(data stored in ACNUC7421 zone)

EMBL: CP000604

ID   CP000604; SV 1; circular; genomic DNA; STD; PRO; 176473 BP.
XX
AC   CP000604;
XX
PR   Project:PRJNA18747;
XX
DT   23-MAR-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid
DE   pSN254, complete sequence.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Newport str. SL254
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
OG   Plasmid pSN254
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-176473
RX   DOI; 10.1371/journal.pone.0000309.
RX   PUBMED; 17375195.
RA   Welch T.J., Fricke W.F., McDermott P.F., White D.G., Rosso M.L.,
RA   Rasko D.A., Mammel M.K., Eppinger M., Rosovitz M.J., Wagner D.,
RA   Rahalison L., Leclerc J.E., Hinshaw J.M., Lindler L.E., Cebula T.A.,
RA   Carniel E., Ravel J.;
RT   "Multiple antimicrobial resistance in plague: an emerging public health
RT   risk";
RL   PLoS One 2:E309-E309(2007).
XX
RN   [2]
RP   1-176473
RX   DOI; 10.1128/JB.00297-11.
RX   PUBMED; 21602358.
RA   Fricke W.F., Mammel M.K., McDermott P.F., Tartera C., White D.G.,
RA   Leclerc J.E., Ravel J., Cebula T.A.;
RT   "Comparative genomics of 28 Salmonella enterica isolates: evidence for
RT   CRISPR-mediated adaptive sublineage evolution";
RL   J. Bacteriol. 193(14):3556-3568(2011).
XX
RN   [3]
RP   1-176473
RA   McDermott P.F., White D.G., Fricke W.F., Mammel M.K., LeClerc J.E.,
RA   Rasko D.A., Rosovitz M., Cebula T.A., Ravel J.;
RT   ;
RL   Submitted (21-FEB-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; 69c60fcc2d817aa94a6f88ec84df804c.
DR   BioSample; SAMN02604062.
DR   EnsemblGenomes-Gn; EBG00001031094.
DR   EnsemblGenomes-Tr; EBT00001633153.
DR   EuropePMC; PMC1819562; 17375195.
DR   EuropePMC; PMC2565877; 18663029.
DR   EuropePMC; PMC2566207; 18708504.
DR   EuropePMC; PMC2573139; 18663027.
DR   EuropePMC; PMC2612187; 18955524.
DR   EuropePMC; PMC2650518; 19064894.
DR   EuropePMC; PMC2681507; 19273688.
DR   EuropePMC; PMC2687259; 19307357.
DR   EuropePMC; PMC2737857; 19596889.
DR   EuropePMC; PMC2812134; 19995930.
DR   EuropePMC; PMC2902851; 18375380.
DR   EuropePMC; PMC3133335; 21602358.
DR   EuropePMC; PMC3187115; 21841024.
DR   EuropePMC; PMC3220660; 21942987.
DR   EuropePMC; PMC3346627; 22330911.
DR   EuropePMC; PMC3519518; 23251446.
DR   EuropePMC; PMC3535917; 23070174.
DR   EuropePMC; PMC3915882; 24567731.
DR   EuropePMC; PMC4026752; 24860553.
DR   EuropePMC; PMC4036041; 22446310.
DR   EuropePMC; PMC4516299; 25138971.
DR   EuropePMC; PMC5545573; 28824587.
DR   RFAM; RF01068; mini-ykkC.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..176473
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Newport str. SL254"
FT                   /plasmid="pSN254"
FT                   /sub_species="enterica"
FT                   /strain="SL254"
FT                   /mol_type="genomic DNA"
FT                   /serovar="Newport"
FT                   /db_xref="taxon:423368"
FT   gene            323..862
FT                   /locus_tag="SNSL254_pSN254_0001"
FT   CDS_pept        323..862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0001"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACR0"
FT                   /protein_id="ABO41078.1"
FT                   /translation="MSLPTERWLDLLDPKLEEERSEITEDLLEAEGREFVAEVRSKLDH
FT                   ALAVLAVEAQQEADMYWNAHKSAREEASEDEQGRVGTRVRILGVSLVAEWYRNRFVEQV
FT                   PGQKKRVLSTHIKKGRGHAYSMSHFKKEPVWAQELIQQVETRYAVLRQRATALAKIRRA
FT                   LNEYERQLNKTHSDEV"
FT   gene            867..1154
FT                   /locus_tag="SNSL254_pSN254_0002"
FT   CDS_pept        867..1154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0002"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41068"
FT                   /db_xref="GOA:A0A0H3ACP6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACP6"
FT                   /protein_id="ABO41068.1"
FT                   /translation="MTASVAATELAKLGKCEAMIKKVASHPRPALSKRPQSPQGTDSTL
FT                   RGEFAHFRYEAAALRFMSGTAGAKRRIYQLVFSATVAAGALTMLAAWTTS"
FT   gene            1175..2239
FT                   /gene="repA"
FT                   /locus_tag="SNSL254_pSN254_0003"
FT   CDS_pept        1175..2239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="SNSL254_pSN254_0003"
FT                   /product="plasmid replication protein RepA"
FT                   /note="identified by similarity to GB:CAA52023.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD46"
FT                   /protein_id="ABO41149.1"
FT                   /translation="MSKRTKDKDLEKLDVIKDSPQMSLFEIIESPAKKDDYSNTIEIYD
FT                   ALPKYIWDQKREHEDLSNAVVTRQCTIRGQHFTVKVKPAIIEKDDGRTVLIYAGQREEI
FT                   LEDALRKLAVNGKGHIIEGKAGVMFTLYELQKELSKMGHGYNLNEIKEAIQVCRGATLE
FT                   CISDDGEAFISSSFFPMVGLTTRGEFRKKGGNARCYVQFNPLVNESIMNLSFRQYNYKI
FT                   GMQIRSPLARYIYKRMSHYWTQASPDSPYTPSLISFLTQSPRELSPRMPENVRAMKLAL
FT                   EALIKQEVISDYDANQIKDGRRVIDVRYVIRPHENFVKQVMASNKRKQQTELRAIKHGM
FT                   IDHDIIDEPQRKGR"
FT   gene            2585..2866
FT                   /locus_tag="SNSL254_pSN254_0004"
FT   CDS_pept        2585..2866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0004"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACB4"
FT                   /protein_id="ABO41152.1"
FT                   /translation="MRFDMWVRCTKAGPEPLDIWELCTIDEAEQRLTDQDKPKKAVKMT
FT                   LIVHKVITRTQKEAKSYPHFLCINGVLVYGNAARSYVGTLHGAKNDQN"
FT   gene            complement(3276..3710)
FT                   /locus_tag="SNSL254_pSN254_0005"
FT   CDS_pept        complement(3276..3710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0005"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41066"
FT                   /db_xref="GOA:A0A0H3AD01"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD01"
FT                   /protein_id="ABO41066.1"
FT                   /translation="MLDFVFLVFLGLGISTVLVRRSSRKGMDLELTWLQSLKVVLVRGA
FT                   VALGLGFGIGRLVLMGMQYGFLSESVLREHALVSVAVVLICGLGSFVAFQWIIGRISGR
FT                   SISVVSVIKAVMYESGYFVLSMLILLVILVLFGLAYETFF"
FT   gene            complement(3728..4711)
FT                   /locus_tag="SNSL254_pSN254_0006"
FT   CDS_pept        complement(3728..4711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0006"
FT                   /product="phosphoadenosine phosphosulfate reductase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01507"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41087"
FT                   /db_xref="GOA:A0A0H3AC44"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC44"
FT                   /protein_id="ABO41087.1"
FT                   /translation="MDLSLYDHIIVCLSGGKDSIAAYLRLVDMGVDKSKVEFWHHDVDG
FT                   QEGSSLMDWAFMRDYCRQLGEELGIPMYFSWLEGGFEGEMLKDNAYSHPHRVETPEGLL
FT                   VLPRDHKRSKPGTRLRFPQQSPSLQTRWCSSALKIDVGRRALNNQERFKGKKILFITGE
FT                   RREESANRSKYNQLEAHACDRRYGKTARLVDAWRPVLHWTEEEVWEVIERHRILAPVPY
FT                   RLGWSRSSCMTCIYNSQRIWSTIRHYWPERAGKIAQYEQTFGVTVSRKKIDVIDLGSAV
FT                   APIQISDVEALEQVSREDYTLPIFVPEGQKWVLPGGAFGREACGSD"
FT   gene            5307..5720
FT                   /locus_tag="SNSL254_pSN254_0007"
FT   CDS_pept        5307..5720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB77476.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACY0"
FT                   /protein_id="ABO41089.1"
FT                   /translation="MTEWHRELEAVLMTLDDCQMECDGMTWAVSHLLNEAGVPHDCMYG
FT                   FVRNEQTKDIVTPHFWVVLDDGWLVDLRLRMWLGDHDNIPHGVFHPDNEPGLFYKGDPV
FT                   QNHKGMRLGKAVLDIMTDGKLSHVKVPERQDGE"
FT   gene            5725..6246
FT                   /locus_tag="SNSL254_pSN254_0008"
FT   CDS_pept        5725..6246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE51711.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41134"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD30"
FT                   /protein_id="ABO41134.1"
FT                   /translation="MEFDYDKSVSNAHLEAAGWGMDAFNHSNPFESHVIYVRDYRNDHI
FT                   RLFTIKQADFDTIKLPLHLTSDMLASVIAEFVSKAAKGKLNTKESDTLAPALVGYAKST
FT                   ETYRSWRRVSGATERLHMVINIYAGSELLRPFIARAPETVLTTQELLVFSSQVKSMDVS
FT                   NHPEWFRGRR"
FT   gene            6249..6770
FT                   /locus_tag="SNSL254_pSN254_0009"
FT   CDS_pept        6249..6770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0009"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEF8"
FT                   /protein_id="ABO41150.1"
FT                   /translation="MKPVLWIFVLIIAPFVIAKVDQWRKRGIGDTWAWWKSENMPYELR
FT                   SATLFLSEQDISTTQPVPMHGRVDQVYQTKNGVLIPLDTKLRQVNHIYESDIIQLSVYR
FT                   VILSHKYKAPVAKYGYVRTVVETADGDRVRYIKTNLLSEKEVVKLWHRYQSIRSGQVKT
FT                   SCSCGGKFHM"
FT   gene            6867..7340
FT                   /locus_tag="SNSL254_pSN254_0010"
FT   CDS_pept        6867..7340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0010"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41020"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE02"
FT                   /protein_id="ABO41020.1"
FT                   /translation="MAQLKHNRFVMLGSLVATVVAAANGLSFLTLMAGGMTLLQFMAWK
FT                   QQDAVRSRFKAAKDAFEALNVIAFDKHWVGSTATVAKVSNMITPPERLDKPWAVQVLAV
FT                   TKGGTWFAVDLQVTGTDKVQMLSLHQLSEKAAKTMLAFDLEVYEKFFGKPDVA"
FT   gene            7351..7644
FT                   /locus_tag="SNSL254_pSN254_0011"
FT   CDS_pept        7351..7644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0011"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41157"
FT                   /db_xref="GOA:A0A0H3ACB8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACB8"
FT                   /protein_id="ABO41157.1"
FT                   /translation="MEKVKSVDAVEFTAADKKAMTHAAYAQCFFILAQVMAFPSLGVAG
FT                   AMVAALCGMMPWLTKFAKEAPSKAFGMVMASLCLAPVYGKLCELVVHAIQGA"
FT   gene            7649..8503
FT                   /locus_tag="SNSL254_pSN254_0012"
FT   CDS_pept        7649..8503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0012"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACF2"
FT                   /protein_id="ABO41202.1"
FT                   /translation="MGVVRVPYLLAELKERGCADESALAQVMQPGCRIGEEDLRKLAAN
FT                   LGLEVSELAPAPENAANTRFKAKLRGGLASFLFEYDGCFRHAEGSSHAEMLGIEQEDDI
FT                   GLPSRAADAMLLEKTLYQVIARAKYMLGKIDSKFVRSEQAIEFREQLAPGIFKPGYRGF
FT                   RFKEAAAGDLPTVMIDGRKFNCVASIARAHGLDPVTVRRRIADTGKAADKLSNDEWKLI
FT                   LAKKKGKGKPFTYLDRTYSNIAQFCREHQLNTNLVYQKVKDRADSADEEFWGLIIETCK
FT                   RKN"
FT   gene            8485..9462
FT                   /locus_tag="SNSL254_pSN254_0013"
FT   CDS_pept        8485..9462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0013"
FT                   /product="signal peptide peptidase SppA domain protein"
FT                   /note="identified by match to protein family HMM PF01343"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41101"
FT                   /db_xref="GOA:A0A0H3AD47"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD47"
FT                   /protein_id="ABO41101.1"
FT                   /translation="MQKEKLMAENKEIPWEKELIEKYMFTLHKEQVKDRRWRTMLRVLR
FT                   ASGFVLLMIGFIILASNPGGMPWQSAKAGAPHTAYINIRGEIAAGTLADADHLIPSIQA
FT                   AFDNPNSQAIVLRINSPGGSPVQAGRIYDEVKAQRALHPEKKVYAIIDDIGASGGYYIA
FT                   SAADEIYADRASLVGSIGVISSGFGFTGLMDKLGIERRAITSGEHKALLDPFSPLTSDM
FT                   KKFWEGVLSKTHQQFIERVKAGRGDRLKDDPEVFSGLLWNGEQAKDIGLIDGLGSLNSV
FT                   ARDVIHQSNLVDYTPTEDIIRRLTQRAKLEASSFVQELSAVKVY"
FT   gene            9478..10338
FT                   /locus_tag="SNSL254_pSN254_0014"
FT   CDS_pept        9478..10338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0014"
FT                   /product="DSBA-like thioredoxin domain protein"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41196"
FT                   /db_xref="GOA:A0A0H3ADH3"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADH3"
FT                   /protein_id="ABO41196.1"
FT                   /translation="MTEQSTKSLRLGVVAAILLGLVGTGFGIYQFVKEKDLAQEIANVK
FT                   STVNQVKDAEGVTFKSKAEFEAAVAESINKFVAQKQQADIDQKYAQFEAAPEKVEEGKH
FT                   IYGDLGARFTLVEFSDMECPFCKRFHDTPKQIVDASKGNVNWQWKHMPLDFHNPAAHKE
FT                   ALAAECIAEQKGNRGFWVFVNDIFHHTQGNGGGVADLASVVTGVGADLDAFRECLGSGK
FT                   YEDKVEADIQKAKSYGVNGTPATFVVDNHTGKSQLLGGAQPAQAIMAVMRKMMIESQQD
FT                   DSANQ"
FT   gene            10372..10800
FT                   /locus_tag="SNSL254_pSN254_0015"
FT   CDS_pept        10372..10800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0015"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41197"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACE7"
FT                   /protein_id="ABO41197.1"
FT                   /translation="MIKITTKLGCLLAGLLVLSACSSVPQPNNEYAKALDDTKQVCAAC
FT                   ALVGNDLLVALNKSCDTPMTPETLTSVMNSNPMFAAMMAINSIGGTDFYQVYRDAAIDT
FT                   LRCNEMDSWPDRTKVRFQQPDMQKALALRVSARQQKAN"
FT   gene            10857..11216
FT                   /locus_tag="SNSL254_pSN254_0016"
FT   CDS_pept        10857..11216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0016"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACS2"
FT                   /protein_id="ABO41024.1"
FT                   /translation="MELQEAKEALDSLHPHKASAPLRLVIHQPGGIGGTPTVGVKAIHA
FT                   GFDWDSNTILIYPEEQLTRLTPDEVAAITKSVSKGQSWHSYQQFKKYREQLAEATEEIN
FT                   RLRAELGRYQNNGRG"
FT   gene            11216..11662
FT                   /locus_tag="SNSL254_pSN254_0017"
FT   CDS_pept        11216..11662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0017"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41146"
FT                   /db_xref="GOA:A0A0H3ADA7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADA7"
FT                   /protein_id="ABO41146.1"
FT                   /translation="MLKRGIINLAASYIIVDALLRNAAIWIFGLSFSVGGTYVTGEAST
FT                   WVVYLATSGAMTLCSVVTAYLLVTYHRWGLMTARVWLLLSACLNGYAVYLSSHNIQLVV
FT                   ALLSSLFIALWMLKTLEQPAVKGTYKVIADLHRQLWGMLKGQTQ"
FT   gene            11659..12177
FT                   /locus_tag="SNSL254_pSN254_0018"
FT   CDS_pept        11659..12177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0018"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41088"
FT                   /db_xref="GOA:A0A0H3ACS3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACS3"
FT                   /protein_id="ABO41088.1"
FT                   /translation="MTTNTQNANANQVRSLRDMLVPALLFYVVMTAMFVGLDAFMDKPT
FT                   SMNLPFMPFLVSMVSFTSDARRAWDWRNGTKVVAVLTAVAMLLAFIYQLAVGEMNLLGV
FT                   GIYPATAILLLAISWVIRAIGKTAPFQFLGRHLARFGASKWVQRTAAVIVLAGGLAITI
FT                   YAYWLNHGS"
FT   gene            12177..12407
FT                   /locus_tag="SNSL254_pSN254_0019"
FT   CDS_pept        12177..12407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0019"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41169"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD70"
FT                   /protein_id="ABO41169.1"
FT                   /translation="MMIIATKNGFLVAAELIREEAGYWLLQPRDQKTPVRVNKQDNNKR
FT                   AFTHMGDALRWAGDPELAKQFDAEGEEHANS"
FT   gene            12394..13251
FT                   /locus_tag="SNSL254_pSN254_0020"
FT   CDS_pept        12394..13251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC41575.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41178"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD49"
FT                   /protein_id="ABO41178.1"
FT                   /translation="MQIRDYMTKLFDAFGDVEEVTREMLLEQAELIHTISDKCQSTGLF
FT                   LDSQVRFNQFVQEIEADDKVEDRLLHAWCWVMDRIVKAPTSFHMDGAVILTMPLVARYL
FT                   PPVEQEPETIVVNLDEDYKAPVGNQTLCELVMERRHWPQGATCATQEADGGVLYWDAPV
FT                   DVVEEGRKVAGKHGMMAEIGLKHQVDAWYADMDETRLATDWNTAVITPHCLLLSYLDVL
FT                   QKNKVPFDEGVQLAAEWVKQLGGEFREDTEEAPEAEASVLSLGRATAHCFKPYPDTKNF
FT                   YYEA"
FT   gene            13482..14009
FT                   /locus_tag="SNSL254_pSN254_0021"
FT   CDS_pept        13482..14009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0021"
FT                   /product="staphylococcal nuclease domain protein"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41079"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACX5"
FT                   /protein_id="ABO41079.1"
FT                   /translation="MRLGFVKNTGVSAFLVAMLVVAPQVWAETFTAKVVGVSDGDTVKV
FT                   LTEQSCDSGKDCRSGKIQYRVRLAEIDTPEKKQPYGSKAKQALSDLVFGRMIKVEQIDK
FT                   DRYGRLVANLYVDGKWVNAEMVRSGSAWVYRQYAKTPELFKLEAEAKADKRGLWALPES
FT                   ERTPPWEWRRKH"
FT   gene            14067..14339
FT                   /gene="hup"
FT                   /locus_tag="SNSL254_pSN254_0022"
FT   CDS_pept        14067..14339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="SNSL254_pSN254_0022"
FT                   /product="DNA-binding protein HU"
FT                   /note="identified by match to protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41166"
FT                   /db_xref="GOA:A0A0H3ADD3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADD3"
FT                   /protein_id="ABO41166.1"
FT                   /translation="MNKSELIMKVAEDADISKAKAEAAVNALINSVTEELKAGGTVALT
FT                   GFGTFHVKERAARTGRNPQTGENIQIAAANIPGFKAGKGLKDSVN"
FT   gene            14427..14720
FT                   /locus_tag="SNSL254_pSN254_0023"
FT   CDS_pept        14427..14720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN87633.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41140"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEE4"
FT                   /protein_id="ABO41140.1"
FT                   /translation="MRLSSTQKDVLFILYAIEAGGKAEPVPGVKILEMINSARQSGIHG
FT                   TNFRTSCHTLVENGLLNKYRNASLKLAFRLTDDGRERAGEIYRKRLEEEQEK"
FT   gene            complement(14747..15049)
FT                   /locus_tag="SNSL254_pSN254_0024"
FT   CDS_pept        complement(14747..15049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAT09653.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41147"
FT                   /db_xref="GOA:A0A0H3ACB0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACB0"
FT                   /protein_id="ABO41147.1"
FT                   /translation="MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQG
FT                   EIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEASGGKLRLDVELPDGTHYGFAV"
FT   gene            complement(15054..15404)
FT                   /locus_tag="SNSL254_pSN254_0025"
FT   CDS_pept        complement(15054..15404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE12736.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41043"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACL5"
FT                   /protein_id="ABO41043.1"
FT                   /translation="MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYAD
FT                   TVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGILLCAGNKTGDEKRFYEVMIPIADR
FT                   EFAAHLDKLKKE"
FT   gene            15567..16115
FT                   /locus_tag="SNSL254_pSN254_0026"
FT   CDS_pept        15567..16115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0026"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE35"
FT                   /protein_id="ABO41055.1"
FT                   /translation="MNNLPLLLDAREAIDYYHQHPGMTDAEKAYVVAFLSGEGRSNSQI
FT                   REDLGIEKVYTVTHLKRAGTLSEEELTLWLRNPRKITLGHVRAVAKLPFSKREKLLRDL
FT                   LHTRTPVHKFEAIAKGKEVDRDADIKRLETLMSDATGRPIKVRYNPAKRSGELTLGFFT
FT                   LDDLDDVCKALGFDPSEQM"
FT   gene            16456..16650
FT                   /locus_tag="SNSL254_pSN254_0027"
FT   CDS_pept        16456..16650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0027"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE07"
FT                   /protein_id="ABO41025.1"
FT                   /translation="MDEKITYEEMLEQLDQKGIRVTNGARRLYVALNNGVKAEVLGNCG
FT                   PATISLVDGMIVVEEQTLH"
FT   gene            16661..17032
FT                   /locus_tag="SNSL254_pSN254_0028"
FT   CDS_pept        16661..17032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0028"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC61"
FT                   /protein_id="ABO41102.1"
FT                   /translation="MGKKVHIICGKCGSDEMNFVINEHCPDDPQNVASMSCSNCCELTG
FT                   IAEWSEFNGRELKGEAVALSTPANVNALLGLLRQAMDSVEYRLYGGDMSLSGNDAAELI
FT                   DLQERAEKVLSVLRSDQHE"
FT   gene            17025..17495
FT                   /locus_tag="SNSL254_pSN254_0029"
FT   CDS_pept        17025..17495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0029"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEM2"
FT                   /protein_id="ABO41195.1"
FT                   /translation="MSDLYEPLEFVFCGFRKGDAGLFISVATLRDGVLGREMYFSKGKS
FT                   KRRWVVGGIYSGASFSDNGAKGLDDAHYVKAWEVQGDKIEWQAKSEQAEALARSEKLEA
FT                   DDRKRNELEELMLPIRKQYGALTKRRDRAGAAALEEAVLRALRAPIRKAEEK"
FT   gene            complement(17510..17845)
FT                   /locus_tag="SNSL254_pSN254_0030"
FT   CDS_pept        complement(17510..17845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0030"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41162"
FT                   /db_xref="GOA:A0A0H3ACC2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACC2"
FT                   /protein_id="ABO41162.1"
FT                   /translation="MKHVLNIALMAVVILGLAMLEATNWGYAVLAIPAVIWAKSVLNLL
FT                   HKLPVLAAAFWILVAVFAWQAALVGILFYGVLATPKAPANTNGKKSRKANLMGTYSYDF
FT                   KTGECFS"
FT   gene            17942..18430
FT                   /locus_tag="SNSL254_pSN254_0031"
FT   CDS_pept        17942..18430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAV97052.1|; match to
FT                   protein family HMM PF07799"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41164"
FT                   /db_xref="InterPro:IPR012441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD64"
FT                   /protein_id="ABO41164.1"
FT                   /translation="MSAIISKCGMYRYRLERDVQPEGLVFGYFGVNGSTATATEDDHTV
FT                   RKWIGFTKVNGGRRFIVGNAFAFRATDVRELATAVDPVGPENEIHLERIIRDADVLVPC
FT                   WGSRTKLPKSLHVHLDRLLEQLVASGKPVLAFGVTGSGDPKHPLMLGYSTKLVPWGGK"
FT   gene            18433..18930
FT                   /locus_tag="SNSL254_pSN254_0032"
FT   CDS_pept        18433..18930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC94"
FT                   /protein_id="ABO41132.1"
FT                   /translation="MSMLEARYFVAKISDAQAVLCDEELATLERLIRKVDDGRRANGKS
FT                   SLTCVVVEEDWPNWQQTVDSVLSLADGKDNDWTNATPEQIKAFWVDDSVWKTLDGRDKW
FT                   IEDLDLLVDGSPVASEWEPFGLESGQSVVIRGGWIEGNALSDDGVPLVQAFVAWKQGQD
FT                   NH"
FT   mobile_element  19093..19912
FT                   /mobile_element_type="insertion sequence:IS26"
FT   repeat_region   19093..19106
FT                   /rpt_type=INVERTED
FT   gene            complement(19145..19867)
FT                   /gene="insB1"
FT                   /locus_tag="SNSL254_pSN254_0033"
FT   CDS_pept        complement(19145..19867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB1"
FT                   /locus_tag="SNSL254_pSN254_0033"
FT                   /product="transposase InsB1 for insertion sequence IS26"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41021"
FT                   /db_xref="GOA:A0A0H3ACU1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACU1"
FT                   /protein_id="ABO41021.1"
FT                   /translation="MLMELHMNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERG
FT                   VNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSR
FT                   GRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCP
FT                   SDVEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAF
FT                   YYGDPLGEMRLVSRVFEM"
FT   gene            complement(19896..20093)
FT                   /locus_tag="SNSL254_pSN254_0034"
FT   CDS_pept        complement(19896..20093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41107"
FT                   /db_xref="GOA:A0A0H3AC67"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC67"
FT                   /protein_id="ABO41107.1"
FT                   /translation="MDLNTAANALRELGHPTRLSIYRELVRAGHEGLPVGELQKHLEIP
FT                   ASTLSHHLSALISAGRHCCK"
FT   repeat_region   19899..19912
FT                   /rpt_type=INVERTED
FT   mobile_element  20337..21156
FT                   /mobile_element_type="insertion sequence:IS26"
FT   repeat_region   20337..20350
FT                   /rpt_type=INVERTED
FT   gene            20382..21104
FT                   /gene="insB2"
FT                   /locus_tag="SNSL254_pSN254_0035"
FT   CDS_pept        20382..21104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB2"
FT                   /locus_tag="SNSL254_pSN254_0035"
FT                   /product="transposase InsB2 for insertion sequence IS26"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41026"
FT                   /db_xref="GOA:A0A0H3ACU1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACU1"
FT                   /protein_id="ABO41026.1"
FT                   /translation="MLMELHMNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERG
FT                   VNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSR
FT                   GRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCP
FT                   SDVEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAF
FT                   YYGDPLGEMRLVSRVFEM"
FT   gene            complement(21138..21629)
FT                   /locus_tag="SNSL254_pSN254_0036"
FT   CDS_pept        complement(21138..21629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAZ65818.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41073"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACQ3"
FT                   /protein_id="ABO41073.1"
FT                   /translation="MAAPWISSPEMAMRDPGQGGRHRQTWRWSTPARIVGCGDASSRSV
FT                   ATAGDLVPSSAMAMLQLDVRGLVVSASSDAAMLERGEKKPPRGVRGGKSACGSGRKKPR
FT                   RRSGRKTARPDVQLGHFSRIFRLIRCERPAVGAARSAVAFSRRASAPGAAARRAALLQS
FT                   "
FT   repeat_region   21143..21156
FT                   /rpt_type=INVERTED
FT   gene            21736..22473
FT                   /locus_tag="SNSL254_pSN254_0037"
FT   CDS_pept        21736..22473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0037"
FT                   /product="resolvase"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41127"
FT                   /db_xref="GOA:A0A0H3AC89"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC89"
FT                   /protein_id="ABO41127.1"
FT                   /translation="MRRTKPVAAPMVARVYLRVSTDAQDLERQEAITTAAKAAGYYVAG
FT                   IYREKASGARADRPELLRMIGDLQPGEVVIAEKIDRISRLPLPEAERLVASIQAKGARL
FT                   AVPGVVDLSDLAAEAQGVAKIVLEAVQIMLFRLALQMARDDYEDRRERQRQGIELARQA
FT                   GRYKGRRADPKRRAQVVALRKSGYSINKTAELAGYSAAQVKRIWAEVSQAEAKQHGAFV
FT                   EDALTEADALAAVGQDERQEERA"
FT   gene            22905..24398
FT                   /gene="insA"
FT                   /locus_tag="SNSL254_pSN254_0038"
FT   CDS_pept        22905..24398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insA"
FT                   /locus_tag="SNSL254_pSN254_0038"
FT                   /product="transposase InsA"
FT                   /note="identified by match to protein family HMM PF04986"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41125"
FT                   /db_xref="GOA:A0A0H3AEC5"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEC5"
FT                   /protein_id="ABO41125.1"
FT                   /translation="MPHVAARTASRDRDTGRYQSHRPEQTLLYQIVDEYYPAFAALMAE
FT                   QGKELPGYVQREFEEFLQCGRLEHGFLRVRCESCHAEHLVAFSCKRRGFCPSCGARRMA
FT                   ESAALLVDEVLPEQPMRQWVLSFPFQLRFLFASRPEIMGWVLGIVYRVIATHLVKKAGH
FT                   THQVAKTGAVTLIQRFGSALNLNVHFHMLFLDGVYVEQSHGSARFRWVKAPTSPELTQL
FT                   THTIAHRVGRYLERQGLLERDVENSYLASDAVDDDPMTPLLGHSITYRIAVGSQAGRKV
FT                   FTLQTLPTSGDPFGDGIGKVAGSSLHAGVAARADERKKLERLCRYISRPAVSEKRLSLT
FT                   RGGNVRYQLKTPYRDGTTHVIFEPLDFIARLAALVPKPRVNLTRFHGVFAPNSRHRALV
FT                   TPAKRGRGNKVRVADEPATPAQRRASMTWAQRLKRVFNIDIETCSGCGGAMKVIACIED
FT                   PIVIKQILDHLKHKAETSGTRALPESRAPPAELLLGLFD"
FT   gene            24429..25313
FT                   /locus_tag="SNSL254_pSN254_0039"
FT   CDS_pept        24429..25313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK64586.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41058"
FT                   /db_xref="InterPro:IPR021795"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACN4"
FT                   /protein_id="ABO41058.1"
FT                   /translation="MLRSQRRGRDPPCWLSEKEPLVGKRRVNFQRCWLPVSRIGLHRRG
FT                   VERVNCGPKLLDLGEKGVYSSYTCRVPGGDYEGYVDAHVRRLEALRRAGIVERIDADQW
FT                   RIPDDLVSRAAAHDAGRDSQASVRVLSPVDLNKQIGSDGATWLDRRLIHGETADLAPTG
FT                   FGQQVREAMDQRREHHIEQGDATRSRDSRVFYRRNLLAILREREVAGVGSDMALSKGLP
FT                   FRAATDGESVSGKFTGTVHLSSGKFAVVEKSHEFTLVPWRPIIDRQLGREVMGIVQGGS
FT                   VSWQLGRQRGLER"
FT   gene            25530..26744
FT                   /gene="floR"
FT                   /locus_tag="SNSL254_pSN254_0040"
FT   CDS_pept        25530..26744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="floR"
FT                   /locus_tag="SNSL254_pSN254_0040"
FT                   /product="florfenicol/chloramphenicol resistance protein
FT                   FloR"
FT                   /note="identified by similarity to GB:CAD57670.1; match to
FT                   protein family HMM PF07690; match to protein family HMM
FT                   TIGR00710"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41097"
FT                   /db_xref="GOA:A0A0H3AC56"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC56"
FT                   /protein_id="ABO41097.1"
FT                   /translation="MTTTRPAWAYTLPAALLLMAPFDILASLAMDIYLPVVPAMPGILN
FT                   TTPAMIQLTLSLYMVMLGVGQVIFGPLSDRIGRRPILLAGATAFVIASLGAAWSSTAPA
FT                   FVAFRLLQAVGASAMLVATFATVRDVYANRPEGVVIYGLFSSVLAFVPALGPIAGALIG
FT                   EFLGWQAIFITLAILAMLALLNAGFRWHETRPLDQVKTRRSVLPIFASPAFWVYTVGFS
FT                   AGMGTFFVFFSTAPRVLIGQAEYSEIGFSFAFATVALVMIVTTRFAKSFVARWGIAGCV
FT                   ARGMALLVCGAVLLGIGELYGSPSFLTFILPMWVVAVGIVFTVSVTANGALAEFDDIAG
FT                   SAVAFYFCVQSLIVSIVGTLAVALLNGDTAWPVICYATAMAVLVSLGLVLLRLRGAATE
FT                   KSPVV"
FT   gene            26772..27077
FT                   /locus_tag="SNSL254_pSN254_0041"
FT   CDS_pept        26772..27077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0041"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41065"
FT                   /db_xref="GOA:A0A0H3AE43"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE43"
FT                   /protein_id="ABO41065.1"
FT                   /translation="MRRTNHRNLVNVGILSGRIPLISLVQFIAVAEHLNFRHAAKALGI
FT                   SQSSVSARVKALEDNLGVLLFERHARGVRLTDAGRHFMERVTAGVDQLDHAVKTAE"
FT   gene            complement(27344..28618)
FT                   /gene="tetA"
FT                   /locus_tag="SNSL254_pSN254_0042"
FT   CDS_pept        complement(27344..28618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetA"
FT                   /locus_tag="SNSL254_pSN254_0042"
FT                   /product="tetracycline repressor protein TetA, class A"
FT                   /note="identified by similarity to SP:P02982; match to
FT                   protein family HMM PF07690; match to protein family HMM
FT                   TIGR00880"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41046"
FT                   /db_xref="GOA:A0A0H3ACW6"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACW6"
FT                   /protein_id="ABO41046.1"
FT                   /translation="MSTNLSVIKNPRVQSDQRRLVRRPDVKPNRPLIVILSTVALDAVG
FT                   IGLIMPVLPGLLRDLVHSNDVTAHYGILLALYALMQFACAPVLGALSDRFGRRPVLLVS
FT                   LAGAAVDYAIMATAPFLWVLYIGRIVAGITGATGAVAGAYIADITDGDERARHFGFMSA
FT                   CFGFGMVAGPVLGGLMGGFSPHAPFFAAAALNGLNFLTGCFLLPESHKGERRPLRREAL
FT                   NPLASFRWARGMTVVAALMAVFFIMQLVGQVPAALWVIFGEDRFHWDATTIGISLAAFG
FT                   ILHSLAQAMITGPVAARLGERRALMLGMIADGTGYILLAFATRGWMAFPIMVLLASGGI
FT                   GMPALQAMLSRQVDEERQGQLQGSLAALTSLTSIVGPLLFTAIYAASITTWNGWAWIAG
FT                   AALYLLCLPALRRGLWRNSSNSRCT"
FT   gene            28622..29299
FT                   /gene="tetR"
FT                   /locus_tag="SNSL254_pSN254_0043"
FT   CDS_pept        28622..29299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetR"
FT                   /locus_tag="SNSL254_pSN254_0043"
FT                   /product="tetracycline repressor protein R, class A"
FT                   /note="identified by similarity to SP:P03038; match to
FT                   protein family HMM PF00440; match to protein family HMM
FT                   PF02909"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41189"
FT                   /db_xref="GOA:A0A0H3AD91"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD91"
FT                   /protein_id="ABO41189.1"
FT                   /translation="MFISDKVSSMTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGV
FT                   QQPALYWHFRNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRD
FT                   GARIHAGTRPGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSD
FT                   AGERGGTVEQAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRK
FT                   GDD"
FT   gene            complement(29331..29573)
FT                   /locus_tag="SNSL254_pSN254_0044"
FT   CDS_pept        complement(29331..29573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAW58856.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACK9"
FT                   /protein_id="ABO41038.1"
FT                   /translation="MKTAALDLARERQAHEAGARTRATAHERTPQQERQKAAREAERGR
FT                   EAWTLGQGMKKPVAGCYGRLTRWKGGGDVVYMALL"
FT   gene            complement(29879..30709)
FT                   /gene="strB"
FT                   /locus_tag="SNSL254_pSN254_0045"
FT   CDS_pept        complement(29879..30709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="strB"
FT                   /locus_tag="SNSL254_pSN254_0045"
FT                   /product="streptomycin resistance protein StrB"
FT                   /note="identified by match to protein family HMM PF04655"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41155"
FT                   /db_xref="GOA:A0A0H3AEG6"
FT                   /db_xref="InterPro:IPR006748"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEG6"
FT                   /protein_id="ABO41155.1"
FT                   /translation="MPPVFPAHWHVSQPVLIADTFSSLVWKVSLPDGTPAIVKGLKPIE
FT                   DIADELRGADYLVWRNGRGAVRLLGRENNLMLLEYAGERMLSHIVAEHGDYQATEIAAE
FT                   LMAKLYAASEEPLPSALLPIRDRFAALFQRARDDQNAGCQTDYVHAAIIADQMMSNASE
FT                   LRGLHGDLHHENIMFSSRGWLVIDPVGLVGEVGFGAANMFYDPADRDDLCLDPRRIAQM
FT                   ADAFSRALDVDPRRLLDQAYAYGCLSAAWNADGEEEQRDLAIAAAIKQVRQTSY"
FT   gene            complement(30715..31518)
FT                   /gene="strA"
FT                   /locus_tag="SNSL254_pSN254_0046"
FT   CDS_pept        complement(30715..31518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="strA"
FT                   /locus_tag="SNSL254_pSN254_0046"
FT                   /product="streptomycin resistance protein StrA"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41059"
FT                   /db_xref="GOA:A0A0H3ACV8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR024165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACV8"
FT                   /protein_id="ABO41059.1"
FT                   /translation="MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASRR
FT                   GELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAWPS
FT                   MGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPQLDLLARV
FT                   ERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLALMIA
FT                   NAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG"
FT   gene            complement(31579..32394)
FT                   /gene="sul2"
FT                   /locus_tag="SNSL254_pSN254_0047"
FT   CDS_pept        complement(31579..32394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sul2"
FT                   /locus_tag="SNSL254_pSN254_0047"
FT                   /product="dihydropteroate synthase 2"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41111"
FT                   /db_xref="GOA:A0A0H3AD59"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD59"
FT                   /protein_id="ABO41111.1"
FT                   /translation="MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVI
FT                   DLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLN
FT                   DIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTG
FT                   AGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGR
FT                   GPGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALKETARIR"
FT   gene            32701..33012
FT                   /locus_tag="SNSL254_pSN254_0048"
FT   CDS_pept        32701..33012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD27"
FT                   /protein_id="ABO41163.1"
FT                   /translation="MDAKELNHMIAEAYSRDLQKPELVSFKEVSRWGRKYGFPVVCTLA
FT                   DESEEKQIHWAASLLIQVAGTWPREDMPELLTPERGSALFNDAMQLLANGLGAANQLR"
FT   gene            33186..33971
FT                   /locus_tag="SNSL254_pSN254_0049"
FT   CDS_pept        33186..33971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0049"
FT                   /product="putative ParA partition protein"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41103"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACU4"
FT                   /protein_id="ABO41103.1"
FT                   /translation="MAKVISFANQKGGVGKSTLCIQQAFYLALQKKKKVLVLDMDGQGN
FT                   TSSRLAPRRELEDGDYEPILTGTKTAELFAYELDGIEVMHCPCGADLIHTPKNDPDLFE
FT                   MEAVPLDQAMNPARHLAELFENYDYVLIDCPPSLGRKLVAALVMSTHVACPVKLSGFAV
FT                   DGVEGLLNTIIGVREAYNQDLEILGIVINDMDRSVNHDKALKSLENTVPDLLFENKIMH
FT                   RPPLDTATTDGIPVWELRYGHVAAKEVEAVLEELLEKVG"
FT   gene            33975..35156
FT                   /locus_tag="SNSL254_pSN254_0050"
FT   CDS_pept        33975..35156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0050"
FT                   /product="putative ParB partition protein"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM PF08535; match to protein
FT                   family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41039"
FT                   /db_xref="GOA:A0A0H3ACT8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR013741"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR042075"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACT8"
FT                   /protein_id="ABO41039.1"
FT                   /translation="MALNNLKGLSELAKAAKGKKGKEVLTVPVDDVVSKVQVRKRFRNI
FT                   EELAATLLTEGQQSPIIVFPKNEEGKFVIQKGERRWRACKHAGIETIDLVVNDKVQNNL
FT                   DETAGELIENIQRDDLTPVEIAEALNLFIEEGWKQKDIADRLGKNITFVSTHLSLLKLP
FT                   DCVRELYDNEVCSDTETLNNLRLLFDLNEERCRAVCAVAMSDGITRKQSRELLNDAKRI
FT                   KDEMEKGPLTGSHQNDELGAGNTDEQSLNSGGDGTSEQTGNDDLNLAQEELEGGKNSNG
FT                   QDDDDEDPLRDEEGEHKDPVKQPDNSGKDKDEEGGDALPPLPKDKEWKNVRADSLIFAV
FT                   NVNLDGETKRGVIMTDRVALVPSTVWVKTLDGEGKEKHVHVPVSDIELLSVEG"
FT   gene            35199..35477
FT                   /locus_tag="SNSL254_pSN254_0051"
FT   CDS_pept        35199..35477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAG19260.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41181"
FT                   /db_xref="InterPro:IPR017162"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADF3"
FT                   /protein_id="ABO41181.1"
FT                   /translation="MNMKISQDMKRKFALVNALSKTEKPSLQDLHKATNIPESTIKRQL
FT                   SALRDEFGMNILFVRESTGERGATGYYMLTDWGILDRSSFLNRYGKL"
FT   gene            complement(35530..36165)
FT                   /locus_tag="SNSL254_pSN254_0052"
FT   CDS_pept        complement(35530..36165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0052"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41203"
FT                   /db_xref="GOA:A0A0H3AD83"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD83"
FT                   /protein_id="ABO41203.1"
FT                   /translation="MSPETQQLTSKALSLIEQSRYRMGTSRFVEAFIDQWAYLQTGLYP
FT                   AKEEIPEELQPVAFELSHVLSAAIKRDPTSDVLGYVLSMSGFHKKGTNYFPTPPEIGRL
FT                   MSLIVGSQSSADFYEPCCGSGINAIHWMENLIENHGPEALREASIYLEDIDPLMVKCCM
FT                   IQLFHYFESRNTTPKTLSIVGIDTLSRRTKNIAYYAEKPPATAATVAA"
FT   gene            36727..37104
FT                   /locus_tag="SNSL254_pSN254_0053"
FT   CDS_pept        36727..37104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC41599.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41144"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD41"
FT                   /protein_id="ABO41144.1"
FT                   /translation="MPKQANHLRLKKPCANCPFRKEGAIELAPGRLEGIINDIVENDMT
FT                   TFHCHKTVHSKSGGEWDEEGNYAPSGQESMCAGAAAYLMKIGRPTVAMRIAFAFGDAKV
FT                   SDWDEAQELVVEPLVQGDRNE"
FT   gene            37353..38027
FT                   /locus_tag="SNSL254_pSN254_0054"
FT   CDS_pept        37353..38027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0054"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC40"
FT                   /protein_id="ABO41082.1"
FT                   /translation="MDENKLNIETVDGHNELVVSFLSRMVSLSDEEKQTVLSCLPDTGK
FT                   QTITQLYEALRSQGHQDLAEKVEPYLQQGVFGPIFDNAKSKVFVRDEAPFFLMDENPLN
FT                   WDDAKAFNRLRMSTTCVLGRGGWTIGERFDDRFDTEVGGTQLIVTQSLNEKGEIEGGLP
FT                   TSMSLNDFAEFPKQPRPPQIVDYQEDKRYTLEEAEAIPELAPVVQRLKERIEEYEERRA
FT                   HD"
FT   gene            38020..38526
FT                   /locus_tag="SNSL254_pSN254_0055"
FT   CDS_pept        38020..38526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0055"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41191"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADG7"
FT                   /protein_id="ABO41191.1"
FT                   /translation="MIDLTCRLCAGSGVYDFSPSKETCGMCQGHGKFVDAKAMLVAAIE
FT                   LAKKQREPVIEVVMGLVLQGVDVRGKEPGERFKAAQAFNAPGHNLLRYGWDAWELYALH
FT                   EGVSPELASLGRSVMREWHSHSWGRFSGEVGFNAAEIMIKQAKDNPEKAEERWAFLLSE
FT                   EWMVE"
FT   gene            38532..38843
FT                   /locus_tag="SNSL254_pSN254_0056"
FT   CDS_pept        38532..38843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0056"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41022"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ABX9"
FT                   /protein_id="ABO41022.1"
FT                   /translation="MTEQTNKKLMLDESPDMPLQFKWRKFGGAIFTATQTMEHVKEGRK
FT                   LGPTPAGMLPQEVWLNRLIAMEETLPRGKFFDRFRRRDKNEQYDLAADHLRLVGKKKR"
FT   gene            38852..39352
FT                   /locus_tag="SNSL254_pSN254_0057"
FT   CDS_pept        38852..39352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB93678.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEL4"
FT                   /protein_id="ABO41190.1"
FT                   /translation="MKAQAYPPSVIRKGAVLYAALYYISDDDKAKVEVTEWIVRSIQKR
FT                   RNSTSDQRYVNLAQKLDGITWGKRSRKNGDFGWLPSIPSWCLKQFREGGELPFGVYTTR
FT                   LAALKFAKVSLQEEVQYCEAELKKAQTEEDTQELQEELAENQRLLKAAGAMVKREQNKK
FT                   KRG"
FT   gene            39356..40783
FT                   /locus_tag="SNSL254_pSN254_0058"
FT   CDS_pept        39356..40783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0058"
FT                   /product="C-5 cytosine-specific DNA methylase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00145"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41120"
FT                   /db_xref="GOA:A0A0H3AEB7"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEB7"
FT                   /protein_id="ABO41120.1"
FT                   /translation="MLPIVSPSVVTKQLAFNRVGDKRKVRVSSNFLDVMGFKPGMGIAV
FT                   EPGEGMGGFSVIPATDELQTHQVYQRRYQPKSRSNNPLETVIEFSGQGLIDKCFPRYTE
FT                   RFHVEMRKGRVVFTPVANRAFAIADRFRKTSPFRAFVALTGGVDIHVMESLGWKAEIVL
FT                   EHRPVEARDRASGRNLSEVHALNTLVNSSPRILLNEDIHHLELDRLGALLAECPPIGLA
FT                   HYSLGCDDHSNAKSPRDKERSLEDLSTMLDMVYPALKQIEVVNPAVVLVENVPNFKASG
FT                   AGAMMGTTLRRMGYFLTEMVLNGLDFGAYQGRERYYMVASVFPGFVPPKPEQRAGGRLW
FT                   PVIEKHLGDCADVTALKSIQARESTSRRMPAFLTRESTSCPTILKSQDRGVKDAVYIQD
FT                   GGRIYKPSVDLVQELMSIPDSFDISWMAKEQATETLGQSVDYRLHSAVMAAVRDHLNVN
FT                   CGRHTVVQHGIRSKEGK"
FT   gene            40783..41439
FT                   /locus_tag="SNSL254_pSN254_0059"
FT   CDS_pept        40783..41439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0059"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD39"
FT                   /protein_id="ABO41096.1"
FT                   /translation="MAVIYYGEGTHDAGFVGFRVARTVGVADDYRQEYFSLREYSYATA
FT                   HRLAYSLDRKWEAEAEEVKRQNKTCKRRRNSGPNIIAEGLRAYISIENRSRMGVKRTYF
FT                   APCFLVTKPGYGNGDIVFRISTHGYAEAYEKAVEKYCEIHDLTDEQYVELLDRMPSTEV
FT                   FTGYLLNALLIRGHRATKAEILSKLGAAKNEDDITNSKGKSGHNRVRCPEYRWAQ"
FT   gene            41495..42112
FT                   /locus_tag="SNSL254_pSN254_0060"
FT   CDS_pept        41495..42112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0060"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41172"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACC9"
FT                   /protein_id="ABO41172.1"
FT                   /translation="MFFDNKVESHSLVMGASGKGKSVLSEQVRKNARLRGDLLVDTEMY
FT                   REGRGLKPYEHEYARRLVLGLSGPLPRELRGKPVTVISDVSRPKKVKRQPKQFVKTVNG
FT                   VTLERQLVADARDQLEMQTGVWLKQPQLIELMEESGIDETLADFGEAETQIREMLADAL
FT                   AMKLVGRSWPKCGALYNAAEKSDVNFSSELDAAAKEAGYMVR"
FT   gene            42345..42623
FT                   /locus_tag="SNSL254_pSN254_0061"
FT   CDS_pept        42345..42623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAP44279.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADB0"
FT                   /protein_id="ABO41204.1"
FT                   /translation="MKKRILHLPVKKIYFDQIKSGEKPDEYRLVTDYWIKRLEGREYDE
FT                   VHVKCGYPKAGDMSRIEIRPWRGFSRNVITHPHFGDYPVEVFAIHVN"
FT   gene            complement(42714..43202)
FT                   /locus_tag="SNSL254_pSN254_0062"
FT   CDS_pept        complement(42714..43202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0062"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41108"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACV0"
FT                   /protein_id="ABO41108.1"
FT                   /translation="MFGKIILTAMLTTSSATAEDAGKNIASGLATASTRQIGQAIMPTL
FT                   AIGSAIAKSAGKGMVLGFAETSASYISHDDLSATRSYQNPEAVDMAKGLGTLKDVPDFL
FT                   YVITDVNANMADKCKRVWEPQSLALSQLIVELVALRKTNNKGSYEQALSHLDCSIFTN"
FT   gene            complement(43217..45409)
FT                   /gene="topB"
FT                   /locus_tag="SNSL254_pSN254_0063"
FT   CDS_pept        complement(43217..45409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="SNSL254_pSN254_0063"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01396; match to protein
FT                   family HMM PF01751; match to protein family HMM TIGR01056"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41061"
FT                   /db_xref="GOA:A0A0H3ACZ3"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACZ3"
FT                   /protein_id="ABO41061.1"
FT                   /translation="MDLYICEKPSQAKDLAGVMKASQRGDGFLHDGGNRVITWAFGHLL
FT                   ELYMPDDYDERYKSWSLETLPIAPESWRYNVRKSAFKQYKIVEGLVKKASTIYISTDYD
FT                   REGEAIARSLLDRFRYSGPIRRVCLTALDESSIKKALNNVKDGKDTVSLYYAALARQRA
FT                   DWLVGMNVSRLYTVLARDVGFNHTLHVGRVITPTVALVCQRDREIAGFTPSPYWTLGVN
FT                   VSVQNGQFAAQWIPPEECSDEQGRCVNKAYAEQVASQVNGANAVISKAETKPGKESAPL
FT                   PFDLTSLQQYASKRWGYTAQQVLDAAQALYETHKATTYPRTDSRYLPESQKEDIPDILQ
FT                   ALILSDQNVSGLVAGADPHRKARVFNDAKVTAHHAIIPTPARTDISAMSEIEFNLYDAI
FT                   RRFYIAQFYSEFEFTKTSIEVQCGRHLFASAGKTPTKQGWKVLFASDSESSPKDEGEDT
FT                   DAPVEQEKLPRVSQGEPALLNGAELANKMTRPAPHFTEATLLAAMENIARFVTEEKFKQ
FT                   ILKDTAGLGTPATRASIIQGAVDKGYFKRQKKVLLATDKAHALIAVLPPAIKSPGMTAA
FT                   WEQELEKVASGSGNMSVFMKQISTWICQMVEQLKVAAPVLTKEGGAMAKAFEGAKPPSH
FT                   ECFNCGGEMHRIKGKNGFFWGCQNEACKKTFPDNRGKPEKRIAAEDCPDCPDCGSPMRL
FT                   RKGKAPGKKRASKFWGCTAYPDCKGTMPFKKSDFMD"
FT   gene            complement(45624..46241)
FT                   /locus_tag="SNSL254_pSN254_0064"
FT   CDS_pept        complement(45624..46241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0064"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD66"
FT                   /protein_id="ABO41116.1"
FT                   /translation="MRQLIAILGVAILAGCASNAPEQKPQPQTAPAENDKPARVSRELS
FT                   MAWDNMGRGGAALRQPGYIHVLGDGNVSATMNKVKDDSAGSDKTPAGIKQHGDVNEAIN
FT                   TFKSMNKGKGYSLYELSRWERYCDGGKGMDEHDWRFVEAEGTTNIPKDVVTGCIPPTHT
FT                   YKDYLNAWTHFCTSQAVTDADRRIVRESVRPYSVVNPCKALK"
FT   gene            46409..49381
FT                   /gene="traI"
FT                   /locus_tag="SNSL254_pSN254_0065"
FT   CDS_pept        46409..49381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traI"
FT                   /locus_tag="SNSL254_pSN254_0065"
FT                   /product="type IV conjugative transfer system protein TraI"
FT                   /note="identified by similarity to GB:AAL59675.1; match to
FT                   protein family HMM PF07514"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41092"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC50"
FT                   /protein_id="ABO41092.1"
FT                   /translation="MLKALNKLFGGRSGVIETAPSVRVLPLKDVEDEEIPRYPPFAKGL
FT                   PVAPLDKILATQAELIEKVRNSLGFTVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGA
FT                   GGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNEPRWRLASCFSGLLHDVGKPLSDV
FT                   SITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSLLAVDRIIPAETR
FT                   EFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVPV
FT                   ERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDP
FT                   DTLADILIERGFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFT
FT                   TEPPAAVAAEVVGDVEDAEIEFVDPEEVDDDQEEDVSALNDDMLAAEQEAEKALAGLGF
FT                   GDAMEMLKSTSDAVEEKPEQKDAGSTESSKPDAGKKGKPQSKPGKAKPKSDTEKQPHKP
FT                   EAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPFDAFSASAETASTDATNSE
FT                   IPDVAMPGKQEKQPKQDFVPQEQNSLQGDDFPMFGSSDEPPSWAIEPLPMLTDAPEQTT
FT                   PAPAMPPTDKPNLHEKDAKTLLVEMLAGYGEASALLEQAIMPVLEGKTTLGEVLCLMKG
FT                   QAVILYPDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAV
FT                   VAAIKDAEASMGGYQDAFELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKPSPEQ
FT                   KAKGKDSQPQQKEKKVDVTSPVEEPQRQPVQEKQNVARLPKREVQPVAPEPKVEREKEL
FT                   GHVEVREREEPEVREFEPPKAKTNPKDINAEDFLPSGVTPQKALQMLKDMIQKRSGRWL
FT                   VTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKKRQGKLYLEVNE
FT                   T"
FT   gene            49378..51243
FT                   /gene="traD"
FT                   /locus_tag="SNSL254_pSN254_0066"
FT   CDS_pept        49378..51243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="SNSL254_pSN254_0066"
FT                   /product="type IV conjugative transfer system protein TraD"
FT                   /note="identified by similarity to GB:AAL59680.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41170"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR022458"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEI6"
FT                   /protein_id="ABO41170.1"
FT                   /translation="MTMSYDPLAYEMPWRPNYEKNAVAGWLAASGAALAVEQVSTMPPE
FT                   PFYWMTGICGVMAMARLPKAIKLHLLQKHLKGRDLEFISIAELQKYIKDTPDDMWLGSG
FT                   FLWENRHAQRVFEILKRDWTSIVGRESTVKKVVRKIQGKKKELPIGQPWIHGVEPKEEK
FT                   LMQPLKHTEGHSLIVGTTGSGKTRMFDILISQAILRGEAVIIIDPKGDKEMRDNARRAC
FT                   EAMGQPERFVSFHPAFPEESVRIDPLRNFTRVTEIASRLAALIPSEAGADPFKSFGWQA
FT                   LNNIAQGLVITHDRPNLTKLRRFLEGGAAGLVIKAVQAYSERVMPDWEAEAAAYLEKVK
FT                   NGSREKIAFALMKFYYDIIQPEHPNSDLEGLLSMFQHDQTHFSKMVANLLPIMNMLTSG
FT                   ELGPLLSPDSSDLSDERQITDSAKIINNAQVAYLGLDSLTDNMVGSAMGSIFLSDLTAV
FT                   AGDRYNYGVNNRPVNIFVDEAAEVINDPFIQLLNKGRGAKLRLFVATQTFADFAARLGS
FT                   KDKALQVLGNINNTFALRIVDGETQEYIADNLPKTRLKYVMRTQGQNSDGKEPIMHGGN
FT                   QGERLMEEEADLFPAQLLGMLPNLEYIAKISGGTIVKGRLPILTQ"
FT   gene            51254..51838
FT                   /locus_tag="SNSL254_pSN254_0067"
FT   CDS_pept        51254..51838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0067"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41030"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE14"
FT                   /protein_id="ABO41030.1"
FT                   /translation="MCDKKYRNYEVAIMVDVNPFDRVMNELKSRGRKNAHILSILQFDW
FT                   PASEAIIEKLSCYITDGIKANQEPVIYPIIEEALHRYSQLVFHEQREKYEDPARIGAFL
FT                   ETLITETCRALEVQIVDSGGDSWSVDSGESFSLWLSSHPGELSINPQPHEDETSLRGLL
FT                   YELITCESVKTVLRRTDYEEAVVAGRMAAGY"
FT   gene            51795..52424
FT                   /locus_tag="SNSL254_pSN254_0068"
FT   CDS_pept        51795..52424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0068"
FT                   /product="putative type IV conjugative transfer system
FT                   coupling factor"
FT                   /note="identified by similarity to GB:AAL59721.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41158"
FT                   /db_xref="GOA:A0A0H3AD21"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD21"
FT                   /protein_id="ABO41158.1"
FT                   /translation="MKKPWLLVAWLLVIELLAILLLIPGDWTDRAIKRESELVEQSLGV
FT                   EARDWIQNKASTWFRSSVIDSGFYEGMYQTLIPSEEERQKSKGMQDMGKGWFVWVKGRM
FT                   EAFVNVIYQFYTRLALLAAWAPYMLILFVPAVYDGMMTWRIKRTNFDYASPVLHRYSVR
FT                   GTMYLMAGLFIAFFIPIALDPVVIPMTMMTCCVLVGLTFGNLQKRV"
FT   gene            52434..52880
FT                   /locus_tag="SNSL254_pSN254_0069"
FT   CDS_pept        52434..52880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0069"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41192"
FT                   /db_xref="GOA:A0A0H3ACE4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACE4"
FT                   /protein_id="ABO41192.1"
FT                   /translation="MSYSVINQDGVHLCDIPLNVYQVIRRQSLSALWLYWAQSLNLVKV
FT                   LIACVGKMIFVMPVMWFWVLVVCRLVEPERISDVSGLISPDVIGWAAGAAITLIIFSVF
FT                   TRPALYGYHNFFKQHICSRVKQVTPELRTVTGPLFFYRNEIGTI"
FT   gene            52890..53267
FT                   /locus_tag="SNSL254_pSN254_0070"
FT   CDS_pept        52890..53267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0070"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACZ4"
FT                   /protein_id="ABO41104.1"
FT                   /translation="MKVTNRLQLLALGLCIAGTAIAAPDVLNDDAKLKNLEKVCPDCQM
FT                   VAKDVLNLRVENCQLKDTSSAMMIGTMQNDPMFSFMLAVHTAAGSEAYKTVVGAAGNHV
FT                   DCENPLNWIKLTQQAIKGGKV"
FT   gene            53339..53929
FT                   /locus_tag="SNSL254_pSN254_0071"
FT   CDS_pept        53339..53929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0071"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACK5"
FT                   /protein_id="ABO41033.1"
FT                   /translation="MEPLARKVSAEFFTAQLNRILKEHDGQLTLSDGTSYPSFWSFIDK
FT                   VDPEQVGFVEIYARQDVNDNVEATLACDIVLVNGVITVKPHWCAYKDIRADEVISTLLV
FT                   PLHLKALQGKAYIRWDDGETEPLLQNDDYQAELENVFSVSKYPSAMSWGDTADQKVKQY
FT                   KMDLECATDVGRRGVSSEQAWDAYRELRYNRTV"
FT   gene            54265..54630
FT                   /locus_tag="SNSL254_pSN254_0072"
FT   CDS_pept        54265..54630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41176"
FT                   /db_xref="GOA:A0A0H3ADE7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADE7"
FT                   /protein_id="ABO41176.1"
FT                   /translation="MNLNKQFFWFLMNAVLMCIFIVPVAVAFWLSAFAAGFDWSQWVKL
FT                   AADTANRAASDPAKALGTVQTYWGILSFFLLAAYSLMFKFKANANKEVKTLEVARPANE
FT                   VSVAASEKHSEAVPQNQ"
FT   gene            54775..55056
FT                   /gene="traL"
FT                   /locus_tag="SNSL254_pSN254_0073"
FT   CDS_pept        54775..55056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traL"
FT                   /locus_tag="SNSL254_pSN254_0073"
FT                   /product="type IV conjugative transfer system protein TraL"
FT                   /note="identified by similarity to GB:AAL59674.1; match to
FT                   protein family HMM TIGR02762"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41091"
FT                   /db_xref="GOA:A0A0H3AD32"
FT                   /db_xref="InterPro:IPR008103"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD32"
FT                   /protein_id="ABO41091.1"
FT                   /translation="MKPVKIPRRVDEPPHLLLWSADELAPMLLGLTIGVIIGKALICFL
FT                   GGLLVTNLYRRFRDNHPDGYLLHMIYWAGFIMTKAKSLKNPFVRRYLP"
FT   gene            55053..55679
FT                   /gene="traE"
FT                   /locus_tag="SNSL254_pSN254_0074"
FT   CDS_pept        55053..55679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traE"
FT                   /locus_tag="SNSL254_pSN254_0074"
FT                   /product="type IV conjugative transfer system protein TraE"
FT                   /note="identified by similarity to GB:AAL59679.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41139"
FT                   /db_xref="GOA:A0A0H3AD35"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD35"
FT                   /protein_id="ABO41139.1"
FT                   /translation="MNLKKYLKTWEGTQTENKWGRIFQGGLIAIVFLLVVQVFSKETIV
FT                   TIQPFTLTEEAWVTKSNASQSYKEAWGFAFAQLLGNVTPGTVDFVKERITPLLSPSIYQ
FT                   DVIDAIEIQAQQIKNDRVTMRFEPRFVEYEPKSDKVFVYGYSYVKGASSNEERSERSYE
FT                   FAIKISNYAPVLDYIDTYVGKPRTKTVLEQLQRKEENRRKHEEQR"
FT   gene            55663..56580
FT                   /locus_tag="SNSL254_pSN254_0075"
FT   CDS_pept        55663..56580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM08021.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41041"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACW0"
FT                   /protein_id="ABO41041.1"
FT                   /translation="MKNNAKLSLLALSLALGTSMAYASDDIPVVPASVMKKDVPAPVTS
FT                   GQSSHEVVGSMNENPLLTMKPGVNQIIPIAVGHPNRIVTPFSNPEIVSTSLTGATDNGQ
FT                   CGEVCIKENVVYVATDKQYPVTMFITEKGSEAQALSLTMVPRRIPPREVFLKLDGGVGI
FT                   TGAFANTKAETWEQSQPYVETIRSVFRKIALGEVPQGYTLNRIPAGAAVPSCAHPGVKV
FT                   DFSKGQYMMGHHLNVFIGVALNVSDQPIEFKEALCGSWDVAAVTTWPLNVLEPGQKTEI
FT                   YVAKKQKRGLAPTSKRPSLLGGAQ"
FT   gene            56577..57893
FT                   /gene="traB"
FT                   /locus_tag="SNSL254_pSN254_0076"
FT   CDS_pept        56577..57893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traB"
FT                   /locus_tag="SNSL254_pSN254_0076"
FT                   /product="type IV conjugative transfer system protein TraB"
FT                   /note="identified by similarity to GB:AAL59682.1; match to
FT                   protein family HMM PF06447"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41084"
FT                   /db_xref="GOA:A0A0H3ACX7"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACX7"
FT                   /protein_id="ABO41084.1"
FT                   /translation="MIKRFWTQLDPNKKRWVSIAGGVFVLFAVVTMFSGEPKKEEKRGR
FT                   QETIKHVLTDKNTREIGIDSLSADVKMVSRENSDLKKELERVKKELEETKTTAGKSSDV
FT                   GREMTRLRQDLDRLTQKNMELAKKVETGAAGGKTSSSSEDARADVNGASGGDGQFMEKK
FT                   LDYKDPASFFRDAPLPDSKGGAPATGKGDGRDATKPGIQIVSYSQKAPEVEEKDNKDDE
FT                   SIYLPSGSILTGVLINGMDAPTSQGARRDPFPSTLRIQKEAILPNRFRADVRECFLIVS
FT                   GYGDLSSERAYLRGETFSCVRDDGGVIEAKLDSYAVGEDGKAGVRGRVVSKQGQIIAKS
FT                   LMAGFLGGVSEAFDVNPVPVVSTNPGSNTQYQSVFSDQMLQGAAVKGASKALDRIAQFY
FT                   IDMAEGIFPVIEVDAGRQVDIIVTKGTKLQIRSTGGTKK"
FT   gene            57890..58468
FT                   /gene="traV"
FT                   /locus_tag="SNSL254_pSN254_0077"
FT   CDS_pept        57890..58468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traV"
FT                   /locus_tag="SNSL254_pSN254_0077"
FT                   /product="type IV conjugative transfer system protein TraV"
FT                   /note="identified by similarity to GB:AAL59672.1; match to
FT                   protein family HMM TIGR02747"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41175"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEJ2"
FT                   /protein_id="ABO41175.1"
FT                   /translation="MKNLNILTRKGSSRGEAQKEQAVRSAKMLGVGAALLILSGCSTFN
FT                   IGKDEYSCPGMPNGVQCMSARDVYAATNDGNVPRPMKPEEVEAKAEADGEGSSNVSANS
FT                   SSSGDPVIDNYVAPRLPDRPIPIRTPAQVMRIWVAPWEDTNGDLIVTGYVYTEIEPRRW
FT                   VIGDGTPQSEPVLRPLQTVQHEPKSETTK"
FT   gene            58481..58864
FT                   /gene="traA"
FT                   /locus_tag="SNSL254_pSN254_0078"
FT   CDS_pept        58481..58864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traA"
FT                   /locus_tag="SNSL254_pSN254_0078"
FT                   /product="type IV conjugative transfer system protein TraA"
FT                   /note="identified by similarity to GB:AAL59683.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41052"
FT                   /db_xref="GOA:A0A0H3AC12"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC12"
FT                   /protein_id="ABO41052.1"
FT                   /translation="MNANQLANASSKNNALFLFLGLMVVAFLLVPDQAHAGTGGTAFDD
FT                   VWVTLKDWTQGTLGRIVAGAMILVGVVGGIARQSLMAFAMGIGGGMGLYNSPTVVESIM
FT                   SATLEHAEKVIPAVVQLSNGLGV"
FT   mobile_element  58963..60107
FT                   /mobile_element_type="insertion sequence:ISEc9"
FT   repeat_region   58963..58975
FT                   /rpt_type=INVERTED
FT   gene            59149..60132
FT                   /pseudo
FT                   /locus_tag="SNSL254_pSN254_0080"
FT                   /note="transposase InsC1 for insertion sequence ISEc9,
FT                   truncation; identified by match to protein family HMM
FT                   PF01609"
FT   gene            complement(60102..60809)
FT                   /pseudo
FT                   /locus_tag="SNSL254_pSN254_0079"
FT                   /note="type IV conjugative transfer system protein TraC,
FT                   truncation; identified by similarity to GB:AAL59681.1"
FT   gene            complement(60806..61513)
FT                   /locus_tag="SNSL254_pSN254_0081"
FT   CDS_pept        complement(60806..61513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM08034.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41057"
FT                   /db_xref="GOA:A0A0H3AE63"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE63"
FT                   /protein_id="ABO41057.1"
FT                   /translation="MRTKLLGALMVFGIITGTAHASSKLEITDPRAAKIEDIVELPIKG
FT                   VRAVQSDGQIMFLSENGRFVISGQIYDLWSKKPLNTMSQMRDVAERIHFKSMGMDVDTL
FT                   NTVSMGRGDKEVVVFVDPRCAVCHQLMGDAKSLVDDYTFKFIVIPALGAESNRLAKNLY
FT                   CAKDKTHALDALMNNTLGSLPSKETCDPGQYDQTLLTAHFIGIEGVPFVVAPDGRVSKG
FT                   RPKNLKSWLESAE"
FT   gene            complement(61662..67148)
FT                   /locus_tag="SNSL254_pSN254_0082"
FT   CDS_pept        complement(61662..67148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0082"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41159"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR025429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADI7"
FT                   /protein_id="ABO41159.1"
FT                   /translation="MINFKPKIPAMLGALAVLTAGAAHAELLEYTFKAPDGTQRSLTPN
FT                   ANYANPTGNISFALSAGIDRKVKISVLRSDGTVVSTATSHLLGATDRITVGGKSYYGAE
FT                   LQLPAPVGGAYTIRAEILASDGSTVQTDEYPLTVDVTPPTYSSLAPVYSNYGQVTSGDV
FT                   WKLGLGGSEDNAFLLSGISDESPIKGVKAKLYRQDGSLYKDVSVNYDDANGQARQSFQS
FT                   GFFPASDLDEVFTLQFEISDSAGNSYLSPRQKVMFDSITNAPSAPFGVYDPSSTNNLGP
FT                   GLTGFVAYTEGMTVKTNPIKLAWRVPRDNWHEYREGGINMTNALGEMSKVGEDASYVYL
FT                   VTTAPYGNTDGNYWRWVNFGQWGGGGIAYNLTLSPSAPKSPRLLGVDYNYSDIGWSSFY
FT                   RYWVNNSVLPVTVSSIRVKVEPRPYVQTAVHRGSCEIPVGQDSCVIANSFTMAKGTTGY
FT                   VHDNATVFNPDKSLRSNPLWAEVNWNDQHYPQLSQQFDQNSKVFTLFVNQPGRGAYFDR
FT                   LRLRSAWIEDSKGNKLSPTGGLIANNWENYTYQWDLKTLPEGQYSLVAAAEEMHGPLTR
FT                   QPMFQITSDRTPPTMTLSVADGAAIQTLDDVVITLADAIDPSPKLTSIALVGGPANDKV
FT                   QLSWREESKGRFRLEYPVMFPSLKEGESYTLTVSGEDAQGNAVQKAVGFEYKPRQVMLA
FT                   DGMDGKVMVPAVTHEFVHADGKRIIETKPLTLSDGAVVTGSYDVFATLRSDAKVPLVVN
FT                   GVRIEPGQTMGIMSQHDFGASGGRLSIPVKPAVPDVVGSSSLLVMTSAPNSPILVVDIN
FT                   TWKGTAKLSAESWTIRQVIDPVKIYALPESGVPCRFTTKEDVAMAADPIRDPVCLLQWD
FT                   RTPDEAEQTTQDNNGMKVAGLVGQAVSIGEQPVEYSLYLFSGDGSKVKVGSGSQNLTVT
FT                   TAYGSVGYTPIDDIAQVNRVIEDFDVNFKQSKGPDCSITLSADRAKKEAANKAVGSASR
FT                   ACLFEWQQIPDGLVQDPLSESPSLSGSLASNGVHPLGWRVSIFTRNGTRVTLNDETFNV
FT                   EAVDPPAPTVELASDYNFKDNIYLVPMTGNYLGDAIINSERADLDIAISRNSDVLESET
FT                   FTPGWGATNKVYRRINTDERALWEETTYKVNAAYNKVPDVKTEVVYRAISAPSDSIRPI
FT                   VEVKGDTAIDTQALPVRVLIRDQYKPDGDYDANTMGVWKVRLIQQKAYNETVALTDYAE
FT                   ASNGEAQFSVDLSGVDTSSVRIAAEAVLESPVEGYNRTELSIRPAFLTVLRGGAIGAGV
FT                   EARKLSGEAPFTAVFKLSLDDRQDLRATGQVVWETSKDDGKTWEQFIPEDRYKYQLVKT
FT                   FDKGEYQVRAKVVNVNSGAEKYTEAVSVVAYDKPDIAVIGPTTLFVGSEGKYTANLTLN
FT                   DEPISGGNAIVEWSTDGGKTYAQTGDSITLSSDEETRYRLWARVRSATAPADDGYAYEV
FT                   AKTAVDFRAVKAPRPYVTGPRVIETGKKYVFKAETSLPYRGMDVKLNGFFTLPDGSIVQ
FT                   GDTAEYEPSDTDLNQATVETKYTTWIEGYRDQGAEASHSLRSRVWQYVWPSFGMQVRKN
FT                   ADVAPATITASVRPIAFNGKLEEPTYEWELPEGAVIQDQRQDIVRSFVINEPGDYNIKV
FT                   TVRDARGHETVIEQPLKIGQAAPYAIDLQYSGSNKYEREPLDVLLRPYISGGHPRDRIS
FT                   TRVYSVDGTPLESSGYYGRATLGAGEHSIKLKITSEMGHEAEGEVNINVAENKLPACSL
FT                   SSRETVGSWIVYANCEDTDGRMKSYEWTIAGELQSISSDRVTISKGTYETMPTISLVGV
FT                   DDSGGKSEAVTMN"
FT   gene            complement(67194..67619)
FT                   /pseudo
FT                   /locus_tag="SNSL254_pSN254_0083"
FT                   /note="transcriptional regulatory protein EntR, truncation;
FT                   identified by similarity to SP:O69280"
FT   gene            67753..68193
FT                   /gene="sugE1"
FT                   /locus_tag="SNSL254_pSN254_0085"
FT   CDS_pept        67753..68193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE1"
FT                   /locus_tag="SNSL254_pSN254_0085"
FT                   /product="quaternary ammonium compound-resistance protein
FT                   SugE1"
FT                   /note="identified by similarity to SP:P69937; match to
FT                   protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41194"
FT                   /db_xref="GOA:A0A0H3AD51"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD51"
FT                   /protein_id="ABO41194.1"
FT                   /translation="MNKKVEIHFLPGKNAISHISFAGRPANASFTGDGPIVLEPDMSWI
FT                   VLLIAGLLEVVWAIGLKYTHGFTRLTPSIITIAAMIVSIAMLSWAMRTLPVGTAYAVWT
FT                   GIGAVGAAITGILLLGESASPARLLSLGLIVAGIIGLKLSTH"
FT   gene            complement(68190..68723)
FT                   /gene="blc1"
FT                   /locus_tag="SNSL254_pSN254_0084"
FT   CDS_pept        complement(68190..68723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blc1"
FT                   /locus_tag="SNSL254_pSN254_0084"
FT                   /product="outer membrane lipoprotein Blc1"
FT                   /note="identified by similarity to SP:P0A901; match to
FT                   protein family HMM PF08212"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41035"
FT                   /db_xref="GOA:A0A0H3AE19"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE19"
FT                   /protein_id="ABO41035.1"
FT                   /translation="MRILPVVAAVTAAFLVVACSSPTPPKGVTVVNNFDAKRYLGTWYE
FT                   IARFDHRFERGLDKVTATYSLRDDGGINVINKGYNPDREMWQKTEGKAYFTGDPSRAAL
FT                   KVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISDEMKQQMLAIATREG
FT                   FEVNKLIWVKQPGA"
FT   gene            complement(68817..70046)
FT                   /gene="blaCMY-2-1"
FT                   /locus_tag="SNSL254_pSN254_0086"
FT   CDS_pept        complement(68817..70046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blaCMY-2-1"
FT                   /locus_tag="SNSL254_pSN254_0086"
FT                   /product="CMY-2 beta-lactamase 1"
FT                   /note="identified by similarity to GB:AAX86815.1; match to
FT                   protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41133"
FT                   /db_xref="GOA:A0A0H3AD62"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR001586"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD62"
FT                   /protein_id="ABO41133.1"
FT                   /translation="MSTRCKSNTLIASDGPGHLFAFNYGTDFMMKKSLCCALLLTASFS
FT                   TFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQ
FT                   QTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAG
FT                   GLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAM
FT                   TRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARW
FT                   VQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVA
FT                   LAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVE
FT                   AAWRILEKLQ"
FT   mobile_element  70079..70595
FT                   /mobile_element_type="insertion sequence:ISEc9"
FT   repeat_region   70079..70092
FT                   /rpt_type=INVERTED
FT   gene            complement(70286..70543)
FT                   /pseudo
FT                   /locus_tag="SNSL254_pSN254_0087"
FT                   /note="transposase InsC2 for insertion sequence ISEc9,
FT                   truncation"
FT   mobile_element  70595..72250
FT                   /mobile_element_type="insertion sequence:ISEc9"
FT   repeat_region   70595..70608
FT                   /rpt_type=INVERTED
FT   gene            70781..72043
FT                   /gene="insC3"
FT                   /locus_tag="SNSL254_pSN254_0088"
FT   CDS_pept        70781..72043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insC3"
FT                   /locus_tag="SNSL254_pSN254_0088"
FT                   /product="transposase InsC3 for insertion sequence ISEc9"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41047"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC04"
FT                   /protein_id="ABO41047.1"
FT                   /translation="MINKIDFKAKNLTSNAGLFLLLENAKSNGIFDFIENDLVFDNDST
FT                   NKIKMNHIKTMLCGHFIGIDKLERLKLLQNDPLVNEFDISVKEPETVSRFLGNFNFKTT
FT                   QMFRDINFKVFKKLLTKSKLTSITIDIDSSVINVEGHQEGASKGYNPKKLGNRCYNIQF
FT                   AFCDELKAYVTGFVRSGNTYTANGAAEMIKEIVANIKSDDLEILFRMDSGYFDEKIIET
FT                   IESLGCKYLIKAKSYSTLTSQATNSSIVFVKGEEGRETTELYTKLVKWEKDRRFVVSRV
FT                   LKPEKERAQLSLLEGSEYDYFFFVTNTTLLSEKVVIYYEKRGNAENYIKEAKYDMAVGH
FT                   LLLKSFWANEAVFQMMMLSYNLFLLFKFDSLDSSEYRQQIKTFRLKYVFLAAKIIKTAR
FT                   YVIMKLSENYPYKGVYEKCLV"
FT   repeat_region   72238..72250
FT                   /rpt_type=INVERTED
FT   gene            72283..73512
FT                   /gene="blaCMY-2-2"
FT                   /locus_tag="SNSL254_pSN254_0089"
FT   CDS_pept        72283..73512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blaCMY-2-2"
FT                   /locus_tag="SNSL254_pSN254_0089"
FT                   /product="CMY-2 beta-lactamase 2"
FT                   /note="identified by similarity to GB:AAX86815.1; match to
FT                   protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41188"
FT                   /db_xref="GOA:A0A0H3AD62"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR001586"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD62"
FT                   /protein_id="ABO41188.1"
FT                   /translation="MSTRCKSNTLIASDGPGHLFAFNYGTDFMMKKSLCCALLLTASFS
FT                   TFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQ
FT                   QTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAG
FT                   GLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAM
FT                   TRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARW
FT                   VQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVA
FT                   LAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVE
FT                   AAWRILEKLQ"
FT   gene            73606..74139
FT                   /gene="blc2"
FT                   /locus_tag="SNSL254_pSN254_0091"
FT   CDS_pept        73606..74139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blc2"
FT                   /locus_tag="SNSL254_pSN254_0091"
FT                   /product="outer membrane lipoprotein Blc2"
