttggcg aagacatcgc gcccttcgct ttgggcatga cgcagaacct    416580
     cgccgcagcg ttctggaagg ttgtgcaaga agctgaagga aaggatgacg atgagtacgg    416640
     catgatggca tgcatgggat gtctgcgcgc catgtcgacg attctcgaat ccgtttctag    416700
     tttaccgcac atgtaccccg aacttgaagc cgccgtgttc ccaattttgc ataaaatgat    416760
     tagcgaagaa ggatacgacg tgtttgagga agttttggag atattgtcct acctaacgta    416820
     tttcactccg gtcgtgacac cacgcatgtg ggaactctgg ccgctgatga tgcgcatgat    416880
     ggatgactgg gcgctgcaat atttcgagaa tatgctcatt ccgctcgaca actacatcag    416940
     tcgaggcacg gagcactttc tcacccctgg ctcgagttac gtggaagata cgtataagct    417000
     gtgcgaaaag gtattaggag gcgattatcc cgagcccgat tgcttgccag cgccaaagtt    417060
     gatggagtgc gtgatgacga attgccgcgg ccgcgtcgac gtcgtcatcg aaccgtacgt    417120
     gaacattgca cttgcgtgtc tcgcgactgc ggagttgcca cactttaggg attggctcat    417180
     gatgacttac gcgcatgcac ttcattataa cgcatcgctt gcgctggcag cgacgaaccg    417240
     aactggcaaa acgaacgaag tgttcgcgtt gtggtcgaac atgctcgccg agcgcaggaa    417300
     gagtggagaa cgtaaaaact tcacctctga acacgccaag aaagtttgcg cgttgggact    417360
     catggcgctt ttgcaagcgc cggcagagtc gttaacacct gagattcgag gtgcgctcgg    417420
     aggtattctt gacacgctca tctctttact cgaagatttg cgattgcaaa tcacggagcg    417480
     caagtcggat gaagcgagcg gcaagagtag gcatcaatgg aatggccttg gcctcttcga    417540
     cggcgaagac gaatacgagg aacacaactt tgacgaagag gacgatgatg gagaaatgca    417600
     ctttgacgcg acgacgctcc gcgcgttggc gaagcaagcg caagacgctg atccgtactc    417660
     tcgcgccggc gacgtcgact cagaagacga cgagcatttc ttcttcgacg acgatgacga    417720
     ttcgtgccaa agcccgctag acgacattga cacgttcatc gtattttcgg agtgcatgaa    417780
     tcagttgcat cgcaccggta gtctcaatcc gagcgctgaa tctcattcaa aattgcagga    417840
     gttgatcaat cacgccgcga ttcgtgccga agagttccct cgagagcgcg cggaggcgaa    417900
     gaaggaatca cacggcgtgt ctggtagttg aacgagtacc agcataccgg cggtacgtta    417960
     gactgataat tatgtgaata tacttagtac aacaagtagc tagatcgtac gttttttacc    418020
     tcgttattcg tcgagattta tttcgttgag aatgcgagac atctcgtcgg ggatgttcgc    418080
     gtgcttaaaa gacatttcaa agttttcgac gtcatctcta tcgacgcgct gtaacccagc    418140
     caatccgagc gtcgtatcaa cgctcttgag tctataaaag aacagcagca tccagtcgtc    418200
     ggggacgtac acattgacca gtcgccccga taccacttct cgcatcggtt cccagacttt    418260
     attcgacgta gacatcggcg ccgaaatgaa cacgacgcgc tcgacaattt tctttccctt    418320
     ttcaccagcg gcgtggagct tcatcagcgc gctctgaacc acaaacgcgc cagagctgta    418380
     cgtcacgaac gtcacgggtc gtcgaccgtg ctgctgggtg agcaaagcgt tggcgatttc    418440