FT                   /note="identified by similarity to SP:Q46036; match to
FT                   protein family HMM PF08212"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41032"
FT                   /db_xref="GOA:A0A0H3AE19"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE19"
FT                   /protein_id="ABO41032.1"
FT                   /translation="MRILPVVAAVTAAFLVVACSSPTPPKGVTVVNNFDAKRYLGTWYE
FT                   IARFDHRFERGLDKVTATYSLRDDGGINVINKGYNPDREMWQKTEGKAYFTGDPSRAAL
FT                   KVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISDEMKQQMLAIATREG
FT                   FEVNKLIWVKQPGA"
FT   gene            complement(74136..74576)
FT                   /gene="sugE2"
FT                   /locus_tag="SNSL254_pSN254_0090"
FT   CDS_pept        complement(74136..74576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE2"
FT                   /locus_tag="SNSL254_pSN254_0090"
FT                   /product="quaternary ammonium compound-resistance protein
FT                   SugE2"
FT                   /note="identified by similarity to SP:P69937; match to
FT                   protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41154"
FT                   /db_xref="GOA:A0A0H3AD51"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD51"
FT                   /protein_id="ABO41154.1"
FT                   /translation="MNKKVEIHFLPGKNAISHISFAGRPANASFTGDGPIVLEPDMSWI
FT                   VLLIAGLLEVVWAIGLKYTHGFTRLTPSIITIAAMIVSIAMLSWAMRTLPVGTAYAVWT
FT                   GIGAVGAAITGILLLGESASPARLLSLGLIVAGIIGLKLSTH"
FT   gene            74710..75135
FT                   /pseudo
FT                   /locus_tag="SNSL254_pSN254_0092"
FT                   /note="transcriptional regulatory protein EntR, truncation;
FT                   identified by similarity to SP:O69280"
FT   gene            75181..80667
FT                   /locus_tag="SNSL254_pSN254_0093"
FT   CDS_pept        75181..80667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0093"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41206"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR025429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADI7"
FT                   /protein_id="ABO41206.1"
FT                   /translation="MINFKPKIPAMLGALAVLTAGAAHAELLEYTFKAPDGTQRSLTPN
FT                   ANYANPTGNISFALSAGIDRKVKISVLRSDGTVVSTATSHLLGATDRITVGGKSYYGAE
FT                   LQLPAPVGGAYTIRAEILASDGSTVQTDEYPLTVDVTPPTYSSLAPVYSNYGQVTSGDV
FT                   WKLGLGGSEDNAFLLSGISDESPIKGVKAKLYRQDGSLYKDVSVNYDDANGQARQSFQS
FT                   GFFPASDLDEVFTLQFEISDSAGNSYLSPRQKVMFDSITNAPSAPFGVYDPSSTNNLGP
FT                   GLTGFVAYTEGMTVKTNPIKLAWRVPRDNWHEYREGGINMTNALGEMSKVGEDASYVYL
FT                   VTTAPYGNTDGNYWRWVNFGQWGGGGIAYNLTLSPSAPKSPRLLGVDYNYSDIGWSSFY
FT                   RYWVNNSVLPVTVSSIRVKVEPRPYVQTAVHRGSCEIPVGQDSCVIANSFTMAKGTTGY
FT                   VHDNATVFNPDKSLRSNPLWAEVNWNDQHYPQLSQQFDQNSKVFTLFVNQPGRGAYFDR
FT                   LRLRSAWIEDSKGNKLSPTGGLIANNWENYTYQWDLKTLPEGQYSLVAAAEEMHGPLTR
FT                   QPMFQITSDRTPPTMTLSVADGAAIQTLDDVVITLADAIDPSPKLTSIALVGGPANDKV
FT                   QLSWREESKGRFRLEYPVMFPSLKEGESYTLTVSGEDAQGNAVQKAVGFEYKPRQVMLA
FT                   DGMDGKVMVPAVTHEFVHADGKRIIETKPLTLSDGAVVTGSYDVFATLRSDAKVPLVVN
FT                   GVRIEPGQTMGIMSQHDFGASGGRLSIPVKPAVPDVVGSSSLLVMTSAPNSPILVVDIN
FT                   TWKGTAKLSAESWTIRQVIDPVKIYALPESGVPCRFTTKEDVAMAADPIRDPVCLLQWD
FT                   RTPDEAEQTTQDNNGMKVAGLVGQAVSIGEQPVEYSLYLFSGDGSKVKVGSGSQNLTVT
FT                   TAYGSVGYTPIDDIAQVNRVIEDFDVNFKQSKGPDCSITLSADRAKKEAANKAVGSASR
FT                   ACLFEWQQIPDGLVQDPLSESPSLSGSLASNGVHPLGWRVSIFTRNGTRVTLNDETFNV
FT                   EAVDPPAPTVELASDYNFKDNIYLVPMTGNYLGDAIINSERADLDIAISRNSDVLESET
FT                   FTPGWGATNKVYRRINTDERALWEETTYKVNAAYNKVPDVKTEVVYRAISAPSDSIRPI
FT                   VEVKGDTAIDTQALPVRVLIRDQYKPDGDYDANTMGVWKVRLIQQKAYNETVALTDYAE
FT                   ASNGEAQFSVDLSGVDTSSVRIAAEAVLESPVEGYNRTELSIRPAFLTVLRGGAIGAGV
FT                   EARKLSGEAPFTAVFKLSLDDRQDLRATGQVVWETSKDDGKTWEQFIPEDRYKYQLVKT
FT                   FDKGEYQVRAKVVNVNSGAEKYTEAVSVVAYDKPDIAVIGPTTLFVGSEGKYTANLTLN
FT                   DEPISGGNAIVEWSTDGGKTYAQTGDSITLSSDEETRYRLWARVRSATAPADDGYAYEV
FT                   AKTAVDFRAVKAPRPYVTGPRVIETGKKYVFKAETSLPYRGMDVKLNGFFTLPDGSIVQ
FT                   GDTAEYEPSDTDLNQATVETKYTTWIEGYRDQGAEASHSLRSRVWQYVWPSFGMQVRKN
FT                   ADVAPATITASVRPIAFNGKLEEPTYEWELPEGAVIQDQRQDIVRSFVINEPGDYNIKV
FT                   TVRDARGHETVIEQPLKIGQAAPYAIDLQYSGSNKYEREPLDVLLRPYISGGHPRDRIS
FT                   TRVYSVDGTPLESSGYYGRATLGAGEHSIKLKITSEMGHEAEGEVNINVAENKLPACSL
FT                   SSRETVGSWIVYANCEDTDGRMKSYEWTIAGELQSISSDRVTISKGTYETMPTISLVGV
FT                   DDSGGKSEAVTMN"
FT   gene            80816..81523
FT                   /locus_tag="SNSL254_pSN254_0094"
FT   CDS_pept        80816..81523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM08034.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41080"
FT                   /db_xref="GOA:A0A0H3AE63"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE63"
FT                   /protein_id="ABO41080.1"
FT                   /translation="MRTKLLGALMVFGIITGTAHASSKLEITDPRAAKIEDIVELPIKG
FT                   VRAVQSDGQIMFLSENGRFVISGQIYDLWSKKPLNTMSQMRDVAERIHFKSMGMDVDTL
FT                   NTVSMGRGDKEVVVFVDPRCAVCHQLMGDAKSLVDDYTFKFIVIPALGAESNRLAKNLY
FT                   CAKDKTHALDALMNNTLGSLPSKETCDPGQYDQTLLTAHFIGIEGVPFVVAPDGRVSKG
FT                   RPKNLKSWLESAE"
FT   gene            81520..83967
FT                   /gene="traC"
FT                   /locus_tag="SNSL254_pSN254_0095"
FT   CDS_pept        81520..83967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traC"
FT                   /locus_tag="SNSL254_pSN254_0095"
FT                   /product="type IV conjugative transfer system protein TraC"
FT                   /note="identified by match to protein family HMM TIGR02746"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41137"
FT                   /db_xref="InterPro:IPR014117"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC99"
FT                   /protein_id="ABO41137.1"
FT                   /translation="MIVTIKKKLEETLIPEHLRAAGIIPVLAYDEDDHVFLMDDHSAGF
FT                   GFMCEPLCGADEKVQERMNGFLNQEFPSKTTLQFVLFRSPDINQEMYRMMGLRDGFRHE
FT                   LLTSVIKERINFLQHHTTDRIFAKTNKGIYDNGLIQDLKLFVTCKVPIKNNNPTESELQ
FT                   QLAQLRTKVESSLQTVGLRPRTMTAVNYIRIMSTILNWGPDASWRHDSVDWEMDKPICE
FT                   QIFDYGTDVEVSKNGIRLGDYHAKVMSAKKLPDVFYFGDALTYAGDLSGGNSSIKENYM
FT                   VVTNVFFPEAESTKNTLERKRQFTVNQAYGPMLKFVPVLADKKESFDTLYESMKEGAKP
FT                   VKITYSVVLFAPTKERVEAAAMAARNIWRESRFELMEDKFVALPMFLNCLPFCTDRDAV
FT                   RDLFRYKTMTTEQAAVVLPVFGEWKGTGTYHAALISRNGQLMSLSLHDSNTNKNLVIAA
FT                   ESGSGKSFLTNELIFSYLSEGAQVWVIDAGKSYQKLSEMLNGDFVHFEEGTHVCLNPFE
FT                   LIQNYEDEEDAIVSLVCAMASAKGLLDEWQISALKQVLSRLWEEKGKEMKVDDIAERCL
FT                   EEENDQRLKDIGQQLYAFTSQGSYGKYFSRKNNVSFQNQFTVLELDELQGRKHLRQVVL
FT                   LQLIYQIQQEVFLGERNRKKVVIVDEAWDLLKEGEVSVFMEHAYRKFRKYGGSVVIATQ
FT                   SINDLYENAVGRAIAENSASMYLLGQTEETVESVKRSGRLTLSEGGFHTLKTVHTIQGV
FT                   YSEIFIKSKSGMGVGRLIVGDFQKLLYSTDPVDVNAIDQFVKQGMSIPEAIKAVMRSRR
FT                   QAA"
FT   gene            83982..84299
FT                   /locus_tag="SNSL254_pSN254_0096"
FT   CDS_pept        83982..84299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0096"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEA3"
FT                   /protein_id="ABO41110.1"
FT                   /translation="MDIKSIAIAAILGAAGGFGGSYYVMSEQTASIHQRLNQTPPVVVV
FT                   DFAKVASAYPAGASQEEVERLMVKTNDAILKLKDAGYLVLDASAVVGAPSDVYLPDEVL
FT                   K"
FT   gene            84296..84826
FT                   /locus_tag="SNSL254_pSN254_0097"
FT   CDS_pept        84296..84826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0097"
FT                   /product="type IV conjugative transfer system signal
FT                   peptidase"
FT                   /note="identified by similarity to GB:AAL59670.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41099"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACY9"
FT                   /protein_id="ABO41099.1"
FT                   /translation="MNFPLKKYFVKKESWKRFGVKAGVTLVVLWAAGAAFASRYRIGID
FT                   PQQEKCLPGYTFFLIDLNDQTLERGAVYAFQAKNMQPFYKDGTRMVKILTGMPGDKVEI
FT                   NDKWKITVNGDVVGEGLQLAGKLHLPESHFYGKTTLKENNYWFMGKSPFSFDSRYWGTV
FT                   KNDQIIGRAYPLF"
FT   gene            84789..86054
FT                   /gene="traW"
FT                   /locus_tag="SNSL254_pSN254_0098"
FT   CDS_pept        84789..86054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traW"
FT                   /locus_tag="SNSL254_pSN254_0098"
FT                   /product="type IV conjugative transfer system protein TraW"
FT                   /note="identified by similarity to GB:AAL59671.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41200"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEM7"
FT                   /protein_id="ABO41200.1"
FT                   /translation="MIRSLAAHIPCSKSVLVALMFSVAGGAYAQESPLTEQDKALIEQG
FT                   KQIAQKAQKMEMPSLLQNQHMDEAQAEAKAFFKQLQTTNPTLKEMHRKQAEKGIYSDHR
FT                   ILVFASLSLGEQGLDDVLTAVSGQPDSVIVFRGIPEGMNLGQGVKAIQALAAKKDPVPN
FT                   IIINPTLFKTYNITAVPTIVMLEDEPLPGEQPNVVAQVSGLSDPVWLAREVDNGEKGDL
FT                   GVKGPVEKISEPDLIDVAKKRLANIDWEEKKKQAIERFWTKQNFNELPRAPKSRTREID
FT                   PSVMITSDISTPDGTVFAHAGDVINPLCDPKEVCKPGTRPFTQAVVVFDPLDKKQMELL
FT                   AKKLPEIKLEPGVQRITYIATEFDKDKGWDSYKSVTDNFDAPVYLLTPDLITRFELEHT
FT                   PSVITARGKKFVVRELAEEGGE"
FT   gene            86051..86722
FT                   /locus_tag="SNSL254_pSN254_0099"
FT   CDS_pept        86051..86722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0099"
FT                   /product="cyclic diguanylate phosphodiesterase (EAL) domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41093"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACT0"
FT                   /protein_id="ABO41093.1"
FT                   /translation="MIFAPAFQPIKDVGTGSFVAAEVLARWYDEGRVLTPSSLSSPPYW
FT                   GLVDMEMARFIQDNLHYCLDLYPALFLNVSEQTLQSDVIFKAWCRVVRDIAKNHSSRLV
FT                   IEITEGIQDASLASRWEALTEIGVELALDDYGDKNSSLDRLSRYDWHYCKFDARRLRSL
FT                   EDYPAILHCRRKGIQLIAEQVESFPLGESAKLLGLSWQQGFYHGKPAVMEKNLNYVKAL
FT                   P"
FT   gene            86719..87726
FT                   /gene="traU"
FT                   /locus_tag="SNSL254_pSN254_0100"
FT   CDS_pept        86719..87726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traU"
FT                   /locus_tag="SNSL254_pSN254_0100"
FT                   /product="type IV conjugative transfer system protein TraU"
FT                   /note="identified by match to protein family HMM PF06834"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41183"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD55"
FT                   /protein_id="ABO41183.1"
FT                   /translation="MMQKILRIMAVSAVFWVGSVSADPGCQNAEVIGGKLITDICWSCI
FT                   FPIKVAGVPISGGGGSFPSEAVSNPLCMCEDNLGVPRPGVTTSMWEPARLVEFQRVPGC
FT                   SSVLNGVRFPFDRTNQGHHGMGDMDGGDGSFMHYHYYAFPLLVMLDLFIKQTCNADGYM
FT                   DLDIMYMSELDPTWNNDELAFFTNPEAAAVANPIAAAACTADAVSSTAGKPLKQLFWCA
FT                   GSWGTLYPFSGNQNGGKGVIRDSSLLSTRVLAALHRRGLAWKTMGSEAMCRGVISPTLP
FT                   KTQYKFTLLHPVPETNSSHVIGESTLTWGLARTIPAIGQDPIYTIWRWNDCCNN"
FT   gene            87842..90637
FT                   /gene="traN"
FT                   /locus_tag="SNSL254_pSN254_0101"
FT   CDS_pept        87842..90637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traN"
FT                   /locus_tag="SNSL254_pSN254_0101"
FT                   /product="type IV conjugative transfer system protein TraN"
FT                   /note="identified by match to protein family HMM PF06986"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41067"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC27"
FT                   /protein_id="ABO41067.1"
FT                   /translation="MRSHNYFMKAVASLLTVTMSALPIHSYANGSQDQDITAVGKEAQA
FT                   FGQNLSNSFKSSSGTVQDGTISMPTLKDGQFQMNGGSQINVNDLFPGTSGTNNKPDSYY
FT                   FPDANKPDVGGLQGIYDSGDDMDSVGNNAKGSLWSDANSANPSISGAAYKVLLDASNRS
FT                   RPDFSNDPVLNLSKKTYEDMDLIAGGFGDCSAETTINQNTINAHIPEYERCQRVVDQSA
FT                   DCEVVHDYDASVVKHYDGPYNLKSCGEGCTELWIGRVGDNYWSGNCKIYEEYTRVQVSN
FT                   PDAIVSATLEYAKWDDYMQVWVGKSGQETKVWSGPDGNFPPETAGRCELSTSWERNPNV
FT                   DVTPYFKNVKDGDVVTFKIRVSVSGEGEGFGRIKLRYDPSKAITKDEWAPQSCMDSAKG
FT                   VVDGFAEGEITCIDDPTDATGCTVINGIKVCESQLKPSPLPGIPKLCKKVRVKADYDFY
FT                   KGQMDCWTDPQGETHCPVNTGGNLDSCQKYEENPQCGFISSKCVDGAQGSSGTCYVHED
FT                   TYDCGTDVSVPTLEKETEYQCGGPIRCMGDDCLDLTKTQSTDFARATALLNAAQFMTQD
FT                   MSCTGQDGDDNPTGDENVICSAFAGEAGECKIAVGGVSDCCEKPTNISLADYLNLIMAV
FT                   PKLDGAVMGLTDGNALKGAYQVLREPALQGWTEVTKPFTSYIENVSGAVDSFFQPVEQF
FT                   VDQLIDQLKEQVKEVMMDVMKSAGQDAATEQAAAAASEQAAEAMMETATTWLSTAMTIY
FT                   TVYVVAMVMIQMIYKCEEEEFTMNAKRALKNCTYVGSYCKSKVLGACIEKREAYCCFNS
FT                   PLSRIIQEQVRPQLGQNFGDPKNPQCEGIPLDKIAEIDWSKINLDEWLGILQQNGKFPD
FT                   PASINLDSLTGAGNDFNIDGTRKNAQERALERLEGIDIDAKRKEATNSIDPQTGAPTGG
FT                   G"
FT   gene            complement(90676..91536)
FT                   /locus_tag="SNSL254_pSN254_0102"
FT   CDS_pept        complement(90676..91536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0102"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACT6"
FT                   /protein_id="ABO41098.1"
FT                   /translation="MKKALITTVALAVAALSGCASTSSYEPTAYKTNHSRAYNIAEAGG
FT                   LVTGIQDASVPRDKLERLTDTKTFGAAYVLSGYMSPQLGMTDWQGGLVNLANWAIGPKQ
FT                   HGARNSLIAWMPANEAVSPADAQAKFLSHVKVSIESALTDLGANFTLLYDKDGRLTYQF
FT                   YKNEWGCPTWVNGQSKVADMCSVKVKIVEPRLGSAPNFVSGVQGTAYAFTSGHETAYNF
FT                   VNVGNGAASHAPQQAIYAAISKQLPAWAYLYLAPKSVELDNGEKVAFPYLLDQGKAELF
FT                   VYPEA"
FT   gene            complement(91659..92300)
FT                   /locus_tag="SNSL254_pSN254_0103"
FT   CDS_pept        complement(91659..92300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM08043.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ABY2"
FT                   /protein_id="ABO41027.1"
FT                   /translation="MAEAQVALDTNNDRSNHYSRPVFKQVLKVNSLQAQRVMERSFERV
FT                   SNSLFSIDVILRIIGEQDEIDQVETVILEHISKVSEDLDKATAQLNKLMEDNGIDMMPG
FT                   YTNPNEYTIEINSPQVAQFAHLIRKLDTLMGIVDTLWLNTVLTSKQRTDATYQWQQRLI
FT                   KLAGRIIGIEKRARISAHSKGKEGEVAEAAPESATGDKEIADEAEKTKAA"
FT   gene            92595..92915
FT                   /locus_tag="SNSL254_pSN254_0104"
FT   CDS_pept        92595..92915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0104"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACF8"
FT                   /protein_id="ABO41207.1"
FT                   /translation="MHIITFIVVLLASLGALYVGAKAFAFSFIVLAKVFQRIGLFLWNK
FT                   FAVPAMRSVQAVIKERAAKAEQAKAVVEPEVTQVQEVAKQEPDWDYLEIPTYLRKGKEL
FT                   VW"
FT   gene            93219..93404
FT                   /locus_tag="SNSL254_pSN254_0105"
FT   CDS_pept        93219..93404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0105"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41018"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACI5"
FT                   /protein_id="ABO41018.1"
FT                   /translation="MQQNLHVYDDHAGIIYLADGREVKFDPKLYSSSYQAHSEAVKWAK
FT                   ETGVIGQNDDVVMFVH"
FT   gene            93624..94592
FT                   /locus_tag="SNSL254_pSN254_0106"
FT   CDS_pept        93624..94592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0106"
FT                   /product="ATPase, AAA family"
FT                   /note="identified by match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41085"
FT                   /db_xref="GOA:A0A0H3AE69"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE69"
FT                   /protein_id="ABO41085.1"
FT                   /translation="MSQYSQFSVSKVFGMPSIPEKVTAIGYADGSNPFIPATDTNYVFR
FT                   KEFLREVLAYLKEPGGDALFVTGPTGSGKTSGITEIAGRLNWPVQQITAHGRMELTDLI
FT                   GHHALVAEKPGQPPVMKFMYGPLAVAMREGHLLLINEVDLADPAELAGLNDVLEGRPLV
FT                   IAQNGGEIIKPHPMFRVVVTGNSTGSGDASGLYQGVMMQNLAAMDRYRFTKVGYADEEA
FT                   ELSILGRATPKLPENVRKGMVRIANQVRKLFLGENGEDGQISVTMSTRTLVRWAKLSLA
FT                   FRGAPNALEYALDQALLIRAAKEEREAILRVAKDVFGDQWR"
FT   gene            94603..95511
FT                   /locus_tag="SNSL254_pSN254_0107"
FT   CDS_pept        94603..95511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0107"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACZ9"
FT                   /protein_id="ABO41109.1"
FT                   /translation="MKKNDCLCRRYTAKEWGNDETTIEVFIGYKLLREPSSSEPGQFTM
FT                   VELRRTVTDGKAENWSETKLEGPFEANGPDTIPMSYKDKESQYVSQFLSQGYTFLDEVL
FT                   VNAETQTVLEGGNVSAGQTASLGSLNWLLSPPSELPPGDINLFKGFVAGVFAKGAGLIG
FT                   FEVARSEGSNDLLPSVLMRTDSGYELGVSTGLGENTIHPATLEGAGELRPEHGHKPLLM
FT                   LVYLQQRFADDFSNVEKPLVAFCDEQGDTFDYERFDSLKPLIERFGFSYDEVRADAERL
FT                   GLVSELIRLAEIDAEQEDHFF"
FT   gene            95575..96102
FT                   /gene="ssb"
FT                   /locus_tag="SNSL254_pSN254_0108"
FT   CDS_pept        95575..96102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="SNSL254_pSN254_0108"
FT                   /product="single-strand DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41198"
FT                   /db_xref="GOA:A0A0H3AD74"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD74"
FT                   /protein_id="ABO41198.1"
FT                   /translation="MSKGVNKVILVGNLGSDPEIRYMPSGTAVANFNVATTDTWRDKQS
FT                   GEQREHTEWHRIVLKGRLAEVAGEYLKKGSQVYLEGSNRTRKWTDSQQIERYTTEVHCV
FT                   EMQMLGGRGNAPQDNSQRAAPQKGQRTGAGTQSAPVQQSAPQGGMGGGYGPAPDGWDDD
FT                   IPFMRLHHLAGG"
FT   gene            96197..97186
FT                   /gene="bet"
FT                   /locus_tag="SNSL254_pSN254_0109"
FT   CDS_pept        96197..97186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bet"
FT                   /locus_tag="SNSL254_pSN254_0109"
FT                   /product="phage recombination protein Bet"
FT                   /note="identified by match to protein family HMM PF03837;
FT                   match to protein family HMM TIGR01913"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41122"
FT                   /db_xref="GOA:A0A0H3AC83"
FT                   /db_xref="InterPro:IPR010183"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC83"
FT                   /protein_id="ABO41122.1"
FT                   /translation="MSDNKSLVTRIASRFGVDTRKFYETLKATAFKQRDGSAPTDEQMM
FT                   TLLIVAEQYGLNPFTREIYAFPDKQNGIIPVVGVDGWSRIINEHPQYDGVEFVYSDKMV
FT                   RMQGAKVDCPEWIECVIYRKDRSRPIRIKEFIDEVYREPFQGQGRNGAYTVDGPWQTHT
FT                   KRQLRHKSLIQCSRVAFGFSGIYDQDEAERIREMEQASAINPAIANLPSPSQVQSQEPL
FT                   AIEHKELDPILTKLANRAIAENAWSAAHEYVKGRYEGSELQYATQFLRDKEMDQMEPPK
FT                   PDYQEAHEQESAAGGSANAEPGAEEMPPLSDEDMIPVTEEEGAEGSYY"
FT   gene            97249..98259
FT                   /locus_tag="SNSL254_pSN254_0110"
FT   CDS_pept        97249..98259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0110"
FT                   /product="putative phage-type endonuclease"
FT                   /note="identified by match to protein family HMM TIGR03033"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41034"
FT                   /db_xref="GOA:A0A0H3ACT2"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR017482"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACT2"
FT                   /protein_id="ABO41034.1"
FT                   /translation="MKIVNLSQREEDWLDWRRQGVTATDAAILLNRSPYKTRWRLWAEK
FT                   TGYAREVDLSLNPLVRRGIENEDAARRAFEEKYDDMLLPACVESVQYPLMRASLDGLRD
FT                   NGEPVELKSPSATVWEDVCAEKANSKAYQLYYPQVQHQLLVTGAKQGWLVFYFEGQIQE
FT                   FPILRDEAMIQEILAEAKKFWQQVVDKKEPDKDPERDLYIPQGEEVNRWIAAAEEYRLY
FT                   DAEIQELKQRLSELQERQKPHLDTMKSLMGEYFHADYCGVMVTRYKAAGRVDYKKLLAD
FT                   KASGVKPEDVDQYREKSSERCRVTVTGSVKPRYIVDEDVLAPLDDLPEEVETFYW"
FT   gene            98459..99736
FT                   /locus_tag="SNSL254_pSN254_0111"
FT   CDS_pept        98459..99736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL59707.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41056"
FT                   /db_xref="InterPro:IPR021496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACY5"
FT                   /protein_id="ABO41056.1"
FT                   /translation="MTKVNHLQSLCVIHVDFDIWSGQTRLSASDLKLGEGGEIPPEKVA
FT                   QLGSKKICDPAKLKGFHRLKTETRRLLLKFGMPFMNGFAVPVSKTDEICNKLNDINFQF
FT                   NQLKQDFIKGYNKAVDEWCQENPEYERAIRAGALPKETVEERIGFEYQVFMIQPVNEDE
FT                   ANAKRLNRKVERLGDDLISEVVQEANKFYMERLAGRDQCAVTTRQTLRNIRDKVDGLSF
FT                   LNSAFNPLVKLLDQTLRGYEQHADGRNIVAPFFYQVVAAVLIMSERDRIEQYANGSITV
FT                   EGMANDIGGSGAQMGDRSKDEKAEQKSDKAGELIPATEGGETKQQQVGGTESVQSEQTN
FT                   SGGNSVDLDEDIDNFFKSFAERGEGESEDESNAGDVVREERVDVEDELVLPEETPVEQE
FT                   PVQEETTEEPLNQELPKTDDDGDYFF"
FT   gene            99821..101617
FT                   /locus_tag="SNSL254_pSN254_0112"
FT   CDS_pept        99821..101617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0112"
FT                   /product="von Willebrand factor type A domain protein"
FT                   /note="identified by match to protein family HMM PF00092"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41142"
FT                   /db_xref="GOA:A0A0H3ACA5"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACA5"
FT                   /protein_id="ABO41142.1"
FT                   /translation="MSKKRTIYSALPIVAAAYGEKLGVKVAIGNDDAYTDGKTIVVPNI
FT                   PDDYPHMDAVWGYLAHEAAHVRFTDFGVERRRGLHAELSNVLEDCRIERAMMELFPGTS
FT                   QTLNEVARYMAQAGHYEHVTDKEAPASILTGFCLYWLQTKAVGQSVLQPYLDSATPVFE
FT                   RVFPQGVVVRLNALLRKAVNTKSTAEVTSLADQIIKMIEEEKEKEEQKPQNGQDGNNQQ
FT                   NAGGNQPQNSQGGSGNDQNQGPDANGGDQQGKDQKQDDANGKSDPKGQGDQGKSDTDGG
FT                   SKAGQSQAGGNSDAAKQDAAKMLQQVLNAGAGDLRGDAHDALKAELNRVAQDKGDSSYM
FT                   TVRSAVNTQDNPAVGKSLVGDVKSTTSKIRTQLYGLVQASQRVAHRNQRSGKRVDARKL
FT                   HRVVTGDTRVFLKPEAKKRPNTAVHILVDMSSSMAYKAANGKERQDIAREASLAISMAL
FT                   EAIPGVNPAVTFFGGNRNQPVFSVVKHGDTVQNRAGRFGFKATGGTPMAEAMWYAAFEL
FT                   TKTREERKMLIVVTDGQPQSAPACRSVIDLCERSDVEVIGIGVETTAVSGLFQKNIVID
FT                   DAAALQRTLFKLMERSLTAFAA"
FT   gene            101679..102014
FT                   /locus_tag="SNSL254_pSN254_0113"
FT   CDS_pept        101679..102014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0113"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41117"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC78"
FT                   /protein_id="ABO41117.1"
FT                   /translation="MNQFHSSLDLYHRNKGRRATVPETPFLLLAKRIPPMYWRLFQGVT
FT                   LDSRMGYTGRRQFHRLGQAIDWAKSSVGDSWSNKRFHKPVGLDVLLACTASKVPEHLVE
FT                   ELKRRGS"
FT   gene            102279..102818
FT                   /locus_tag="SNSL254_pSN254_0114"
FT   CDS_pept        102279..102818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0114"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD24"
FT                   /protein_id="ABO41129.1"
FT                   /translation="MSHLNNLKSVMISLAAEHKLPEIYQDDITTDVESLDRFDGLRLVW
FT                   LLRSCGSVLVPAEVGVNPIYITHWLWSNHGQQVVPFSVDTRTGLIEKIDFEQAEKLIMQ
FT                   MPCNLSSLQNKEYLVDQVNRVLQRGCEMRIWGIFESPSSVESVGGWKEWQSYFSSTGNR
FT                   LMADFVGKAIRFTNPR"
FT   gene            102909..103409
FT                   /locus_tag="SNSL254_pSN254_0115"
FT   CDS_pept        102909..103409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0115"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41048"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACM0"
FT                   /protein_id="ABO41048.1"
FT                   /translation="MKNLSALEAVLDYDKPSRRFLDELNENQMKDLSGEIFAKLYWSKR
FT                   NPQWYEKDTNRLFARLRWVQRIIKKRLKTGKVKPELTENGSVMERFNFPYGDTLDFFHR
FT                   YLRHPKWEVVYQESGCSAFWKNEATLELCTYCEGDVVMMKAPDEATFFRDCNRLSWWYA
FT                   DNA"
FT   gene            103468..104367
FT                   /locus_tag="SNSL254_pSN254_0116"
FT   CDS_pept        103468..104367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0116"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41136"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD94"
FT                   /protein_id="ABO41136.1"
FT                   /translation="MMEDAMFKSSVCSYENRGPYGNNKYRGNCSGFIVKDFIESYMRKP
FT                   NGLVADPSVGGGSSIDVANELGVRFKGTDLHQGFNLLRDDFLSFLGEPAHLIWWHPPYW
FT                   DMIQYSGKQWGEPNKWDMSRMNLPEFVEALELAVMNIHDACERGGHYGILMGNLRRDGD
FT                   YFNLSSLVERIAPGKLVDEIIKTQHNCVSDRTQYSGKLVRIAHEKLLVFRRNDVASSLC
FT                   LLAAVHRRATNMVSTTWKAAIRRTLQGKTLKLEQIYKEIEPYAKHRENNHWQAKVRQVL
FT                   QDARFFIRIEVGVYALAE"
FT   gene            104433..104657
FT                   /locus_tag="SNSL254_pSN254_0117"
FT   CDS_pept        104433..104657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0117"
FT                   /product="[2Fe-2S]-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00111"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41113"
FT                   /db_xref="GOA:A0A0H3ACV6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACV6"
FT                   /protein_id="ABO41113.1"
FT                   /translation="MNVQLQASNNVLLAQIESKGLTVETHCRSGFCGMCRVRLLEGQVA
FT                   YDETPIAFVKEGEVLVCCAKAKTDVTLEI"
FT   gene            104719..105108
FT                   /locus_tag="SNSL254_pSN254_0118"
FT   CDS_pept        104719..105108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0118"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADE2"
FT                   /protein_id="ABO41171.1"
FT                   /translation="MSINTKVEQIAYGHATALVLSELGQQENWCKAYEYLSECVERGDE
FT                   PEDLVVWQPFEHWEWKDILEQIESEAESLLSTIKSVLGLAHKGIIQSAIDCSLDSDMTQ
FT                   LDLIGMVELGSEIEDGECAGGGYAA"
FT   gene            105098..105550
FT                   /locus_tag="SNSL254_pSN254_0119"
FT   CDS_pept        105098..105550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0119"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC23"
FT                   /protein_id="ABO41062.1"
FT                   /translation="MQLNRYTARESDKSRILRTIGWCKRNHLTLAGLPYEDNLAGSDGI
FT                   SIEIITPPGMSREMLEQAVREGYSERDVVRHRILECPVGWFMEADGKAFDHEVFHDYVV
FT                   AHGYGEPSSEAYELAERWFWQGNDYALIAAEIVARDLCVRDDEDED"
FT   gene            105555..105830
FT                   /locus_tag="SNSL254_pSN254_0120"
FT   CDS_pept        105555..105830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0120"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACZ5"
FT                   /protein_id="ABO41138.1"
FT                   /translation="MDAVAHIAADNLVPACGGAEKPFTVSGRQWLYCYHPASGRHCYLD
FT                   LDNDRPVWHRGFHPAFHPELEFADEAELLRPVERKPDHEELEDFYF"
FT   gene            105888..106079
FT                   /locus_tag="SNSL254_pSN254_0121"
FT   CDS_pept        105888..106079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0121"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE39"
FT                   /protein_id="ABO41060.1"
FT                   /translation="MKDHSQTIVFPGNNVESLAEANAMLSAVSEDARKASNTEDKRDLE
FT                   SLQGWLEENINSQLAGVK"
FT   gene            106148..106501
FT                   /locus_tag="SNSL254_pSN254_0122"
FT   CDS_pept        106148..106501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM08083.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41036"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACV4"
FT                   /protein_id="ABO41036.1"
FT                   /translation="MNAVKMIQKENQLELPLFFLDEEPKTAEVIPFEPKPEWTDDEVRQ
FT                   LRDGLLWHSLRVLADGRAGSEIKQETMAWVMSDEVHPFSFVVCCDEAGYDPSGVREGVK
FT                   SILNRLARVKAGG"
FT   gene            106693..107037
FT                   /locus_tag="SNSL254_pSN254_0123"
FT   CDS_pept        106693..107037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0123"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADA0"
FT                   /protein_id="ABO41141.1"
FT                   /translation="MTTLASFANPISVIQRSPTSGVFGTNQFVGDKEGFVQKVLGKWYC
FT                   NPGNTIPVESMSHLEQAEKLYDFYVKYLQVKEKISVNLGRVLHKLYSTGSIKEAEIVLE
FT                   AIKAQAGVTA"
FT   gene            107115..107417
FT                   /locus_tag="SNSL254_pSN254_0124"
FT   CDS_pept        107115..107417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0124"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACR5"
FT                   /protein_id="ABO41083.1"
FT                   /translation="MEKHNLKSGFSIYFADVHFEKQVYAFGSGLGFTSVIYAYSLGRDP
FT                   EEAEKLALEKYDSDETKVKKVHVNLARSQDINRYTFPEQMAGFANAIQSHGIAVN"
FT   gene            107495..109120
FT                   /locus_tag="SNSL254_pSN254_0125"
FT   CDS_pept        107495..109120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0125"
FT                   /product="C-5 cytosine-specific DNA methylase"
FT                   /EC_number="2.1.1.37"
FT                   /note="identified by match to protein family HMM PF00145"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41182"
FT                   /db_xref="GOA:A0A0H3ACD7"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACD7"
FT                   /protein_id="ABO41182.1"
FT                   /translation="MATIVNTKLGEHRGKKRVWLEGQKLLREGYYPGMKYDLELKDSQV
FT                   VLRVKEEGKFTISKRERNGRVSPIIDLTVQELATVFDGVEMLRVFIRNGAIVISAHHQQ
FT                   ERVIERVNRLISKLENGESLSVCSLFHGGGVLDKAIHAGFHKAGIASAISVAVEMEGKY
FT                   LDSSLANNPELWNEDSIVIESPIQAVNLSKRPPQVDVLMGGIPCTGASKSGRSKNKLEF
FT                   AESHEAAGAMFFNFLQFVEALNPAVVLIENVPEYQNTASMEVIRSVLSSLGYSLQERIL
FT                   DGNEFGVIERRKRLCVVALSHGIDGFELEKVQPVRTKESRIQDILEPVPLDSERWKSFD
FT                   YLAEKELRDKAAGKGFSRQLLTGDDEFCGTIGKDYAKCRSTEPFIVHPEQPELSRIFTP
FT                   TEHCRVKGIPEELIQGLSDTIAHQILGQSVVFPAFEALALALGNSLWSWVGMMPIMVEV
FT                   VDESQPVIGGEDFHWATALVDAKGTLKLSPAAKKQGMPFNIMDGQLAVYSPNGTKKSCG
FT                   HEPCEYLPVMMSGDAIMVTSSLVH"
FT   gene            109181..109612
FT                   /locus_tag="SNSL254_pSN254_0126"
FT   CDS_pept        109181..109612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0126"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41064"
FT                   /db_xref="GOA:A0A0H3ACW3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACW3"
FT                   /protein_id="ABO41064.1"
FT                   /translation="MKIETVVPLPPEDSGLQHCIARFHNRNMDSKRKDKTRFFRREPVM
FT                   IVNPETKAKVLRYAMGNPGNLSITKLAVALDYDAVDALGVRFKDTVNLEVRRARRWEVW
FT                   QWFWNHPDQSVQLSIKLGVVGAVLGVMGFLTGVAPYLLG"
FT   gene            109686..110240
FT                   /locus_tag="SNSL254_pSN254_0127"
FT   CDS_pept        109686..110240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0127"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE77"
FT                   /protein_id="ABO41090.1"
FT                   /translation="MNTLEQLVNQRVLEEGLKKAKPLAAQMGLESVPDEMLEMICPNLN
FT                   YSGQFTPALYARFQSVKRLLKELSEQTSPKHGHIVKFTNQYGSYDESALLFKEGDVRNQ
FT                   NLVACVGGKTINLGELELRDYGLNMHIGCGGPFEPISEAQIQSLSEFDFYETTYRFWGQ
FT                   NPCGNGMIDITVPMKRWFLTV"
FT   gene            110473..110859
FT                   /locus_tag="SNSL254_pSN254_0128"
FT   CDS_pept        110473..110859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0128"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41031"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACU8"
FT                   /protein_id="ABO41031.1"
FT                   /translation="MSKNVNDVFSNRTSLECTVNAALDRRIGLRVGFPHYREGANGVVC
FT                   EIEAEYPLLNTHSSVAWPLLDELNSYTIQKNQSLIDHIDNAVAELLKHKARLQLDIQKL
FT                   QDGDIDLVKQAKQQYEDNQMSSSS"
FT   gene            110947..113400
FT                   /locus_tag="SNSL254_pSN254_0129"
FT   CDS_pept        110947..113400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE51790.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41193"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD67"
FT                   /protein_id="ABO41193.1"
FT                   /translation="MQQTLNFDLSEQPIPVLLRGDKWDSVWSELTDNEDLNFVDASRGT
FT                   SLSSLITSSVESIHTALIDGWTMMIGYSSGKDSETVLHLFLMALIRAVRSGATISQHHF
FT                   ILHTDTLIESPEVRWLADQKLAELERFIAKENLPLTIVLAKPGISQSWTGRILTGRGLP
FT                   TFSNSTARQCSQDLKITSAKRAKAAYMRELPKEVRQKVCLLLGSRDAESTIRAANIAKQ
FT                   RGSSDRVIKTKDGGELYVVKNWLASDVWEFLLSAGMGSAYPLPSYLESNVTTAELYKAA
FT                   TGECVWSATEKKASDACGARFGCWACQAVGLDKSMETLLATDPERHGYMSGLNRIQRYL
FT                   AKRRYAWEDRHPVGRTIYEGGYIKIQPDVYSPVFLERLLHVCCSMDYMEQKRADELAYK
FT                   LATGQAEDNDWNRRMAEPQFRIISEEALVHIDFMWAFHHFNDKPFHALEIYHRVWSMGD
FT                   LDLLEDEPQCETVPQSPIPKPLWLKVGRWGDGSLSDGLADPLAEMAYFDGGDDPLAAQV
FT                   INTADGKRRVVCFAEDDEVKVDPDSAAFIIWNEYPRLRESVLKGHYTPGSAAQFYLRFG
FT                   AIQLAKGKGALYHRMMQRGQTYHQMGLTGLQTMEGIQQRKDVKVLSDAKYKDLVKRKIK
FT                   GRLATVRWWVNLHLTFKYHLHHRTPTGLFIEKQLDQEAMEEQKRHQERWFNYVTDAMLC
FT                   YSSAFCMSVMEGREGSGNANIRRYMAATRRKAYTALCELLDNTDAQWMNDVVQSAVGQY
FT                   EAIQAALTEGSALAIYLDWINLLSKRHPASLERHVRTMIKAVQRLHRRDDTELQRGQQG
FT                   LSLAA"
FT   gene            113602..113805
FT                   /locus_tag="SNSL254_pSN254_0130"
FT   CDS_pept        113602..113805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0130"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACW9"
FT                   /protein_id="ABO41069.1"
FT                   /translation="MSLDKLSRLVDQQRKIQDEIDNEIILAVKEVLATNSVGLARELVG
FT                   GVPQDHPFHPFLLAIAKQLDPR"
FT   gene            113877..114482
FT                   /locus_tag="SNSL254_pSN254_0131"
FT   CDS_pept        113877..114482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0131"
FT                   /product="putative 5'-nucleotidase"
FT                   /note="identified by similarity to SP:P76491"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD79"
FT                   /protein_id="ABO41126.1"
FT                   /translation="MSNSNFGFLALALRQRLIKRWSLMHSVQPESVLEHSAVVTLLSYL
FT                   AGNIAIQQGKSVDLAVMLAHASLHDAAEVLCSDVVTPVKKANAVLQREFERLEKAAEDK
FT                   LIQTLPEELQDAVAIAFAPGGYEQSLVKACDTYSAYIKCKLEVAAGNGLEFQDALSKME
FT                   RVVAQVKSDFPEIDALDKWFGNGLGHSVDKLLAGGNDD"
FT   gene            114475..114744
FT                   /locus_tag="SNSL254_pSN254_0132"
FT   CDS_pept        114475..114744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAR12555.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41037"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ABZ4"
FT                   /protein_id="ABO41037.1"
FT                   /translation="MTNPIPGDIKIKDFGRDRKFRSVDELQSTLSEQYKGQHVSIVYPA
FT                   KPSGLLRTVFVSVDDAGGVNRTYGDQSPVDFSAIKDDLYVPSDL"
FT   gene            114758..114976
FT                   /locus_tag="SNSL254_pSN254_0133"
FT   CDS_pept        114758..114976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0133"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41124"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD17"
FT                   /protein_id="ABO41124.1"
FT                   /translation="MVVIIVNTGHYEFIGLGETHGQATEGLLKRWDEHCERNPDAESGY
FT                   MQELIEEGSAQVVEMEPGSAVIYGLDG"
FT   gene            115050..115607
FT                   /locus_tag="SNSL254_pSN254_0134"
FT   CDS_pept        115050..115607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACR8"
FT                   /protein_id="ABO41019.1"
FT                   /translation="MSNFEQALERTDGKTLILSNGSKWAGQDPDSIQTLLDVLGDNVLD
FT                   PMFEQYHCYRPYPFEPMVRTGRNGEMFQPWLGAACFFGNFLTVSHVFNIITKDDGVVEA
FT                   LTEAIRKNMATEQYQQNAYERYAGWFYAETSEGLRLVSPSEAADIRAGAVSKLRYPRNF
FT                   EVMKTAVLKGPRFDTELSRKAS"
FT   gene            115649..116533
FT                   /locus_tag="SNSL254_pSN254_0135"
FT   CDS_pept        115649..116533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAK16082.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41112"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC73"
FT                   /protein_id="ABO41112.1"
FT                   /translation="MVSPSEIKEIPMIKQHFQNELVKCGYPDDLTIEYSLGYCQGDGVA