     ctccccggcg atttccgcct ttgctcgcgc aatcgtccac ggattgtcta ggtagcacgc    418500
     gcagctgagg agcgtcaccg gccaagacac cgcggtcgtg atcgacgcga gcgcggttcg    418560
     agctaaaact ttcggcgcgg cgaccgtgat ggcgtactta ccacccacga actgcatcgc    418620
     ggtgccgagt tcggtgagcg tggacggctc ccagttcagc acgtattgtt cgccggtgtg    418680
     atttccccac tcaggttttg ccgccggcgc ttcggcgtcc ttctcgtcga tcgtcttctc    418740
     cagcacgacc tccctcatct tttccaccag cgagtccatt tttttatcca acgcctcgtc    418800
     cttggtgagt tgcagtcgta gctccaacgg ccgcggcatg gcttccagtt cctcaatctt    418860
     cggcgtcttg cccttcttgc tcaagatttt actcgaacgc gaacgcgcca actcttgcgg    418920
     atcgatcgag cggtaagaaa ccaagatact cccagagatc accccagcca gagacgccgc    418980
     gcccttgacg gtctgcttca acgcgtcggt ggtttgcacg atcaaatagc cgtcgtcgtc    419040
     gcgctcgagc gtcatcccga gttcgcccgg atcatcgatc acgacgacgt attgattctt    419100
     ttccgctccc cacgcgcgga gtaaatcgcg ctcatcgcgc aaaaatccag gaacgaacac    419160
     gtgcagcgcg aatcgtcgcc cgacgccgcg cagaggaatg aactgaaact gttccatctc    419220
     cgtcgacgtt cgacgcaaca tcgcgtaccc agtcagcccc gcgcccgtgg cgccgaacac    419280
     ggcgccgacg ccgcccagcg tcgccaacac ccccgtcgtc gccgcgccta tcacgcccag    419340
     cccgctcaac gacgccagca ccgccggcgc cgcgaccccc cccgtgacga acaacgccgc    419400
     ccccccgatc gccgccgctc caccgatttt caccgcccgc gtccacgacc actccccctc    419460
     cgctcgttct tcgctctccg attcgctccc atcgtccaac gccgccgcgc gtcgcattcg    419520
     ctccgccgcg ccgtcctccg cctccgcgaa cgtcctccac gactcgcccg cgcgcgtcgc    419580
     ccgcgttctc aatcccgctc tcgcgtccgc gtcgtacgtc ccgctcgcga tcagcgcctc    419640
     cgccgcgaat tccacgctca tgcgctccat gctctcctcc tcgtcgccgg attcgtcgta    419700
     cgtcgccatg cgtcccgcgc gtcgcgtctc cgccgccgcc tcgagcgcgc gtcgaacgcg    419760
     cgcccccgtc tctcgtcgcc gttcgcgcgt ccagtgcgcg cgtcccacgt ccgcgtcgaa    419820
     gtccacgacg gaccaatcga tcgtcgtcgg catcgcgtcg ccgtcgctcg agacgcgcgt    419880
     cggattcgga tcggaattcg cgtcgcgcgc gacgatccgc actcgcgagc gcgacgcgcg    419940
     cgcgcgtccg agcgcgcgcg atggcgaacc cgtgcccgac gccgtacccg gagcggtgcg    420000
     cgcgcgtccg agcgcggcgc gcatgcgagc gcgcggcgct ctgacgaact cgaccgcgac    420060
     cgttggagcg cgacgattcg agcgcgattc gagcgcggcg actgacccgc gcgcgaacgc    420120
     gcgacgcagg tttcacgcgg cgacgcgcgt ggggaactcg agcgcggcgc ggtcgttttt    420180
     cagcgacgag acgcgattga tgctcttcgc gttggagcga cgcgcgacgc gcggcgcgtt    420240
     gacgacggtg cgcgaacaga cgggcgcgtc cgacgcggag gcgctggcgg aggacgcgca    420300