FT                   FYGDLSVDDVKALMNRLFSTEPGQVDAVSRVKNLMAQKDIENMLSVLREYGSCDLSITR
FT                   NSHGHHYSHWNCMNIDDNVDFTGIFPDDDSMIGTGIEGINQDMVERWQDLWERFVLELA
FT                   DDVKSLSKKLEADGYSLIEASPCEDEVVWERATENYLVRVTELPERDFDMGHWDDEVRD
FT                   QTICSILEGKERVLGLRVEVLSRENEIVLGEESLHGLTVASDDKSYAGYRRELLRGAIQ
FT                   QTRDFFSRHLKAA"
FT   gene            116992..117378
FT                   /locus_tag="SNSL254_pSN254_0136"
FT   CDS_pept        116992..117378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0136"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41114"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD05"
FT                   /protein_id="ABO41114.1"
FT                   /translation="MNQVAKLDLAQIRQQAINDGLLVDQSSIGKQAGFLTNVAVTPAIV
FT                   DGVFGADGKHSVEDFLFMFLQLCVAQTKVAFTDNKNWGKIRLYYPMPTVDGFFKPTEVV
FT                   IKSDPVTADVTIMMASEEGAHLCL"
FT   gene            117556..119283
FT                   /locus_tag="SNSL254_pSN254_0137"
FT   CDS_pept        117556..119283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM08013.1; match to
FT                   protein family HMM PF08273"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41201"
FT                   /db_xref="GOA:A0A0H3ADI0"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADI0"
FT                   /protein_id="ABO41201.1"
FT                   /translation="MSYYKADTVREAANGNWLFILAALAPHLEPALRKPGRHVSCPIHG
FT                   GKDGFRLFKDAHLTGGGVCNTCGANHDGFELLMWLNNWDFKQCLSEVGDYLGVEKEQPQ
FT                   YQQAAAPTRAPVQAKAPVQQEPMKVNNKVLDSKNRKKSIAGTLIAHGKAPYEHNEDNEL
FT                   SYFAFIRDKSGLERTIWGVDLERAIGESEAKYGDEIVMTNLGREPVTVVVEVKDEQGNV
FT                   VREQPMQTHRNTWLVERRGATVTQFRARSNGGVEPVSHHVESAPVVNRKVETPAPQVQP
FT                   AATQPEEQSSENKPKVVPMFREQPKPWLLELQEEMEKRMERERAYSARLREKIEKVWNE
FT                   CLPFSSHVTEPMRLYFKNRELLFKVDEVEKTDCLRFNPAMAYYDEDGNEVGKFPAIVCA
FT                   IRDVEGNLVTLHRTYLTQNGKKAKVGNAKKMMPIPDGLDVNGAAIRLGEPTEGILGVAE
FT                   GLETALSAYRVTQIPVWSTVNATLMESFEVPEGVHTVLIWADKDKSVTGEKSANVLKAK
FT                   LEKRGIRVYVLLPKLPIPPRAKGIDWNDVLMSQGSLGFPNARYLRDFIARRRAEYGRH"
FT   gene            119270..119548
FT                   /locus_tag="SNSL254_pSN254_0138"
FT   CDS_pept        119270..119548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41135"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AED8"
FT                   /protein_id="ABO41135.1"
FT                   /translation="MAVIDVSKVDTTPGNDAVCPFSPPEGWEGDSAAYVELMRSRYRHL
FT                   MHGQRMMVTASFARREPIQVTGPFADEATKIINSMKMNKAKPTALSA"
FT   gene            119621..119842
FT                   /locus_tag="SNSL254_pSN254_0139"
FT   CDS_pept        119621..119842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0139"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEK7"
FT                   /protein_id="ABO41185.1"
FT                   /translation="MKKFLRIKTWFVRLFSPDKKTLGAIGEDLRKVAVTAIGVGIVGVV
FT                   SENGIYGHSRFCNTDFDDKLACLNLSGV"
FT   mobile_element  119770..121088
FT                   /mobile_element_type="insertion sequence:IS4321R"
FT   repeat_region   119770..119783
FT                   /rpt_type=INVERTED
FT   gene            complement(120024..121028)
FT                   /gene="insD1"
FT                   /locus_tag="SNSL254_pSN254_0140"
FT   CDS_pept        complement(120024..121028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insD1"
FT                   /locus_tag="SNSL254_pSN254_0140"
FT                   /product="transposase InsD1 for insertion sequence IS4321R"
FT                   /note="identified by match to protein family HMM PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41165"
FT                   /db_xref="GOA:A0A0H3AEH9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEH9"
FT                   /protein_id="ABO41165.1"
FT                   /translation="MENIALIGIDLGKNSFHIHCQDHRGKAVYRKKFTRPKLIEFLATC
FT                   PATTIAMEACGGSHFMARKLEELGHFPKLISPQFVRPFVKSNKNDFVDAEAICEAASRP
FT                   SMRFVQPRTESQQAMRALHRVRESLVQDKVKTTNQMHAFLLEFGISVPRGAAVISRLST
FT                   LLEDSSLPLYLSQLLLKLQQHYHYLVEQIKDLESQLKRKLDEDEVGQRLLSIPCVGTLT
FT                   ASTISTEIGDGKQYASSRDFAAATGLVPRQYSTGGRTTLLGISKRGNKKIRTLLVQCAR
FT                   VFIQKLEHQSGKLADWVRELLCRKSNFVVTCALANKLARIAWALTARQQTYEA"
FT   repeat_region   121077..121088
FT                   /rpt_type=INVERTED
FT   gene            complement(121107..124079)
FT                   /gene="tnpA"
FT                   /locus_tag="SNSL254_pSN254_0141"
FT   CDS_pept        complement(121107..124079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="SNSL254_pSN254_0141"
FT                   /product="transposase TnpA for transposon Tn21"
FT                   /note="identified by match to protein family HMM PF01526"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41094"
FT                   /db_xref="GOA:A0A0H3ACY3"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACY3"
FT                   /protein_id="ABO41094.1"
FT                   /translation="MPRRSILSATERESLLALPDAKDELIRHYTFNETDLSVIRQRRGA
FT                   ANRLGFAVQLCYLRFPGTFLGVDEPPFPPLLRMVAAQLKMPVESWSEYGQREQTRREHL
FT                   VELQTVFGFKPFTMSHYRQAVHTLTELALQTDKGIVLASALVENLRRQSIILPAMNAIE
FT                   RASAEAITRANRRIYAALTDSLLSPHRQRLDELLKRKDGSKVTWLAWLRQSPAKPNSRH
FT                   MLEHIERLKSWQALDLPAGIERQVHQNRLLKIAREGGQMTPADLAKFEVQRRYATLVAL
FT                   AIEGMATVTDEIIDLHDRIIGKLFNAAKNKHQQQFQASGKAINDKVRMYGRIGQALIEA
FT                   KQSGSDPFAAIEAVMPWDTFAASVTEAQTLARPADFDFLHHIGESYATLRRYAPQFLGV
FT                   LKLRAAPAAKGVLDAIDMLRGMNSDSARKVPADAPTAFIKPRWAKLVLTDDGIDRRYYE
FT                   LCALSELKNALRSGDVWVQGSRQFKDFDEYLVPVEKFATLKLASELPLAVATDCDQYLH
FT                   DRLELLEAQLATVNRMAAANDLPDAIITTASGLKITPLDAAVPDAAQAMIDQTAMLLPH
FT                   LKITELLMEVDEWTGFTRHFTHLKTSDTAKDKTLLLTTILADAINLGLTKMAESCPGTT
FT                   YAKLSWLQAWHIRDETYSTALAELVNAQFRQPFAGNWGDGTTSSSDGQNFRTGSKAEST
FT                   GHINPKYGSSPGRTFYTHISDQYAPFSAKVVNVGIRDSTYVLDGLLYHESDLRIEEHYT
FT                   DTAGFTDHVFGLMHLLGFRFAPRIRDLGETKLFIPKGDAAYDALKPMISSDRLNIKQIR
FT                   AHWDEILRLATSIKQGTVTASLMLRKLGSYPRQNGLAVALRELGRIERTLFILDWLQSV
FT                   ELRRRVHAGLNKGEARNALARAVFFYRLGEIRDRSFEQQRYRASGLNLVTAAIVLWNTV
FT                   YLERATSALRGNGTALDDTLLQYLSPLGWEHINLTGDYLWRSSAKVGAGKFRPLRPLPP
FT                   A"
FT   mobile_element  121112..148294
FT                   /mobile_element_type="transposon:Tn21"
FT   gene            complement(124082..124699)
FT                   /pseudo
FT                   /locus_tag="SNSL254_pSN254_0142"
FT                   /note="resolvase TnpR for transposon Tn21, truncation;
FT                   identified by match to protein family HMM PF00239; match to
FT                   protein family HMM PF02796"
FT   gene            complement(124945..125958)
FT                   /gene="intI1"
FT                   /locus_tag="SNSL254_pSN254_0143"
FT   CDS_pept        complement(124945..125958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="intI1"
FT                   /locus_tag="SNSL254_pSN254_0143"
FT                   /product="integrase IntI1 for transposon Tn21"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899; match to protein
FT                   family HMM TIGR02249"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41086"
FT                   /db_xref="GOA:A0A0H3AD25"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011946"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD25"
FT                   /protein_id="ABO41086.1"
FT                   /translation="MKTATAPLPPLRSVKVLDQLRERIRYLHYSLRTEQAYVNWVRAFI
FT                   RFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQEI
FT                   GRPRPSRRLPVVLTPDEVVRILGFLEGEHRLFAQLLYGTGMRISEGLQLRVKDLDFDHG
FT                   TIIVREGKGSKDRALMLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALERKYPR
FT                   AGHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATPHTLRH
FT                   SFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDALPPLTSER"
FT   gene            125888..126895
FT                   /gene="aadA"
FT                   /locus_tag="SNSL254_pSN254_0144"
FT   CDS_pept        125888..126895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aadA"
FT                   /locus_tag="SNSL254_pSN254_0144"
FT                   /product="aminoglycoside adenylyltransferase"
FT                   /note="identified by match to protein family HMM PF01909"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41095"
FT                   /db_xref="GOA:A0A0H3AE82"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR025184"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE82"
FT                   /protein_id="ABO41095.1"
FT                   /translation="MRSRNWSRTLTERSGGNGAVAVFMACYDCFFVQSMPRASKQQARY
FT                   AVGRCLMLWSSNDVTQQGSRPKTKLDIMRVAVTIEISNQLSEVLSVIERHLEPTLLAVH
FT                   LYGSAVDGGLKPHSDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIV
FT                   VHDDIIPWRYPAKRELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAA
FT                   EELFDPVPEQDLFEALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAA
FT                   DWAMERLPAQYQPVILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
FT   repeat_region   126950..127062
FT                   /rpt_type=DIRECT
FT   gene            127059..127961
FT                   /gene="aacC"
FT                   /locus_tag="SNSL254_pSN254_0145"
FT   CDS_pept        127059..127961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aacC"
FT                   /locus_tag="SNSL254_pSN254_0145"
FT                   /product="aminoglycoside 3-N-acetyltransferase"
FT                   /note="identified by similarity to GB:AAA16194.1; match to
FT                   protein family HMM PF02522"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41023"
FT                   /db_xref="GOA:A0A0H3ACJ2"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACJ2"
FT                   /protein_id="ABO41023.1"
FT                   /translation="MMTDPRKNGDLHEPATAPATPWSKSELVRQLRDLGVRSGDMVMPH
FT                   VSLRAVGPLADGPQTLVDALIEAVGPTGNILAFVSWRDSPYEQTLGHDAPPAAIAQSWP
FT                   AFDPDHAPAYPGFGAINEFIRTYPGCRRSAHPDASMAAIGPDAAWLVAPHEMGAAYGPR
FT                   SPIARFLAHAGKILSIGAGPDAVTALHYAEAVARIEGKRRVTYSMPLLREGKRVWVTTS
FT                   DWDSNGILDEYAAPDGPDAVERIARDYLARTRVAQGPVGGAQSRLIDAADIVSFGIEWL
FT                   EARHAAPAAAALKPKQRRD"
FT   gene            128168..128488
FT                   /gene="groS"
FT                   /locus_tag="SNSL254_pSN254_0146"
FT   CDS_pept        128168..128488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="SNSL254_pSN254_0146"
FT                   /product="10 kDa chaperonin GroS"
FT                   /note="identified by similarity to SP:P31295; match to
FT                   protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41128"
FT                   /db_xref="GOA:A0A0H3ACX8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACX8"
FT                   /protein_id="ABO41128.1"
FT                   /translation="MGSPTRKICAAINIKPLYDRVVIKRTEEEKVSAGGIVIPDSATEK
FT                   PIKGQVVAVGEGKVFDNGNVRAPKVKVGDQVLFGKYAGTEVKLDGTEYLVVKEDDIFAV
FT                   LG"
FT   gene            128544..130181
FT                   /gene="groL"
FT                   /locus_tag="SNSL254_pSN254_0147"
FT   CDS_pept        128544..130181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="SNSL254_pSN254_0147"
FT                   /product="60 kDa chaperonin GroL"
FT                   /note="identified by match to protein family HMM PF00118;
FT                   match to protein family HMM TIGR02348"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41063"
FT                   /db_xref="GOA:A0A0H3ACP0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACP0"
FT                   /protein_id="ABO41063.1"
FT                   /translation="MAAKDIRFGEDARARMVRGVNVLANAVKATLGPKGRNVVLEKSFG
FT                   APTITKDGVSVAKEIELADKFENMGAQMVKEVASKTSDNAGDGTTTATVLAQALIREGM
FT                   KAVAAGMNPMDLKRGIDKAVTSAVEELKKISKPCSTSKEIAQVGSISANSDTDIGELIA
FT                   KAMDKVGKEGVITVEEGSGLENELDVVEGMQFDRGYLSPYFINNPQSMQAELEDPFILL
FT                   HDKKISNVRDLLPILEGVAKAGKPLLIVAEDVEGEALATLVVNTIRGIVKVCAVKAPGF
FT                   GDRRKAMLEDMAILTGGTVISEEVGLSLEKATINDLGRAKKVQVSKENTTIIDGAGDTA
FT                   DIEARIKQIKAQIEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGIVPGGGVALIRAKAAIAELKGANEDQNHGIAIALRAMEAPLREIVTNA
FT                   GDEPSVVLNRVAEGTGAFGYNAANGEFGDMIEFGILDPTKVTRSALQNAASIAGLMITT
FT                   EAMVAEAPKKEEPAAPGGGMGGMGGMDF"
FT   gene            130370..131899
FT                   /gene="insE"
FT                   /locus_tag="SNSL254_pSN254_0148"
FT   CDS_pept        130370..131899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insE"
FT                   /locus_tag="SNSL254_pSN254_0148"
FT                   /product="transposase InsE"
FT                   /note="identified by match to protein family HMM PF04986"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41075"
FT                   /db_xref="GOA:A0A0H3AE55"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE55"
FT                   /protein_id="ABO41075.1"
FT                   /translation="MPRLTAPRRQAEVCAPLPAAHAAARYARHLPERTLLYALVQAHYP
FT                   DFIARLEAEDRPLPEYVREEFETYLRCGVLEHGFLRVVCEQCRAERLVAFSCKKRGFCP
FT                   SCGARRMAESARHLVEEVFGPRPVRQWVLSFPYPLRFLFASKPEAIGPVLGIVHRVIAG
FT                   WLADQAGVDHASAQCGAVTLIQRFGSALNLNVHFHMLWLDGVYEDTTERPQRKPRLHRT
FT                   RAPTSAQLTELAGTIAHRVCRHLSRRGWLEGEDESVFLSDSAGSDDGMDGLRMSSMTYR
FT                   IATGRDAGRKVVTLQTLPGDAGSLEGDAGKVGGFSLHAGVAAEAHESHKLEKLCRYITR
FT                   PAISEQRLSISPQGRVRYQLKTPWRNGTTHVEWDAVDFIAKLAALVPPPRAHLTRFHGV
FT                   FAPNANLRAQLTPSGRGRRPAGDAVPVDASAHDEPRSPEQKRRAMSWAQRLKRVFSIDV
FT                   TTCAHCGGAVRIVASIEDPKAIRAILAHFEKHGALEQAHYRPAARAPPPAA"
FT   gene            132167..133402
FT                   /gene="insF"
FT                   /locus_tag="SNSL254_pSN254_0149"
FT   CDS_pept        132167..133402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insF"
FT                   /locus_tag="SNSL254_pSN254_0149"
FT                   /product="transposase InsF"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41131"
FT                   /db_xref="GOA:A0A0H3AD87"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD87"
FT                   /protein_id="ABO41131.1"
FT                   /translation="MPRKKKTPVVTPAIDLPKEFLEKLIPGPMDAAGVEAVFQQLKKAV
FT                   IERALGAELGLHLADAEGGSGNHRNGRSGKTVLTDEGPLRIDVPRDRTGTFEPQLIPKH
FT                   ERRFAGFDDRIVSMYARGMTVREIQGHLAEMYSVEVSPEFISKVTDEVMAEVTAWQARP
FT                   LEAMYPVVFFDALRVKIREDGVVRNKAVYLALGVLADGTRDILGLWIENTEGAKFWMKV
FT                   FNDLKTRGVNDILIGVADGLKGFPEALEAVFPATTLQTCIVHLIRNSLDYAGWKDRKAL
FT                   AAAIKPIYTAPTAEAAEAELDAFEAGDWGERFPTVVAAWRRAWTRVVPFFAFPPDVRRV
FT                   IYTTNAIESVHARLRKIIKTRGHFPSDEAATKLIWLALRNITAEWSRASQHWKAAMNQF
FT                   AIIYEDRFTLAR"
FT   repeat_region   133511..133623
FT                   /rpt_type=DIRECT
FT   gene            133620..133967
FT                   /gene="qacEdelta1"
FT                   /locus_tag="SNSL254_pSN254_0150"
FT   CDS_pept        133620..133967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qacEdelta1"
FT                   /locus_tag="SNSL254_pSN254_0150"
FT                   /product="quaternary ammonium compound-resistance protein
FT                   QacEdelta1"
FT                   /note="identified by similarity to SP:P0AGC9; match to
FT                   protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41040"
FT                   /db_xref="GOA:A0A0H3AE23"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE23"
FT                   /protein_id="ABO41040.1"
FT                   /translation="MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFY
FT                   FLSLVLKSIPVGVAYAVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIIAAFLLARSP
FT                   SWKSLRRPTPW"
FT   gene            133961..134800
FT                   /gene="sul1"
FT                   /locus_tag="SNSL254_pSN254_0151"
FT   CDS_pept        133961..134800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sul1"
FT                   /locus_tag="SNSL254_pSN254_0151"
FT                   /product="dihydropteroate synthase 1"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41168"
FT                   /db_xref="GOA:A0A0H3AD34"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD34"
FT                   /protein_id="ABO41168.1"
FT                   /translation="MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVG
FT                   PAASHPDARPVSPADEIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQ
FT                   GFPDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSALRRS
FT                   GVAADRLILDPGMGFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLP
FT                   VKDLGPASLAAELHAIGNGADYVRTHAPGDLRSAITFSETLAKFRSRDARDRGLDHA"
FT   gene            134928..135428
FT                   /locus_tag="SNSL254_pSN254_0152"
FT   CDS_pept        134928..135428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0152"
FT                   /product="conserved hypothetical protein ORF5"
FT                   /note="identified by similarity to GB:AAZ95875.1; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41177"
FT                   /db_xref="GOA:A0A0H3ACD3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACD3"
FT                   /protein_id="ABO41177.1"
FT                   /translation="MDSEEPPNVRVACSGDIDEVVRLMHDAAAWMSAKGTPAWDVARID
FT                   RTFAETFVLRSELLVASCSDGIVGCCTLSAEDPEFWPDALKGEAAYLHKLAVRRTHAGR
FT                   GVSSALIEACRHAARTQGCAKLRLDCHPNLRGLYERLGFTHVDTFNPGWDPTFIAERLE
FT                   LEI"
FT   gene            135452..135739
FT                   /locus_tag="SNSL254_pSN254_0153"
FT   CDS_pept        135452..135739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE50482.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41184"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD85"
FT                   /protein_id="ABO41184.1"
FT                   /translation="MSGWDGPVASRSLAVRPRCLGCARGCRYPPLPSSTLDNAAAVIAA
FT                   DARAGLFGPVRLARPSACLGEISGGRINGGASPPFVRVKAEDSSLKNIRL"
FT   gene            complement(135963..136745)
FT                   /gene="istB"
FT                   /locus_tag="SNSL254_pSN254_0154"
FT   CDS_pept        complement(135963..136745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="istB"
FT                   /locus_tag="SNSL254_pSN254_0154"
FT                   /product="transposition protein IstB for insertion sequence
FT                   IS1326"
FT                   /note="identified by match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41199"
FT                   /db_xref="GOA:A0A0H3ADA3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADA3"
FT                   /protein_id="ABO41199.1"
FT                   /translation="MQHEGHVRILKSLKLFGMAHAIEELGNQNSPAFNQALPMLDSLIK
FT                   AEVAEREVRSVNYQLRVAKFPVYRDLVGFDFSQSLVNEATVKQLHRCDFMEQAQNVVLI
FT                   GGPGTGKTHLATAIGTQAVMHLNRRVRFFSTVDLVNALEQEKSSGRQGQIANRLLYADL
FT                   VILDELGYLPFSQTGGALLFHLLSKLYEKTSVILTTNLSFSEWSRVFGDEKMTTALLDR
FT                   LTHHCHILETGNESYRFKHSSTQNKQEEKQTRKLKIET"
FT   gene            complement(136735..138258)
FT                   /gene="istA"
FT                   /locus_tag="SNSL254_pSN254_0155"
FT   CDS_pept        complement(136735..138258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="istA"
FT                   /locus_tag="SNSL254_pSN254_0155"
FT                   /product="transposase IstA for insertion sequence IS1326"
FT                   /note="identified by similarity to SP:Q46087; match to
FT                   protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41074"
FT                   /db_xref="GOA:A0A0H3ACX1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACX1"
FT                   /protein_id="ABO41074.1"
FT                   /translation="MINVAILSAIRRWHFRDGASIREIARRSGLSRNTVRKYLQSKVVE
FT                   PQYPARDSVGKLSPFEPKLRQWLSTEHKKTKKLRRNLRSMYRDLVALGFTGSYDRVCAF
FT                   ARQWKDSEQFKAQTSGKGCFIPLRFACGEAFQFDWSEDFARIAGKQVKLQIAQFKLAHS
FT                   RAFVLRAYYQQKHEMLFDAHWHAFQIFGGIPKRGIYDNMKTAVDSVGRGKERRVNQRFT
FT                   AMVSHYLFDAQFCNPASGWEKGQIEKNVQDSRQRLWQGAPDFQSLADLNVWLEHRCKAL
FT                   WSELRHPELDQTVQEAFADEQGELMALPNAFDAFVEQTKRVTSTCLVHHEGNRYSVPAS
FT                   YANRAISLRIYADKLVMAAEGQHIAEHPRLFGSGHARRGHTQYDWHHYLSVLQKKPGAL
FT                   RNGAPFAELPPAFKKLQSILLQRPGGDRDMVEILALVLHHDEGAVLSAVELALECGKPS
FT                   KEHVLNLLGRLTEEPPPKPIPIPKGLRLTLEPQANVNRYDSLRRAHDAA"
FT   mobile_element  138340..139953
FT                   /mobile_element_type="transposon:IS1353"
FT   repeat_region   138340..138351
FT                   /rpt_type=DIRECT
FT   gene            138381..139925
FT                   /gene="insG"
FT                   /locus_tag="SNSL254_pSN254_0156"
FT   CDS_pept        138381..139925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insG"
FT                   /locus_tag="SNSL254_pSN254_0156"
FT                   /product="transposase InsG for insertion sequence IS1353"
FT                   /note="identified by match to protein family HMM PF00665;
FT                   match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41118"
FT                   /db_xref="GOA:A0A0H3ACW1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACW1"
FT                   /protein_id="ABO41118.1"
FT                   /translation="MYSYEDRLRAVRLYLKLGRRMSATLRQLGYPTKNSLKAWLAEFER
FT                   NQDLRRGYQRIKRQYTDEQKQRAVDHYIEQGYCLSHTIRSLGYPSREALRAWIRDLRPE
FT                   FARTVVGSSAPTVARSRLEKQQAVIALNLRVGSAKDVADTVGVSRPTLYNWQHRLLGKV
FT                   PLKPMTKKKGDTSLEQRHEALLRELAELESQNQRLRMENAILEKASELIKKDMGINPLE
FT                   LTSREKTKVVDALRVTFPLANLLCGLKLARSTYFYQRLRQTRPDKYTQVREVIRTIFED
FT                   NYRCYGYRRIDSALRLGGMRVSEKVVRRLMAQERLVVRTPRRRRFSAYAGDPTPAVPNL
FT                   LNRDFHASAPNTKWLTDLTEIHIPAGKVYVSPIVDCFDGLVVAWNIGTSPDANLVNTML
FT                   DHAVRTLRPGEHPVIHSDRGSHYRWPAWIRRTENAQLTRSMSKKGCSPDNAACEGFFGR
FT                   LKTELIYPRNWQHVTLKDLMTRIDAYIHWYNERRIKVSLGGRSPIEYRHAVGLMSV"
FT   repeat_region   139941..139953
FT                   /rpt_type=DIRECT
FT   gene            complement(139976..140836)
FT                   /gene="tniB"
FT                   /locus_tag="SNSL254_pSN254_0157"
FT   CDS_pept        complement(139976..140836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tniB"
FT                   /locus_tag="SNSL254_pSN254_0157"
FT                   /product="transposition protein TniB"
FT                   /note="identified by match to protein family HMM PF05621"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41105"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE98"
FT                   /protein_id="ABO41105.1"
FT                   /translation="MDEYPIIDLSHLLPAAQGLARLPADERIQRLRADRWIGYPRAVEA
FT                   LNRLEALYAWPNKQRMPNLLLVGPTNNGKSMIVEKFRRTHPASSDADQEHIPVLVVQMP
FT                   SEPSVIRFYVALLAAMGAPLRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVLAGNSV
FT                   NRREFLNLLRFLGNELRIPLVGVGTRDAYLAIRSDDQLENRFEPMMLPVWEANDDCCSL
FT                   LASFAASLPLRRPSPIATLDMARYLLTRSEGTIGELAHLLMAAAIVAVESGEEAINHRT
FT                   LSMAC"
FT   gene            complement(140839..141321)
FT                   /pseudo
FT                   /locus_tag="SNSL254_pSN254_0158"
FT                   /note="transposase TniA for transposition module tni,
FT                   truncation"
FT   mobile_element  141275..142094
FT                   /mobile_element_type="insertion sequence:IS26"
FT   repeat_region   141275..141288
FT                   /rpt_type=INVERTED
FT   gene            complement(141327..142049)
FT                   /gene="insB3"
FT                   /locus_tag="SNSL254_pSN254_0159"
FT   CDS_pept        complement(141327..142049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB3"
FT                   /locus_tag="SNSL254_pSN254_0159"
FT                   /product="transposase InsB3 for insertion sequence IS26"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41100"
FT                   /db_xref="GOA:A0A0H3ACU1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACU1"
FT                   /protein_id="ABO41100.1"
FT                   /translation="MLMELHMNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERG
FT                   VNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSR
FT                   GRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCP
FT                   SDVEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAF
FT                   YYGDPLGEMRLVSRVFEM"
FT   repeat_region   142081..142094
FT                   /rpt_type=INVERTED
FT   gene            complement(142094..142816)
FT                   /gene="insB4"
FT                   /locus_tag="SNSL254_pSN254_0160"
FT   CDS_pept        complement(142094..142816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB4"
FT                   /locus_tag="SNSL254_pSN254_0160"
FT                   /product="transposase InsB4 for insertion sequence IS26"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41130"
FT                   /db_xref="GOA:A0A0H3AED1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AED1"
FT                   /protein_id="ABO41130.1"
FT                   /translation="MLMELHMNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERG
FT                   VNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSR
FT                   GRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCP
FT                   SDVEHRQIKYRNNVIECDHGKLKRIINATLGFKSMKTAYATIKGIEVMRALRKGQASAF
FT                   YYGDPLGEMRLVSRVFEM"
FT   mobile_element  142095..142861
FT                   /mobile_element_type="insertion sequence:IS26"
FT   repeat_region   142848..142861
FT                   /rpt_type=INVERTED
FT   gene            complement(143008..143997)
FT                   /gene="urf2"
FT                   /locus_tag="SNSL254_pSN254_0161"
FT   CDS_pept        complement(143008..143997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="urf2"
FT                   /locus_tag="SNSL254_pSN254_0161"
FT                   /product="EAL domain protein Urf2"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41077"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR021767"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC36"
FT                   /protein_id="ABO41077.1"
FT                   /translation="MSASQPIEWTVAQLAQAVERGQLELHYQPIVDLRSEQIVGAEALL
FT                   RWRHPTLGLLPPGQFLPVIESSGLMPEIGAWVLGAACRQMRDWRVLAWQPFRLAVNVSA
FT                   SQVGPDFDKWVKGVLADAGLPAAYLEIELTESVAFGDPAIFPALEALRQIGVRFAADDF
FT                   GTGYSCLQHLKCCPISTLKIDQSFVAGLANDHRDQTIVRTVIQLAHGLGMEVVAEGVET
FT                   SASLDLLRQADCDTGQGFLFAKPMPAAAFAVFVSQWRGATMNANDPTATSCCVCCKEIP
FT                   LDAAFTPEGAEYVEHFCGLECYQRFQARAKTGSETDADPNACDSSLSD"
FT   gene            complement(143994..144230)
FT                   /gene="merE"
FT                   /locus_tag="SNSL254_pSN254_0162"
FT   CDS_pept        complement(143994..144230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merE"
FT                   /locus_tag="SNSL254_pSN254_0162"
FT                   /product="mercuric resistance protein MerE"
FT                   /note="identified by match to protein family HMM PF05052"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41071"
FT                   /db_xref="GOA:A0A0H3AD06"
FT                   /db_xref="InterPro:IPR007746"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD06"
FT                   /protein_id="ABO41071.1"
FT                   /translation="MNSPERMPAETHKPFTGYLWGALAVLTCPCHLPILAIVLAGTTAG
FT                   AFIGEHWGIAALTLTGLFVLSVTRLLRAFRGRS"
FT   gene            complement(144227..144592)
FT                   /gene="merD"
FT                   /locus_tag="SNSL254_pSN254_0163"
FT   CDS_pept        complement(144227..144592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merD"
FT                   /locus_tag="SNSL254_pSN254_0163"
FT                   /product="mercuric resistence transcriptional repressor
FT                   protein MerD"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM TIGR02054"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41143"
FT                   /db_xref="GOA:A0A0H3AD02"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD02"
FT                   /protein_id="ABO41143.1"
FT                   /translation="MNAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTTGGYGLFDDA
FT                   ALQRLCFVRAAFEAGIGLGALARLCRALDAANCDETAAQLAVLRQFVERRREALANLEV
FT                   QLAAMPTAPAQHAESLP"
FT   gene            complement(144704..145342)
FT                   /gene="merB"
FT                   /locus_tag="SNSL254_pSN254_0164"
FT   CDS_pept        complement(144704..145342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merB"
FT                   /locus_tag="SNSL254_pSN254_0164"
FT                   /product="alkylmercury lyase MerB"
FT                   /EC_number="4.99.1.2"
FT                   /note="identified by match to protein family HMM PF03243"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41205"
FT                   /db_xref="GOA:A0A0H3AEN5"
FT                   /db_xref="InterPro:IPR004927"
FT                   /db_xref="InterPro:IPR024259"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEN5"
FT                   /protein_id="ABO41205.1"
FT                   /translation="MKLAPYILERLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGI
FT                   LDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFP
FT                   ALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVH
FT                   FFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSSRTP"
FT   gene            complement(145357..147042)
FT                   /gene="merA"
FT                   /locus_tag="SNSL254_pSN254_0165"
FT   CDS_pept        complement(145357..147042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merA"
FT                   /locus_tag="SNSL254_pSN254_0165"
FT                   /product="mercuric reductase MerA"
FT                   /EC_number="1.16.1.1"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF01266; match to protein family HMM PF02852;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR02053"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41106"
FT                   /db_xref="GOA:A0A0H3AD53"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR021179"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD53"
FT                   /protein_id="ABO41106.1"
FT                   /translation="MTHLKITGMTCDSCAAHVKEALEKVPGVQSAIVSYAKGAAQLALD
FT                   PGTAPDALTAAVAGLGYKAMLADAPPTDNRTGLFDKVRGWMGAADKGSGGERPLQVAVI
FT                   GSGGAAMAAALKAVEQGAQVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRESPFD
FT                   GGMPPTPPTILRERLLAQQQARVEELRHAKYEGILDGNSAITVLHGEARFKDDQSLIVS
FT                   LNEGGERVVMFDRCLVATGASPAMPPIPGLKESPYWTSTEALVSDTIPERLAVIGSSVV
FT                   ALELAQAFARLGSQVTILARNTLFFRDDPSIGEAVTAAFRAEGIKVLEHTQASQVAHVN
FT                   GEFVLTTGHGEVRADKLLVATGRTPNTRSLALDAAGVTVNAQGAIVIDKGMRTSTPHIY
FT                   AAGDCTDQPQFVYVAAAAGTRAAINMTGGDAAINLTAMPAVVFTDPQVATVGYSEAEAH
FT                   HDGIETDSRTLTLDNVPRALANFDTRGFIKLVIEEGSGRLIGVQVVAPEAGELIQTAVL
FT                   AIRNRMTVQELADQLFPYLTMVEGLKLAAQTFTKDVKQLSCCAG"
FT   gene            complement(147114..147389)
FT                   /gene="merP"
FT                   /locus_tag="SNSL254_pSN254_0166"
FT   CDS_pept        complement(147114..147389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merP"
FT                   /locus_tag="SNSL254_pSN254_0166"
FT                   /product="mercuric transport protein periplasmic component
FT                   MerP"
FT                   /note="identified by match to protein family HMM PF00403;
FT                   match to protein family HMM TIGR02052"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41160"
FT                   /db_xref="GOA:A0A0H3AEH4"
FT                   /db_xref="InterPro:IPR001802"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR011795"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEH4"
FT                   /protein_id="ABO41160.1"
FT                   /translation="MKKLFASLAIAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAIS
FT                   KVEGVSKVNVTFETREAVVTFDDAKTSVQKLTKATEDAGYPSSVKK"
FT   gene            complement(147405..147755)
FT                   /gene="merT"
FT                   /locus_tag="SNSL254_pSN254_0167"
FT   CDS_pept        complement(147405..147755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merT"
FT                   /locus_tag="SNSL254_pSN254_0167"
FT                   /product="mercuric transport protein MerT"
FT                   /note="identified by match to protein family HMM PF02411"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41050"
FT                   /db_xref="GOA:A0A0H3AE32"
FT                   /db_xref="InterPro:IPR003457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE32"
FT                   /protein_id="ABO41050.1"
FT                   /translation="MSEPQNGRGALFTGGLAAILASACCLGPLVLIALGFSGAWIGNLT
FT                   VLEPYRPIFIGAALVALFFAWRRIYRPAQACKPGDVCAIPQVRATYKLIFWVVAALVLV
FT                   ALGFPYVMPFFY"
FT   gene            147827..148261
FT                   /gene="merR"
FT                   /locus_tag="SNSL254_pSN254_0168"
FT   CDS_pept        147827..148261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merR"
FT                   /locus_tag="SNSL254_pSN254_0168"
FT                   /product="Hg(II)-responsive transcriptional regulator MerR"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF09278; match to protein
FT                   family HMM TIGR02051"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41161"
FT                   /db_xref="GOA:A0A0H3ADC8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011794"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADC8"
FT                   /protein_id="ABO41161.1"
FT                   /translation="MEKNLENLTIGVFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIRR
FT                   YGEADVTRVRFVKSAQRLGFSLDEIAELLRLDDGTHCEEASSLAEHKLQDVREKMTDLA
FT                   RMETVLSELVFACHARQGNVSCPLIASLQGEKEPRGADAV"
FT   mobile_element  148304..149617
FT                   /mobile_element_type="insertion sequence:IS4321L"
FT   repeat_region   148304..148312
FT                   /rpt_type=INVERTED
FT   gene            148361..149365
FT                   /gene="insD2"
FT                   /locus_tag="SNSL254_pSN254_0169"
FT   CDS_pept        148361..149365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insD2"
FT                   /locus_tag="SNSL254_pSN254_0169"
FT                   /product="transposase InsD2 for insertion sequence IS4321L"
FT                   /note="identified by match to protein family HMM PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41076"
FT                   /db_xref="GOA:A0A0H3AD12"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD12"
FT                   /protein_id="ABO41076.1"
FT                   /translation="MENIALIGIDLGKNSFHIHCQDRRGKAVYRKKFTRPKLIEFLATC
FT                   PATTIAMEACGGSHFMARKLEELGHSPKLISPQFVRPFVKSNKNDFVDAEAICEAASRP
FT                   SMRFVQPRTESQQAMRALHRVRESLVQDKVKTTNQMHAFLLEFGISVPRGAAVISRLST
FT                   ILEDNSLPLYLSQLLLKLQQHYHYLVEQIKDLESQLKRKLDEDEVGQRLLSIPCVGTLT
FT                   ASTISTEIGDGKQYASSRDFAAATGLVPRQYSTGGRTTLLGISKRGNKKIRTLLVQCAR
FT                   VFIQKLEHQSGKLADWVRDLLCRKSNFVVTCALANKLARIAWALTARQQTYVA"
FT   repeat_region   149606..149617
FT                   /rpt_type=INVERTED
FT   gene            149771..149887
FT                   /locus_tag="SNSL254_pSN254_0170"
FT   CDS_pept        149771..149887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0170"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41072"
FT                   /db_xref="GOA:A0A0H3AC33"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AC33"
FT                   /protein_id="ABO41072.1"
FT                   /translation="MDAFTLGMLGLLIFFTVVTGGSLYLYHEKQKEKKHHNA"
FT   gene            149981..150382
FT                   /locus_tag="SNSL254_pSN254_0171"
FT   CDS_pept        149981..150382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0171"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41151"
FT                   /db_xref="InterPro:IPR035087"
FT                   /db_xref="InterPro:IPR038339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADB5"
FT                   /protein_id="ABO41151.1"
FT                   /translation="MTCNGKGDFLKVSNEDAQATAIYLLRAASRPAFWRDVPFDKKLEA