     cttggcggag ggcgacccgc gggcgctgcg agcgatggcg cgggcgtggg aggcgctgga    420360
     cgcgacgccg gcgaacgagg cgatgcggct gtacgtcaag gtgctggacg aggaaaaacc    420420
     gaattggtgg gacggcgcgg cgacggaggc gcggcgaagc aatcgtggga tgcacgcgaa    420480
     gggcgggatg gaggcgctgc cggaggcgat gcgcgtcgag cgcgggagat gggagttttt    420540
     ggagtacgcg gggacgaagc cgacggcgcg gtttcaacac gcggcgaccg tcgcgggcgc    420600
     gaagatgtac gtcatcgggg gatcgtttcg cggacgattc atgaacgaca cgcacgagct    420660
     cgatttgacg acgtcgacgt ggcggcggtt gaagacgaag ccggggacga gcgcgttacc    420720
     ggcgtgcgcg gggcatcggg cggtgacgtg tcgaggcgtc gtcttcgtcg tcggcggccg    420780
     gttcaaggga ccggagacga gcgccatgtc ggtgtacagg atggaaacga aagacgatgg    420840
     attagacgaa gtggaatggg tcaagattga aaccggcgga gacgaagcgc cgtgcgcgcg    420900
     tcgcggcgcc tcggtcacga tggtcggcga acacaagtgc atcgtcttcg gcggcgaaga    420960
     cgacgagcga cgatttttga acgacgcgtg gattttagac atgacttctt tcgtgtggcg    421020
     cgcggtgaag gcacccggtg ggcaccctcc agagtctcgc gcggagcaca ctgcgacgat    421080
     gtggggccaa gacacgctgc tcgtcttcgg cggtacgggc agatcgacga aatgtttttc    421140
     atcactcttt gcgctcgact tagtgcaaca caaatggata gaggtgaatc ctcgcggcgc    421200
     ggcgcgcgtc gagcctcgcg cgggtcacgc ggctgtcttg atcaaagacg gtcggttctg    421260
     ggtcctcgtc ggcggaggca acaacgagcg cgggctctca gagtgttcga ttttagattt    421320
     ggaggagatg gaatgggtcg atcggaacga tgcatttctc gcaccgccga tcgtgggaga    421380
     aggcatgacg ttgtgcgcgc tgagcacgcg cgatggtatg gaggacgccg tcgtcgcctt    421440
     tggtggatac aacggagcgt gccaaaacga gacgcaaatc ttgcgcgtgc cggaagattt    421500
     ccccgagcac gaagccctgg cgagcgatga aaatcgcgct ccaccggtga gcacgagcgt    421560
     tctgcgcgat gacaagtcga tcgaacgaga cgacgaacga gacgacgaac acgcgtcctc    421620
     cccggcgtcg gcgcttatcg atttcgctag tccggacaag ccggcggcga ccaccttcgc    421680
     tttcggcacc gacgcgagcg tgcaggcgta cagaaaagaa aacgtcgagc tccgtcgcgc    421740
     gttacatcgc atgcggaacg acgcccaaat cgtcgccgac gcacacgccg ccctccgcgt    421800
     gcgatgcgag gacctcgagc gcggcttgag cgacgagcgc cgccgcaacg aagacctcga    421860
     gcgcaaagtc gccgcgctcg cggagcaaat tcgcggcggt ttaggtgcca gcggttcatt    421920
     cttctctcct tgatttcgtt tagcgtttag tgtttagcat ttcaccgcac atgcatcgcg    421980
     tttcagccgc gcgccgcgtc tcctggcctc cctctcctcg aaagtgacgc gaagagtcgc    422040
     gcgcgccgca gtgcgcgacg cgcgcgatcg ccgcgcccga gagcgccacg aacgcgaacg    422100
     aacgcgaacg aacgcgtgat ggggcttcat ctgcgtcagc gcgcgcagga gttggcgcgc    422160
     acggtcgcga caacgcgcgg ccgtccgtcg cgcagttcgt cgcgcagaga cgcgacggag    422220
     agcgagcacg agcgcgcgaa tcgcatcgtg cgcgagcgca agctcaacta cgatcgattg    422280
     tcgttctgcg tcatggcgtg cgcgatgtgg gcgatgctgc ggttcgcgtt cggggaggtg    422340
     atggcgccga acggggcgaa cgtcgagctg agcggcggcg gcgtctgggc ggtggcgctg    422400
     atttgggcgt gcgcgcacgt cggtggggcc gcggcggtga tgtgtgggct accgtcgttg    422460
     actggaatgt tgttgtgcgg gttgctgctg agaaacgtgc cgggaggcct ggtgaacgat    422520
     ttgccagagc ggtggtcgag cgacattcgc gccgccggtt tgagcgtgat tttaatgcgg    422580
     agcgggttag agttagattt ggacgcgttt cgctcgatag gatggatggc gagtcgattg    422640
     accgtcatgc cagggctctc tgaagcgatc gcgtgcgggt tattttcgat gctgatattt    422700
     aaaatgtcgt tcccgctcgg gatgtgcttg gggttcatcc tgggcgcggt gtcgcccgcg    422760
     gtggtggtgc tcggcatgtt tgagttacaa tcgctcggtt acggcgtggc gaagggaatt    422820
     ccgtcgttag tcgtcgcggc ggcgtcgttt gatgacgtcg tagcgatcac ggggtacacg    422880
     atcttcaagt cgttcgcgct aggcagcaag ggacacatgg cgtggacgat tttgcacggt    422940
     cccgtggacg tgttggcggg tctgtgcgtc ggcacgctcg ggggggttat ttgcggtatg    423000
     acgaaaattt ggaacgagcg ttggaagaga tcgtccatgg ttatgatttt agggttgttt    423060
     acgatgttct taggtcgaca ttacgggttc aacggtggtg gcgccatgtc cgcgctcgct    423120
     ttgggcatct cggccaataa gtgttggcgc acgaacaagc cgcacccggc gctgacaaac    423180
     ggaccttccg acgatcacgc gcacggtgtg gagactgatt tggccaagtt atggcgtttc    423240
     atatttcagc ccttgctgtt cggcgtcatc ggcacggcgg tgagtttcaa agacgtcacg    423300
     ccgtcgacga ttcccaaatc catcggtctt ctcctcatcg gtatttgcat tcgtttgccc    423360
     atggcttatg tagccgtggg cggcggtgag ctatcgcgaa tcgagcgcgc gtttgtgtct    423420
     ttggcatgga tccccaaagc caccgtccaa gctgcgctgg catctgatcc gctggattac    423480
     atcatagaga agaaaaaatc cgccgagtac gtgtcgtggg gcaacgacat tctcactacg    423540
     gcggtatttt caatcatttt aaccgcgccg ctcggaatgg tcatcatcgc cacgctcggg    423600
     ccgaagtggt tacagaagga tcagaagaac gccatcgtga gcaacgtcga gcccggagac    423660
     gacattgtca aaaaagttga gctggtccga agaaactcaa ttgaaactgc ggcgcgacga    423720
     acgagcgagg aacgtcgcgg cagttccgtc gacggcggtt cgccgttcag cgaacgtgtt    423780
     gcagacttct ggcgcgatga tggcgcgtca tctcgtcgcg atcaacgcga agggagcgtg    423840
     atttcagaag ctgactcgcc aaccggactg aagggcgcgt cggcgagcga aaagctcgtc    423900
     tatcacctcg ccacccttcg cgatttcgcc acggattccg caaacctcga acctgaggac    423960
     atgaagctca tccaagacgc ttcggacgaa atcgaagcaa tcatgcgcga gcatttaccg    424020
     cgcgtgcgct cggtggacac tccgggtttg ttcttccgtc gaacgtcggc gacgtacgcc    424080