FT                   VDSLNSIGRSPSELTEWINKYLTAEQINKLGTSIRQRRRRGYGVGKSITISDKAHRILK
FT                   RLSEVDGCSLSEVIEKRLARAYKNTWDHK"
FT   gene            150496..151221
FT                   /locus_tag="SNSL254_pSN254_0172"
FT   CDS_pept        150496..151221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL59702.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACU7"
FT                   /protein_id="ABO41049.1"
FT                   /translation="MMTLTTVSKKTSNNSALVFWRVGTKRKGILDVHIDFDHEEADLLA
FT                   ELVAIRYLALDKQVFCREPGAGAGYKLVVSKGAIKKLALGKSTKAFAFKFAACLTGRLK
FT                   GATIEVSQSMEFMDEPGEGNIELLDVDKQAYTQTHDEISTPAIGPVLVTQHAIDQYQAR
FT                   ITSGDPKKPWASLVGRLQHPELQVQPFDEKVARHKARKYGRVDNVEVWGHRDSKFKYLM
FT                   VINDDNQKRVLVTVFERNE"
FT   gene            151462..155607
FT                   /locus_tag="SNSL254_pSN254_0173"
FT   CDS_pept        151462..155607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0173"
FT                   /product="Rhs family protein"
FT                   /note="identified by match to protein family HMM PF03527;
FT                   match to protein family HMM PF05593; match to protein
FT                   family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41053"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACM6"
FT                   /protein_id="ABO41053.1"
FT                   /translation="MSTEVDKMRFNTIIDAHSFMKNYRSGEEQGKGTPVGDALYPVASY
FT                   GDGRYVSRICFKYLGATGDYDPTTCTGDPATVYWRSTYVLPGEMDKTPFLDRDLGLPTT
FT                   TMCVGNPIHLGTGNKFQAELDYQSGGSDPFTFTRYYNSHLPDEELGGWRHTYSRSVEVN
FT                   ASKYGENMVVLHRPEGQQLAFYNSSSVWVPTWKTDDTLTKDATGWRYTQSDGVVEAYDE
FT                   TGRLTGIEKPNGNHITLSYLNGELSSITDGFGRTIQFQYQDGRMVSVTDPAGGSIQYQY
FT                   NSAGKLAEVIYQDNTSRSYLYDDPNAPGLLSGLVDENGNRFATWGYDTQGRAVLSEHAG
FT                   GAEKTQVSYNADGSVSVTNALGHVQRYTYSRHNGMLKPDVVEGAPCTGFVGGKETYVYD
FT                   SKGLVSSITDRAGQKRTFTHNDRGLETTQIDQDGGKVTTDWLPSKSLPAKITEPTRITE
FT                   LTYDTHLRVISRKVTDRSSGASRTWTYTYAPVGTGKPSLLASVDGPRTDVSDVTTFDYD
FT                   DQGNLIRTTNALGQVTQFGDYDANGRAGTIQGVNGVTQTLTYDARGRLVSSTGPEGTTV
FT                   YNYDAVGLLSSLTKPNGATVSYEYDAAHRLVAETDAQGNRRELELNDLGNPVEERLLDA
FT                   LGQTRWIERRIFNEIGWLSSVSDAYSNQSSFSYDVVANLIQETSPSGNTHSYKYDGFHH
FT                   RTQTTDPLGKVTQVLYKDTGDVYRVSDPRSRLTYYSYNGFGEVTQVRSPDTGTTDITYD
FT                   EAGNVATRKTAKGQTTSYSYDALNRIIETSSDVAGESPILYGYDEATSPYGIGRLTSVD
FT                   DGNGVRRFGYTPEGWLAYETWETHGQSLTTQYQYDGAGLVTKITYPSGREVSYTRDSAG
FT                   DVIEVTTTQAGTTTNLASQIERAPFGPVTSMVRGNGISESRTLDLDYRVTGIDAARVHS
FT                   LVYRYTPDSLISAIDDNLSSSVNQSLGYDAVGRITSAEGIYGVLGYGYDATGNRTSITT
FT                   DGLSQSYTINYMNNWLVKAGQTSRSYDANGNLTKQGADTFTYDSQNRLVAATVAGVTVS
FT                   YTYNHLDQRVTKTLNGHTRLLVYDLAGNLIEELDAATGDVLAEYIWLDGTPLGFVQSGQ
FT                   TYQVHVDHLGTPKALTDVSGQVVWKASYSPFGKASIIIQGPTFNLRFPGQYYDAETGFH
FT                   YNWRRYYDPATGRYITSDPLGLIDGVNTYGYVHGNPMSNTDPTGEFAFVGAGIGAGLEL
FT                   LSQLIENNGSWKCVSWSKVGIAGAIGAIGGGWASGVFRHASSGKSWFKLSQKWSNVSPR
FT                   VRKVQGVPRGNELHHWAIQRNGKFGKYVPDSIKNHPWNLKSIPRDIHQNIHGNGPTPYS
FT                   AFGRWWHGTPEWAKVAQASPVSGGLADSINDEGCGCAN"
FT   gene            155597..156019
FT                   /locus_tag="SNSL254_pSN254_0174"
FT   CDS_pept        155597..156019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0174"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACW8"
FT                   /protein_id="ABO41123.1"
FT                   /translation="MQIEFPALLVSSKKRSLFVVASESEFGKCTIQSLRNGYFELMDIY
FT                   DSEGRHYKIDEVASYKPLSPFWYWPVEIVMYGSRLFKANFNAVLISNLDCKELKSELCD
FT                   LAKKYRSNLDSGVGIEKIMEEMESARTIKELIKVFG"
FT   gene            156454..156642
FT                   /locus_tag="SNSL254_pSN254_0175"
FT   CDS_pept        156454..156642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0175"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADG1"
FT                   /protein_id="ABO41186.1"
FT                   /translation="MGLDAAGGSLQDTLSVIGKNVTCSDLNAPFKALLDDKDFTRKHQH
FT                   LSKVLHTWNEVVSQSKP"
FT   gene            complement(156658..157260)
FT                   /locus_tag="SNSL254_pSN254_0176"
FT   CDS_pept        complement(156658..157260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0176"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41148"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD08"
FT                   /protein_id="ABO41148.1"
FT                   /translation="MYKSLEDLMAGIYEMAAPDGIICNEVSKFLAANQVKPEDISSGIW
FT                   FFLWLKSAPKDAKPIQKEIPGFGVVLNMPTYGGTLNEAITGLIENECRQIELAEGHPSL
FT                   EAWVESVLAGRDDGEENEAAANIVDLLNGCHDLLDTAIINYLFKVGKINEQEILSLIYY
FT                   GELCDHSLVGTPFSTLHIPSENNVHERNIIPIKKGAS"
FT   gene            157530..157811
FT                   /locus_tag="SNSL254_pSN254_0177"
FT   CDS_pept        157530..157811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB93677.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACJ8"
FT                   /protein_id="ABO41028.1"
FT                   /translation="MIFDVRATFEVALQTDTHLVLIDLDQGASVTNDADAVIAWLAANL
FT                   EGGIGKRKVYYRDTDGRFDELKVNAGAFAGFAPCSEGQQTTLAGMLGQ"
FT   gene            157830..158117
FT                   /locus_tag="SNSL254_pSN254_0178"
FT   CDS_pept        157830..158117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0178"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41173"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD42"
FT                   /protein_id="ABO41173.1"
FT                   /translation="MLNKNKFEKVLKRILDKNFERCSICRKPFPGPCHTFAGLDSDNKV
FT                   QNVGSCCRTSIVDLRHGGVYTTAPVDTQEGQSQARELLATHPCKGMMGHA"
FT   gene            158110..158646
FT                   /locus_tag="SNSL254_pSN254_0179"
FT   CDS_pept        158110..158646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC41610.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41081"
FT                   /db_xref="GOA:A0A0H3AD18"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD18"
FT                   /protein_id="ABO41081.1"
FT                   /translation="MLSKKVFFISQAEAERLEPVPGAAMISITDPDKSPAALGQWGQLY
FT                   RDSFYDGGYSENTIHTMKAAFRMNYASYIDSSQAEKLSTFLDGLVGSGIDQIFVHCYYG
FT                   ESRSGAVALYLQNKHGFTPNKPITKPNRTVYELLCNPTKFEPLMQSYETQHMEEELPLH
FT                   LKIWDFLLVAVGLRR"
FT   gene            158649..159659
FT                   /locus_tag="SNSL254_pSN254_0180"
FT   CDS_pept        158649..159659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0180"
FT                   /product="phage integrase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41044"
FT                   /db_xref="GOA:A0A0H3ACU3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACU3"
FT                   /protein_id="ABO41044.1"
FT                   /translation="MHDTNNDKEELVSHAKVNVPAEQSIRGELLPSSSSLRNIQDNPAV
FT                   AYLVSLGSKRSRQTMSSFLNIVAKMIGFQNLRDCAWSSMRRHHILAVLEMLGDAGKAPA
FT                   TINTYLSALKGVALEAWTMKQIDTDSFQHIKQVRSVRGSRLPKGRALERHEIRSLFFTC
FT                   ESDSSAKGLRDAAILGVLLGCGLRRSEIVALDMGSMIYKDRALKVLGKGNKERMAYVPG
FT                   GAWKRLDKWVEEVRGTHEGPLFPRIRRFDDVTGERMSDQAIYHILETRRVEAGLEMFAP
FT                   HDLRRTFASSMLDNGEDIVTVKDAMGHSSIATTQKYDRRGDERLKRASQRLDIAD"
FT   gene            159664..160533
FT                   /locus_tag="SNSL254_pSN254_0181"
FT   CDS_pept        159664..160533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0181"
FT                   /product="putative exonuclease"
FT                   /note="identified by match to protein family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41070"
FT                   /db_xref="GOA:A0A0H3AE48"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE48"
FT                   /protein_id="ABO41070.1"
FT                   /translation="MNDEELELARAEAMKADRCFSKGRLRDEFRMKPKPGVEPVSFYKN
FT                   GYGGQFGVYRIADCQPMRRRGCSPASQKQIRAQSILSVKARMRSNLAKASVMAQRWVAL
FT                   EPLVLDTETTGLGERDQVIELAVTDIRGAVLLCTRLRPTVEIDPQAMGVHGITETELSN
FT                   EPTWTQVAPALARLLSGRHLVIFNSSFDSRMLRQTASAFGDQLSWWQEQNCLCAMKLAA
FT                   DAFGSTNRHGTISLADATCEAGVSWKGRAHSAATDAIATADLVTEIAKVQRDLVVQLQE
FT                   LQSKGNLE"
FT   gene            160530..161021
FT                   /locus_tag="SNSL254_pSN254_0182"
FT   CDS_pept        160530..161021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB93565.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41167"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACC6"
FT                   /protein_id="ABO41167.1"
FT                   /translation="MTEQSYGESLKFFSDWQKDPAKRTGLNVQHTLTRGEYPTVSIEIA
FT                   PIRASGSSPDWKSKITVQLTRGELTAFCSVLFGLRSKAEGSYHGDAKNKSFAVYNNGKA
FT                   GVAIILSERGNQLQNFINDDDRMELAVFAVRQLSNAWKVTPSDAIALLRQSAWMDRNLS
FT                   "
FT   gene            161348..162223
FT                   /locus_tag="SNSL254_pSN254_0183"
FT   CDS_pept        161348..162223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0183"
FT                   /product="DNA replication terminus site-binding protein"
FT                   /note="identified by match to protein family HMM PF05472"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41029"
FT                   /db_xref="GOA:A0A0H3ACS7"
FT                   /db_xref="InterPro:IPR008865"
FT                   /db_xref="InterPro:IPR036381"
FT                   /db_xref="InterPro:IPR036384"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACS7"
FT                   /protein_id="ABO41029.1"
FT                   /translation="MAKNFISEQFSAMCRDLTNLSSLIKRLPPRYAKVAAIPPTGKGME
FT                   NEPVNKIVVTEQTGREALELAAHSYRDLHINPDYSQKSARRTVGVLWFSPSRIGVADEI
FT                   AATVERINAAKAGIEEFIISTYPTRQERFEALRADCPGVMTLHLYRQIRCYTNGDIDSI
FT                   RFTWQRKDSLKKPVKEELLQRIREELERSGPDYQLPLEQLIQKIASTPEPYLRERREVK
FT                   VQPVANVMAAGVLKTVTAPMPLIVLQDKDVQLKLLRNFDASEQRKTRSDKAASEILGTF
FT                   GGVTIESFPG"
FT   gene            162385..163425
FT                   /locus_tag="SNSL254_pSN254_0184"
FT   CDS_pept        162385..163425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41153"
FT                   /db_xref="GOA:A0A0H3AD14"
FT                   /db_xref="InterPro:IPR019513"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD14"
FT                   /protein_id="ABO41153.1"
FT                   /translation="MARKLVEFDDVAAAAQKLKDAGKRPTVIAIRDIIGKGSFTTISTY
FT                   LKQWSEEHSLDEELVEVVLPESVMSDAELFLQKIYTVAKASADEQLERERELLRQKEIE
FT                   YQEDMQQAVDMANDATERAELLEEQLEALTNKKSELDAALGKAENSLSLKSAELERSLA
FT                   DIDKLEKRIVELEGKLEAKAADLTRAQDHLEQAKSENRSLSQKLATTEGELEEQKGKSI
FT                   EQTEKLRAAQEQKTSLKEQLENVQAKLAQSQDSLATAKAHGESAERECQRLSGEVEKLD
FT                   AKLSSAEAEARALVQDKGMMAGQLQEKDQQAKSLEQRLNDALTKISGLEQELAKAGKGG
FT                   KKKEEN"
FT   gene            163425..163703
FT                   /locus_tag="SNSL254_pSN254_0185"
FT   CDS_pept        163425..163703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD72"
FT                   /protein_id="ABO41121.1"
FT                   /translation="MARKAKYSEEWRHRAAALQTKIEEAMTLATSSIGDYRWLHRLHSW
FT                   VTEVAQGKAPDWWTDLDCEVSLPREEKRISTFLSTQKKRITLQMCLS"
FT   gene            163712..165223
FT                   /locus_tag="SNSL254_pSN254_0186"
FT   CDS_pept        163712..165223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAG73527.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41045"
FT                   /db_xref="GOA:A0A0H3AE28"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AE28"
FT                   /protein_id="ABO41045.1"
FT                   /translation="MKQLPPDTPEQSLITQYKGPRLVVKAYAGTGKTTTLVKYAHNNLD
FT                   SRILYLAYNRAIRDEAREKFPANVDCKTSHQLAYATIGRGYQHKLSGNLRLTDIAQAVN
FT                   TKNWTFAKDILDTLNAFMCSADMRILYTHFARADTGKVLTSKQERYQIQVVEGAELIWK
FT                   RMTNVQDPFPTVHDCYLKQYQLGMPNLSRRYTTILFDEAQDANPVTSSIVLQQNCKVIL
FT                   VGDRHQQIYRFRGANNALDSKELMNADQLYLTHSFRFGPNVSLVANALLELKGETRPVV
FT                   GRGPADQVLMFLPGDVGHRAILHRTVMGVIETALSATESGAQVFWVGGIDAYQINELQD
FT                   LYWFSMAEPDRVKNKKLLDEYEDYFEYQEVAKATKDPEMMRAVKIINSYDEIPERLTTL
FT                   RRNTVKEEFGADITVSTAHRCKGLEWDFVQLYDDFPDVLDPELDPMARDDEINLLYVAS
FT                   TRAMRILALNSAVEMVIRYITQKRMVEKQMKMAAEATEVEEDTTK"
FT   gene            165346..166374
FT                   /gene="traF"
FT                   /locus_tag="SNSL254_pSN254_0187"
FT   CDS_pept        165346..166374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="SNSL254_pSN254_0187"
FT                   /product="type IV conjugative transfer system protein TraF"
FT                   /note="identified by match to protein family HMM TIGR02740"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41187"
FT                   /db_xref="InterPro:IPR014111"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACE2"
FT                   /protein_id="ABO41187.1"
FT                   /translation="MRETMKKSPLNLLLLAALTLGASHQAWAQDGTRPGFYERKEEGWF
FT                   WYKEEPKEPEKKPEKPKPKPVAEAKPTQPKPAAPLPSGPEMFSAEWFRENLPKYKDLAW
FT                   NNPTVENVRTFLYLQRFAIDRSEQFSDATELAVVGDPFLDEITRRPAATFASQQVDRDA
FT                   GNAKNMLLKSVAERVGIFFFYKSDDDYSDLQAPLIKMLEQGEGFSIIPVSMDGKPLPSG
FT                   LFPHYKTDEGHAKQLGIVTFPAVYLASPDGQFAPIGQGPMSLPELNHRILVAAKRNGWV
FT                   TDEEFNRTRPVLNLENNIAERLASPELGSDLKQLSQASGDKDNFVPPEQLMKYIRDKLQ
FT                   EN"
FT   gene            166376..167809
FT                   /gene="traH"
FT                   /locus_tag="SNSL254_pSN254_0188"
FT   CDS_pept        166376..167809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traH"
FT                   /locus_tag="SNSL254_pSN254_0188"
FT                   /product="type IV conjugative transfer system protein TraH"
FT                   /note="identified by match to protein family HMM PF06122"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41051"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACX3"
FT                   /protein_id="ABO41051.1"
FT                   /translation="MVTHKTLKRSLLALSVAASLVMAPTGAIAANGLQSQMDKLFNEMS
FT                   NTTPPGVYESQRRGVLAGGRFTAKTRIFDENLVSFAPPSWKAGCGGVDLFGGSLSFINA
FT                   DQIVQLLRAVAANAKGYAFQLALDNVFPDGAKWIENFQKKVQALNQHLGNSCQLAQGFV
FT                   NDLTSGMDLKHKTDASITATTSGLYEDFFGSKQETSGKSPLEELKANKPDEYNKMIGNI
FT                   VWKQLKSNNANTWFQYGDNTLLEAIMSLTGTVIIGDLVNDPNSTGTGAKTTPLTTLPGN
FT                   KITLSDLISGGSVEIYSCDSDTTNCLSAGSSNKTVVLKGIKNQITDMLLGTSSTPGVIY
FT                   KYATNSGTLTDPEKAFVSNLPGGIGTIVRNLSVLSQDGANLFATESSGAIALTMMYSFS
FT                   EEFFRAARIAMANSKSPYKKEALELLAQSQQQIRAEYTILSSQYGDLASQIEKYNNLLD
FT                   NIRKQKYMLATLSNPPSTN"
FT   gene            167822..171436
FT                   /gene="traG"
FT                   /locus_tag="SNSL254_pSN254_0189"
FT   CDS_pept        167822..171436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="SNSL254_pSN254_0189"
FT                   /product="type IV conjugative transfer system protein TraG"
FT                   /note="identified by match to protein family HMM PF07916"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41180"
FT                   /db_xref="GOA:A0A0H3AEK0"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEK0"
FT                   /protein_id="ABO41180.1"
FT                   /translation="MGSFSIHSIGDSAFLEQILIAVSMITGTGDFEKMVSIGLLLGVLM
FT                   ICIQSVFQGAKQINLQQVLVGWILYACFFGPTTTVTIEDAYTGQVRVVANVPIGVGFAG
FT                   GVISNVGYTITNLFETGYGVIVPNVTESHFSETLKLLNDVRRRAYDTGVFTALNSANGG
FT                   GYVDVRRSWNNYIRECTLTKVDLNLMSLDELMNRSTDSALRFNSQLYGTRLYLSTANPD
FT                   GADYTCTDGWVAISTATANLSSPVVVDALNSLLGIDTSTGDNALTKLTDSLQAMGATTT
FT                   SSIDYLKAAVLEPLYYEAAAGRYQDLQDYGSALMVNQAIQQRNTQWAAEQSMFMTVVRP
FT                   MLTFFEGFIYAITPIIAFIIVMGSFGLQLAGKYVQTILWIQLWMPVLSIINLFVHTAAS
FT                   NEMSSLSAGGLNSMYALSSTGDVLQHWIATGGMLAAATPVISLFIVTGSTYAFTSLASR
FT                   ISGSDHVDEKMQTPDLLKQGPVMQSQPAYNHNQFSGAIANGAESMISTFSLGSTLASGV
FT                   SSAQALQSQKSEAFQSTLGRGFSDGVSQDQAYSRLSNVGRNVSSQNTAQSQLINQQAKN
FT                   FMDKFQVDDSHSDAVKGAFAMQAMGTLDVDEAASMLMPMVGKARAAMKAAAGVKSNSTA
FT                   LVPAGGNGESGGGSDVLDIKAQAKGATESSTQDSSSWSASDVSQFMKGVSYSQTDSQAL
FT                   TNQLAQGFSRSGSESFKQTWGDSLSQNLSKSASELVSASDTFTTMSQLQNQMGSMTNTD
FT                   FKTLGGAVAQTPAAMNQLNDYFRNAAPQSVKDEAASLQQRYQAYGMSPQVAQAAARMTA
FT                   MTNSKNYEQGKELGGYQAALQAINTASGRNGAFSGDAYGNNGIEGPNVQGLPGQVQGAV
FT                   GSGPNIPTGFRENVAGMAGTNPASEAGQLPTNSPLVQNEHAAGTSALHNQAQQTERNVS
FT                   APELKKAQDNLMNSLPEMSWSASAWGAWDNSSDWMGRRAEQAGGALIAGGQAGADAFSR
FT                   AMDQMRTMTPEQRDQFIAATQRGDQAVQEEFGWAGDAMVGMAKLGRNVMGAAASGYDAA
FT                   KEWLTGKSDLSEAAKGMSIEERGAFYAAALSSAAEAGGGAAQQFMNQYGDEFKETMQSI
FT                   AQSRYGLTESQAAVYAESFDTNEGRMNQAVQNLKMEYAERNPDGSPMMQGGQPVLSQQN
FT                   EEFTDKLVNVLQNSTEAGDRSGSYLTAVRGYNIANQRF"
FT   gene            complement(171474..171836)
FT                   /locus_tag="SNSL254_pSN254_0190"
FT   CDS_pept        complement(171474..171836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0190"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41174"
FT                   /db_xref="GOA:A0A0H3AD75"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD75"
FT                   /protein_id="ABO41174.1"
FT                   /translation="MKHVVNILLLGMVLLGIAMMADTPWGLGVALAPFGVWGARFLFLV
FT                   HKSLWAAVIFWGGIAYFQWQVALVVGALFGLTCFIRVARSAYKEAPPTRRRKKQTGGFQ
FT                   DSYDFDQRFHIGAGDE"
FT   gene            172552..172824
FT                   /locus_tag="SNSL254_pSN254_0191"
FT   CDS_pept        172552..172824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ94440.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41119"
FT                   /db_xref="GOA:A0A0H3AD11"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD11"
FT                   /protein_id="ABO41119.1"
FT                   /translation="MDKCQLIDIPSDPEKKREWIKYKLKIQGLSLAALGRKHKTSRQVV
FT                   STALYKPSPRWEHEIATALGVKPSEIWPERYDEEHEIPLRHKEAS"
FT   gene            172824..173357
FT                   /locus_tag="SNSL254_pSN254_0192"
FT   CDS_pept        172824..173357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0192"
FT                   /product="transglycosylase SLT domain protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41145"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEF2"
FT                   /protein_id="ABO41145.1"
FT                   /translation="MKNKAKALVLSAALLSSTANAIDLSGTIFDKAAKAYNLDPLLVYS
FT                   VALAESASGRGNGSISPWPWTLRVPGLPFYAKSEDQAKAKLAEFQQQYGRAIDVGFMQV
FT                   SIRWNGHRVSSPADLLDPETNVMVGAEVLSEAIQSSPNDLELGVGRYHAWEDEIRARNY
FT                   GSRVLAIYRNLRDL"
FT   gene            173368..173976
FT                   /locus_tag="SNSL254_pSN254_0193"
FT   CDS_pept        173368..173976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0193"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41179"
FT                   /db_xref="InterPro:IPR036194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AD81"
FT                   /protein_id="ABO41179.1"
FT                   /translation="MLELDIIGAWDARAVNLDQEEADRNVYEFDLTLWNLLSTLAKERP
FT                   DDAASQFSLGMDTVQKLSLATPSQLEALASGVLISFKLETAEQNIITRLSGDYDPVVFI
FT                   NHSVDEFDAAYWLLFNRVASRDPEMAKEVFGVSRELAELVAKATDSQLRHMSGTTVTHF
FT                   TLRFAPSIIEEILDDSREELTHPVLKKLQQSLQGRGRWR"
FT   gene            173973..174257
FT                   /locus_tag="SNSL254_pSN254_0194"
FT   CDS_pept        173973..174257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0194"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3AEB0"
FT                   /protein_id="ABO41115.1"
FT                   /translation="MNIGNSGTLGRWVTARHMALAGYITKIIMIETGLTYKQVRRLYQD
FT                   LERDGYTLERKSRTFRGGATLIHSHTSKIQASLLMQLYFNIGGKPCCGL"
FT   gene            174254..174523
FT                   /pseudo
FT                   /locus_tag="SNSL254_pSN254_0195"
FT                   /note="conserved hypothetical protein, truncation"
FT   gene            complement(174583..175002)
FT                   /locus_tag="SNSL254_pSN254_0196"
FT   CDS_pept        complement(174583..175002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0196"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41054"
FT                   /db_xref="GOA:A0A0H3ACV2"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACV2"
FT                   /protein_id="ABO41054.1"
FT                   /translation="MKDHEEFSTLSAAERRELIIAELKRKSRIRTLLRGLPLDEVREII
FT                   DRMKGVLNELEEEYKKREEEEKEKRAQAERIMSDMESCGVDIGLLNEMFTSRSEPDNAK
FT                   YSKDGVSWSGQGRRPDAFKGLGAVELERYRIPQKK"
FT   gene            complement(175004..175297)
FT                   /locus_tag="SNSL254_pSN254_0197"
FT   CDS_pept        complement(175004..175297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0197"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41156"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ADC2"
FT                   /protein_id="ABO41156.1"
FT                   /translation="MAGSKWDGKISNLNISEQAFPELYRELSQMQHKARSDRLRALALL
FT                   GLYSLRFSGNIGSFEQQSSESQPAQHQNSPVQTDAKLNSQRDSLKGKLMGSV"
FT   gene            complement(175314..176297)
FT                   /locus_tag="SNSL254_pSN254_0198"
FT   CDS_pept        complement(175314..176297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SNSL254_pSN254_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAL59744.1"
FT                   /db_xref="EnsemblGenomes-Gn:SNSL254_pSN254_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABO41042"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ABZ9"
FT                   /protein_id="ABO41042.1"
FT                   /translation="MSQFVLGLDIGYSNLKMAMGYKGEEARTVVMPVGAGPLELMPQQL
FT                   TGGAGTCIQVVIDGEKWVAGVEPDRLQGWERELHGDYPSTNPYKALFYAALLMSEQKEI
FT                   DVLVTGLPVSQYMDVERREALKSRLEGEHQITPKRSVAVKSVVVVPQPAGAYMDVVSST
FT                   KDEDLLEIIQGGKTVVIDPGFFSVDWVALEEGEVRYHSSGTSLKAMSVLLQETDRLIQE
FT                   DHGGAPGIEKIEKAIRAGKAEIFLYGEKVSIKDYFKKASTKVAQNALIPMRKSMREDGM
FT                   DADVVLLAGGGAEAYQDAAKELFPKSRIVLPNESVASNARGFWFCG"
XX
SQ   Sequence 176473 BP; 43433 A; 44988 C; 48221 G; 39831 T; 0 other;
     gataggctca gataaacaga ccttaccctc gcatcgagaa ccgcttgccc tccagcatcg        60
     agagacggtg gtaaagaggc atttggaatc tttgatgcca tatccaatat atctggaatc       120
     tttaaatata gattcatatg taaagaggct gtgaaagaat aagagcatca agattccaga       180
     tagatagagg gaaatttgac aaattccaaa gatgggttag cctagtgaca gaactagatt       240
     ccagtattgg aataatcagc tttaaattcc agatagatag ttatgtggat aggaattgga       300
     taggaattgg gagggtattg aggtgagtct accaacagag cgatggctag atctgctaga       360
     tccgaagctc gaagaagaac gatccgagat aacagaggat ctgctagagg cagagggacg       420
     agagtttgtt gcagaggtac ggagcaaact ggatcacgcc ttagcggttc ttgctgtcga       480
     ggcgcagcag gaagcggaca tgtactggaa cgcgcacaaa tcagcgcgtg aagaagcgtc       540
     agaggacgaa caagggcgtg tcggtacacg ggttcgcatt ctaggcgtat cactcgttgc       600
     agagtggtat cgcaacagat ttgtcgaaca agttcccgga caaaagaaaa gggttctatc       660
     gacacatatc aagaagggtc gcggtcatgc ctacagcatg tcgcacttca agaaagagcc       720
     tgtctgggca caagagttga tccagcaagt tgaaaccagg tatgccgtgt taagacaacg       780
     cgccactgcc ttagcaaaaa ttcgccgggc gctaaacgag tacgagcgcc agctaaacaa       840
     gacacatagc gacgaggtgt gacaacatga cagcatctgt agcggccact gaattggcga       900
     aactggggaa atgtgaagcg atgatcaaga aagtcgccag ccatcctcgc cctgccctgt       960
     caaagcgccc acaatcgcca caggggacag atagcaccct tcggggtgag ttcgctcatt      1020
     tccgatatga agcggcagcc ctgcgtttta tgagcggcac tgcgggggct aagcgtcgca      1080
     tctaccagct agtgttttca gcgacggtag cagcgggagc attgacaatg ctggcggcat      1140
     ggaccaccag ctagaaagta tcgacggaac aatcatgagc aagagaacca aagacaaaga      1200
     cctggagaaa ctcgacgtaa tcaaagactc accgcaaatg agcctgtttg agatcattga      1260
     atctccggcc aagaaagacg actactccaa caccatcgag atctacgatg cgctgccgaa      1320
     gtacatttgg gaccaaaagc gtgagcatga agatttatcc aacgctgtag tgacacgaca      1380
     atgcaccatc agaggccagc atttcacggt gaaggtgaag ccagccatca tcgagaagga      1440
     tgacggaaga accgtgctga tctacgcggg acagcgagag gaaatccttg aggatgctct      1500
     acgcaagctc gcagtgaacg ggaaaggcca tatcatcgag ggcaaggctg gagtcatgtt      1560
     cactctgtac gaactccaga aagagctctc gaagatgggt cacgggtaca acctgaacga      1620
     aatcaaggaa gcaatccagg tttgtcgtgg cgcaacactc gaatgtatca gtgatgacgg      1680
     tgaagccttc atcagctcca gcttcttccc gatggtggga ctgaccacca gaggtgagtt      1740
     tcgcaagaaa ggcgggaacg ccaggtgcta tgtgcagttc aacccgctgg taaacgaatc      1800
     gatcatgaat ctgtcgtttc gtcagtacaa ctacaaaatc ggaatgcaaa tccgctcccc      1860
     tcttgcacgg tacatctaca agcgaatgag ccactactgg actcaagcat caccagattc      1920
     gccgtacacg ccatcgctta tcagcttcct gacccagagc cctcgtgaat tgagcccacg      1980
     gatgccggag aacgtcagag ccatgaagct cgctctggag gccctcatca aacaagaggt      2040
     cataagcgac tacgacgcga accagatcaa ggatggccgc agagtcatcg acgtgcggta      2100
     cgtcataagg cctcatgaga acttcgtgaa gcaggtgatg gcgtccaaca agcgtaagca      2160
     gcagacagag ctacgggcca tcaagcacgg catgatcgac cacgacatca ttgatgaacc      2220
     ccaacgtaag gggagatagc caccagaatc tcccaccccc cagggaaaag aaagataggc      2280
     gcgtcagcgc ctttttttat gccagaagaa agcgcacaag gtacgcccac caggcaggac      2340
     cggaaacgga atgcctccgc atatggggga gctgcacgga tagagcgaac gtgaccccag      2400
     atgcagcgtg ggctggggct ctatatatgg gatcgctgca cggtagtcgc aagctgagtc      2460
     tcagtatcgt gcaagcgtaa gccacgacga aggataagtg ccatgctgct ccagtggttc      2520
     ccgtagagtg gttcccgtaa ggtattgata gttaaagggt gaggatgtgg gggacctgca      2580
     cgttatgaga tttgatatgt gggtacgttg cacgaaagca ggtcctgaac ctctcgatat      2640
     atgggaactc tgcacgattg acgaagcaga acaaagattg acagatcagg acaaacctaa      2700
     aaaagcagtc aaaatgactc taatagtcca taaagtgatc acgcgcacac aaaaagaggc      2760
     caaaagttat ccacatttcc tgtgcataaa cggggttttg gtatatggga acgctgcacg      2820
     atcatatgtg ggtacgctgc acggtgcaaa aaacgaccaa aattgacatg tgggtacgtt      2880
     gcacgttcag aaaattgtat atggggcgac tgcacgtatg accttagaca tgtgggaata      2940
     ctgcacgaac accagatctg atatgtggga acgctgcacg aaagctctgt tttgtaagga      3000
     ttttgtggaa aaaagagggg ttccgtgtgg ataacagtgg ataagatcca agggtatgtg      3060
     gggacgttgc acggcaacct atgggaacgc tgcacggcaa cctatgggtt tgttgcacgg      3120
     aataaatatg aaaacaccag taatatcaat gtgttgagtg gtgatttaga acgcctaacc      3180
     tgtctttaac cgtttttaat cctttataca aagatctaaa gatctttata tttatccttt      3240
     tgatcactga acaaaaaata atcaacactg tttttttaga aaaaagtctc gtatgcaagg      3300
     ccgaacagga cgagtatcac caacaagata agcatcgaca gcacaaagta accagactcg      3360
     tacatcacag ctttgatcac agaaacgacg ctgatcgatc ttccagagat cctcccgatg      3420
     atccactgaa acgcaacgaa cgaaccaagc ccacagatca gaaccaccgc tacggagaca      3480
     agtgcatgtt ccctcaggac agactcactc aggaaaccat actgcatccc catcaataca      3540
     agcctgccaa tgccaaaacc caggcccaat gcaacagctc cacgaaccag cacgaccttc      3600
     aacgactgga gccatgtcag ctcaagatcc atccccttac gggaagaccg acgcaccagc      3660
     accgtagata tgcccaaccc caaaaacacc aaaaaaacaa aatccaacat tgccacctct      3720
     gcacaaatca atcagaacca caggcctctc ggccaaatgc gccaccaggg agaacccact      3780
     tctgcccctc cggcacaaaa atcgggagcg tgtaatcttc tctggatacc tgctccaatg      3840
     cctcaacatc actaatctgt atcggcgcaa cagcagaacc taaatctatt acgtcgattt      3900
     tttttcttga taccgtcaca ccaaaggttt gttcatactg agcaattttc ccagctcgtt      3960
     caggccagta gtgacggatc gtggaccaga tacgctgtga gttgtagatg caggtcatac      4020
     acgacgaccg gctccagcca aggcgataag ggactggggc caggatgcgg tgacgctcga      4080
     ttacttccca tacctcctcc tcagtccaat gaagaacggg cctccaggca tcaactaacc      4140
     gtgcagtctt cccatatctt ctgtcacagg catgagcctc aagctggttg tacttggatc      4200
     tgtttgcact ttcctcccgg cgctcaccag tgatgaaaag gatcttcttc cccttgaagc      4260
     gctcctggtt attaagagct ctgcggccaa catcgatctt caaggctgat gagcaccacc      4320
     ttgtttggag tgatggcgat tgctgaggga aacgaaggcg cgtaccaggc ttagagcgct      4380
     tatggtctct aggcagcacc agaagcccct caggcgtctc tacacgatgg gggtggctat      4440
     aggcattgtc tttgagcatt tcgccctcaa agccgccctc aagccacgag aagtacattg      4500
     ggatacccag ttcttccccg agctgacgac agtaatcacg catgaaggcc caatccatca      4560
     acgaactgcc ttcctgacca tcaacatcat ggtgccagaa ctccaccttt gacttatcaa      4620
     cacccatgtc caccagccgc aagtacgcag caatcgagtc tttgcctcca gacaggcaaa      4680
     caatgatgtg atcgtacaaa ctcaggtcca catccggagc ggagaagtac gttgttctat      4740
     cgtcacaacg ctgactggaa gatatgccgg taagaaccga ctccagtgat ggcaacacca      4800
     cctggtcatc gaacaaatct ccttggtttt ctcgtctcaa cataagtcgc tcttttttct      4860
     ttactgggtt gtttttatga tttacagtat tataaaatga tactgtgaaa agtaaagttt      4920
     tcagaacgac taatcactca ggagaacttg ataagcacca gaaagcaatc taaaggtggt      4980
     ttttcggtga ggttagttca ggggcaacct gccgctgctg attggaaatc atcaagaagt      5040
     ggctttttgg tggggttacg gtttgaaggg gtgagtatgt gggaacgttg cacggttaaa      5100
     gggggccgca catgaaaacg ataaagcggt tcatcgtatg ggtgaattac ggtcttgagg      5160
     gttggagcat tttcggatcg agcgatgact gggatgaagc ggtatccatc cgttcggaag      5220
     cgatagacga atgcaatatt gacgaggaag acatcatctt ggcagaaaac aaaaacgagc      5280
     tggtggtaaa acctgcggcc aagcaaatga cggagtggca ccgggaactg gaagccgtcc      5340
     ttatgacctt ggatgactgc cagatggaat gtgacggtat gacatgggca gtaagccacc      5400
     tactcaatga agcgggtgta cctcatgact gcatgtatgg ctttgtgcga aacgaacaga      5460
     ccaaggacat cgtgacaccg catttctggg ttgtcctgga tgatgggtgg ctggtggatc      5520
     tgaggctacg catgtggctg ggcgatcacg acaacattcc tcacggggta ttccatcccg      5580
     ataacgagcc aggacttttc tacaagggag acccggttca aaaccataaa gggatgagac      5640
     tgggcaaagc cgtcctggac atcatgaccg acggaaaact ttcacatgtg aaagttcctg      5700
     aacgacaaga cggagagtaa tagcgtggaa tttgattacg acaagtcagt atcaaacgca      5760
     catcttgagg ccgcaggctg gggtatggat gcctttaacc actccaaccc atttgagagt      5820
     catgtcatct atgtgcgtga ctaccgcaac gatcacatcc gcctgttcac catcaagcag      5880
     gctgacttcg acacgataaa gctgccgctt caccttacct ccgacatgct ggcttcggtg      5940
     atcgctgagt tcgtatcgaa ggcagcaaaa gggaagttga atacgaagga gtccgacacg      6000
     ctggctcctg ccttggttgg ctatgccaaa tcaacagaaa cctaccggag ctggcggaga      6060
     gtttctggag caacagagcg attgcatatg gtcatcaata tctatgcggg ttctgaattg      6120
     ctgagacctt tcatcgctcg ggctcctgag accgtcctga cgacccaaga gctactggtc      6180
     ttctcatcac aggttaagag catggatgta tccaatcatc cagagtggtt taggggccgg      6240
     aggtagtcat gaagccagtt ctctggatat tcgtcctgat catcgcccct ttcgtcattg      6300
     cgaaagtgga ccaatggcgc aaacgcggca ttggagacac ctgggcgtgg tggaaatcag      6360
     agaacatgcc ttatgagctg cgctcggcca ctctgttttt gtccgaacag gacatatcaa      6420
     ccacacagcc ggtgcccatg cacggcaggg ttgatcaggt gtaccaaacc aagaatgggg      6480
     ttctcattcc cttggacacc aagctgcgcc aggtaaacca catctatgag tcggacatta      6540
     tccagctctc ggtttaccgg gtaattctgt cacacaagta caaggcaccc gttgccaagt      6600
     acggctatgt ccgaaccgtt gttgagacag cggacgggga tagagtccgt tacatcaaga      6660
     caaaccttct cagcgaaaaa gaagtggtca agctgtggca ccgctatcaa tccatccgtt      6720
     ctggtcaggt aaaaacctcc tgttcctgtg gcggaaagtt tcacatgtga aagttctgga      6780
     ttgaatcagg gttgcccgaa ttgggcagct aggcggggtt gcatttttga aaagtcctgt      6840
     acgctggttg gtataggagg tgaatagtgg cccagcttaa acataaccgc ttcgtcatgt      6900
     tggggtcctt ggtagcgacg gtcgtagctg ccgccaatgg cttgagtttt ctcaccctta      6960
     tggctggtgg aatgaccctt ctccagttca tggcttggaa gcaacaagat gctgtccgga      7020
     gccggtttaa agctgcgaag gatgcgtttg aagcgttgaa cgtcattgcg ttcgacaagc      7080
     actgggtagg ttcaaccgcg acggtcgcca aagtgtcgaa catgatcact ccgcccgaac      7140
     gactggataa gccctgggcg gtgcaagttc tggccgtgac caaaggtggg acgtggttcg      7200
     cggtggatct gcaagtgacc ggcactgaca aggttcagat gcttagcctc caccagctta      7260
     gtgaaaaggc ggcaaagacc atgctggcct tcgacctcga agtgtatgag aaatttttcg      7320
     gaaaacctga tgttgcatga ggacaatgtg atggaaaaag tcaaaagcgt agatgccgtg      7380
     gagttcacgg cagcagataa gaaggcgatg acccatgcgg catacgccca gtgtttcttc      7440
     attctggccc aagtgatggc attcccttcc ctgggggtgg ctggcgctat ggttgctgct      7500
     ctgtgcggca tgatgccgtg gttgaccaag ttcgccaaag aggctccatc gaaagccttt      7560
     ggcatggtga tggcttcact ctgccttgct cctgtgtacg ggaaactctg tgagctggtg      7620
     gtccacgcga ttcagggagc ttgagcttat gggggtagta cgagttccct acctcttggc      7680
     tgagctgaaa gaacgcggat gtgctgatga atctgctctg gcgcaggtta tgcagcctgg      7740
     atgccgaatt ggagaggaag acctgcggaa gttggccgca aatttagggc ttgaagtgtc      7800
     cgagctggca ccagcgccag agaacgcggc caacacccgg ttcaaagcaa agctgagagg      7860
     aggtttggcc tcctttcttt ttgagtacga cggctgtttc cgacatgcag aaggctccag      7920
     ccatgcagaa atgttgggta tcgagcaaga agacgacata ggtcttccga gtcgagctgc      7980
     tgacgccatg ctcctggaga agacgcttta ccaggtaatc gctcgggcta agtacatgct      8040
     cggcaaaatc gacagcaagt ttgtcaggtc agaacaagca atcgagttcc gtgagcaact      8100
     tgctcctggg atcttcaaac caggttacag aggtttccga ttcaaggagg ctgccgctgg      8160
     tgatttgcct actgtcatga ttgacggtcg gaagttcaac tgcgttgcca gcatagccag      8220
     agcacatgga cttgatccgg taacggtgcg taggcgcatt gcggacaccg ggaaggccgc      8280
     agacaaactc tccaatgatg agtggaagct catcctcgcc aagaaaaaag gtaaagggaa      8340
     acccttcacc tatctggaca ggacctacag caacattgct cagttctgtc gtgagcatca      8400
     gctcaacacc aaccttgttt accagaaagt caaagaccgg gctgatagcg ctgatgaaga      8460
     gttctgggga ctgataatcg aaacatgcaa aaggaaaaac taatggcaga aaacaaagag      8520
     atcccctggg agaaagaact cattgagaag tacatgttca ccctgcataa agagcaggtg      8580
     aaagaccggc gctggcggac catgttgcgt gtgcttcgcg catctggttt cgtgcttctc      8640
     atgatcggct tcatcatttt ggcatctaat ccgggtggga tgccgtggca aagcgccaag      8700
     gcaggagccc ctcacaccgc gtatatcaac atccgtggtg aaattgctgc tggcactctg      8760
     gccgatgctg atcaccttat cccgtccatc caagctgcat tcgacaaccc gaactcacaa      8820
     gctatcgtgc ttcgcataaa cagccctggc ggtagcccgg ttcaagcagg acggatttat      8880
     gacgaagtga aggcgcagcg agcccttcat ccggagaaaa aggtctacgc catcattgat      8940
     gacatcggtg cctctggcgg ttactacatc gcctctgctg cggatgaaat ctatgctgac      9000
     cgcgccagcc ttgtcggttc tatcggcgtc atcagctcgg ggtttggatt caccggcttg      9060
     atggacaagc tcggcatcga gcgccgggct atcacttccg gagagcacaa agcgcttctc      9120
     gacccattct cccctcttac ctctgacatg aagaaattct gggagggcgt tctatcgaaa      9180
     acccaccagc agttcatcga acgagtgaag gctgggcggg gtgatcgact gaaagacgac      9240
     ccagaggtgt tttctggatt gctctggaac ggggagcagg ccaaagacat tgggctgatt      9300
     gatggcctgg gtagtttgaa ctccgtggcg cgagacgtca tccaccagag caacttggtg      9360
     gactacacac caaccgaaga catcatccgg cgactgaccc aacgagcgaa gctcgaagcc      9420
     agttccttcg tgcaagaact cagcgctgtg aaagtttact gataggagca gtttgatatg      9480
     acagaacaaa gtaccaaatc actacgtctc ggggttgttg ccgccattct tttggggctc      9540
     gtaggaaccg ggttcgggat ctaccagttc gtgaaagaga aggatctggc gcaagagatc      9600
     gccaacgtga agtctacggt caaccaggtg aaggatgccg aaggcgtcac cttcaaaagc      9660
     aaggcagagt ttgaagctgc tgtggccgaa agcatcaaca agtttgtcgc gcagaaacaa      9720
     caagccgaca tcgatcagaa gtatgcccag ttcgaggcag cacctgagaa ggtcgaagaa      9780
     ggcaaacaca tctacgggga ccttggtgct cggttcacgc tggtggagtt ctccgatatg      9840
     gagtgcccat tctgcaagcg attccacgac acacccaaac aaattgtgga tgccagcaaa      9900
     ggcaatgtga attggcagtg gaagcacatg cctctcgatt tccataaccc ggcagctcac      9960
     aaggaagctc tggccgctga atgtattgct gagcagaagg gcaaccgtgg cttctgggtc     10020
     ttcgttaacg acattttcca ccatacccag gggaatggtg gcggtgttgc tgacctggcc     10080
     tctgttgtca ctggtgttgg tgctgatctg gatgcgttcc gggagtgcct cggctcagga     10140
     aagtacgaag acaaggttga agctgacatc cagaaagcca agagctatgg cgtcaacggg     10200
     acaccagcca cttttgtagt ggacaaccat accggcaaga gccagcttct cggcggcgct     10260
     caaccggcgc aagccatcat ggccgtgatg cgaaaaatga tgattgagtc gcaacaagac     10320
     gactccgcga accaataaaa actttcacat gtgaaagtgg agtgagaact gatgatcaag     10380
     attacaacta aattgggatg ccttctggcg gggctgcttg tcctgtcggc ttgctcaagc     10440
     gtccctcagc caaacaacga atacgcgaag gccttggatg ataccaaaca ggtatgcgct     10500
     gcctgtgccc tggttggtaa tgacctgctg gttgccctca acaagtcatg cgacacccca     10560
     atgacccccg agactcttac aagcgtcatg aacagtaacc cgatgtttgc cgccatgatg     10620
     gcaattaact ccataggtgg aaccgacttc tatcaggttt accgtgatgc ggccatagac     10680
     accctgcggt gcaatgaaat ggacagttgg cctgatcgga ccaaggtgcg tttccagcag     10740
     cccgacatgc aaaaggcgct ggccttgagg gtttctgcca gacagcagaa ggcaaattaa     10800
     ctttcacatg tgaaagtcag gctctccggg gcctgatttc actatgaggt gaatctatgg     10860
     agttacaaga agcaaaagag gctctcgata gccttcatcc acacaaggcc tcagcgcctt     10920
     tgaggcttgt catccaccag ccaggtggga ttggtggaac ccctacagtg ggggtgaaag     10980
     ctattcacgc aggctttgac tgggacagca acaccatcct gatctatccg gaagagcagc     11040
     tcacccggtt gacgccggat gaggtcgccg ccatcacgaa gtcagtatcg aaaggacagt     11100
     cctggcattc atatcagcag ttcaagaagt atcgggagca gttggccgaa gccacggaag     11160
     aaattaatag gctcagggct gagctgggca ggtatcagaa taacgggagg gggtaatgct     11220
     aaaacgcgga attatcaatc tcgctgctag ttacatcatt gttgatgccc tactccggaa     11280
     tgcagcaatt tggatctttg gcttgtcctt ctccgttggt ggcacttacg tcactggcga     11340
     ggccagtaca tgggtcgttt acctagccac ttctggtgcc atgacactct gttctgtcgt     11400
     aacagcctac ctgctcgtga cctatcaccg ctgggggctg atgacggcca gggtctggtt     11460
     gctattgagt gcctgcctaa acggctatgc cgtctatttg agtagccaca acatccagtt     11520
     ggtggtggca ctgctttcca gcctgtttat tgctttgtgg atgctcaaga cccttgagca     11580
     accagcagtg aaggggacgt acaaggtaat cgctgatctt caccgtcagc tatggggaat     11640
     gttgaagggg caaacacaat gacgacgaat actcaaaacg cgaacgccaa ccaggttcgg     11700
     tctttacgcg acatgcttgt ccccgccctg ttgttctatg tggtgatgac ggccatgttt     11760
     gtgggtcttg acgcattcat ggataaaccc accagcatga acctgccatt tatgccgttc     11820
     cttgtctcga tggtgagttt taccagtgac gcacgtcgag cgtgggactg gcgaaacggg     11880
     accaaggttg tagctgtatt gactgcggta gccatgctgt tggcattcat ctatcagctc     11940
     gcggtcggag agatgaatct cttaggggtt ggtatatacc cggccacagc catccttctg     12000
     ttggcaatct cctgggtgat tcgcgctatc ggaaagacag cacctttcca gttcctgggg     12060
     agacacctgg cgcggtttgg tgcatcgaag tgggtccagc gtaccgccgc agtcattgtg     12120
     ctcgcgggag gccttgccat cactatctat gcctactggc ttaaccacgg gagctgatga     12180
     tgatcattgc aacgaagaac ggctttctgg tggccgcaga actaatcagg gaagaggccg     12240
     ggtactggct actacagcct cgtgaccaaa agacgccggt cagggtgaat aagcaggata     12300
     acaataaacg cgctttcacg catatgggag acgcccttcg ctgggccggt gatcctgagc     12360
     ttgcaaagca attcgatgcc gagggggaag aacatgcaaa ttcgtgacta catgacaaag     12420
     ttgtttgacg catttggtga tgtggaggaa gtcacccgag aaatgcttct ggagcaggcg     12480
     gagctcattc atacgatcag cgataagtgt cagagcacag gcctgtttct ggatagtcag     12540
     gttcgtttca accagttcgt tcaagagatt gaggctgacg acaaggtaga ggatcggttg     12600
     cttcatgctt ggtgctgggt aatggaccga atagtgaagg ctccaacatc ctttcacatg     12660
     gatggggctg tgattttgac aatgcctctg gtcgccagat acctgccacc ggttgaacag     12720
     gagccggaaa ccatcgtggt gaatctcgat gaggactaca aggctcctgt aggcaaccaa     12780
     acgctctgcg agctcgttat ggaacggagg cattggccgc aaggtgcaac ctgtgcgacc     12840
     caagaagcgg acgggggagt cctctactgg gacgccccgg ttgatgtggt agaggaaggc     12900
     agaaaggtcg ccggtaagca cggcatgatg gccgagatcg gattgaaaca tcaggttgat     12960
     gcctggtatg cagatatgga cgaaacacgg ctcgcaaccg attggaacac cgccgtcatt     13020
     acgcctcact gcttgctgct ttcctatctg gatgtgcttc aaaagaacaa agttcccttt     13080
     gatgaaggtg tgcagctcgc tgccgaatgg gtgaagcaac ttggcgggga atttcgtgaa     13140
     gacactgagg aagcgccgga agctgaggct tcagtgcttt ccctggggag agccacggct     13200
     cattgcttta aaccctatcc ggacacaaaa aatttctatt acgaggccta agcctcaccc     13260
     aaacaggagg atcaacatgc gataccaggt atttaaaacg aaggaagggg gccagccggt     13320
     gtttacggca ccgtggtact ggttggcctc tgccattgct cactggtcat ctcttaactg     13380
     ggatgcctgt cgaatcgtag acagcaaggt ggatgaaaca aggctctgtt gggccaaggc     13440
     tctaccggct gggaaaaaaa agtaatttgg atggagtgat tatgaggtta ggttttgtga     13500
     aaaatacggg ggtttcagcg ttcctggtag ccatgctggt ggtggcccct caggtatggg     13560
     cagaaacctt tactgcgaag gttgtggggg tgtctgacgg tgatacggtc aaggtcctga     13620
     ctgaacaaag ctgtgactcc gggaaagatt gccggagcgg caaaatccag taccgggtaa     13680
     ggctggcgga aatcgacacc ccagagaaga aacaacccta cggctcaaag gcgaaacagg     13740
     cgttgtccga tctggtgttt ggtcgaatga ttaaagtcga gcaaatcgac aaagaccgtt     13800
     atggccgtct ggtcgccaac ctttatgtcg atggcaaatg ggtcaatgcc gaaatggtcc     13860
     gttctgggag tgcgtgggtg taccggcagt acgccaaaac accggagctg ttcaagctgg     13920
     aggccgaagc caaagccgat aagcgaggtc tctgggcatt accggaatcg gagagaactc     13980
     ccccttggga gtggcgaaga aagcactaac cacaccccag agtatgcagg tgtaaacagt     14040
     aaccaagaaa acaaacagga ataacgatga acaaaagtga actgattatg aaagtggccg     14100
     aagacgctga cattagcaaa gcaaaggccg aagctgcggt aaatgcgctg atcaactcag     14160
     tgacagagga gcttaaagcg ggtgggacag tagcgctcac tgggtttggt actttccacg     14220
     ttaaggaacg cgcagcgcga accgggcgga atccccagac tggagagaac atccagatcg     14280
     cggcggccaa cattcctggg ttcaaagctg gtaaggggtt gaaagactcc gtgaactaga     14340
     tcttaatcat gtgacacatg aataaggttt acataaggct ccttcgtggg agccttattc     14400
     atatcagaca tgaataaggg gaagggatga gattgtcgtc aactcaaaaa gacgttttgt     14460
     tcattctata cgcaattgag gccggtggaa aagccgagcc tgtaccaggt gtaaaaatac     14520
     tggagatgat caattcagct cgccagagcg gtattcatgg aacgaacttc cgaacgtcat     14580
     gccacacgct ggtggagaac ggcctgttga acaagtaccg gaatgcttct ctaaagctgg     14640
     cctttaggct gaccgacgat ggcagggaac gtgcaggaga gatataccga aaacggctgg     14700
     aagaagagca agagaagtaa tacgccccat aacggggcgt atcgagttaa acggcaaagc     14760
     cgtagtgggt gccgtccgga agttcaacat cgaggcgtag cttgccaccg gaggcctcaa     14820
     cgtaccgctt aatggacgac agcttgagat ctcgtccagg tttttccatc tcggagactg     14880
     tcggctgtct cacacccaga gatgcagcaa tttccccctg ggtaaggttc atgcgatcac     14940
     gaagctctgc caagtggatg ttcagtaaca tctcagtggc cgctttctgt gctttggcaa     15000
     caacctcagg cttttctgtt gccagcattt ggtcaagagt tcttgccata acgtcactcc     15060
     ttcttcaatt tatccaagtg cgccgcaaac tcacggtctg caattgggat cattacttca     15120
     taaaaccttt tctcgtcccc ggtcttgtta ccggcgcaga gaagaatccc cttacgcttt     15180
     ggatcgaacg caaagaacgc tctgatagga tctcctttgc tttggacccg aagctctttc     15240
     atgttgctgt aggatgaacc gttaacagta tccgcgtatg gcctcgacag catggggcct     15300
     ctatctcgca gcaccatcat cgaagccagc acgtttgctc tatcggtatc atccagagca     15360
     tcgaaccact catcaaaggt gtcggttgtc tcgatgaccc acatgatttc tccttactta     15420
     atataggtgc aatcctatat agattcaaac ctataatcaa gaaaaatcgg cggcgatggg     15480
     ggccgaaatg tcagtaagta gtcatgtgac taaaataggg ggtagaataa gcctcgatat     15540
     agtcatgtga ctaaaaggtg tcctgaatga acaacctacc cctactgctc gatgcaagag     15600
     aagccattga ctactaccac cagcatccag gcatgactga tgcagaaaag gcctatgtgg     15660
     tcgcgttcct aagcggagag gggcgttcaa acagtcagat cagagaggat ctgggtattg     15720
     agaaggtcta tacggttaca cacctgaaac gcgccggtac gctatcggag gaagagctaa     15780
     cactctggct cagaaatcca cgcaagatca ccctggggca tgtgagggcc gtggctaagt     15840
     tacctttcag caagagagaa aagctcctga gggatctcct gcataccagg acaccggttc     15900
     ataaatttga ggcgatagcg aagggcaaag aagtggacag ggatgcagac attaagcgcc     15960
     tggagaccct gatgagcgat gctacgggta ggcctatcaa agttcgctat aaccccgcga     16020
     agcgctccgg ggaactgacg ctgggattct tcacgctcga tgacctggat gacgtgtgca     16080
     aggctttggg gtttgatcca agcgagcaga tgtaaaccag aaaactttca catgtgaaag     16140
     tcttgcaagg tgtcttttta ttgtttacag tatcataaaa tgaatctgta aaggtgcgcg     16200
     atgaatgtgc ttccaacgaa aagctggcct tgggcgttat aactcaacca gacctgagtg     16260
     gctggcggcg taccgaaacg caagatgtat gagaagctca ggtaaagaac ctgatgcttc     16320
     tctttccggg atagcttgga aggcgcaact cattgttgcc catgaaagag gcagaattga     16380
     cagcctggct gtccctttgg atgccagatt gatagcaaag aacctcatcg acgagatcct     16440
     tgctgaggag aactgatgga cgaaaaaatt acctacgaag aaatgcttga acaactcgac     16500
     cagaaaggca tccgcgtcac caacggggcg agacggcttt atgtcgcgtt gaacaacgga     16560
     gtcaaagctg aggtgctggg taactgcggt cccgccacaa tcagcttggt tgacgggatg     16620
     attgttgtgg aagagcagac tctccactaa gggcagcagc atgggcaaaa aagtacacat     16680
     catttgtgga aagtgcggca gtgacgagat gaactttgtc atcaatgaac actgtccaga     16740
     cgatccccag aatgttgcca gtatgtcctg ctcaaattgt tgcgaactga caggcatagc     16800
     cgagtggtcg gaatttaatg gacgtgagct gaaaggtgaa gccgtcgccc tatcaacacc     16860
     ggcaaacgtg aatgctcttc taggattgct tcgccaggcg atggacagcg ttgagtatcg     16920
     cctctatggc ggggacatgt cattgagcgg taatgatgct gccgaactca tagacctcca     16980
     ggagcgagct gagaaggtct tgtctgttct tcggagtgat cagcatgagt gatttatacg     17040
     aaccgcttga gtttgtgttc tgcggcttta ggaaagggga cgctgggcta tttatctcgg     17100
     tagccacttt gcgcgatggt gttttaggcc gtgagatgta tttctcaaag ggaaaaagca     17160
     aaaggcgctg ggttgtcggt ggcatttact caggggcctc gttttcggac aacggagcaa     17220
     aaggtctgga tgatgctcat tacgttaaag catgggaagt gcaaggcgac aagatagagt     17280
     ggcaagcaaa aagcgagcaa gccgaagcct tggcgcgaag cgagaaactt gaagccgacg     17340
     ataggaagcg caatgaactc gaagagctga tgctacccat caggaagcaa tatggggcat     17400
     taacaaagcg acgtgatagg gcaggggccg cagctcttga agaagctgtc ctgagagcgc     17460
     tgagagcgcc catcaggaag gctgaggaga aataaccgtg gagccagtct tagctaaagc     17520
     attcgccggt tttaaagtcg tagctgtaag tgcccatcag attggctttt cggcttttct     17580
     tgccattggt gtttgctggc gctttagggg tcgcaagtac gccatagaac aggataccaa     17640
     caagtgccgc ttgccacgcg aaaacagcaa ccagaatcca aaaagcagca gccagaaccg     17700
     gcagtttgtg cagaaggttg agcaccgact tggcccaaat cactgccggg atagccagca     17760
     ctgcgtaacc ccagttggtg gcctcaagca tagccaggcc aagaataaca acagccatca     17820
     gcgcgatatt cagtacatgt ttcatggtca tctctccttt tcaacttaca cttttatcct     17880
     atcacagcat taaaaaatgc aactgtgaaa gggcattttt cattcaaaaa gaggtgacac     17940
     tttgagtgca attatcagca agtgcggcat gtacagatac cgtctggaaa gggatgtgca     18000
     acccgaaggc cttgtgttcg gttattttgg tgtaaacggc tctacggcca cggccaccga     18060
     ggacgatcac acggtcagaa agtggatagg gtttaccaag gtcaacggag ggaggcgatt     18120
     catagtcggt aatgcttttg cttttcgggc gaccgacgtt cgagagctgg ctacggcggt     18180
     tgatcctgtc gggcctgaaa atgaaatcca cttggaaagg attattcggg atgctgatgt     18240
     cttggtgccc tgctggggga gccgaactaa gctgcctaag tctttgcatg ttcatttgga     18300
     caggctttta gagcagctcg ttgcatctgg gaagccggta ttggcatttg gcgtgactgg     18360
     ttcgggggac ccgaagcacc cactaatgct tggatattcg acaaaacttg tgccctgggg     18420
     aggaaaataa ttatgtcgat gcttgaagca cgttacttcg tggcaaagat aagcgatgca     18480
     caggccgtgc tctgcgatga ggagctggcg acactggaaa ggctgatccg gaaggttgat     18540
     gatggccgca gagcaaatgg caagagctcg cttacttgcg ttgttgtcga agaagattgg     18600
     ccgaactggc agcaaacggt tgactctgta ctttcacttg ctgacgggaa agacaacgat     18660
     tggaccaatg ccacaccaga acaaatcaag gccttttggg tcgatgactc agtttggaaa     18720
     actctggatg gccgggataa atggattgaa gatctcgacc tgctggtgga cggttccccg     18780
     gtggcttctg agtgggaacc ttttggcttg gaatcagggc agtctgtcgt catacgaggc     18840
     ggatggatag aagggaatgc cttgagtgat gatggcgtac cgctagtgca ggcattcgtc     18900
     gcttggaaac agggccaaga caaccactaa aggaaaatta cttcggaagg gcggctatgg     18960
     ccgctttctt tttaatattt acagcatcac ataatgatac tatgatgttg ttaatttact     19020
     tggggaggcg cttatgctca ctgctaaatg tatagggtgc ggatgcaccg atgatcacgc     19080
     ttgtgttgaa aaggcactgt tgcaaagtta gcgatgaggc agccttttgt cttattcaaa     19140
     ggccttacat ttcaaaaact ctgcttacca ggcgcatttc gcccagggga tcaccataat     19200
     aaaatgctga ggcctggcct ttgcgtagtg cacgcatcac ctcaatacct ttgatggtgg     19260
     cgtaagccgt cttcatggat ttaaatccca gcgtggcgcc gattatccgt ttcagtttgc     19320
     catgatcgca ttcaatcacg ttgttccggt acttaatctg tcggtgttca acgtcagacg     19380
     ggcaccggcc ttcgcgtttg agcagagcaa gcgcgcgacc ataggcgggc gctttatccg     19440
     tgttgatgaa tcgcgggatc tgccacttct tcacgttgtt gaggatttta cccagaaacc     19500
     ggtatgcagc tttgctgtta cgacgggagg agagataaaa atcgacagtg cggccccggc     19560
     tgtcgacggc ccggtacaga tacgcccagc ggccattgac cttcacgtag gtttcatcca     19620
     tgtgccacgg gcaaagatcg gaagggttac gccagtacca gcgcagccgt ttttccattt     19680
     caggcgcata acgctgaacc cagcggtaaa tcgtggagtg atcgacattc actccgcgtt     19740
     cagccagcat ctcctgcagc tcacggtaac tgatgccgta tttgcagtac cagcgtacgg     19800
     cccacagaat gatgtcacgc tgaaaatgcc ggcctttgaa tgggttcatg tgcagctcca     19860
     tcagcaaaag gggatgataa gtttatcacc accgactatt tgcaacagtg ccgtccagcg     19920
     gatatcagcg ctgaaagatg atggctgagc gtggaggcag gaatctcaag gtgcttctgc     19980
     agttcgccaa ccggcaggcc ttcatgaccc gccctgacca gctcccggta tatgctgaga     20040
     cgtgtcgggt ggcccagttc tcgaagtgcg tttgcagcag tgtttaaatc cataatacct     20100
     cctttatcta tatttccaga ataatagaaa tatagcctgc gtcaatcgtt tctgccgtga     20160
     gggtaccgct ttcccaatca tgctctgtcc gccaggttat ggggggcaga gccagagcac     20220
     taccgaaatc cttgcgaata cccgtgcagg gaataatttc cgcccccttt atggccggaa     20280
     aaaaaactga taaacgtcgc cttttcagaa ggttgctttc ttaacgtggt ttttcgggca     20340
     ctgttgcaaa tagtcggtgg tgataaactt atcatcccct tttgctgatg gagctgcaca     20400
     tgaacccatt caaaggccgg cattttcagc gtgacatcat tctgtgggcc gtacgctggt     20460
     actgcaaata cggcatcagt taccgtgagc tgcaggagat gctggctgaa cgcggagtga     20520
     atgtcgatca ctccacgatt taccgctggg ttcagcgtta tgcgcctgaa atggaaaaac     20580
     ggctgcgctg gtactggcgt aacccttccg atctttgccc gtggcacatg gatgaaacct     20640
     acgtgaaggt caatggccgc tgggcgtatc tgtaccgggc cgtcgacagc cggggccgca     20700
     ctgtcgattt ttatctctcc tcccgtcgta acagcaaagc tgcataccgg tttctgggta     20760
     aaatcctcaa caacgtgaag aagtggcaga tcccgcgatt catcaacacg gataaagcgc     20820
     ccgcctatgg tcgcgcgctt gctctgctca aacgcgaagg ccggtgcccg tctgacgttg     20880
     aacaccgaca gattaagtac cggaacaacg tgattgaatg cgatcatggc aaactgaaac     20940
     ggataatcgg cgccacgctg ggatttaaat ccatgaagac ggcttacgcc accatcaaag     21000
     gtattgaggt gatgcgtgca ctacgcaaag gccaggcctc agcattttat tatggtgatc     21060
     ccctgggcga aatgcgcctg gtaagcagag tttttgaaat gtaaggcctt tgaataagac     21120
     aaaaggctgc ctcatcgcta actttgcaac agtgccgcgc gacgagcagc agcaccagga     21180
     gcagaagcac gtcgagaaaa agcaacagca gatcgagcag cgcccacggc gggccgctcg     21240
     catcggataa gtcgaaaaat ccggctaaag tggccgagct gcacatcagg ccgcgcggtt     21300
     ttcctccctg atcgccggcg cggtttcttc ctccctgaac cgcatgcaga cttgccgcct     21360
     cggacacccc gaggcggttt tttttcgcct cgctcgagca tcgccgcatc cgacgatgcc     21420
     gagacgacca ggccgcgcac gtcgagctgc agcatcgcca ttgccgacga tggcaccagg     21480
     tcgccggcgg tggccaccga cctcgagctc gcatcgccac atccgacgat gcgcgccggc     21540
     gtcgaccatc gccaggtctg acgatggcgg ccgccctgcc ctggatctcg catcgccatt     21600
     tctggcgatg agatccacgg agcggccatt tagacccgcc aataacgacc cggccaagat     21660
     aaatcgcatg acggcctttt tggccggggg tagcatgacc ggacactttg cgtatgccca     21720
     aaggagcccg caagtatgcg caggacgaag ccagtagccg cgccgatggt ggcgcgggtc     21780
     tatctgcgcg tcagcaccga cgcgcaggac ttggaacgcc aagaggcgat cactacggcc     21840
     gcgaaggccg ccggctacta cgtcgccggc atctaccgtg agaaggcatc cggcgcacgc     21900
     gccgaccggc ctgagctgct gcgcatgatc ggcgacctac agcccggcga ggtggtcatt     21960
     gccgagaaga tcgaccgcat cagccgccta cctttgcccg aggccgagcg cctggtggcc     22020
     tcgatacagg ccaaaggcgc acgcctggcc gtccctggcg tggtcgatct atccgacctg     22080
     gcggccgagg cccagggcgt cgccaagatc gtgctggaag ccgtgcagat catgcttttt     22140
     cgcctggcct tgcagatggc ccgcgacgac tacgaggaca ggcgcgaacg ccagcgccaa     22200
     ggcattgagt tggcccgcca ggccgggcgg tacaagggcc gccgtgctga tccgaagcgc     22260
     cgcgcccaag ttgtcgcgct gcgcaagtcc ggctacagca tcaacaagac cgccgagctg     22320
     gccgggtaca gtgcggccca ggtgaaacgg atatgggccg aggtcagcca ggccgaagcg     22380
     aagcagcacg gcgcgttcgt ggaggacgca ttgacggaag ccgatgccct ggccgctgtc     22440
     ggccaggatg agcgccagga ggaaagggca tgaagaagcc gaaccaagac gacgagccgt     22500
     ttttcatcac cgaggagatt gcggccgaaa tgatcgccgg cggctatgag ttcgagctgc     22560
     cgcccattcc ttgcaccatc cgcctacgcg acgtgctgga gcgcatgacc gatgctgagc     22620
     tagcattgca gccgggcgag atcgccgacc aggagcgtga acgctgccgg cgcaagccgt     22680
     gttcaacctc atgatctggt catggtattt ttcatggcac tgagcctgat agttcttgca     22740
     aattgttgtc actaaagggt tttgtgtgct tgtttacaat cgagtgggag tgacgggcac     22800
     tggctggcaa tgtctagcaa cggcaggcat ttcggctgag ggtaaaagaa ctttccgcta     22860
     agcgatagac tgtatgtaaa cacagtattg caaggacgcg gaacatgcct catgtggcgg     22920
     ccaggacggc cagccgggat cgggatactg gtcgttacca gagccaccga cccgagcaaa     22980
     cccttctcta tcagatcgtt gacgagtatt acccggcatt cgctgcgctt atggcagagc     23040
     agggaaagga attgccgggc tatgtgcaac gggaatttga agaatttctc caatgcgggc     23100
     ggctggagca tggctttcta cgggttcgct gcgagtcttg ccacgccgag cacctggtcg     23160
     ctttcagctg taagcgtcgc ggtttctgcc cgagctgtgg ggcgcggcgg atggccgaaa     23220
     gtgccgcctt gctggttgat gaagtactgc ctgaacaacc catgcgtcag tgggtgttga     23280
     gcttcccgtt tcagctgcgt ttcctgtttg ccagccggcc cgagatcatg gggtgggtgc     23340
     tgggcatcgt ttaccgcgtc attgccacgc acctggtcaa gaaagcgggc catacccacc     23400
     aagtggccaa gacgggcgcg gtcaccctga tccagcgttt tggatcggcg ctcaatctga     23460
     atgttcactt ccacatgctg tttctcgacg gtgtgtatgt cgagcaatcc cacggctcag     23520
     cgcgtttccg ctgggtcaag gcgccgacca gcccagagct cacccagctg acgcacacca     23580
     tcgcccaccg ggtgggtcgc tatctggaac ggcaaggcct gctggaacgg gatgtcgaaa     23640
     acagctatct ggcctcggat gcggtggatg acgacccgat gacacccctg ctggggcact     23700
     cgatcactta ccgtatcgct gtcggttcac aggcggggcg aaaggtgttc actttgcaaa     23760
     ctctgccgac cagtggtgat ccgttcggtg acgggattgg caaggtagcc gggtccagcc     23820
     tgcacgccgg cgtggcggcc agggccgatg aacgcaagaa gctcgaacgg ctgtgccggt     23880
     acatcagccg cccggcggta tccgagaagc ggctgtcgtt aacacgaggc ggcaacgtgc     23940
     gctaccagct caagacgccg taccgggacg gcaccacgca cgtcattttc gaaccattgg     24000
     atttcattgc aaggctggcc gccctggtac cgaagcccag agtcaaccta acccgcttcc     24060
     acggggtgtt cgcacccaac agtcggcacc gggcgttggt cacgccggca aaacggggca     24120
     ggggcaacaa ggtcagggtg gctgatgaac cggcaacacc agcacaacgg cgagcgtcga     24180
     tgacatgggc gcaacggctc aagcgtgttt tcaatatcga catcgagacc tgcagcggct     24240
     gcggcggcgc catgaaagtc atcgcctgca ttgaagaccc tatagtgatc aagcagatcc     24300
     ttgatcacct gaagcacaaa gccgaaacca gcgggaccag ggcgttaccc gaaagccggg     24360
     cgccaccggc tgagctgctc ctgggtctgt ttgactgacg agcctgaagg ccaacgatac     24420
     caatcaaaat gctgcgttca cagcgccgcg gcagggatcc gccgtgctgg ttgtcggaaa     24480
     aggagccgct agtgggaaag aggagggtaa attttcagcg ttgctggctc cccgtcagcc     24540
     ggattgggtt gcatcgcagg ggtgtcgaaa gagtcaactg cggtccaaag ctgttggact     24600
     tgggtgaaaa gggcgtttat tcttcctata cgtgccgcgt tccaggcggc gactatgagg     24660
     gctatgtcga tgcccatgtg cgccggctgg aggcgctacg ccgggccggt atcgtcgagc     24720
     ggatcgacgc cgaccaatgg cgcatccccg atgatctggt cagccgtgcc gccgcccatg     24780
     acgccggccg agacagtcag gccagcgttc gcgtcctttc cccggtcgat ctgaacaaac     24840
     agatcggatc ggacggcgcg acctggctgg accggcggct gatccacggc gagacggccg     24900
     accttgcgcc aaccggcttc gggcaacaag tccgcgaagc catggaccag cgccgcgagc     24960
     accatatcga acagggcgac gccacccgca gccgggacag ccgcgtcttc taccggcgca     25020
     accttctcgc catcctgcgg gagcgcgagg tagccggcgt cggatcggat atggctttga     25080
     gtaagggcct gccgttccgc gccgccacgg acggcgagag cgtcagcggc aagtttaccg     25140
     gaaccgtgca tctatcgagc ggcaagttcg ccgtggtcga gaaatcccat gagttcaccc     25200
     ttgtcccgtg gcggccgatc atcgaccgcc aactcggccg cgaggttatg ggcatcgtgc     25260
     agggcgggtc ggtgtcgtgg cagttagggc ggcagagggg gctggaacgc tgagtgcgcc     25320
     catgccgcat tgcgaagcaa aagataatcg gataaaatgt agcaattcat attcgtaagc     25380
     gtggagtaat cagatgggaa attccaagtc agcagacaag taagccgcaa caaccagtat     25440
     tgttgttgcg gcgctctgta aggctagtct catctgattg ctgacgagca gacgtcgccc     25500
     ggtattcctt aatcgagggt tgattcgtca tgaccaccac acgccccgcg tgggcctata     25560
     cgctgccggc agcactgctg ctgatggctc ctttcgacat cctcgcttca ctggcgatgg     25620
     atatttatct ccctgtcgtt ccagcgatgc ccggcatcct gaacacgacg cccgctatga     25680
     tccaactcac gttgagcctc tatatggtga tgctcggcgt gggccaggtg atttttggtc     25740
     cgctctcaga cagaatcggg cgacggccaa ttctacttgc gggcgcaacg gctttcgtca     25800
     ttgcgtctct gggagcagct tggtcttcaa ctgcaccggc ctttgtcgct ttccgtctac     25860
     ttcaagcagt gggcgcgtcg gccatgctgg tggcgacgtt cgcgacggtt cgcgacgttt     25920
     atgccaaccg tcctgagggt gtcgtcatct acggcctttt cagttcggtg ctggcgttcg     25980
     tgcctgcgct cggccctatc gccggagcat tgatcggcga gttcttggga tggcaggcga     26040
     tattcattac tttggctata ctggcgatgc tcgcactcct aaatgcgggt ttcaggtggc     26100
     acgaaacccg ccctctggat caagtcaaga cgcgccgatc tgtcttgccg atcttcgcga     26160
     gtccggcttt ttgggtttac actgtcggct ttagcgccgg tatgggcacc ttcttcgtct     26220
     tcttctcgac ggctccccgt gtgctcatag gccaagcgga atattccgag atcggattca     26280
     gctttgcctt cgccactgtc gcgcttgtaa tgatcgtgac aacccgtttc gcgaagtcct     26340
     ttgtcgccag atggggcatc gcaggatgcg tggcgcgtgg gatggcgttg cttgtttgcg     26400
     gagcggtcct gttggggatc ggcgaacttt acggctcgcc gtcattcctc accttcatcc     26460
     taccgatgtg ggttgtcgcg gtcggtattg tcttcacggt gtccgttacc gcgaacggcg     26520
     ctttggcaga gttcgacgac atcgcgggat cagcggtcgc gttctacttc tgcgttcaaa     26580
     gcctgatagt cagcattgtc gggacattgg cggtggcact tttaaacggt gacacagcgt     26640
     ggcccgtgat ctgttacgcc acggcgatgg cggtactggt ttcgttgggg ctggtgctcc     26700
     ttcggctccg tggggctgcc accgagaagt cgccagtcgt ctaaccgacg actggtagca     26760
     ggcccgctcc gatgcggcgc actaaccatc gaaacctcgt gaatgtcggt atcctgtctg     26820
     gcaggatacc gctcatttcc cttgttcagt tcatcgccgt cgccgagcat ctgaattttc     26880
     ggcatgcggc caaggcactt ggtatcagcc agtcgagcgt cagcgcgcgt gtgaaagcgc     26940
     tggaggataa ccttggtgtc ctgctatttg agcgccatgc gcggggcgtt cggctaacag     27000
     acgcaggcag gcacttcatg gagcgtgtca cggcgggtgt cgatcaactc gatcacgcag     27060
     tgaagaccgc ggagtgacgg gcactggctg gcaatgtcta gcaacggcag gcatttcggc     27120
     tgagggtaaa agaactttcc gctaagcgat agactgtatg taaacacagt attgcaagga     27180
     cgcggaacat gcctcatgtg gcggccagga cggccagccg ggatcgggat actggtcgtt     27240
     accagagcca ccgacccgag caaacccttc tctatcagat cgttgacgag tattacccgg     27300
     cattcgctgc gcttatggca gagcagggaa aggaattgcc gggctatgtg caacgggaat     27360
     ttgaagaatt tctccaaagc ccgcgacgca gcgccggcag gcagagcaag tagagggcag     27420
     cgcctgcaat ccatgcccac ccgttccacg ttgttataga agccgcatag atcgccgtga     27480
     agaggagggg tccgacgatc gaggtcaggc tggtgagcgc cgccagtgag ccttgcagct     27540
     gcccctgacg ttcctcatcc acctgcctgg acaacattgc ttgcagcgcc ggcattccga     27600
     tgccacccga agcaagcagg accatgatcg ggaacgccat ccatccccgt gtcgcgaagg     27660
     caagcaggat gtagcctgtg ccgtcggcaa tcattccgag catgagtgcc cgcctttcgc     27720
     cgagccgggc ggctacaggg ccggtgatca ttgcctgggc gagtgaatgc agaatgccaa     27780
     atgcggcaag cgaaatgccg atcgtggtcg cgtcccagtg aaagcgatcc tcgccgaaaa     27840
     tgacccaaag cgcggccggc acctgtccga caagttgcat gatgaagaag accgccatca     27900
     gggcggcgac gacggtcatg ccccgggccc accggaacga agcgagcggg ttgagagcct     27960
     cccggcgtaa cggccggcgt tcgcctttgt gcgactccgg caaaaggaaa cagcccgtca     28020
     ggaaattgag gccgttcaag gctgccgcgg cgaagaacgg agcgtggggg gagaaaccgc     28080
     ccatcagccc accgagcaca ggtcccgcga ccatcccgaa cccgaaacag gcgctcatga     28140
     agccgaagtg ccgcgcgcgc tcatcgccat cagtgatatc ggcaatataa gcgccggcta     28200
     ccgccccagt cgccccggtg atgccggcca cgatccgccc gatatagaga acccaaagga     28260
     aaggcgccgt cgccatgatg gcgtagtcga cagcagcgcc ggccagcgag acgagcaaga     28320
     ccggccgccg cccgaaacga tccgacagcg cgcccagcac aggtgcgcag gcaaattgca     28380
     tcaacgcata cagcgccagc agaatgccat agtgggcggt gacgtcgttc gagtgaacca     28440
     gatcgcgcag gaggcccggc agcaccggca taatcaggcc gatgccgaca gcgtcgagcg     28500
     cgacagtgct cagaattacg atcaggggtc tgttgggttt cacgtctggc ctccggacca     28560
     gcctccgctg gtccgattga acgcgcggat tctttatcac tgataagttg gtggacatat     28620
     tatgtttatc agtgataaag tgtcaagcat gacaaagttg cagccgaata cagtgatccg     28680
     tgccgccctg gacctgttga acgaggtcgg cgtagacggt ctgacgacac gcaaactggc     28740
     ggaacggttg ggggttcagc agccggcgct ttactggcac ttcaggaaca agcgggcgct     28800
     gctcgacgca ctggccgaag ccatgctggc ggagaatcat acgcattcgg tgccgagagc     28860
     cgacgacgac tggcgctcat ttctgatcgg gaatgcccgc agcttcaggc aggcgctgct     28920
     cgcctaccgc gatggcgcgc gcatccatgc cggcacgcga ccgggcgcac cgcagatgga     28980
     aacggccgac gcgcagcttc gcttcctctg cgaggcgggt ttttcggccg gggacgccgt     29040
     caatgcgctg atgacaatca gctacttcac tgttggggcc gtgcttgagg agcaggccgg     29100
     cgacagcgat gccggcgagc gcggcggcac cgttgaacag gctccgctct cgccgctgtt     29160
     gcgggccgcg atagacgcct tcgacgaagc cggtccggac gcagcgttcg agcagggact     29220
     cgcggtgatt gtcgatggat tggcgaaaag gaggctcgtt gtcaggaacg ttgaaggacc     29280
     gagaaagggt gacgattgat caggaccgct gccggagcgc aacccactca ctacagcaga     29340
     gccatgtaga caacatcccc tccccctttc caccgcgtca gacgcccgta gcagcccgct     29400
     acgggctttt tcatgccctg ccctagcgtc caagcctcac ggccgcgctc ggcctctctg     29460
     gcggccttct ggcgctcctg ctgcggcgtc cgctcgtggg ccgtggcgcg ggtccgcgcg     29520
     ccggcctcgt gcgcctggcg ctcgcgggcg aggtccaggg cggccgtctt cacgttctgc     29580
     cttgcgcaga tgagatagat ctagcgtgga ctcaaggctc tcgcgaatgg ctcgcgttgg     29640
     aaactttcat tgacacttga ggggcaccgc agggaaattc tcgtccttgc gagaaccggc     29700
     tatgtcgtgc tgcgcatcga gcctgcgccc ttggcttgtc tcgcccctct ccgcgtcgct     29760
     acggggcttc caggggtcgt ttgcgggaag gggcggaatc ctacgctaag gctttggcca     29820
     gcgatattct ccggtgagat tgatgtgttc ccaggggata ggagaagtcg cttgatatct     29880
     agtatgacgt ctgtcgcacc tgcttgatcg cggccgcgat agctagatcg cgttgctcct     29940
     cttctccatc cgcgttccaa gctgcggaaa ggcacccata agcgtacgcc tggtcgagca     30000
     ggcgacgcgg atcgacgtcc agcgcacgag agaatgcgtc cgccatctgt gcaatgcgtc     30060
     taggatcgag acaaaggtcg tctctgtcag ccggatcgta gaacatattg gcggcgccaa     30120
     agcccacttc accgaccaga ccgacgggat ctatcaccag ccagccgcga ctggagaaca     30180
     tgatgttttc atgatgcaga tcgccatgta gcccacgcag ttccgaggca ttgctcatca     30240
     tttgatcggc tataatcgcc gcgtggacgt agtcagtttg acaacctgcg ttttgatcat     30300
     cgcgcgcccg ctgaaacaaa gctgcaaagc gatcccggat cgggagaagg gcagaaggca     30360
     ggggttcctc agatgcggca tacagcttcg ccattagttc cgctgcaatt tcggtcgcct     30420
     ggtagtcgcc gtgctcggca acgatgtgag agagcattcg ctccccggca tattcgagca     30480
     acatcagatt gttctcacga ccgagcaacc ggactgctcc cctcccattg cgccatacca     30540
     gatagtcggc cccgcgcagt tcatcagcaa tgtcttctat aggtttcaat cccttgacga     30600
     ttgcaggagt cccgtctggc aatgaaactt tccaaacgag gctggaaaag gtgtccgcaa     30660
     tgagaacagg ttgcgaaacg tgccaatgag caggaaaaac aggcggcatg aacatcaacc     30720
     ccaagtcaga gggtccaatc gcagatagaa ggcaaggcgt tcgcggtcgg gggcttcgat     30780
     ccccaataca ttgaatagga cagcgaaggc gcgctctgct tcatctggcg ctgcccagtt     30840
     ctcttcggcg ttagcaatca tgagtgccaa atcggcatag cgatctgctg ttccgagccg     30900
     cccaaggtcg atcagacccg tgcattgaag agttttaggg tccaccatga agttcggcat     30960
     gcagggatca ccatggcaaa caaccatatc ggtgcgctct tggtcgagcc gcaccggtag     31020
     ctctcgttcg acacgagcca aaagatcgag ctgcggcgta ctcttgtcct cgtccggtaa     31080
     gaagtcggga ttgacggcat tgcgggacac cacatcaacg gcgcgtccga acattcgcga     31140
     cagcctgcgc tcaaacggac attgatcaac cgataggctg tgaacagcgc caagttgctg     31200
     ccccattgac ggccacgctt tgagcaaatc cgctccagac agatcagccg ccggtactcc     31260
     cggaattgcc gttatcacca agcatgcacc ctcctgttcc tcctgccagt tgatgacctc     31320
     ggggcaagcc acacctcgac ctttgagcca aatgaggcgg tcacgctctc cagcgagctc     31380
     accgcggcgg gaagcaggtg cgattttcgc gaaggcatgc ccgtcaccac gtcgaaaaac     31440
     aaaatcacca gattctccgc ctctgacagg caaccagtca gaatgcgatt caccaaaaaa     31500
     aatattagtt cgattcaatg gaggttcctt cagttttctg atgaagcgcg aatatagaga     31560
     aatatcccga atgtgcagtt aacgaattct tgcggtttct ttcagcgccg ccaataccgc     31620
     cagcccgtcg cgcaaggggc gcggctcgtg tgtgcggatg aagtcagctc cacctgcggc     31680
     ggcggcaagc tctgcagcga gtgtcgcggc cccgacatcc cccggaccac ggcctgtgag     31740
     cgcgcgcaga aaggatttgc gcgaaacaga cagaagcacc ggcaaatcga agcgcagccg     31800
     caattcatcg aaccgcgcca gcaccgagag cgaggtttcg ggagcagccc ccagaaaaaa     31860
     ccccatgccg ggatcaagga caaggcggtt gcgtttgata ccggcacccg tcagcgccgc     31920
     gatgcgcgcg tcaaagaacg ccgcaatgtg atccatgatg tcgccagcgg gtgcctcgcg     31980
     ccgatctgcc tgcccgtctt gcaccgaatg cataacgacg agtttggcag atgatttcgc     32040
     caattgcgga tagaacgcag cgtctggaaa accgcgaata tcattgagat aggccacacc     32100
     acgcgacaag gcataggctt gcgtcgcggg ttgataactg tcgagcgaga cgggaatgcc     32160
     atctgccttg agcgcgtcca gcaccggcgc gatacgcgcg atttctgtgt cggacgaaac     32220
     aggcgcggcg tcgggattgc tggatgccgg accgaggtcg atcacatctg ccccctcggc     32280
     catcagctta cgcgcctgcg caatggctgc gtctggcgcc agataccggc ctccatcgga     32340
     gaaactgtcc gaggttatgt tgacgatgcc gaaaatgatg agcgatttat tcatgggggc     32400
     ttctataata ataataatcg agcatgagtc tcatacggat gctcgggtcg aaagggaatc     32460
     cccaggcgag taacctgttt gcggtgatcc attagctgca ggagcagaat agcatacatc     32520
     tggaagcaaa gccaggaaag cggcctatgg agctgtgcgg cagcgctcag taggcaattt     32580
     ttcaaaatat tgttaagcct tttctgagca tggtattttt catggtatta ccaattagca     32640
     ggaaaataag ccattgaata taaaagataa aaatgtcttg tttacaatag agtgggataa     32700
     atggacgcta aagaactgaa ccacatgata gctgaggcct acagccggga tttgcaaaag     32760
     cctgagctgg tatcgttcaa agaggtgagt cgctgggggc gtaagtacgg tttccccgtc     32820
     gtatgcactc tggccgatga aagtgaagaa aagcagatcc actgggctgc cagtttgctc     32880
     attcaagtag ccggtacttg gccgcgagaa gatatgccgg aattgctcac accggaacgg     32940
     ggctccgcgc tgttcaacga tgcgatgcag ttattggcga atgggcttgg agcagcaaat     33000
     caattgcgct gacagcacaa accttgtcaa taagcggcct tcatggccgt ttttttgttt     33060
     aaagtttgtt ttaacagaac cataattaga tattgcagta tcattttatg atcgctacaa     33120
     tctttcacat gtgaaagttt gggggtggtc ttgatcacct gcgagaaacc aaaatagagg     33180
     tgggtatggc aaaagtaatc agcttcgcca accagaaagg cggagtgggt aagagtaccc     33240
     tctgtatcca gcaggccttt tatctggcgt tacagaagaa aaagaaagtg ctggtcttgg     33300
     atatggatgg tcaggggaac acgtcctctc gactggcccc cagacgagag cttgaggatg     33360
     gtgactacga gcccatcctc acaggaacca aaaccgcaga gctgttcgct tacgagctgg     33420
     acggcattga ggtcatgcac tgcccttgcg gtgcagacct cattcatacg ccgaaaaacg     33480
     acccggatct gtttgagatg gaggctgtgc ctcttgacca ggccatgaat ccggctcgcc     33540
     atttggctga gctgtttgag aactacgact acgtgctgat tgattgtccg cctagcctcg     33600
     gcagaaagct ggtggcagcg ttggtgatgt ctacccatgt ggcatgtcca gtaaagctct     33660
     ctggcttcgc tgtggacggc gtagaaggtc tcctgaacac gattattggt gtgcgcgagg     33720
     cgtacaacca agatttggag atcctgggca tcgtgatcaa cgacatggac cgctctgtca     33780
     atcacgacaa agccctcaag tcgctggaga acacagttcc ggatctgttg tttgagaaca     33840
     aaattatgca ccggcctccg ctcgatacgg cgacgactga tggcatccct gtctgggagc     33900
     ttcgctatgg acatgtcgcg gccaaagaag ttgaggcggt gttggaagaa ctattagaga     33960
     aggtgggcta agcgatggca ttgaacaatt taaaaggcct gtccgaactt gctaaagccg     34020
     ccaaaggcaa gaaaggcaaa gaggttctta ccgtacctgt tgacgacgtt gtatccaagg     34080
     tccaggttcg taagcgcttc cgtaacattg aagagctggc ggcaaccttg ctgaccgaag     34140
     ggcagcagtc tccgatcatc gtgttcccga agaacgaaga aggcaagttc gtcatccaaa     34200
     aaggggagcg gcgttggaga gcgtgtaaac acgctggtat cgagaccatt gacttggtgg     34260
     tgaatgataa ggtccagaac aacttggacg agactgctgg tgagctgatc gaaaacatcc     34320
     agcgggatga cttgactccg gtagagattg ccgaggcgtt aaacctgttt attgaagaag     34380
     gttggaagca aaaggatatt gctgatcggc tcggtaagaa tatcactttc gtatctacgc     34440
     atctgtcgtt gctcaagcta cctgactgtg tgcgtgagtt atacgataat gaagtatgtt     34500
     ctgatacaga gaccttgaat aaccttcgtc tcttgttcga tctgaatgaa gaaagatgtc     34560
     gcgccgtctg cgcggtggct atgtctgacg ggattactcg taaacaaagc cgtgagctgc     34620
     tgaatgatgc caaacgtatc aaagacgaaa tggaaaaagg cccactgact ggctcccacc     34680
     agaatgatga gcttggcgct ggcaacaccg acgagcaatc cctcaactcg ggtggggatg     34740
     gtacgtcgga acaaaccggg aatgacgacc tgaaccttgc ccaggaggaa ctggaagggg     34800
     gtaaaaattc caatggtcag gacgatgatg acgaagaccc tttgcgtgat gaagagggtg     34860
     agcacaaaga tcctgtcaag cagccagata acagcggcaa ggacaaagat gaagaaggcg     34920
     gtgatgctct tcctcctctg ccgaaggaca aggaatggaa gaacgtccgg gctgacagtt     34980
     tgatttttgc tgtcaacgtt aacctggatg gcgagaccaa acgtggagtc atcatgaccg     35040
     accgtgttgc tctggttccg tctactgtct gggttaaaac gctcgatggc gaaggcaagg     35100
     aaaagcatgt tcatgtgcct gtgtcagaca ttgaactcct gagtgtcgaa ggctaataaa     35160
     ggaggcccag ccagagaggt tgggcctgtc aagaacaggt gaatatgaag atctcacagg     35220
     acatgaaaag aaaatttgct ttggtgaatg ccctgtctaa aacggagaag ccaagtctcc     35280
     aagaccttca caaggcaaca aatattcctg aatcaacgat caagagacag ttgtctgccc     35340
     tgcgtgatga gttcggaatg aatatcttgt tcgtcaggga gtctaccggc gaacgaggtg     35400
     ccaccggcta ctacatgctg acagactggg ggatcttaga caggtcttcg ttcttgaacc     35460
     ggtacggaaa actgtaaggt gccatagagc agcgcattga atgcaaaacc cgccaatcgg     35520
     cgggtttttt tatgctgcca cggtagcggc ggttgctgga ggtttttcgg cgtagtaggc     35580
     gatgttcttg gttcgtctgc taagggtgtc tatgccgacg atactcagcg ttttgggagt     35640
     ggtattgcgg gactcgaaat aatggaatag ctggatcatg cagcacttca ccatcaacgg     35700
     atcgatgtct tccaggtaga ttgaggcttc tctcaatgct tcgggaccgt ggttctcgat     35760
     caggttttcc atccagtgaa tggcgttgat gccagaacca cagcagggct cataaaagtc     35820
     tgccgaagac tgtgagccaa caatgagtga catcaagcgg ccaatctctg gaggagtggg     35880
     gaagtaattg gtgcccttct tgtggaagcc agacatgctt aggacgtaac ccaaaacatc     35940
     gctggtgggg tcgcgcttaa tggcggcaga caggacgtga gagagctcga aggcgaccgg     36000
     ctgaagttct tccgggatct cctccttggc tgggtatagg ccagtctgca agtatgccca     36060
     ctggtcaata aaggcctcaa caaaccgaga tgtgcccatt ctgtatcggg actgctcgat     36120
     gagagataaa gccttggatg taagttgctg tgtttctggt gacataagcg ctccagtttg     36180
     ttctgacgaa acattcaaga ggtagaaacg aagaaccccg ccgaagcgag gttctttgct     36240
     ttcctgcctg atcgccttaa tgccgaagca aagacgtctt gataaagtcg gggcaaccgg     36300
     acatttcccg gtcgatgaag tcctgacgtt tcgccagcgg ccatttcatg aacgccgcga     36360
     gcgggatgcg cttattcgtg ttagtattgc cttgcagcat aacaaagctc cttaattgct     36420
     tgattgtgtt gtaagggctg caacgaaggt cgaagagcga tgcggccctt atttatgatt     36480
     attacagcat cataaaataa tatcaagaga caataaaacg ataccaagaa acaaaacttt     36540
     cacatgtgaa agtctccccg ctgtccacct cgcacactcc aaacgcccaa acgcccaaat     36600
     aacttgtcta tctgcccaaa atgggcgcgt aagcgtccga tagaaagtaa ttgttagtga     36660
     gatattgact acacggaata tggctatatc atagaatcat aaaatgatgc tgtaaaagtg     36720
     atatgtatgc caaagcaagc aaatcatctc cgtttgaaga aaccttgcgc caactgtcca     36780
     ttccggaagg agggcgctat cgagctggcc cctgggcgat tagaaggcat catcaacgac     36840
     atcgttgaaa acgacatgac gacgtttcat tgccacaaga ccgtgcactc aaagtcaggt     36900
     ggtgaatggg atgaagaggg taactatgca ccttcgggac aagagtcgat gtgtgccggt     36960
     gctgcggctt acttgatgaa aataggcagg ccgacagtgg ctatgcgaat tgcctttgcg     37020
     tttggtgatg caaaggtgtc cgactgggac gaagctcaag agctggttgt cgagcctttg     37080
     gtacaagggg accgaaatga gtaagcgata tgcggtagtg ccgcatccga aactgaaacg     37140
     agagtacaaa ggtcggctgg tcagaactac tcgggtacta aaaaacggct gggggttgat     37200
     ccctctaggg gctgtggcaa cggtcacgca tcagtctccc aagggatcag aactgacctt     37260
     tgaaccatgc gactgctgcg gcctgaaagc cattatcagt catgtaagca tggactccat     37320
     tgaatttatc gaaccgatta ctgaggaaga agatggacga gaacaagctc aacattgaaa     37380
     cggtcgatgg gcacaacgag ctggtagtca gctttttgtc cagaatggta agcctgagtg     37440
     acgaggaaaa gcagacagta ttgtcctgcc ttccggacac cggcaaacaa acaatcaccc     37500
     agctctatga ggcgctgcgt tctcaagggc accaggatct tgcagagaaa gtcgaaccat     37560
     acctccagca gggggtgttt gggccgatct tcgataacgc caagtccaag gtgttcgttc     37620
     gggacgaagc gccttttttc ctcatggatg aaaatccttt gaactgggat gacgctaaag     37680
     cattcaatcg cctacgtatg agtacgacct gtgttcttgg ccgtggcggc tggactatcg     37740
     gtgagcgctt tgatgaccgc tttgataccg aggtgggcgg aacacagctt atcgtcactc     37800
     agtcactcaa cgaaaaaggt gagattgaag gaggacttcc tacctcgatg tcgctgaatg     37860
     actttgctga gttccctaaa cagccaaggc ctcctcaaat agtcgattac caggaagaca     37920
     agcgatacac gcttgaggaa gcggaagcta tccctgagct cgcaccagtg gttcagcgtc     37980
     tgaaagagcg catcgaagag tatgaggaga gaagagccca tgattgacct gacatgccgc     38040
     ctttgtgctg gttccggtgt ttatgacttt tccccttcca aagaaacctg cggtatgtgc     38100
     caagggcatg ggaaatttgt tgacgccaaa gcaatgctgg tggctgccat cgagctggca     38160
     aagaagcaac gcgagcctgt cattgaagtg gtaatggggt tggtgctcca gggtgtggat     38220