     gatttagacc ttcccgcgcc cgaggaattc atcgaagccg acgtcgaggt cacggacccg    424140
     cgcgtcaact cggacgaagc agtgtagacc atagatgtcg cgcagctttc gcggtcgacg    424200
     tcctctcgat atcgatgtaa cgaagaaacc gccccgcggc gccgcacacg tcgactctcc    424260
     gtcgcgccat gtcgcacgcc gtcgcctcga cgtcctcgcg cgcgccgcgc gcccacgcga    424320
     cgcgttgccg gcaccgtcgc acgcgcgcgc gcgtcgtcgt tcgcgcctcg gcggcgccga    424380
     gcgacgagga aacgcccgaa agcgtgctca gagtgagccg acgaacctcg ttcgaaggtc    424440
     tcaaagccgc gcgtcgcgtc gagttacagg cggcgcgcga cgccggcgac gacgagagag    424500
     cggcgaaagt ggagtgggcg ttcgatgcgc tgatcgcgca gtcaaaaacg ttcttcgaag    424560
     agcgcgtgaa gacggatgag agtccagaga gtcgattcat gttgggcaac ttttatcaaa    424620
     cgctggaaaa gtttgacgac gcggagcggg agtatcgacg cgcgctggag ctcgggacga    424680
     acgtggacgc ggcgaataat ttagcgatga tattacaggc gcgaggagag ttagatgagg    424740
     cggaagcgta ttacttaaag gcgttagagc cggatcccga ttgcgtcgac gtgctcttta    424800
     attgggcgac gttgaagctc gagtgtcgaa aagacttgaa cgccacgcgg attttgattg    424860
     aacgcatcgt tacgatacag ccagatctta agaaacatcc gctggtgaag gcgttgaggg    424920
     acgacgacga cgacgacgac gacgagccgt tcattccgcc gatttagttt cgatttgtga    424980
     atgtgaattg aaaatttcga gctgcaatag ttttgcgtct acacctcgat ctcgaacatc    425040
     tcttccggtt cttccttggc tgggggtggt gcactgcgcg taggcttaag ttttggaatg    425100
     ttcgggggca cttcccaacg aagcaaaccc caattgatgg atttgaaaaa tgggtgtgac    425160
     ttaatttctt cggcaccgcc gagcgtgccc aagcgatttg tcgtatcgtg ctgcagtaat    425220
     ttaccgacac aatctttgaa atcgtcgctc atgggaacgt catctgggaa cgtcactttc    425280
     ccatccgaga ttttgttgaa cgtctcttct cgcgtcgccg atttgaacgg tgtcgtgccg    425340
     tacgccatct cgtacatgaa aatgcccagt tcccaccagt caaccgaacc ggagtggccg    425400
     gtaccgttca aaacctctgg ggaaagatac tcttccgtgc cgacaaaaga gttcgtgaat    425460
     gtgaacggtt ccgccataag catgggattg gaaccgttct ttggcagtcg cggcggcttg    425520
     agtgacttct ttgacgacgc ttgctcgacg gctcgctcgc cggcgatcca agacgggttc    425580
     ccaggttgaa tattaatgtg cggtttgcat gtcgcgcaaa acgacaggtc gaaatcggtg    425640
     ataacgatgt gcccactacg acgtagcaaa acgttctccg gtttcaagtc tctgtacacg    425700
     aatccgagca agtgcaggta ctggagcgcc acgagtactt ccgccgcgta aaacctcgtc    425760
     gcattttcgc tcagacgcct gtctggaatc ttttgcagga agtcatatag ctcgcctcct    425820
     tcgcaatact ccatcaaaaa gtacacgtga gtcgcggttt gaaacgacgc gaacaacgtc    425880
     gccacgaatg ggtggtcgac ttcgttcaaa atcgtcgact cagtgtgcaa acggtgaagc    425940
     ttgttgcggt cgatgatttc ctgcttggtc aaaatcttca atgcgaacgt gatatcttgc    426000