     gttagaggga aggagcctgg agagcggttc aaggctgctc aggcctttaa cgccccaggg     38280
     cacaacctat tacgatacgg gtgggatgct tgggagctct atgccctcca tgagggtgta     38340
     agtccagaac ttgcatcgct tggccgaagt gtgatgcgcg agtggcatag ccattcatgg     38400
     ggccggttca gtggagaggt aggctttaac gccgccgaga tcatgatcaa acaggccaaa     38460
     gacaacccag aaaaagcaga agagcgctgg gcgttcctgc ttagtgaaga atggatggtg     38520
     gagtaattgt cgtgacagaa caaaccaata agaaattgat gctggatgag tctccagata     38580
     tgcccctgca attcaagtgg agaaagtttg gtggtgcgat ttttactgcc acgcaaacaa     38640
     tggagcacgt caaggaagga cgtaagctcg ggccgactcc agcagggatg ctacctcaag     38700
     aagtgtggct gaaccgcctg atcgctatgg aagaaaccct gccacgaggg aagttttttg     38760
     acagattccg ccgccgcgac aaaaacgagc agtatgactt ggccgccgat catctccgtc     38820
     ttgtcggaaa gaaaaagcga tagggggata gatgaaagcc caggcatacc caccatcagt     38880
     cattcgtaaa ggcgctgtgt tgtacgcagc cctttattac atctctgatg atgataaagc     38940
     aaaggtcgag gttacagagt ggatagttcg ctctattcag aaacgacgca actcaaccag     39000
     cgatcaacgc tatgtcaatc ttgcccaaaa gttagatggg attacgtggg ggaaaaggtc     39060
     acggaagaat ggggactttg gttggttgcc atctataccg agctggtgct tgaagcagtt     39120
     ccgggaaggt ggcgaattgc cttttggcgt ttatacgacg cgactggccg ctctcaagtt     39180
     tgcgaaagtc agcttgcagg aagaggtcca atattgcgag gccgagctga aaaaggctca     39240
     gacagaagag gatactcagg aactccaaga ggagctggcg gagaaccaga gacttctgaa     39300
     agctgctgga gcaatggtga agcgcgagca aaacaagaag aaaagaggtt gaccaatgtt     39360
     accgatcgtc tccccctccg tagtaaccaa acaacttgcg ttcaatcgag taggcgataa     39420
     acgcaaggtt agggtttcgt ccaacttttt ggatgttatg gggttcaagc caggtatggg     39480
     catcgccgtt gagccagggg aggggatggg cggtttttcg gtgatcccag cgaccgatga     39540
     actacagaca caccaggttt atcagcgccg gtatcaacca aagagtcgct ccaacaaccc     39600
     gctggaaacc gttattgagt tttctggaca agggctcata gataagtgct tccctcgcta     39660
     tacagagcgt ttccacgtcg aaatgcgaaa aggtcgagta gtcttcactc ccgtcgcaaa     39720
     cagagccttt gccattgctg atcggttcag aaaaaccagc cctttccgtg cctttgtggc     39780
     attgactggc ggggtagaca ttcatgttat ggaatcgctt ggctggaagg ctgagattgt     39840
     tttggaacat cgtccagttg aagccagaga cagagcatcc gggcggaacc tgagtgaagt     39900
     acatgcgctc aatacgctgg tgaacagctc cccgcgtatc ctgctgaatg aagacattca     39960
     tcacctggag ctggatcgcc ttggagcctt gctggcggag tgcccaccaa ttggtttggc     40020
     ccattactcg ttggggtgtg atgaccactc aaacgccaaa agtccaaggg acaaagagcg     40080
     ttctcttgaa gatctctcca ccatgctcga catggtttac ccggcactaa aacagatcga     40140
     ggtcgtgaac cctgccgtcg tgctggtgga aaacgtcccg aacttcaaag catccggagc     40200
     cggggcgatg atgggaacga cactgcggcg gatggggtac ttcctcactg agatggtctt     40260
     gaacggtctg gatttcggcg cgtaccaggg gcgagaacgc tattacatgg tggcgtcggt     40320
     cttccctggg ttcgttccac cgaaacctga gcagagagct ggtggacgat tgtggccggt     40380
     gatcgagaag cacctcgggg attgtgcaga cgtcacagcg ttgaagtcaa ttcaggccag     40440
     agagtcaact tctcgcagga tgcctgcgtt cttgacgaga gaaagcacca gttgcccgac     40500
     catcctcaag tctcaggatc gtggggtaaa ggatgcagtg tacatccaag acggtggccg     40560
     catttacaag ccatcggtcg atctggttca ggagttgatg tcgatacctg atagctttga     40620
     tatttcgtgg atggcaaaag aacaagcgac agaaacactt gggcagagtg tggattacag     40680
     attgcattca gcggtcatgg ccgcagttcg ggatcacctg aatgtgaatt gcggtcgcca     40740
     taccgtggtg cagcacggta tcagaagtaa ggaaggtaaa taatggcagt catttactac     40800
     ggcgagggaa cccatgacgc cggtttcgtc gggttccgtg tcgcacgaac agttggggtg     40860
     gcggatgatt accggcagga atacttctcc ttgagagagt attcctacgc aacagctcac     40920
     cggctggcct acagcttgga ccgaaagtgg gaagctgagg cagaagaggt gaagcgtcag     40980
     aataagactt gtaagcggcg acgcaactcc gggccaaata tcattgctga ggggctgagg     41040
     gcttatatca gtatcgagaa ccggagccgg atgggggtga agagaaccta cttcgcacct     41100
     tgttttctcg tcacaaagcc aggctacggc aatggggata ttgttttcag gatttccact     41160
     catggctacg cagaagccta cgaaaaggcg gtggaaaaat attgtgagat ccatgatttg     41220
     acggatgagc agtatgttga gttgcttgac cgtatgccga gtacagaggt gttcactgga     41280
     tacctgctga atgctctttt aatacgcggt catcgcgcca caaaagctga aatactgagt     41340
     aagctggggg ctgcgaagaa tgaagatgac atcaccaata gcaaagggaa aagcggccac     41400
     aacagagtgc gttgcccaga gtatcggtgg gcgcaataac agcgccagat gttcaaacca     41460
     tgttttatag caacacctct ttgggggcgg aattatgttt tttgataaca aagtagaatc     41520
     tcactcgctc gtaatgggag ccagcgggaa gggcaaatcg gtcttgtccg aacaagtgcg     41580
     gaaaaacgcg aggctgcgcg gtgatctgct ggtggatact gagatgtacc gtgaaggtcg     41640
     agggttgaaa ccatacgagc atgagtacgc tcgtcgctta gttctggggc taagtggacc     41700
     gttgccgcgt gaactgcgtg ggaagccggt gacggttatc tctgatgtgt ccagaccaaa     41760
     aaaggtaaag cgtcagccaa agcaatttgt taagaccgta aatggcgtca cccttgaacg     41820
     ccaattggtg gcagatgcaa gagaccagtt ggaaatgcaa acaggcgtct ggctcaaaca     41880
     acctcagctc atcgagctga tggaagagtc gggcatagac gaaactctag ccgattttgg     41940
     tgaggctgaa acacagatcc gagaaatgct ggcggatgcg ttggcgatga aactggtagg     42000
     gcgctcatgg cccaagtgtg gagccctcta taacgcggca gaaaagtccg acgttaactt     42060
     ttcctccgag cttgatgctg cggcaaaaga agctggatac atggttcgct gaatgggatt     42120
     tggtgtggac aagatagatc ggcaaagttg gctcgttaaa ttcaggcgag cgaagtgtca     42180
     ggacacttta gacacgatgc gggatgcggc cattcgcaac tatgaaggga atattcgtgt     42240
     tatcgcggat attgtattgg cccatgaggc gagagagaca gaaattgaaa aagggatgtt     42300
     ttgtctaata gttagatagt ctgatgagct atcaggtggt gattatgaaa aagagaatac     42360
     ttcatctgcc cgtaaaaaag atttacttcg atcagatcaa atctggagaa aaaccagatg     42420
     aatatcgcct cgtcacagac tactggataa aaagactaga ggggcgcgag tatgatgaag     42480
     tccatgttaa gtgtggctac ccaaaggctg gagatatgtc caggatagag attcgtcctt     42540
     ggcgtggctt ctcaaggaac gtcataacgc acccgcactt tggagattat ccggttgaag     42600
     tattcgccat ccatgtgaat tgattttggt attctgattt aaaactattg tagctcaggt     42660
     atcaaaagaa cttgggtaat taaagataag gggccgacgg ccccttaatt gttttagttt     42720
     gtgaatattg aacaatcgag gtgggatagc gcttgttcgt agctaccttt gttgttcgtc     42780
     ttacgcagtg ccaccagctc aacaatcaat tggcttaaag ccagtgattg aggctcccag     42840
     acgcgcttgc atttgtcagc catgttggca tttacgtctg taatgacgta gaggaaatca     42900
     gggacgtctt tcaaggtccc caggcctttt gccatatcaa cagcctcagg gttttgatag     42960
     cttcgagtgg cgctcaggtc atcgtgggaa atatagctgg cagatgtctc agcgaaacct     43020
     aacaccatgc cttttcctgc gctttttgca atggccgagc cgatagctag agttggcatg     43080
     atggcctgac ctatttggcg ggtagatgca gttgccaagc ctgaggcgat gttcttcccg     43140
     gcatcttcgg cagtggcaga gctggttgtg agcatcgcag ttaaaatgat ttttccaaac     43200
     atacttaatt cctctatcaa tccataaagt ccgacttttt gaagggcata gtgcctttgc     43260
     aatcgggata cgctgtgcag ccccagaact tagaggctcg tttcttgcca ggggcttttc     43320
     ctttcctgag acgcatcggg ctaccgcaat ctgggcagtc tggacaatcc tccgccgcga     43380
     tacgtttctc gggtttccct cggttgtctg ggaacgtctt cttgcaagcc tcgttctggc     43440
     agccccagaa aaaaccgttc ttccctttga tccggtgcat ctctccaccg cagttgaagc     43500
     attcgtgtga aggaggcttc gcgccctcga aggctttagc catcgcgcca ccttctttgg     43560
     tcagaaccgg tgcggccact ttgagctgct caaccatttg gcagatccag gtggaaatct     43620
     gcttcatgaa gacagacatg ttcccggagc cggaggcaac tttctcaagc tcctgctccc     43680
     aagccgcagt catgccgggt gatttgatgg ctggtggaag cactgctata agcgcatgag     43740
     ccttatcagt tgcaagcagt acctttttct gacgcttgaa gtagccttta tcaacagcgc     43800
     cctggatgat gcttgcgcgt gttgctggag tgcctaaacc ggctgtgtct ttgaggattt     43860
     gtttgaactt ctcctcagtc acgaaccggg caatgttctc catcgcggca agcaatgtgg     43920
     cttcggtgaa gtgcggtgct ggccgcgtca ttttgtttgc cagctcggcc ccattcagca     43980
     aggcaggttc gccctggcta accctgggga gcttctcttg ttcaaccggc gcgtcggtgt     44040
     cttccccctc gtccttggga ctgctttcac tatcagaagc aaacaaaacc ttccagcctt     44100
     gtttggtagg tgtcttacca gcggacgcaa agaggtgacg cccacactgc acctcgatgg     44160
     aggttttggt gaactcgaac tcgctgtaga actgcgcgat gtagaaacga cggatggcgt     44220
     cgtaaagatt gaactcgatc tcagacatgg cactgatgtc tgttctggcc ggtgttggaa     44280
     tgatcgcgtg gtgcgcggtc actttggcgt cattgaatac cctggccttg cgatgaggat     44340
     ctgcgccagc caccagccca gagacgttct gatcggacaa aatgagcgcc tggagaatgt     44400
     ccggaatgtc ttccttttgg ctctcgggta gataacgact gtcagtacga gggtaggtgg     44460
     tcgctttgtg cgtctcgtac agagcttgag ctgcatccag tacctgctga gctgtgtatc     44520
     cccatcgttt gctcgcgtat tgttgcagcg acgttagatc gaaggggagg ggggctgact     44580
     ctttacctgg tttggtttct gctttgctga taacagcatt ggcaccattg acctgggagg     44640
     ctacctgctc ggcataggcc ttattgacgc accggccttg ctcgtcactg cactcttctg     44700
     gtggtatcca ttgggcggca aactgtccat tctgtacgga cacgttcaca cccagagtcc     44760
     agtatggtga gggggtgaaa ccggcgatct ctcggtcccg ttgacaaaca agagcgacgg     44820
     ttggggtgat aaccctgcca acgtgaagag tgtggttgaa gccgacatct cgggccagca     44880
     ctgtgtagag gcggctcacg ttcatgccta ccaaccagtc agcgcgttgc cgtgccaatg     44940
     cggcgtagta gagtgagacc gtatccttgc catcctttac gttgttcagc gctttcttga     45000
     tgcttgactc atcgagagcc gtcaaacaaa ctcggcgaat agggccagag tagcggaatc     45060
     gatccagaag cgaacgggcg atagcctcac cttctcggtc gtagtccgtt gagatgtaga     45120
     tggtgctcgc ctttttgacc agtccctcaa caattttgta ctgtttgaac gcactcttgc     45180
     gaacgttgta ccgccatgac tctggtgcaa tagggagggt ctccagtgac catgacttgt     45240
     agcgttcgtc ataatcgtct ggcatataca attccagcag gtggccgaac gcccacgtaa     45300
     taacgcggtt tcctccatca tggagaaatc catcacctcg ttgggaggcc ttcattacgc     45360
     cagccaaatc ttttgcctga gaaggcttct cgcagatata aaggtccatt aagcagctcc     45420
     tctcatcttt gattccagat tcgccagctc agtccagctt tgagccagac ctttgacttc     45480
     ggggtagtct ctggagaggt tttcgaggac tccagaaatg acataggccg cttcgctgga     45540
     attacccctc gaaccggcct cctggagcat gattaataaa gcgtcgaaga gctcagcctt     45600
     acggcctagc tctgtctggt ttcttatttc agagctttgc atgggttcac cactgaatag     45660
     ggacgcacgg actcgcgcac aatgcggcga tctgcgtcag ttacagcctg actggtgcaa     45720
     aagtgcgtcc aggcattcag ataatcttta taggtgtggg taggtggtat gcagccggtt     45780
     acaacgtcct tggggatgtt tgtggttccc tcggcttcca caaagcgcca atcgtgctcg     45840
     tccatacctt tgccaccatc gcaatagcgt tcccagcgtg acaactcgta cagcgagtag     45900
     cctttgcctt tattcatgga cttgaaggta ttgatggctt cgttgacatc cccgtgctgt     45960
     ttgatccctg ctggagtttt atctgaacca gcggagtcat ctttgacctt gttcatcgtt     46020
     gcgctgacat taccgtcgcc cagcacatgg atataaccag gttgacgtaa tgcagcacca     46080
     ccgcgcccca tgttgtccca tgccatcgac agttcccggc taactcgggc aggtttgtca     46140
     ttttcggcag gggcagtctg gggctgaggc ttttgctcgg gggcgttaga ggcacacccg     46200
     gccagaattg ccactcccag aattgctatc agttgtctca tcgtgtcgtt cctcataaaa     46260
     aattgtcgat gagcccattc taaaaggggg gggatggaaa gctggtttct caaactgccc     46320
     aaattggaca gataggcgtg tgtgcgatct aaaggtgttt tgagagcatg tagcgacgag     46380
     aaatacgata ggaatatggt caacctacat gctgaaagcc cttaacaagt tatttggtgg     46440
     gcgaagtgga gtgatcgaga ccgcgccgag cgtcagagtg ttgccgctta aagacgtgga     46500
     agatgaagaa atccctcgat acccaccttt tgccaagggc ctgccagtgg ccccactaga     46560
     caagatactg gcaacccaag ctgaactgat tgagaaagtg cggaactctc tcggtttcac     46620
     tgtggacgac ttcaaccggc ttgttttgcc ggtgatccag cggtatgccg cgtttgttca     46680
     cctgttgcca gcttccgaat cacaccacca ccgtggcgct ggtggtctgt tccgacatgg     46740
     gcttgaagtg gccttctggg cagctcaggc atctgagtca gttatctttt ccatcgaggg     46800
     gacgcctcgt gaacgccgtg acaatgagcc gcgttggaga ctggcgagct gtttctccgg     46860
     gctgctgcat gatgtgggta aaccgctctc ggatgtgtcc attacggaca aagacgggtc     46920
     aatcacatgg aacccgtatt cggagtcact tcatgactgg gcacaccgtc acgaaatcga     46980
     ccgttacttt atccggtggc gcgacaagcg acacaaaaga catgagcaat tctcgctgct     47040
     ggcggtggat cgaattattc cggctgagac tcgggagttt ctgtccaagt ctggcccgtc     47100
     catcatggaa gcgatgctgg aagctatctc aggaaccagc gtcaatcagc ctgtgaccaa     47160
     gctgatgctt cgcgctgacc aagagagcgt ctcacgggac cttcgccaga gtcgtctcga     47220
     tgtggacgag ttctcctatg gtgtgcctgt cgagcggtac gtgttcgatg ccatccgccg     47280
     cctggttaaa accggaaaat ggaaggtcaa tgagccaggc gcgaaagtct ggcacctcaa     47340
     ccaaggtgta ttcattgcct ggaaacagct tggggacctt tatgacttga tcagccacga     47400
     caagatcccc ggtattccac gagaccctga cacactggcc gacattctca tcgaacgtgg     47460
     ttttgctgta ccaaacacgg tgcaggagaa gggtgaacgt gcgtactacc gctactggga     47520
     agttttgcct gagatgctcc aggaggcggc gggatcggtg aagatcttga tgctccgact     47580
     cgaatcaaac gacctggtgt ttacgactga gcctcctgcg gctgttgctg cggaagttgt     47640
     tggtgatgtt gaggacgctg agattgagtt cgttgatcct gaggaagtcg atgacgacca     47700
     agaggaagat gtgtcagctc tgaacgatga catgttggcc gcagagcagg aagcagagaa     47760
     agctctagct ggtcttggct ttggtgatgc gatggagatg ctgaaaagca cctcagatgc     47820
     tgtcgaggag aaaccagagc aaaaagatgc tggatcaacg gaatcatcta agcctgacgc     47880
     tggcaagaag ggtaagccgc agagcaaacc gggcaaagca aaaccgaaga gtgatacaga     47940
     gaaacaaccc cacaaaccag aggcaaaaga ggatttgtcc cctcaggaca ttgccaaaaa     48000
     cgcaccacct ttggcaaacg acaatccgtt acaagcactc aaggatgttg ggggtggact     48060
     gggggacatc gactttccgt ttgacgcatt cagcgcatcg gcagagacag ccagcactga     48120
     cgcaacaaac tcagaaatcc cagatgtggc aatgcccgga aagcaagaga agcagccaaa     48180
     acaggacttc gttccacaag aacaaaactc cctgcagggc gatgactttc caatgttcgg     48240
     tagttctgat gaaccgccat catgggcgat tgagccgctc cctatgctga ctgacgcacc     48300
     agaacaaaca acaccagcgc cagcaatgcc acctacggac aaacctaatc tgcatgagaa     48360
     agacgcaaag accttactcg ttgagatgtt agccgggtac ggagaagcat cggcgttgct     48420
     tgaacaagcg atcatgcctg ttttggaagg taaaacgacg ctgggcgaag tcctatgcct     48480
     gatgaagggt caagccgtca ttttgtaccc ggatggcgct cggtcgctgg gtgcgccgtc     48540
     agaggttctc tcgaagctgt cccacgccaa cgcgattgtt ccagacccga ttatgccagg     48600
     tcgcaaagtt cgtgatttca gcggagtgaa ggcaattgta ctggcggagc agctttcaga     48660
     tgcagtcgta gcggccatta aggatgccga ggcgtcaatg gggggatacc aggatgcctt     48720
     tgagctcgtc tctccccctg gcttggatgc aagcaagaat aagtctgcac cgaaacaaca     48780
     aagccgaaaa aaggcgcagc agcagaagcc tgaggttaac gccggtaaac cctcgcctga     48840
     acaaaaggcg aaaggtaagg actcccagcc acagcagaag gagaagaagg tcgatgttac     48900
     ttctccggtt gaagagccgc agcgccagcc ggtccaagaa aaacagaacg tggctcgcct     48960
     tcctaagcgg gaggttcaac cagtggctcc tgagcccaaa gttgagcgtg agaaggaatt     49020
     gggacacgtc gaggtgcgag aaagggaaga gccagaggtt agggagtttg agccgcctaa     49080
     ggcgaaaaca aacccgaaag acatcaacgc ggaagatttc ttgccgtctg gtgttacgcc     49140
     tcagaaagca ctccagatgc tcaaggacat gatccaaaaa cgctcgggca gatggctcgt     49200
     gacacctgtc ctggaagagg atggctgctt agtaaccagt gacaaagcct tcgacatgat     49260
     tgccggtgaa aacatcggca tcagcaaaca catcctctgc gggatgctga gccgggcaca     49320
     gagacggcct ttgctcaaga aacgtcaggg aaaactgtat ttagaggtaa atgaaacatg     49380
     acaatgagtt atgacccgct cgcctacgag atgccgtggc ggcccaacta tgaaaaaaat     49440
     gctgtagcag gctggcttgc cgcctccggc gcggctttgg ccgtagagca agtcagcacg     49500
     atgcctccgg agcccttcta ttggatgacg gggatctgtg gcgtgatggc gatggctcgt     49560
     ttgccaaagg ctatcaaact tcacctgctc caaaagcatt tgaaggggcg tgatctggag     49620
     tttatttcta ttgcggagct ccaaaagtac atcaaggaca cgccggacga tatgtggctt     49680
     ggtagtgggt tcctgtggga aaaccgccat gcccagcgcg tgtttgagat cctgaaacgc     49740
     gactggactt ccatcgtagg gagagagtcc acggtcaaaa aggttgtccg gaagatacag     49800
     ggtaagaaaa aggagctgcc aatcggccag ccctggattc acggggtaga acccaaagaa     49860
     gagaagctga tgcagccact caagcacact gaggggcatt cgctgatcgt tgggaccacc     49920
     ggctcgggca agacccgtat gttcgacatc ctgatttcac aggccattct gcgtggggaa     49980
     gccgtgatca tcatagaccc gaaaggggat aaggagatgc gggacaatgc acgacgtgcc     50040
     tgtgaagcta tggggcagcc ggaaagattc gtctcatttc atccagcatt cccggaagag     50100
     tcggtgcgta tcgaccctct gcgtaacttc acccgcgtga ctgaaattgc aagtcgtttg     50160
     gcagcgttga tcccgtccga agcaggggcc gacccgttca aatcatttgg atggcaggca     50220
     ctgaacaaca tcgctcaggg cttggtcatc actcatgatc gtcccaacct gacaaagctc     50280
     cgccgattcc ttgaaggtgg cgctgctggc ttggtcatca aggccgttca ggcttactca     50340
     gagcgagtta tgcccgactg ggaggcagaa gcagcggctt atttggagaa agtcaaaaac     50400
     ggttcgcgtg agaagatcgc tttcgcgttg atgaagttct actacgacat catccaacct     50460
     gagcacccaa actctgatct ggaaggcttg ctgtcgatgt tccagcacga ccaaacccac     50520
     ttctccaaga tggtggcgaa cctcctgccg atcatgaata tgctgacgtc cggggagcta     50580
     ggccctctgc tgtctccaga ctcatctgat ctgagcgacg aacgccagat cactgattcc     50640
     gcaaaaatca tcaacaacgc tcaagttgct tatctggggc tcgactccct gaccgacaac     50700
     atggttggta gtgctatggg gtccatcttc ctgtcagacc tgacagcggt tgccggtgac     50760
     agatacaact acggcgtcaa caacagaccc gtaaatatct ttgttgatga ggctgctgag     50820
     gtgatcaacg acccgttcat ccagctcctg aacaaaggtc gcggtgcgaa acttcgtctt     50880
     ttcgttgcaa ctcagacttt tgctgacttc gcagctcgac tgggtagcaa agacaaagcg     50940
     ctccaagtgt tggggaacat caacaacacg tttgctctgc gtatcgtcga tggtgaaaca     51000
     caggagtata tcgcagataa cttgccgaag acccggctca agtacgtcat gcggactcaa     51060
     ggccagaact cggatggcaa ggagcccatt atgcacggag gcaaccaagg cgagcgtttg     51120
     atggaggagg aagctgatct gttcccagcc cagttattgg gaatgcttcc gaacctggaa     51180
     tacatagcca aaatttcagg cggaacaatc gtaaaaggcc gtctgcccat attgacccag     51240
     taagagcaga gctatgtgtg acaagaagta tagaaattac gaggtagcca tcatggtcga     51300
     tgtgaaccct ttcgacaggg ttatgaatga attgaaaagt cgtggccgca agaacgctca     51360
     catcctgagc atcctccaat tcgactggcc tgcatcggag gccatcatcg agaagctgag     51420
     ctgctacatc acagacggga ttaaggctaa tcaggagcct gtgatttacc cgatcattga     51480
     agaagctctg catcgctaca gccagctcgt gtttcatgag cagagagaga aatatgaaga     51540
     cccggccaga attggggcat ttctggaaac cctgatcacc gaaacctgcc gggcgttgga     51600
     agtgcaaatt gtcgatagtg gcggtgattc atggtctgtc gattcaggag agtcgttctc     51660
     actgtggctt tcttcccatc caggagaact atccattaac ccgcagcccc atgaggatga     51720
     gacctctttg cgtggcttgc tgtatgagct catcacctgt gagagcgtga aaactgtttt     51780
     aaggagaacc gactatgaag aagccgtggt tgctggtcgc atggctgctg gttattgagt     51840
     tgctggcaat attgctgctg atccctggcg actggacaga cagagccatc aaaagggaat     51900
     ccgagctggt ggaacagagt cttggtgtcg aagcaagaga ctggatacag aacaaagcat     51960
     ctacctggtt caggtcgagc gttattgatt caggattcta tgaggggatg taccaaacgc     52020
     tgatcccatc agaagaggag cgccagaagt ccaaggggat gcaggacatg ggcaagggct     52080
     ggtttgtgtg ggtcaaaggc cgcatggaag cctttgtcaa cgtcatttac cagttctaca     52140
     caaggttggc actgttagcc gcgtgggctc cctatatgct gatcctgttc gtacctgcgg     52200
     tatatgacgg gatgatgaca tggcgaatta agcggaccaa cttcgattat gcgagtccgg     52260
     ttctccatcg ttacagcgtt cgcggaacga tgtacctgat ggccggattg ttcatcgcgt     52320
     tcttcatccc catagcgctc gatccggttg tcatcccgat gacaatgatg acgtgctgtg     52380
     tcctggttgg cctgacgttc ggcaacctcc agaaacgggt atagggaggg aggatgagct     52440
     actccgttat aaatcaagat ggggtgcatc tgtgcgacat cccattgaac gtctaccagg     52500
     tgatacgtcg ccaatccttg tctgcgttgt ggctttactg ggcgcagagc ttgaatttgg     52560
     tgaaggtgct cattgcttgc gtcggaaaga tgatctttgt gatgccggta atgtggttct     52620
     gggtgctggt ggtgtgccgc ttggttgaac cagaacgtat ctcagacgtg tcaggactta     52680
     tctctccgga cgtgatcggg tgggccgctg gtgcggccat caccctcatt atcttttccg     52740
     tatttacacg cccagcgttg tacggatacc acaacttttt caagcagcat atttgctcaa     52800
     gagtaaagca agtaacgccg gaactcagaa cagtcactgg gccactgttc ttttaccgaa     52860
     acgaaattgg aacgatatag agaggaacca tgaaagtaac taatagactc caactgctgg     52920
     cactggggct gtgtatagcc ggtactgcca tcgcggctcc tgatgtgctc aatgacgacg     52980
     caaagctcaa gaaccttgag aaggtgtgtc ccgactgtca gatggtggca aaagatgtac     53040
     tcaatctgcg ggttgaaaac tgccagctca aagacacttc cagtgcaatg atgattggca     53100
     ccatgcaaaa tgaccctatg ttttcgttta tgctggctgt acacacagcg gcaggctcgg     53160
     aggcatacaa aacggtagtt ggtgccgctg gcaaccatgt tgactgtgaa aacccgttga     53220
     actggatcaa gctgacccag caagcgatta aaggtggcaa agtctaatgc gtaagagaga     53280
     tttctttttt ggagaggtgt atgaggggag tggaggagcc actctacgac tgagtgatat     53340
     ggaaccattg gcaagaaaag tgtcggcaga gttcttcact gcacaactga accgtatact     53400
     gaaagagcat gacggtcagt tgacgctcag cgatggaacg tcgtacccca gcttttggag     53460
     cttcatcgac aaggttgatc cagagcaggt tggtttcgtg gagatctacg ctcggcagga     53520
     tgttaacgat aatgttgaag cgacactggc gtgtgacatc gttttggtaa atggtgtgat     53580
     caccgttaaa cctcactggt gtgcttacaa agacatcagg gctgacgaag tgatttccac     53640
     cttactggtg cctttgcatt tgaaggctct ccagggtaag gcttacattc gctgggatga     53700
     tggtgaaacc gaacctctgt tacaaaacga cgactatcag gctgaacttg aaaatgtgtt     53760
     tagtgtttcc aagtacccat cagccatgag ctggggcgat acagcagacc agaaggttaa     53820
     gcagtacaag atggaccttg agtgcgccac agatgttggt cgtcgaggtg tctcatcaga     53880
     gcaagcatgg gatgcttatc gagaactccg ttacaataga acagtgtgaa acaagcggcc     53940
     atcggccgct ttgaactttc acatgtgaaa gtttttcgcc tcccgctctt atcatctcct     54000
     cgaataaacc tccataaagt gcccaaaatg ggccgtaaca gcactgttcc tagattgatc     54060
     aattaagaga cgattactcc gtgatgacga caagttattt ggagggtcta tgtccgcaca     54120
     agctcacgtc agagaaagcg aaagctcatc tggttcattc atctcctggc agttccttgt     54180
     ctggcaggtg atgttcgtta taggtgttgt tgcagggatg aacctggaac acgcattcaa     54240
     ttttctaggt taatgggagg aagtgtgaac cttaataaac aatttttctg gtttttgatg     54300
     aacgcggtgc tgatgtgcat cttcatcgtt ccagtggccg tcgcgttttg gctgtctgct     54360
     tttgcggcag gttttgactg gagtcagtgg gttaagttgg ctgctgatac ggccaacaga     54420
     gctgcaagtg acccggccaa ggctctgggc acggttcaga cctactgggg cattctcagc     54480
     ttcttcctgc tggcggcgta cagtctgatg ttcaagttta aagccaatgc taacaaggaa     54540
     gtgaaaactc tggaggtggc ccgaccagcc aatgaagtta gcgttgcggc ttcggaaaaa     54600
     cattcggaag cggttcctca aaatcaataa ccgatccagt aaacgcaaaa aaggcggctt     54660
     aggccgcctt tttttatttg tcgctggaag tgcccgaaaa gggcgcgaag ccgtggcaga     54720
     aaatcagtga ccctgaatga gaatacaggc cactaggaaa agaagagggt tgctatgaag     54780
     cctgtaaaga taccgcgccg ggtcgatgag cccccgcatc tgctgttgtg gagcgcagat     54840
     gagttggccc cgatgctttt ggggctaacg ataggggtca tcatcggtaa ggctctgatc     54900
     tgctttctgg gggggttact tgtaaccaac ctttatcgcc gattcaggga taaccatccg     54960
     gatggatacc tgctccacat gatctactgg gccgggttca tcatgaccaa ggccaaatct     55020
     ctcaagaacc cgtttgtccg gaggtatttg ccttgaacct gaaaaagtat ctcaagacct     55080
     gggaagggac ccaaacagaa aataagtggg ggcgaatctt ccagggtggt cttattgcta     55140
     tcgttttcct gctggtggtc caagtattca gcaaggaaac catcgtcact atccagcctt     55200
     tcacgctcac ggaagaagcc tgggtgacga aaagtaacgc ctctcagtcc tataaagagg     55260
     cttggggttt cgcttttgct cagctccttg gcaatgtgac gccaggaacc gttgactttg     55320
     tgaaagaacg gatcaccccg cttctctccc cgagcatcta tcaggacgtg attgatgcca     55380
     tcgaaattca agctcaacag atcaagaacg accgcgtaac catgcggttt gagccgcgtt     55440
     ttgttgagta cgagcccaag agcgacaagg tgtttgtcta cggatattcc tacgtcaaag     55500
     gggcttcttc taacgaagag cgtagcgaac gctcctacga gttcgccatc aagatttcaa     55560
     actacgcgcc cgtgctggac tacatcgaca cctatgtagg aaagccacgc accaaaactg     55620
     ttttggagca actccagcgc aaagaagaaa accggagaaa gcatgaagaa caacgctaaa     55680
     ctttcgctcc tggcgctgtc cttggcgctt ggaacttcaa tggcctatgc ctcggatgac     55740
     attcctgttg tcccggccag tgttatgaaa aaggatgttc ctgcccctgt gacgtcagga     55800
     caaagctccc atgaggttgt gggcagcatg aatgaaaacc ccttactgac gatgaagccg     55860
     ggggttaacc agatcatccc gatagccgtt ggtcatccga accgaatcgt cacgcctttc     55920
     agcaatcctg agatcgtttc aacatctctg accggggcga cggataacgg ccagtgtggt     55980
     gaggtctgca tcaaagagaa tgtggtctat gtcgccacgg ataagcagta tccggtgact     56040
     atgttcatta ctgaaaaagg ctcggaagcc caagctctca gcctgacgat ggttccccgt     56100
     cgtattccgc ccagagaagt ctttctcaag ctcgatggtg gtgtaggtat cactggtgct     56160
     tttgccaata ccaaggctga gacctgggaa cagagccagc cttatgtcga aaccatccgg     56220
     tcggtattcc gcaagattgc tcttggtgaa gtccctcaag gttacacgtt gaaccgcatc     56280
     cctgctggtg ctgcggtgcc gagctgcgct catcctgggg taaaggtgga tttcagcaag     56340
     gggcaataca tgatgggcca ccaccttaac gtgttcatcg gtgtcgccct gaacgtctct     56400
     gatcagccta ttgagttcaa agaggcgttg tgtgggagct gggatgtggc tgcggtgact     56460
     acgtggccgc ttaacgtgct tgagcccggc cagaagacgg agatctatgt ggcgaagaag     56520
     cagaagcgtg gtctcgcacc aacgtctaag cgtccatcgc tgctgggagg tgcccaatga     56580
     ttaagcgatt ttggacacag ttagacccca acaagaagcg ttgggtgtct atcgctggcg     56640
     gcgtcttcgt tctttttgcg gtcgtgacaa tgttctctgg tgaacccaag aaagaagaga     56700
     agcgcggtcg ccaagaaacc atcaagcacg ttctcacaga caaaaacacc cgtgagatcg     56760
     ggatagattc gttgtctgcc gatgtgaaga tggtgtctcg tgaaaactcc gacctgaaaa     56820
     aggagctgga acgagtcaag aaagagctgg aggaaaccaa aaccactgcc gggaaatcca     56880
     gtgatgttgg ccgtgagatg acccgccttc gtcaagattt ggaccgcctg acccagaaga     56940
     acatggaatt ggctaagaaa gtcgaaaccg gcgctgctgg tggaaaaaca tcctcttcat     57000
     cagaggatgc cagagccgat gttaatggtg catctggtgg tgatggtcag ttcatggaga     57060
     aaaagctcga ctacaaagat cctgcatcct tttttcggga cgcaccgctt cctgactcga     57120
     agggtggggc tcctgcaact ggcaagggag acggtcgtga tgcaactaaa ccaggcatcc     57180
     aaatagtgag ctactcgcag aaagcgccag aagttgaaga gaaggacaac aaggatgatg     57240
     agtctatcta cctaccttct ggctccatcc tgacaggggt gctcatcaac ggtatggacg     57300
     caccaacatc tcaaggtgct cgtcgagatc cgttcccttc gaccctcagg attcagaaag     57360
     aggctatttt gcctaaccgc ttccgtgcgg atgttcgtga gtgcttcctg attgtttcag     57420
     gctatggaga tctcagttca gagcgagcgt acctgcgtgg cgagaccttc tcgtgcgttc     57480
     gggatgatgg gggtgtcata gaagcgaagc tggattccta tgcagtgggt gaagacggta     57540
     aggccggtgt ccgtggtcgc gtcgtatcga agcaggggca aatcatcgcc aagagcttga     57600
     tggcaggctt ccttggtggc gtttccgaag cctttgacgt caatcctgtg ccggtcgtta     57660
     gcactaaccc tggctcaaat acccagtacc agtctgtgtt ctccgaccag atgttgcagg     57720
     gagcagcagt gaagggggcc agtaaggcgc tagatcgcat cgctcagttc tatatcgaca     57780
     tggccgaagg catcttccct gttatcgagg tcgatgctgg ccgtcaggta gacatcatcg     57840
     tgaccaaagg aaccaagcta caaattcgtt ccaccggggg aaccaagaaa tgaaaaattt     57900
     gaacattttg accagaaagg gcagttccag aggcgaggct caaaaggaac aggcagtaag     57960
     atccgcaaag atgttggggg tgggtgcagc gctacttatt ttgtcgggct gttcgacgtt     58020
     caacatcggc aaggatgagt atagctgtcc gggaatgccg aatggtgttc agtgtatgtc     58080
     agcgcgagac gtttacgccg caaccaatga cggaaatgtc ccgcgtccaa tgaaaccaga     58140
     ggaagtcgag gccaaagcgg aagcggatgg cgaaggttcc tcaaacgttt cagcgaactc     58200
     atctagctcc ggagacccgg tgattgacaa ctatgtcgca ccgcgtcttc cggatcgccc     58260
     gattccaatt cgtacaccag cacaggttat gcggatttgg gtagctccct gggaggacac     58320
     caatggtgat ctcatcgtga cagggtatgt ctataccgaa atcgaaccgc gcaggtgggt     58380
     gattggggat ggcacaccgc aaagtgagcc agttttgaga ccgctgcaaa cggtacaaca     58440
     cgaaccgaag tctgaaacaa ccaaatagga gatgttcttg atgaacgcaa atcagttggc     58500
     gaatgcctca agtaaaaaca acgcactctt cctcttcctg gggttgatgg tggtagcctt     58560
     cctgctcgtg ccggatcagg cccacgctgg tactggtggt acagcgtttg acgacgtatg     58620
     ggtaactctc aaggattgga cccaaggtac tttgggtcga atcgttgcgg gtgcgatgat     58680
     cctggtcggt gttgttggtg gtatcgctcg ccagagcctc atggctttcg ctatgggtat     58740
     cggtggcggt atgggcctgt acaactcccc gaccgtagtg gaatccatca tgtctgctac     58800
     tctggaacat gcagagaagg tcatcccggc tgttgtgcaa ctcagcaatg gcctgggggt     58860
     gtaaaagaca ccttgccgtt aatcaacggg tgataggggc agcctaaaag ctgcccttat     58920
     tttttggcaa aaagtccagt cataacaaat tccaactatt tccctagatt ctacgtcagt     58980
     acttcaaaaa gcataatcaa agccttgata aatatgcatt ccttcgaaat tcagctttca     59040
     cccattgggt gaaagaaaag tgctcaaaaa tatgttaaat tatcagcttt tatgactcga     59100
     tatatggtaa aataatagta agaaaagtag taaaaagggg ttctaattat gattaataaa     59160
     attgatttca aagctaagaa tctaacatca aatgcaggtc tttttctgct ccttgagaat     59220
     gcaaaaagca atgggatttt tgattttatt gaaaatgacc tcgtatttga taatgactca     59280
     acaaataaaa tcaagatgaa tcatataaag accatgctct gcggtcactt cattggcatt     59340
     gataagttag aacgtctaaa gctacttcaa aatgatcccc tcgtcaacga gtttgatatt     59400
     tccgtaaaag aacctgaaac agtgtcacgg tttctaggaa acttcaactt caagacaacc     59460
     caaatgttta gagacattaa ttttaaagtc tttaaaaaac tgctcactaa aagtaaattg     59520
     acatccatta cgattgatat tgatagtagt gtaattaacg tagaaggtca tcaagaaggt     59580
     gcgtcaaaag gatataatcc taagaaactg ggaaaccgat gctacaatat ccaatttgca     59640
     ttttgcgacg aattaaaagc atatgttacc ggatttgtaa gaagtggcaa tacttacact     59700
     gcaaacggtg ctgcggaaat gatcaaagaa attgttgcta acatcaaatc agacgattta     59760
     gaaattttat ttcgaatgga tagtggctac tttgatgaaa aaattatcga aacgatagaa     59820
     tctcttggat gcaaatattt aattaaagcc aaaagttatt ctacactcac ctcacaagca     59880
     acgaattcat caattgtatt cgttaaagga gaagaaggta gagaaactac agaactgtat     59940
     acaaaattag ttaaatggga aaaagacaga agatttgtcg tatctcgcgt actgaaacca     60000
     gaaaaagaaa gagcacaatt atcactttta gaaggttccg aatacgacta ctttttcttt     60060
     gtaacaaata ctaccttgct ttctgaaaaa gtagttatat actatgagct gacttccacg     60120
     tcggtgccgt aatcgaagat ttgctcgcag atgggcttat ccatctccca atccacagag     60180
     tcatgtcgcc atgaagcatc tggcccccaa ttcaggatgg tgctcatgat ccggatgtag     60240
     ttcaccgccg tcattgtgcg aggacgcaga ccaacggttt gaagcgatga ttcgaccttc     60300
     gtgcgaagct gtgcgagctg ctggagttcg ctttcagtcg ggttattgtt cttgatgggg     60360
     actttgcacg taacgaacag cttgaggtct tggatcaagc cattgtcgta gatacctttg     60420
     ttggtcttgg caaatatgcg atctgtcgtg tggtgctgga ggaagttaat ccgttccttg     60480
     ataacagatg tcagcagctc gtgacggaag ccatcacgca aacccatcat ccggtacatc     60540
     tcctgattga tgtccgggga gcggaacagg acaaactgga gcgtagtctt cgacgggaac     60600
     tcctgattca ggaaaccgtt cattcgctcc tgaacttttt catcggcacc acacaggggc     60660
     tcacacatga aaccaaagcc tgcactgtga tcatccataa ggaagacatg atcgtcttcg     60720
     tcataggcca ggacaggaat aatcccggca gctcgcaagt gctccgggat caacgtttct     60780
     tcgagtttct ttttgatggt tacgatcatt cagcactctc caaccatgat ttcaggttct     60840
     tcggacgtcc tttgctgaca cgaccatccg gagcaacaac gaacggaacg ccctcaatcc     60900
     caatgaaatg agctgtcagc agcgtttggt cgtattggcc ggggtcgcag gtttcttttg     60960
     aaggaaggga acccagggtg ttgttcatca gcgcatcaag cgcgtgggtt ttgtctttcg     61020
     cgcagtacaa gttttttgcc aggcggttgg actcagcacc cagagctgga atcacgataa     61080
     atttaaaggt gtaatcatcc accagcgatt tggcatcacc catgagctga tggcaaaccg     61140
     cgcacctagg atcaacaaag accaccacct ctttgtcacc acgccccatc gacacagtgt     61200
     tcagcgtgtc cacatccatg cccatgctct tgaagtggat acgctccgct acatccctca     61260
     tttgggacat cgtgttgagg ggcttcttgc tccacaggtc gtagatttgt cctgaaataa     61320
     caaatcgtcc gttttcagag aggaacatga tctgcccatc actttggacg gctcgaaccc     61380
     ctttgatggg tagctctaca atgtcctcta tcttcgccgc tctgggatcg gtgatttcca     61440
     atttcgatga cgcatgagcc gtgccggtaa taatcccgaa caccatcagc gccccaagta     61500
     attttgtccg catgtctatc ccctaagatt ggattactgg atgctgggca gtgtatccgg     61560
     gggatggaaa tagactcgcc tctgtaatag cccaatttgg acaattccag cgcgatacaa     61620
     aaaaaagccc ggtctgaacc gggctttgag aggaatgaac cttagttcat ggtaacagct     61680
     tcggatttgc ccccagagtc atcgacccca accagagaga tggtcggcat cgtttcatag     61740
     gtgcccttgc tgatagtcac tcgatcagag ctgatgctct gcaactcacc ggcaatggtc     61800
     cattcgtagg acttcatgcg gccatcggta tcttcgcagt tcgcatagac gatccacgac     61860
     ccaacggtct ctcgtgagct caggctacat gcaggcaact tgttctctgc aacattgatg     61920
     ttcacctcgc cctcagcttc atgccccatt tctgaggtta ttttcagctt gatgctgtgc     61980
     tcaccagcgc ccagagttgc tctgccgtag taaccactgc tttccaacgg tgtaccatct     62040
     accgaataaa cacgagtcga aatacggtcg cgtgggtggc cgccagaaat gtacggtcgc     62100
     aacagcacat ccagaggctc acgctcgtat ttgttcgagc cagagtattg caggtcaatg     62160
     gcatagggcg ctgcctggcc gatcttgagc ggttgctcga tcacggtctc atggccgcga     62220
     gcatcacgga cagtgacctt gatgttgtaa tcacccggct cattgatcac aaaggaccgg     62280
     acaatatcct gccgctgatc ctgaatcaca gcgccttccg gcaactccca ctcgtaggtc     62340
     ggctcttcca gcttgccgtt gaaggcaatt ggccgcactg acgcggtgat cgtcgcagga     62400
     gccacgtctg cgttcttcct aacctgcatt ccgaagctcg gccatacata ctgccaaacg     62460
     cgggagcgta ggctatgcga agcctctgca ccctgatctc ggtatccttc gatccaggtg     62520
     gtgtacttcg tttctacagt agcctgattg aggtcagtgt cagagggttc gtactcagca     62580
     gtatcaccct gcacaatcga gccatcaggc agcgtgaaga acccgttcag cttcacgtcc     62640
     atcccacggt aaggcaggct ggtttcggct ttgaacacat acttcttacc ggtctcaata     62700
     actcgcggcc ctgtcacgta aggacgaggt gccttcactg ctcggaagtc aaccgccgtt     62760
     ttcgcaactt cataggcata gccgtcatca gccggtgccg tggcagagcg cacacgagcc     62820
     cacaggcggt atcgggtttc ttcatcgctc gaaagcgtga tgctatcccc tgtctgcgcg     62880
     taggttttgc caccgtcagt agaccactca acaatggcat tgccaccgga gattggctca     62940
     tcgttcaacg tcaggttcgc tgtgtacttg ccttcacttc cgacaaacaa cgtggtcggg     63000
     ccgataacag caatatcagg tttgtcgtaa gcgacaacac tgaccgcttc ggtgtacttt     63060
     tccgcacctg agttgacgtt caccaccttg gcccgaacct ggtactcccc cttgtcgaag     63120
     gtcttcacaa gctgatactt gtatcgatct tctgggatga actgctccca ggttttaccg     63180
     tcgtccttac tggtttccca cacaacctgg ccggtagccc ggagatcctg acggtcgtcc     63240
     aaagatagct tgaacacagc agtgaacgga gcttcaccag acaacttgcg agcctccacg     63300
     ccagcaccga tggcaccacc gcgaagcact gtcaagaagg caggtctgat agacaactct     63360
     gtgcggttgt aaccctcaac agggctttcc agaacagcct cagcagcgat acggacggag     63420
     gaagtatcca caccagacag gtctactgag aactgagctt caccgttcga tgcttccgca     63480
     taatcagtga gcgcaaccgt ctcgttgtag gccttttgct ggatcaggcg tactttccac     63540
     acccccatcg tgttagcgtc atagtcacca tcaggtttgt actgatcacg gatgagaacc     63600
     ctaaccggca atgcctgggt gtcaatcgcg gtatcacctt taacttcaac gataggacgg     63660
     atactgtcag aaggtgcaga gatagcccgg tagacaacct cagtcttcac atcaggcacc     63720
     ttgttgtagg ccgcgttcac cttgtaggtg gtctcctccc acaacgctcg ctcatcggta     63780
     ttgatgcggc gatacacctt attggtggca ccccatcccg gagtgaaggt ctcagactca     63840
     agaacatccg agttgcgcga tatggcaata tccagatcag ctcgttcaga gttgataatg     63900
     gcatcaccca ggtagttacc tgtcatcggc accaagtaga tgttgtcttt gaagttgtag     63960
     tcggaggcta gttcaacggt cggagctggt gggtcaaccg cttcgacatt gaaagtctcg     64020
     tcgttcaacg tcaccctagt gccgttacgg gtgaaaatac ttacccgcca ccccagtgga     64080
     tgaacgccgt tggaggccaa tgaaccagag agcgaaggtg attccgataa cgggtcttgg     64140
     accaatccat cggggatctg ctgccactcg aacagacagg cacggcttgc actaccaaca     64200
     gccttgttcg cggcctcttt tttcgcacgg tctgcgctga gggttataga acagtctggc     64260
     cccttgctct gcttgaagtt cacatcaaaa tcttcaatga cgcgattcac ctgagcaatg     64320
     tcatcaatcg gggtgtagcc aacagagcca taggcagtag ttaccgtcag gttctgagag     64380
     ccagacccaa cttttacctt ggaaccgtca ccactgaaca ggtacaggct gtattcgaca     64440
     ggttgttcac caatgctcac agcctgcccc accagcccag caactttcat cccgttgttg     64500
     tcctgcgtag tttgttcagc ctcatctgga gttctgtccc actggagcaa acacaccggg     64560
     tcacgaattg ggtctgcggc catagccaca tcctctttcg tggtgaaccg gcaaggcaca     64620
     cccgactctg gcagggcata gattttcact gggtcaatga cctggcgaat tgtccatgat     64680
     tcagcagaga gcttagccgt ccctttccag gtattgatgt ccacaaccaa gatgggtgag     64740
     ttcggcgcgg aggtcatgac aagaaggctg gaagagccga ccacatcagg aacagcaggt     64800
     ttaaccggaa tgctcaaacg accacctgac gcaccgaaat catgttggct catgatcccc     64860
     attgtctggc ctggctcgat acgcacccca ttaaccacca gcggtacttt cgcatcagaa     64920
     cgtagggtcg caaacacgtc gtatgaacct gtcacgacag caccatcact gagcgtcagc     64980
     ggcttggttt cgatgatccg tttgccatct gcatgaacaa attcatgagt gacagcgggg     65040
     accatgacct tgccatccat cccatccgcc agcattacct gacgaggttt gtactcgaag     65100
     ccaacagcct tttgaaccgc attgccttgt gcatcctcac cggaaacagt cagcgtgtaa     65160
     gattcccctt ccttcaaaga agggaacatt accgggtact caaggcggaa tcgacctttc     65220
     gactcctcac gccaagacaa ctgcaccttg tcattggcag gcccccctac aagggcaata     65280
     gaggtcaatt taggtgaagg gtcgatagca tcagccaagg taataacaac atcatctaga     65340
     gtctggatag ctgctccatc tgccacactg agtgtcatgg ttggtggcgt tctatcagac     65400
     gttatctgga acattggttg tcgcgttaaa ggcccgtgca tctcctctgc tgcggcaaca     65460
     agactgtatt gcccctcagg gagagtttta agatcccact ggtaagtgta gttctcccag     65520
     ttgttggcta ttaacccacc agttggagac agcttgttgc ctttgctatc ttcaatccat     65580
     gcacttcgca gacgcagcct atcaaagtaa gcgcctcgtc ctggctggtt aacgaataag     65640
     gtaaatacct tgctattttg atcgaactgc tgacttagct gagggtagtg ctgatcgttc     65700