     tgtttggcga gggtaaccaa gtgcacggtg cccacatcgc cttgtccaat gcgctttacc    426060
     ggcacgaagt cgtcgatcgt taaagctctg gtgccatcgt tcgtcgcctt gcgcagcgcc    426120
     tcccaatgac gacgattttc aatttgatga ggcttgggcg tgagcatttt cccgtgcatg    426180
     cgcacccacg gtggctcgaa ctctttgtct tttgccgtcg caccggcgac catactcgcc    426240
     gcgcccttcg atatggctat gttctcttca tccgtgccct tgaacgtgat ctccgcgatc    426300
     gactcgtcct cggtgctcgg atcgtgcgcg gtgatgtcca cctgtacgcc cgcaaaaaat    426360
     cgtacaattc cctggtcatc acgcacgggg gccaacgtga acatgttcca aaactgcttt    426420
     ccgctctttg tgtaattcaa taatcgcacc gtacactctt ccccgagctc gatcgcctga    426480
     cgaatcttcg ccaccgccgc tcgatccgtc ttcggccctt gcaaaaaccg acagttccgt    426540
     cccaagattt catccacaga gtatccagta aaatccatga aaccgtcgct cgcgaacacg    426600
     atcggatgat cgggcaacga cggatcggtg atgacgaacg attgctcgat gcgctcgagc    426660
     gtcgaggcca aatccaaacc cacgcgtccc ttcctcgcgc ccgcgtcgtc cacgccatcc    426720
     tcagataacc cttccgccgc tcgcaccgcg ttctccacct cgctcacgcg ccctagcgac    426780
     acggctgccg cgcgagcgtc gtagcgactc ggcactggca tcccttcctc atcgaaatcg    426840
     atccctcgct cgcccgtcgt cgcgtccttc acctccgtca cgtccacctg cacgccgatg    426900
     tacttcgcca ccgtcccatc cgccagtttc accggcgcga cgacgagata attccaaaac    426960
     ggcgtcccat ccttcttata attcaacaac cgcacgctcc atcgatcgcc ccgcttaatc    427020
     gcctctcgca gctcgcgcac gtcgttccca tccgtcgcct ctccctgcaa aaatcgacaa    427080
     ttatgcccga tcacctcgtc cgcgccgtac tgcgtcatcc gcaggaaccc atcgctcgcg    427140
     tacacgatcg gacaatcctc cctcgtcgcg tcgcacacgg tgaacgtgtg atcgaacgcc    427200
     gcgaacgccc tcgcgacctt ggcgtccagg ctcggcgcgt gcgcgccgcc ctcgatcgac    427260
     ctcgcgcgcg acatcgtcgc cgtctcctcg cgacgtctcc cgcgtcgtcc cgcgcgtcgt    427320
     cccgcgcgtc gccccgcgcg tcaccgcgtc accgcgtcac cgcgtcgcgc gtcgcgccct    427380
     caagataacg aatgccctcg ccgccgcgtc cgcgcgcgtc gacgcgcgtc gacgcgctcg    427440
     cgccgcgcgt cgcgcgtcgc gcgtcgcgac gcgcgtcgcg gttccgcgcg tccgtcgccg    427500
     cgcgtccgtc gacgggcgcg cgtcgacgcg ttctggcgcg acgggcgcgc ccaaccgtcg    427560
     tcgtcgcact cggacgcgcg cgcgacgcgc cgacgactcg acccgcgccg acgatgcgcg    427620
     cgcgctgacg actcgacccg cgcgaccgcg accgcgacga cgcgcgacga cgcgcgacgc    427680
     gcgaccgcga cgacgacgcg aatggatgcg acgacgacga cgacgcgaat ggacgcgttc    427740
     gccgcggcgc tgggcgcgct cgacgccgtc agggcgggat acgcgacggg cgcgcgtccg    427800
     cgatgcctca ccgcgatcgt ggacgcgtac gacgacgtgg cggtggaggg ggcgatgcgg    427860
     acgctgagcg gacgagacga cgcggcggcg gtggcggcgc tggcgagacg acgcgcgagg    427920
     tgcgacgagg gcgcggcgaa cgcgagggcg agcgatcggg acgatggaga cgatgggaaa    427980
     gacgcgaaag acgctggatt cgcgccgacg ctggatgtgg ggcgacaggg cgtggatgag    428040
     gaaagcgggt ggggcgcgat gcaccacgcg gcgcattacg gcgcgttggc gtgctgtcaa    428100
     acgctgtcaa agacgtgtcg aaacgcggat tgggagcgac cgcgcgatcg acgaggacgg    428160
     ggggcgatag atttgatcag tgaaaagttg acgagggatc gggcgaggaa acgcgcgatc    428220
     gggggtgggg gagacgaagc ggcgcgaacg acgtttgtgc gttcgtttgg aagcggggcg    428280
     aattattgct tggggaccgg gagcacggag accgagcgca agcccgcgcg cgtggagggg    428340
     gcgctgatga aggcgaacgt gtcgcgggtg agcacgtcca agtttcacgc gctcgccgtg    428400
     gatgagagcg ggagcgtgta cgcgtggggg tgcgctcgag acggagtttt gggattcgga    428460
     cgcgaacgcg gagacgaggc ggtggtattt ccgacgctcg tgcgtagctt tggatgcgac    428520
     gtgcgcgtcg tgcgcgtttc cgcgggtctc gcgcacagcg cggtgacgac ggatgcgttc    428580
     gagacgttta cgtggggaaa cggagcgctc gggcgattgg gatactccgt cgccgtcgac    428640
     gattcggcgt ccgacgacga acgcgaacgc gagcggaggt gcacacaatt cacgccgcgt    428700
     aaggtgccga acatggctgg cgcgcgcgcc gtcgacgtgt cgtgcggcga caccttcacg    428760
     gctgtgctcg acgccgacgg cgcggtgtgg acgatgggtt cgaacgctcg aggggcgctg    428820
     ggatactacc tcggcggcgg cggcgactcg cgagacgggc cgcactcgag cgtcgccaag    428880
     caggtggaat atttaaaaca ccgtgacgtc gtcgtgaccg gtgtgtcgag cgcaaaacaa    428940
     cacgtcgtcg cgtgctcgtc cgccggcgac gtgtactcgt ggggcaacgg atccgtctct    429000
     gttcgtcgag ttgtcatccc gaaagcgtca gccgacggca cgcgatggca cgagctcgat    429060
     caaaagatta tcaaggtttc tgcgggtgcc gcgcaaagcg cggcgctcac cgccgacggt    429120
     tgggtgtacg tctgggacag cgcgtctgaa cgcgtcgaag cgcggttgct cgctgacggc    429180
     gacggaccgg gtggacgcgc cgtcgacgtg tcgtgcggag cgacgtcttc cgccatcgtc    429240
     accgacactg gtgatgtgta cacgtgggag tcgactgagc tcgaagtcgt cgacacggcg    429300
     tcgaagaacg tgctctcgtc ggcgtcgcca aaatctttcg cgagttccgg tgaatttgcg    429360
     gcgaagcgac gatgcggggc acttcgtcgt gtcagcggat tgaagggtgt cgcgagcgcg    429420
     tgcgtaggag acgcgcatgt gttggtgctg caagcgattt cgcgtccgca attttctctg    429480
     gggcggttgg atccgcggcg aaagaaggcg tctgtagaat ccgagctcga tcgcttgatt    429540
     cgcgacatcg gttccgtcgt cgtgtccccg cctcgacctc gcgacgaaga agacgtggaa    429600
     gaaagcgagg aagaagagga ctttgaagac gatgaaagcg agttcccgtc tttgaacgtg    429660
     ttggcgcaac acgccgtggc gaaattcatc gaaccgagaa acgtgttgaa tgttgtgcag    429720
     ctcgccgatc aaattaacgc cgtggcg