     cagttaacct ctgcccaaag aggattcgag cgaagagatt tatccggatt gaaaactgtc     65760
     gcattatcgt ggacgtaccc tgttgtgcct ttagccattg tgaagctatt tgcaatcacg     65820
     cagctatctt gaccaacagg aatttcacag cttcccctgt gaacggcagt ttgaacgtaa     65880
     ggccttggtt caactttgac acggatacta ctaacagtga caggaagaac agaattgttc     65940
     acccagtagc ggtaaaaact agaccatcct atatcactgt aattgtagtc cacacccaaa     66000
     agtctgggac ttttaggcgc tgatggagag agtgtgaggt tataagcaat accgcctccc     66060
     ccccactggc cgaagttcac ccaacgccaa taattgccgt cggtattgcc ataaggtgcg     66120
     gttgtgacga gataaacata gctggcatct tctcctacct tggacatctc tcccaaggca     66180
     ttggtcatat ttatcccacc ttctctatac tcatgccagt tatcacgcgg aacacgccaa     66240
     gctaacttga ttgggttagt tttaactgtc atgccctcag tgtaagcaac aaatccggtt     66300
     aatccagggc ctaagttgtt tgtacttgaa gggtcataaa caccaaaagg tgcagacgga     66360
     gcattggtta tgctatcaaa catcactttt tgacgaggtg aaagatagct atttccagcg     66420
     ctatcgctta tctcaaactg aagtgtaaac acttcatcca agtcagaggc tgggaaaaag     66480
     ccagattgga aagactgtct agcttgtccg ttagcgtcat cgtagttcac ggatacatct     66540
     ttgtagagtg aaccgtcttg acgatacagc tttgctttga cgcctttgat gggtgactca     66600
     tcagagattc ctgacagcaa aaaggcatta tcctcagagc cacctagacc cagtttccaa     66660
     acatcaccgc tagtaacctg cccatagtta ctataaaccg gggcaagcga agagtaggtt     66720
     ggcggcgtca catcgacagt aagagggtat tcatccgtct gtactgtaga accatcagag     66780
     gcaagaattt ccgccctgat agtgtatgcc ccaccaactg gagctggtag ttgaagttcc     66840
     gcaccatagt aggattttcc acccactgtg atgcgatcag tagccccaag aaggtggctg     66900
     gtcgctgtcg aaaccactgt tccatccgac cgaagcaccg aaatctttac ctttcggtcg     66960
     ataccggcac tcaaggcaaa cgagatattg cccgttgggt tggcatagtt ggcattcgga     67020
     gtcagagacc gttgcgtacc atctggagcc ttaaaggtgt attccagcag ctctgcatga     67080
     gcagcaccag cggtaagaac cgccagagcc ccaagcatcg ccggaatttt aggcttgaaa     67140
     ttgatcatcg cattctccat tcgttttgag ttacaagaac ccaatgctgg aggttacggg     67200
     agggagtgca taaacatggg ctgtggaagt gccctttttg agcaaataag gaaatcctga     67260
     attgtgtggg agagtgtgtt cagcgtggtg tgcttggtca agaccgaatg ggctacggat     67320
     tgagagggca cgatgggtgc atgctgtctg tctgctgatt gcagtaaaat tagtgggatg     67380
     acgccacaac tcataaaaaa aggtttaatt ggcggactgg agtgcgtctc gctaataaaa     67440
     ctgtataaat ccgcgatcac cagatgcggt ttccattgca aaatatgctc ttttgctaac     67500
     aggagattat tgattcctga taccagaaat gaggagctga acctgccaga atgattaagc     67560
     aaggcctcta tccctgtgcg ggtaaagtgg caccggtcaa tcactaaaat tttaagcata     67620
     aacgtttcgc attcagaaga ggggcaatcg actttctggt ttcagaaagc ccttcatcat     67680
     agagaactcc gatgagtgcc aaatgcggga actacgccgc taattatgct taattcttgc     67740
     ttttagcagg cggtgaataa aaaggttgaa attcattttc ttccgggcaa aaatgccatt     67800
     tcacacatta gctttgcagg acgacctgca aacgcttctt tcaccgggga cggccccatt     67860
     gttctggagc ctgatatgtc ctggatcgtt ttattaattg caggtttgct cgaagttgtc     67920
     tgggcgattg gcctgaaata cacccacggt tttacgcgtc ttacgccaag cattatcact     67980
     attgcggcga tgatcgtcag tatcgccatg ctctcttggg caatgcgcac gttgcctgta     68040
     ggaaccgctt atgcggtctg gaccggtatt ggcgctgttg gggcggccat tacagggatt     68100
     ttgctgctgg gtgagtctgc cagcccggca cgtttgctga gccttgggct gatcgttgct     68160
     ggcattattg gtctgaagct gagcactcac taagcgccag gctgtttcac ccaaatcagt     68220
     ttattcactt caaacccttc ccgggtcgcg atggctaaca tttgctgttt catttcatct     68280
     gaaatagtag gggtccgtga aaggatccac aggtagtcgc gatccggacc acaaaccagc     68340
     gcgtgacgat attcccggtc gagtgcaatt acgttatacc cgccatagaa ggggccgaaa     68400
     aaagaaacct taagcgcggc tctgcttggg tcgccggtga aataggcttt cccttccgtt     68460
     ttctgccaca tctccctgtc agggttatag cccttgttaa taacgttgat gccgccgtcg     68520
     tcgcgcaagc tgtatgttgc ggtcacttta tccaatccgc gctcgaaacg atggtcgaag     68580
     cgcgcaattt cataccaggt tcccagatag cgtttggcat caaagttatt taccacggta     68640
     acgcctttcg gcggtgtcgg ggagctacac gcgacaacca ggaatgcagc cgtaactgca     68700
     gcaacgacgg gcaaaatgcg catgggattt tccttgctgt atttttgtta agtgtagatg     68760
     acaacaggaa aaaaagagaa agaaaggagg cccaatatcc tgggcctcat cgtcagttat     68820
     tgcagctttt caagaatgcg ccaggccgcc tcgacacgga cagggttagg atagcttttg     68880
     tttgccagca tcacgatgcc aaggtttttt tctggaacga aggctacgta gctgccaaat     68940
     ccaccagtgg agcccgtttt atgcacccat gaggctttca ctgcgggggc gggcgggttt     69000
     acctcaacgg cgggaagcgc tgccaatgcc actttgctgt cgctgccgtt gatgatcgaa     69060
     tcagctttca gcggccagtt cagcatctcc cagcctaatc cctggtacat atcgccaata     69120
     cgccagtagc gagactgcgc aagcgcaatg ccctgctgga gcgttttctc ctgaacgtgg     69180
     ctggcatcca tgttggcctg aacccagcgg gccatatcaa taacgctgga tttcacgcca     69240
     taggcttcgg cgtcaagttg tcccggagaa acgtgtacgg gcttcccttc gcgatagccc     69300
     caggcataat ctttttgttc gttctgcgga accgtaatcc aggtatgcgc cagttttaat     69360
     ggttgcagga cgcgtctggt cattgcctct tcgtaactca ttcctgaggg tttcaccgcc     69420
     agcgcgccaa acagaccaat gctggagtta gcgtaaagtc gcttagcgcc cggagtccat     69480
     tgcggctgcc agttttgata aaaatgcagt aatgcggctt tatccctaac gtcatcgggg     69540
     atctgcagcg gtaggccgcc tgccgtatag gtggctaagt gcagcaggcg gataccctgc     69600
     cactgtttgc ctgtcagttc tggccagtat ttcgtgaccg gatcgctgag cttaatttcg     69660
     ccgcgggcga tagcatcgcc gcccaacacg ccgttaaacg tcttactaac cgatcctagc     69720
     tcaaacagcg tttgctgcgt gactgggtgg ttattggcga tatcggcttt accccaggtg     69780
     aaataatagg gttttccctg gtagataacg gcaacggcca tacccggaat agcctgctcc     69840
     tgcatcaacg gggtgatggt gcgattaacg atatcggcaa tctgttgttc tgtttttgcg     69900
     gcagcaaatg tggagaaaga ggctgtcagc agcagagcgc agcataacga ttttttcatc     69960
     atgaaatcag ttccgtaatt aaaagcaaaa aggtgtccgg gcccgtcaga cgcaatcagt     70020
     gtgtttgatt tgcaccgtgt tgacaaacgg ttaaatttag cagcagatat aagtttttcc     70080
     taaattccac gtgtgttttt tattagcttc aaaaatcact atttcacgaa gaatttagac     70140
     tgcttctcac acattgtaac attatttaca accacctttc aatcattttt gataaatcat     70200
     tgatttcatc tttgctgcaa tgatacttaa taaactctgc aagttatcca cagagcaaca     70260
     ctcaatttta ttgatgatat tcttattata ccagacattt ttcatacact cccttgtacg     70320
     gatagttttc cgacaacttc atgattacat atcttgcggt tttgattatt tttgctgcaa     70380
     gaaatacata cttcaaacga aaggtcttta tttgctgtct gtattctgaa gagtccaagg     70440
     aatcaaactt gaacaacaaa aataggttat atgaaagcat catcatttga aacacggctt     70500
     cattcgccca aaatgacttt agcaagagat gacccaccgc catgtcgtat ttggcttctt     70560
     tgatatagtt ttcagcatta ccacgctttt catacctaga ttctacgtca gtacttcaaa     70620
     aagcataatc aaagccttga taaatatgca ttccttcgaa attcagcttt cacccattgg     70680
     gtgaaagaaa agtgctcaaa aatatgttaa attatcagct tttatgactc gatatatggt     70740
     aaaataatag taagaaaagt agtaaaaagg ggttctaatt atgattaata aaattgattt     70800
     caaagctaag aatctaacat caaatgcagg tctttttctg ctccttgaga atgcaaaaag     70860
     caatgggatt tttgatttta ttgaaaatga cctcgtattt gataatgact caacaaataa     70920
     aatcaagatg aatcatataa agaccatgct ctgcggtcac ttcattggca ttgataagtt     70980
     agaacgtcta aagctacttc aaaatgatcc cctcgtcaac gagtttgata tttccgtaaa     71040
     agaacctgaa acagtgtcac ggtttctagg aaacttcaac ttcaagacaa cccaaatgtt     71100
     tagagacatt aattttaaag tctttaaaaa actgctcact aaaagtaaat tgacatccat     71160
     tacgattgat attgatagta gtgtaattaa cgtagaaggt catcaagaag gtgcgtcaaa     71220
     aggatataat cctaagaaac tgggaaaccg atgctacaat atccaatttg cattttgcga     71280
     cgaattaaaa gcatatgtta ccggatttgt aagaagtggc aatacttaca ctgcaaacgg     71340
     tgctgcggaa atgatcaaag aaattgttgc taacatcaaa tcagacgatt tagaaatttt     71400
     atttcgaatg gatagtggct actttgatga aaaaattatc gaaacgatag aatctcttgg     71460
     atgcaaatat ttaattaaag ccaaaagtta ttctacactc acctcacaag caacgaattc     71520
     atcaattgta ttcgttaaag gagaagaagg tagagaaact acagaactgt atacaaaatt     71580
     agttaaatgg gaaaaagaca gaagatttgt cgtatctcgc gtactgaaac cagaaaaaga     71640
     aagagcacaa ttatcacttt tagaaggttc cgaatacgac tactttttct ttgtaacaaa     71700
     tactaccttg ctttctgaaa aagtagttat atactatgaa aagcgtggta atgctgaaaa     71760
     ctatatcaaa gaagccaaat acgacatggc ggtgggtcat ctcttgctaa agtcattttg     71820
     ggcgaatgaa gccgtgtttc aaatgatgat gctttcatat aacctatttt tgttgttcaa     71880
     gtttgattcc ttggactctt cagaatacag acagcaaata aagacctttc gtttgaagta     71940
     tgtatttctt gcagcaaaaa taatcaaaac cgcaagatat gtaatcatga agttgtcgga     72000
     aaactatccg tacaagggag tgtatgaaaa atgtctggta taataagaat atcatcaata     72060
     aaattgagtg ttgctctgtg gataacttgc agagtttatt aagtatcatt gcagcaaaga     72120
     tgaaatcaat gatttatcaa aaatgattga aaggtggttg taaataatgt tacaatgtgt     72180
     gagaagcagt ctaaattctt cgtgaaatag tgatttttga agctaataaa aaacacacgt     72240
     ggaatttagg aaaaacttat atctgctgct aaatttaacc gtttgtcaac acggtgcaaa     72300
     tcaaacacac tgattgcgtc tgacgggccc ggacaccttt ttgcttttaa ttacggaact     72360
     gatttcatga tgaaaaaatc gttatgctgc gctctgctgc tgacagcctc tttctccaca     72420
     tttgctgccg caaaaacaga acaacagatt gccgatatcg ttaatcgcac catcaccccg     72480
     ttgatgcagg agcaggctat tccgggtatg gccgttgccg ttatctacca gggaaaaccc     72540
     tattatttca cctggggtaa agccgatatc gccaataacc acccagtcac gcagcaaacg     72600
     ctgtttgagc taggatcggt tagtaagacg tttaacggcg tgttgggcgg cgatgctatc     72660
     gcccgcggcg aaattaagct cagcgatccg gtcacgaaat actggccaga actgacaggc     72720
     aaacagtggc agggtatccg cctgctgcac ttagccacct atacggcagg cggcctaccg     72780
     ctgcagatcc ccgatgacgt tagggataaa gccgcattac tgcattttta tcaaaactgg     72840
     cagccgcaat ggactccggg cgctaagcga ctttacgcta actccagcat tggtctgttt     72900
     ggcgcgctgg cggtgaaacc ctcaggaatg agttacgaag aggcaatgac cagacgcgtc     72960
     ctgcaaccat taaaactggc gcatacctgg attacggttc cgcagaacga acaaaaagat     73020
     tatgcctggg gctatcgcga agggaagccc gtacacgttt ctccgggaca acttgacgcc     73080
     gaagcctatg gcgtgaaatc cagcgttatt gatatggccc gctgggttca ggccaacatg     73140
     gatgccagcc acgttcagga gaaaacgctc cagcagggca ttgcgcttgc gcagtctcgc     73200
     tactggcgta ttggcgatat gtaccaggga ttaggctggg agatgctgaa ctggccgctg     73260
     aaagctgatt cgatcatcaa cggcagcgac agcaaagtgg cattggcagc gcttcccgcc     73320
     gttgaggtaa acccgcccgc ccccgcagtg aaagcctcat gggtgcataa aacgggctcc     73380
     actggtggat ttggcagcta cgtagccttc gttccagaaa aaaaccttgg catcgtgatg     73440
     ctggcaaaca aaagctatcc taaccctgtc cgtgtcgagg cggcctggcg cattcttgaa     73500
     aagctgcaat aactgacgat gaggcccagg atattgggcc tcctttcttt ctcttttttt     73560
     cctgttgtca tctacactta acaaaaatac agcaaggaaa atcccatgcg cattttgccc     73620
     gtcgttgctg cagttacggc tgcattcctg gttgtcgcgt gtagctcccc gacaccgccg     73680
     aaaggcgtta ccgtggtaaa taactttgat gccaaacgct atctgggaac ctggtatgaa     73740
     attgcgcgct tcgaccatcg tttcgagcgc ggattggata aagtgaccgc aacatacagc     73800
     ttgcgcgacg acggcggcat caacgttatt aacaagggct ataaccctga cagggagatg     73860
     tggcagaaaa cggaagggaa agcctatttc accggcgacc caagcagagc cgcgcttaag     73920
     gtttcttttt tcggcccctt ctatggcggg tataacgtaa ttgcactcga ccgggaatat     73980
     cgtcacgcgc tggtttgtgg tccggatcgc gactacctgt ggatcctttc acggacccct     74040
     actatttcag atgaaatgaa acagcaaatg ttagccatcg cgacccggga agggtttgaa     74100
     gtgaataaac tgatttgggt gaaacagcct ggcgcttagt gagtgctcag cttcagacca     74160
     ataatgccag caacgatcag cccaaggctc agcaaacgtg ccgggctggc agactcaccc     74220
     agcagcaaaa tccctgtaat ggccgcccca acagcgccaa taccggtcca gaccgcataa     74280
     gcggttccta caggcaacgt gcgcattgcc caagagagca tggcgatact gacgatcatc     74340
     gccgcaatag tgataatgct tggcgtaaga cgcgtaaaac cgtgggtgta tttcaggcca     74400
     atcgcccaga caacttcgag caaacctgca attaataaaa cgatccagga catatcaggc     74460
     tccagaacaa tggggccgtc cccggtgaaa gaagcgtttg caggtcgtcc tgcaaagcta     74520
     atgtgtgaaa tggcattttt gcccggaaga aaatgaattt caaccttttt attcaccgcc     74580
     tgctaaaagc aagaattaag cataattagc ggcgtagttc ccgcatttgg cactcatcgg     74640
     agttctctat gatgaagggc tttctgaaac cagaaagtcg attgcccctc ttctgaatgc     74700
     gaaacgttta tgcttaaaat tttagtgatt gaccggtgcc actttacccg cacagggata     74760
     gaggccttgc ttaatcattc tggcaggttc agctcctcat ttctggtatc aggaatcaat     74820
     aatctcctgt tagcaaaaga gcatattttg caatggaaac cgcatctggt gatcgcggat     74880
     ttatacagtt ttattagcga gacgcactcc agtccgccaa ttaaaccttt ttttatgagt     74940
     tgtggcgtca tcccactaat tttactgcaa tcagcagaca gacagcatgc acccatcgtg     75000
     ccctctcaat ccgtagccca ttcggtcttg accaagcaca ccacgctgaa cacactctcc     75060
     cacacaattc aggatttcct tatttgctca aaaagggcac ttccacagcc catgtttatg     75120
     cactccctcc cgtaacctcc agcattgggt tcttgtaact caaaacgaat ggagaatgcg     75180
     atgatcaatt tcaagcctaa aattccggcg atgcttgggg ctctggcggt tcttaccgct     75240
     ggtgctgctc atgcagagct gctggaatac acctttaagg ctccagatgg tacgcaacgg     75300
     tctctgactc cgaatgccaa ctatgccaac ccaacgggca atatctcgtt tgccttgagt     75360
     gccggtatcg accgaaaggt aaagatttcg gtgcttcggt cggatggaac agtggtttcg     75420
     acagcgacca gccaccttct tggggctact gatcgcatca cagtgggtgg aaaatcctac     75480
     tatggtgcgg aacttcaact accagctcca gttggtgggg catacactat cagggcggaa     75540
     attcttgcct ctgatggttc tacagtacag acggatgaat accctcttac tgtcgatgtg     75600
     acgccgccaa cctactcttc gcttgccccg gtttatagta actatgggca ggttactagc     75660
     ggtgatgttt ggaaactggg tctaggtggc tctgaggata atgccttttt gctgtcagga     75720
     atctctgatg agtcacccat caaaggcgtc aaagcaaagc tgtatcgtca agacggttca     75780
     ctctacaaag atgtatccgt gaactacgat gacgctaacg gacaagctag acagtctttc     75840
     caatctggct ttttcccagc ctctgacttg gatgaagtgt ttacacttca gtttgagata     75900
     agcgatagcg ctggaaatag ctatctttca cctcgtcaaa aagtgatgtt tgatagcata     75960
     accaatgctc cgtctgcacc ttttggtgtt tatgaccctt caagtacaaa caacttaggc     76020
     cctggattaa ccggatttgt tgcttacact gagggcatga cagttaaaac taacccaatc     76080
     aagttagctt ggcgtgttcc gcgtgataac tggcatgagt atagagaagg tgggataaat     76140
     atgaccaatg ccttgggaga gatgtccaag gtaggagaag atgccagcta tgtttatctc     76200
     gtcacaaccg caccttatgg caataccgac ggcaattatt ggcgttgggt gaacttcggc     76260
     cagtgggggg gaggcggtat tgcttataac ctcacactct ctccatcagc gcctaaaagt     76320
     cccagacttt tgggtgtgga ctacaattac agtgatatag gatggtctag tttttaccgc     76380
     tactgggtga acaattctgt tcttcctgtc actgttagta gtatccgtgt caaagttgaa     76440
     ccaaggcctt acgttcaaac tgccgttcac aggggaagct gtgaaattcc tgttggtcaa     76500
     gatagctgcg tgattgcaaa tagcttcaca atggctaaag gcacaacagg gtacgtccac     76560
     gataatgcga cagttttcaa tccggataaa tctcttcgct cgaatcctct ttgggcagag     76620
     gttaactgga acgatcagca ctaccctcag ctaagtcagc agttcgatca aaatagcaag     76680
     gtatttacct tattcgttaa ccagccagga cgaggcgctt actttgatag gctgcgtctg     76740
     cgaagtgcat ggattgaaga tagcaaaggc aacaagctgt ctccaactgg tgggttaata     76800
     gccaacaact gggagaacta cacttaccag tgggatctta aaactctccc tgaggggcaa     76860
     tacagtcttg ttgccgcagc agaggagatg cacgggcctt taacgcgaca accaatgttc     76920
     cagataacgt ctgatagaac gccaccaacc atgacactca gtgtggcaga tggagcagct     76980
     atccagactc tagatgatgt tgttattacc ttggctgatg ctatcgaccc ttcacctaaa     77040
     ttgacctcta ttgcccttgt aggggggcct gccaatgaca aggtgcagtt gtcttggcgt     77100
     gaggagtcga aaggtcgatt ccgccttgag tacccggtaa tgttcccttc tttgaaggaa     77160
     ggggaatctt acacgctgac tgtttccggt gaggatgcac aaggcaatgc ggttcaaaag     77220
     gctgttggct tcgagtacaa acctcgtcag gtaatgctgg cggatgggat ggatggcaag     77280
     gtcatggtcc ccgctgtcac tcatgaattt gttcatgcag atggcaaacg gatcatcgaa     77340
     accaagccgc tgacgctcag tgatggtgct gtcgtgacag gttcatacga cgtgtttgcg     77400
     accctacgtt ctgatgcgaa agtaccgctg gtggttaatg gggtgcgtat cgagccaggc     77460
     cagacaatgg ggatcatgag ccaacatgat ttcggtgcgt caggtggtcg tttgagcatt     77520
     ccggttaaac ctgctgttcc tgatgtggtc ggctcttcca gccttcttgt catgacctcc     77580
     gcgccgaact cacccatctt ggttgtggac atcaatacct ggaaagggac ggctaagctc     77640
     tctgctgaat catggacaat tcgccaggtc attgacccag tgaaaatcta tgccctgcca     77700
     gagtcgggtg tgccttgccg gttcaccacg aaagaggatg tggctatggc cgcagaccca     77760
     attcgtgacc cggtgtgttt gctccagtgg gacagaactc cagatgaggc tgaacaaact     77820
     acgcaggaca acaacgggat gaaagttgct gggctggtgg ggcaggctgt gagcattggt     77880
     gaacaacctg tcgaatacag cctgtacctg ttcagtggtg acggttccaa ggtaaaagtt     77940
     gggtctggct ctcagaacct gacggtaact actgcctatg gctctgttgg ctacaccccg     78000
     attgatgaca ttgctcaggt gaatcgcgtc attgaagatt ttgatgtgaa cttcaagcag     78060
     agcaaggggc cagactgttc tataaccctc agcgcagacc gtgcgaaaaa agaggccgcg     78120
     aacaaggctg ttggtagtgc aagccgtgcc tgtctgttcg agtggcagca gatccccgat     78180
     ggattggtcc aagacccgtt atcggaatca ccttcgctct ctggttcatt ggcctccaac     78240
     ggcgttcatc cactggggtg gcgggtaagt attttcaccc gtaacggcac tagggtgacg     78300
     ttgaacgacg agactttcaa tgtcgaagcg gttgacccac cagctccgac cgttgaacta     78360
     gcctccgact acaacttcaa agacaacatc tacttggtgc cgatgacagg taactacctg     78420
     ggtgatgcca ttatcaactc tgaacgagct gatctggata ttgccatatc gcgcaactcg     78480
     gatgttcttg agtctgagac cttcactccg ggatggggtg ccaccaataa ggtgtatcgc     78540
     cgcatcaata ccgatgagcg agcgttgtgg gaggagacca cctacaaggt gaacgcggcc     78600
     tacaacaagg tgcctgatgt gaagactgag gttgtctacc gggctatctc tgcaccttct     78660
     gacagtatcc gtcctatcgt tgaagttaaa ggtgataccg cgattgacac ccaggcattg     78720
     ccggttaggg ttctcatccg tgatcagtac aaacctgatg gtgactatga cgctaacacg     78780
     atgggggtgt ggaaagtacg cctgatccag caaaaggcct acaacgagac ggttgcgctc     78840
     actgattatg cggaagcatc gaacggtgaa gctcagttct cagtagacct gtctggtgtg     78900
     gatacttcct ccgtccgtat cgctgctgag gctgttctgg aaagccctgt tgagggttac     78960
     aaccgcacag agttgtctat cagacctgcc ttcttgacag tgcttcgcgg tggtgccatc     79020
     ggtgctggcg tggaggctcg caagttgtct ggtgaagctc cgttcactgc tgtgttcaag     79080
     ctatctttgg acgaccgtca ggatctccgg gctaccggcc aggttgtgtg ggaaaccagt     79140
     aaggacgacg gtaaaacctg ggagcagttc atcccagaag atcgatacaa gtatcagctt     79200
     gtgaagacct tcgacaaggg ggagtaccag gttcgggcca aggtggtgaa cgtcaactca     79260
     ggtgcggaaa agtacaccga agcggtcagt gttgtcgctt acgacaaacc tgatattgct     79320
     gttatcggcc cgaccacgtt gtttgtcgga agtgaaggca agtacacagc gaacctgacg     79380
     ttgaacgatg agccaatctc cggtggcaat gccattgttg agtggtctac tgacggtggc     79440
     aaaacctacg cgcagacagg ggatagcatc acgctttcga gcgatgaaga aacccgatac     79500
     cgcctgtggg ctcgtgtgcg ctctgccacg gcaccggctg atgacggcta tgcctatgaa     79560
     gttgcgaaaa cggcggttga cttccgagca gtgaaggcac ctcgtcctta cgtgacaggg     79620
     ccgcgagtta ttgagaccgg taagaagtat gtgttcaaag ccgaaaccag cctgccttac     79680
     cgtgggatgg acgtgaagct gaacgggttc ttcacgctgc ctgatggctc gattgtgcag     79740
     ggtgatactg ctgagtacga accctctgac actgacctca atcaggctac tgtagaaacg     79800
     aagtacacca cctggatcga aggataccga gatcagggtg cagaggcttc gcatagccta     79860
     cgctcccgcg tttggcagta tgtatggccg agcttcggaa tgcaggttag gaagaacgca     79920
     gacgtggctc ctgcgacgat caccgcgtca gtgcggccaa ttgccttcaa cggcaagctg     79980
     gaagagccga cctacgagtg ggagttgccg gaaggcgctg tgattcagga tcagcggcag     80040
     gatattgtcc ggtcctttgt gatcaatgag ccgggtgatt acaacatcaa ggtcactgtc     80100
     cgtgatgctc gcggccatga gaccgtgatc gagcaaccgc tcaagatcgg ccaggcagcg     80160
     ccctatgcca ttgacctgca atactctggc tcgaacaaat acgagcgtga gcctctggat     80220
     gtgctgttgc gaccgtacat ttctggcggc cacccacgcg accgtatttc gactcgtgtt     80280
     tattcggtag atggtacacc gttggaaagc agtggttact acggcagagc aactctgggc     80340
     gctggtgagc acagcatcaa gctgaaaata acctcagaaa tggggcatga agctgagggc     80400
     gaggtgaaca tcaatgttgc agagaacaag ttgcctgcat gtagcctgag ctcacgagag     80460
     accgttgggt cgtggatcgt ctatgcgaac tgcgaagata ccgatggccg catgaagtcc     80520
     tacgaatgga ccattgccgg tgagttgcag agcatcagct ctgatcgagt gactatcagc     80580
     aagggcacct atgaaacgat gccgaccatc tctctggttg gggtcgatga ctctgggggc     80640
     aaatccgaag ctgttaccat gaactaaggt tcattcctct caaagcccgg ttcagaccgg     80700
     gctttttttt gtatcgcgct ggaattgtcc aaattgggct attacagagg cgagtctatt     80760
     tccatccccc ggatacactg cccagcatcc agtaatccaa tcttagggga tagacatgcg     80820
     gacaaaatta cttggggcgc tgatggtgtt cgggattatt accggcacgg ctcatgcgtc     80880
     atcgaaattg gaaatcaccg atcccagagc ggcgaagata gaggacattg tagagctacc     80940
     catcaaaggg gttcgagccg tccaaagtga tgggcagatc atgttcctct ctgaaaacgg     81000
     acgatttgtt atttcaggac aaatctacga cctgtggagc aagaagcccc tcaacacgat     81060
     gtcccaaatg agggatgtag cggagcgtat ccacttcaag agcatgggca tggatgtgga     81120
     cacgctgaac actgtgtcga tggggcgtgg tgacaaagag gtggtggtct ttgttgatcc     81180
     taggtgcgcg gtttgccatc agctcatggg tgatgccaaa tcgctggtgg atgattacac     81240
     ctttaaattt atcgtgattc cagctctggg tgctgagtcc aaccgcctgg caaaaaactt     81300
     gtactgcgcg aaagacaaaa cccacgcgct tgatgcgctg atgaacaaca ccctgggttc     81360
     ccttccttca aaagaaacct gcgaccccgg ccaatacgac caaacgctgc tgacagctca     81420
     tttcattggg attgagggcg ttccgttcgt tgttgctccg gatggtcgtg tcagcaaagg     81480
     acgtccgaag aacctgaaat catggttgga gagtgctgaa tgatcgtaac catcaaaaag     81540
     aaactcgaag aaacgttgat cccggagcac ttgcgagctg ccgggattat tcctgtcctg     81600
     gcctatgacg aagacgatca tgtcttcctt atggatgatc acagtgcagg ctttggtttc     81660
     atgtgtgagc ccctgtgtgg tgccgatgaa aaagttcagg agcgaatgaa cggtttcctg     81720
     aatcaggagt tcccgtcgaa gactacgctc cagtttgtcc tgttccgctc cccggacatc     81780
     aatcaggaga tgtaccggat gatgggtttg cgtgatggct tccgtcacga gctgctgaca     81840
     tctgttatca aggaacggat taacttcctc cagcaccaca cgacagatcg catatttgcc     81900
     aagaccaaca aaggtatcta cgacaatggc ttgatccaag acctcaagct gttcgttacg     81960
     tgcaaagtcc ccatcaagaa caataacccg actgaaagcg aactccagca gctcgcacag     82020
     cttcgcacga aggtcgaatc atcgcttcaa accgttggtc tgcgtcctcg cacaatgacg     82080
     gcggtgaact acatccggat catgagcacc atcctgaatt gggggccaga tgcttcatgg     82140
     cgacatgact ctgtggattg ggagatggat aagcccatct gcgagcaaat cttcgattac     82200
     ggcaccgacg tggaagtcag caagaatggc atcaggctgg gtgactacca cgcgaaagtc     82260
     atgtcagcga aaaagctgcc tgacgttttc tactttggtg atgcgttgac ctatgccggg     82320
     gatctcagcg gcggcaattc cagcatcaaa gaaaactaca tggtcgtgac caatgttttt     82380
     ttccctgagg cagaaagcac gaaaaacact ctggagcgca aacgccagtt cactgtaaac     82440
     caagcctacg ggccgatgct caaattcgtg ccggtgctgg cggacaagaa ggagagcttc     82500
     gacactctct atgagtccat gaaagagggg gctaagccag tcaagatcac ctactcggtg     82560
     gttttatttg ctccaaccaa agaacgtgtt gaagcggcgg cgatggccgc acgaaacatc     82620
     tggcgtgaat ctcggttcga gctgatggag gacaagttcg ttgctctgcc gatgttcctc     82680
     aactgcctgc cattctgtac cgaccgggat gcagtgcgag acctattccg ctacaagacc     82740
     atgacaaccg agcaggctgc tgtggtcctg ccggtgtttg gggaatggaa ggggaccggg     82800
     acctatcatg cagcgctgat ttcccgcaac ggccagctca tgagtctgtc tcttcacgac     82860
     agtaatacca acaagaacct ggtgatcgca gccgaatccg gctcgggtaa atcgttcctt     82920
     accaacgaac tgattttttc ctacttgtcc gagggggctc aggtctgggt tattgatgcc     82980
     ggtaagtcct accagaagtt gtcggaaatg ctcaatggcg acttcgttca ctttgaagaa     83040
     ggaacgcacg tctgcctcaa cccgtttgag ctcatacaga actacgagga cgaagaagac     83100
     gcgatagtca gcctcgtttg tgcgatggct tcggctaagg gcttgctgga tgaatggcaa     83160
     atctctgcgt tgaaacaggt cctttctcgc ctgtgggaag agaaaggtaa agagatgaag     83220
     gttgacgaca tcgctgagcg ctgcctggaa gaagaaaatg accagcgcct caaggatatt     83280
     ggtcagcagc tctacgcctt tacgtcgcag ggcagctacg ggaaatactt ctctcgcaag     83340
     aacaacgtca gcttccagaa ccagttcact gtactggagc tcgatgaact gcaagggcgt     83400
     aagcacttgc gtcaggttgt actactccag cttatttacc agatccagca agaagtattc     83460
     ctgggtgaac gtaaccgcaa gaaagtcgtc atcgtggatg aggcctggga cctgctcaaa     83520
     gagggcgagg tctcggtctt catggaacat gcctaccgca aattccgtaa gtacggtggc     83580
     tccgttgtca ttgcaacgca gtccatcaac gacctctatg agaacgcagt gggccgcgcc     83640
     atcgcggaga actcggccag catgtacttg ctcggccaaa ccgaagaaac cgtggaatct     83700
     gttaaacgta gcggtcgtct gaccctttca gagggcgggt tccacaccct caaaacggta     83760
     cacaccatcc aaggcgtgta ctcagaaatc tttatcaaat cgaagagcgg tatgggcgtc     83820
     ggtcgcttga tagtgggcga cttccagaag ctactttatt cgaccgatcc ggtggacgtt     83880
     aacgccatcg accagtttgt gaaacaaggc atgagcatac ctgaggcaat caaggccgta     83940
     atgcgaagcc gtcggcaggc tgcataacca gggagacagt aatggacatt aaatcaatcg     84000
     caatcgccgc cattctcggt gccgctggtg gcttcggcgg tagctactac gtgatgagcg     84060
     aacaaacggc aagcatccat cagcgtttga atcaaacccc gccagtggtc gtggttgact     84120
     tcgctaaagt ggcgtcggcg tatcccgctg gtgcctctca ggaggaagtt gaaaggctga     84180
     tggtcaagac caatgacgca attttgaagt tgaaagacgc aggttatttg gtccttgacg     84240
     caagtgctgt cgtcggggct ccaagtgacg tgtacctccc tgatgaggtg ctgaaatgaa     84300
     ttttccactc aagaagtatt tcgtcaaaaa ggaatcctgg aagcgcttcg gggttaaggc     84360
     aggtgtgaca ctagtggttc tttgggctgc tggtgcggcc tttgccagcc gctaccgtat     84420
     tggcattgat ccacaacagg agaagtgcct gccgggttac accttcttcc tcattgatct     84480
     gaacgaccaa actctggaga ggggagcggt ttacgccttc caagccaaga acatgcagcc     84540
     tttctacaag gacgggactc gcatggtcaa aatcctcacc ggtatgccgg gggataaagt     84600
     cgagatcaac gataagtgga agatcaccgt caatggtgat gtcgtcggag aggggctcca     84660
     gctcgcaggg aaactacatc tgccagagag ccacttttac ggcaagacca cgctgaaaga     84720
     gaacaactac tggtttatgg gcaaaagccc attcagcttc gactcacgtt actgggggac     84780
     tgtgaaaaat gatcagatca ttggccgcgc atatcccctg ttctaagagc gttctggtgg     84840
     cgttgatgtt ctctgtggct ggcggggcat acgctcaaga gtctccgctc acagagcagg     84900
     ataaggcgct tattgagcaa ggaaagcaaa ttgcccaaaa ggcccagaag atggaaatgc     84960
     catctctgtt gcaaaaccaa cacatggacg aggctcaggc cgaagccaag gcatttttca     85020
     agcagctcca aactactaac ccaacgctca aggagatgca ccggaaacag gctgaaaagg     85080
     gtatctactc tgaccatcgg atactggttt tcgcctcgtt gtctcttggc gaacaggggt     85140
     tagatgacgt cctaacggcg gtgtcaggcc agcctgattc tgtaattgtg ttccgtggca     85200
     tcccggaagg aatgaacttg gggcagggag ttaaagctat tcaggcgctc gcggccaaaa     85260
     aagacccagt gccgaacatc atcatcaacc ctacgttgtt caaaacgtac aacatcacag     85320
     ccgttcccac gattgtgatg ctggaggatg agccgctgcc tggcgaacaa ccaaacgtcg     85380
     tcgcccaggt ctccgggttg tccgacccgg tatggttggc tcgggaagtg gataacggag     85440
     aaaaaggcga tctcggcgtt aaggggccgg tggagaaaat cagtgagcca gaccttattg     85500
     atgttgccaa gaaacgcctt gccaatatcg actgggaaga gaagaagaaa caggctatag     85560
     agcgcttctg gaccaagcag aatttcaatg agctgccaag agcgccaaaa tctcgaacac     85620
     gagaaattga ccctagcgtc atgatcacca gtgacatcag cactccggat ggcactgtgt     85680
     tcgctcacgc gggtgacgtg atcaacccat tgtgcgatcc gaaggaagtt tgcaagcctg     85740
     gaacgcggcc atttacccaa gcggtcgtag ttttcgaccc gctggacaaa aagcaaatgg     85800
     aactactcgc caagaagctg cctgaaatca agctggagcc tggcgtacaa cggatcacct     85860
     atatcgccac agagttcgac aaagacaaag gctgggattc ctacaagagt gtcaccgaca     85920
     actttgacgc gccggtatat ctgctgacgc cagatctgat tacccggttc gagctggagc     85980
     acacaccgag cgtcattact gccagaggca agaagtttgt tgtccgcgaa cttgctgagg     86040
     agggcggtga atgatttttg ccccggcttt ccaaccaatt aaagacgtcg gcacaggttc     86100
     gtttgtcgct gctgaggtac tggctcgttg gtacgacgaa ggccgggttc ttacaccatc     86160
     ctctctgtca tctcctcctt attggggact ggtggatatg gagatggcac ggttcattca     86220
     ggacaacctt cattattgct tggatctgta cccggctctc tttctgaatg tctccgaaca     86280
     aactttgcaa tcagacgtca tcttcaaggc gtggtgtagg gttgtccgcg acattgctaa     86340
     aaatcactca tcacggcttg tcatcgagat tacagagggc attcaggacg cctctctcgc     86400
     atcgagatgg gaggctctga ccgaaatagg ggttgagctg gcgctggatg actatggaga     86460
     caaaaactct tctctggatc gcctgagccg ttatgactgg cactattgca agtttgacgc     86520
     gagaagactg cggtcgcttg aagactaccc ggccatcctc cactgccgcc gaaaaggcat     86580
     acagctcatt gctgagcagg tggagagctt cccattgggg gagagcgcca aattacttgg     86640
     actgtcatgg caacaaggtt tctatcacgg gaagcctgct gtcatggaga aaaatttgaa     86700
     ttacgtaaag gccttaccat gatgcaaaaa attctacgga tcatggccgt tagcgcggtc     86760
     ttttgggttg gttcggtatc ggctgaccct gggtgccaga atgcggaagt gatcggcgga     86820
     aaactgatta ctgacatctg ctggagctgt attttcccta tcaaagtagc aggggttcct     86880
     ataagtggtg gaggcggatc attcccgagt gaagccgtaa gcaaccctct gtgtatgtgc     86940
     gaggataatc taggggtccc tcggcctgga gtcaccactt ctatgtggga gccagcacgg     87000
     ctcgttgaat ttcagagagt gcctggctgc tcatcagtct tgaatggtgt caggttcccg     87060
     tttgatagga ctaaccaagg gcatcatggc atgggagaca tggatggtgg tgatggttct     87120
     tttatgcact atcactacta tgcgtttcct ctgttggtga tgctcgattt atttattaag     87180
     cagacctgta atgctgatgg gtatatggat ctcgacatca tgtacatgtc ggagctcgac     87240
     ccgacctgga acaatgatga gctcgctttt tttaccaatc cagaggcggc ggcagtagca     87300
     aacccaattg cggcggctgc gtgtactgct gatgctgtct catcaaccgc tggaaaacct     87360
     ttaaaacagc ttttctggtg tgctggttca tggggcaccc tgtatccatt tagtggcaac     87420
     cagaatggtg gaaaaggtgt tatccgcgat agcagtcttc ttagcacaag ggttctggct     87480
     gctttgcatc gccgggggtt agcgtggaag acaatgggtt ctgaggctat gtgtagaggc     87540
     gttattagcc caacactacc caaaacgcag tacaaattca cgctattgca tccggttcca     87600
     gagacaaact catctcacgt aattggcgaa tccactctta cgtggggtct ggcgcgaact     87660
     ataccggcaa ttgggcaaga ccctatttac accatctggc gatggaatga ttgctgtaac     87720
     aattgagcag accctaacga atttgcacgg gcattttaga ttatgcccca aaagggccac     87780
     tacacgtaca ggtggccctt gtcttctcag atagcatggg aaggttgaaa tggagaacac     87840
     aatgcgaagt cataattact ttatgaaagc tgtggcctcg ctgttgacag taaccatgtc     87900
     tgcgctgccg atacattcct acgctaacgg tagccaagac caggacatca cagcggtggg     87960
     taaagaggcc caggctttcg gacaaaacct ctcaaactca ttcaagtcga gctcggggac     88020
     tgtgcaagat ggcacaatct ctatgccgac gttgaaagac ggtcaattcc aaatgaacgg     88080
     ggggagtcag attaatgtca atgatctatt ccccggaacg agcgggacca acaataaacc     88140
     tgatagttat tacttccctg atgccaataa acctgatgtg ggcggtctgc aaggcattta     88200
     cgactctggc gatgacatgg acagcgtggg gaataatgca aaagggtcgc tgtggagtga     88260
     tgccaatagt gctaatccat caatctctgg tgcggcatac aaggttcttc tcgatgcctc     88320
     taatcgatca cgccctgatt tcagtaatga cccggtacta aatctaagca aaaagaccta     88380
     tgaggatatg gacctcatcg caggtggctt tggggattgt tctgccgaaa caaccatcaa     88440
     tcagaatact atcaacgccc acattccaga gtatgaacgg tgtcagcgtg ttgtagatca     88500
     aagcgcggac tgtgaggttg tccatgacta cgacgcctct gtggtgaagc actatgatgg     88560
     tccatataac ctcaaatctt gtggagaagg ctgtactgag ttgtggattg gtcgagtggg     88620
     ggacaactac tggagtggta actgcaagat ttatgaggag tacacgcggg tccaagtcag     88680
     caatccagat gccatagtgt ctgcaacgct tgaatacgcc aagtgggatg actacatgca     88740
     agtgtgggtc ggtaagtccg gccaagagac taaagtgtgg tctggcccag atggcaactt     88800
     ccctccagaa acagccggta gatgtgagct ctccacgagt tgggagcgaa accctaatgt     88860
     tgatgtcact ccctatttta agaacgtgaa agatggtgat gttgttacgt ttaagatccg     88920
     cgtttcagta agtggcgaag gtgagggttt tggccgcata aaactccgct atgacccatc     88980
     gaaagccatt accaaggatg agtgggctcc acagagctgc atggattcag ccaaaggggt     89040
     ggtagatggt tttgcggaag gcgagatcac atgtatagat gacccgactg atgctactgg     89100
     ctgcacagtc atcaatggga tcaaagtttg cgaatctcaa ctcaagccgt cacctttgcc     89160
     tggtattcca aaactatgca aaaaggttcg agttaaagct gactatgact tctataaggg     89220
     gcaaatggac tgctggacag accctcaagg tgaaacgcac tgtccggtaa acacgggcgg     89280
     gaatctcgat agctgtcaga aatatgaaga aaaccctcag tgcggcttca tcagttccaa     89340
     atgtgttgat ggtgctcagg gaagttctgg tacgtgctac gtccacgagg atacttatga     89400
     ctgtggtaca gatgtttctg ttccgacctt ggaaaaggaa actgagtacc agtgcggtgg     89460
     gcctatacgc tgcatgggag atgactgcct tgatttgacc aaaacacaaa gcactgattt     89520
     tgctcgcgct actgcgttgc tcaatgcagc ccaattcatg acgcaggata tgagctgcac     89580
     aggccaagat ggggatgaca atcctaccgg ggatgaaaac gttatttgct ctgcttttgc     89640
     aggggaagct ggcgaatgca agatagctgt tgggggagtt tctgattgct gtgaaaagcc     89700
     aaccaatata tctcttgccg attatctgaa cctaataatg gccgttccaa agctcgatgg     89760
     cgcagtgatg gggctgactg atggtaatgc gcttaaaggt gcttatcagg tacttaggga     89820
     acctgccctt caagggtgga cagaagtcac aaaaccgttc acaagttata tagagaacgt     89880
     ttcaggtgct gttgattcgt tcttccagcc tgtagagcag tttgttgatc aactcattga     89940
     ccagctcaaa gagcaagtca aagaagtgat gatggatgtc atgaaatcag caggccaaga     90000
     tgcagcaaca gagcaggcgg ctgccgcagc atctgaacaa gctgccgaag caatgatgga     90060
     gactgcgaca acatggctta gcactgccat gacgatatat accgtctatg tcgttgcgat     90120
     ggtgatgatc cagatgattt ataagtgcga ggaagaagag ttcactatga acgcaaaaag     90180
     agcgctcaag aattgcacct atgtaggctc ttattgtaaa tctaaggtgt tgggcgcttg     90240
     tattgaaaaa agagaagcgt attgctgctt caattctccg ctctctcgta ttatacaaga     90300
     acaggttcgc cctcaattgg ggcagaactt tggagacccc aaaaatcctc agtgtgaagg     90360
     gattccacta gataaaattg ccgaaattga ttggagcaaa attaatttgg atgagtggct     90420
     tgggatatta cagcagaacg gtaaattccc tgatccggcc tcaataaatc tcgactcgct     90480
     gactggagca gggaatgact tcaatattga cgggacgcgg aagaatgctc aggaaagggc     90540
     gttggagcgg ttggaaggga ttgatattga cgcgaagcga aaagaggcga caaacagcat     90600
     agaccctcaa acaggcgcgc caactggtgg tggataaaaa aaggggcctt tcggcccctt     90660
     tctcatgtag attgattacg cttctgggta aacaaataac tctgcttttc cctgatcaag     90720
     aaggtaaggg aaagcaactt tttcgccatt atccagctca accgattttg gagcaaggta     90780
     gaggtaggcc caagctggta gctgtttgct aatagctgcg tagatcgctt gctgaggagc     90840
     atggcttgct gccccattac cgacattcac aaagttgtat gcggtctcat ggcctgatgt     90900
     gaaggcatac gctgtacctt gaacgccaga gacaaaatta ggagctgacc ctaggcgagg     90960
     ctccacgatt ttcaccttaa cggaacacat gtcagctacc ttactttgtc cgttcaccca     91020
     cgtcgggcaa ccccattcat tcttgtagaa ctgataggtt aggcgaccgt ctttgtcata     91080
     cagaagcgtg aaattggcac ccaaatcagt cagcgctgac tcaatggaaa ctttcacatg     91140
     tgaaagaaat ttggcctgag cgtctgccgg tgaaactgct tcgttagcag gcatccaagc     91200
     gatcaagcta ttgcgagcgc catgctgttt ggggccgata gcccagttcg caaggttgac     91260
     caagccacct tgccagtcgg tcattccgag ctgaggggac atgtagccag acagcacgta     91320
     ggctgcccca aacgttttgg tgtcggtcag acgctccagc ttgtcacgcg gaacagaagc     91380
     gtcttggatg cctgttacca ggccaccggc ctccgcgatg ttgtaagcgc gactgtgatt     91440
     ggttttgtac gctgtgggtt cgtaactgct ggtggatgca cagccagata gagctgctac     91500
     agccagagcc acggtggtga ttaaagcctt tttcatgttg ttctccgttc ttacctgagt     91560
     tgaatctgat ttacttcgat aatatcacag catcaaaaaa tgcaaccata aaagacaaaa     91620
     aaaagcccct cgggcgaggg gcaaaggttt gggctgggtt atgctgcttt tgttttctcg     91680
     gcttcgtctg cgatttcctt gtcgccggtt gcagattccg gagcggcttc ggccacttca     91740
     ccttctttgc ctttgctgtg ggcggaaatg cgagcccgtt tctcgatgcc gatgattcga     91800
     ccggccagct tgatgaggcg ttgctgccat tggtaagtgg cgtcggtgcg ctgcttgctg     91860
     gtcagtacgg tgttcagcca gagagtgtca acgatcccca tcagggtatc cagtttgcgg     91920
     atcaggtgtg caaactgagc aacctgagga gagttgatct cgatggtgta ttcattcggg     91980
     ttggtgtagc cgggcatcat gtcgatgccg ttgtcttcca tcagcttgtt gagctgggcg     92040
     gtagctttgt ccaggtcttc ggagaccttg gaaatgtgtt ccaggatgac ggtttcaacc     92100
     tggtcgattt cgtcctgctc accgatgatg cgaaggatca cgtcgatgga gaacagggag     92160
     ttggaaactc gctcaaagct gcgttccatg acgcgctgag cttggaggct gtttactttc     92220
     agaacttgct tgaaaacagg gcgagagtag tggttgctgc ggtcgttgtt tgtgtccagt     92280
     gctacttgtg cttctgccat tagagatact cctaaatttg aggtacagat aaacgcactg     92340
     gaaaggataa atgcggtcaa tctgtaacct gacctctcga agtgcccaaa atggacagtt     92400
     acagcgtttt ctgtttagca aaggtgagct atatttgaat catcttagtc gctctgcggc     92460
     tataggtgag atagctggtc tccgaaaaca aacagcatct agtcttatgc cgtatggcat     92520
     tacttaaccc caagccgggg gcttctcccg gttttcgggt gttgcccctg ttttttttac     92580
     ataggagcaa caccatgcac atcatcactt tcattgtagt tctgcttgca tctctgggcg     92640
     cactgtacgt aggcgcgaag gcatttgctt tttccttcat cgttctcgct aaagtgttcc     92700
     agcgtatcgg tttgttcctt tggaacaaat tcgcagttcc tgcaatgcgg tctgtacagg     92760
     ccgtcatcaa agaacgtgct gccaaggctg aacaagccaa agcagtcgtt gaacctgagg     92820
     taactcaagt tcaagaagtc gctaaacaag aacctgactg ggattatctc gaaatcccga     92880
     cttaccttcg taagggcaag gaacttgttt ggtaataact gtcgctgagt aatcttcgac     92940
     actttcaaac ccatcggggc aaccataccc cgacggggat gttgcccctt tttgcttagg     93000
     agcaacatca tggaaatcgc tatcatcgct ttgtgtatcc ctgctggttg ggcaatctct     93060
     cgtcctttcg tgagaatcgc tgaatcgttc ggttactgct gatagtcaac gcaaagggag     93120
     ggggcaaccc ctctctttct ggtcaagcct ctgtggcttg tcctcaaagt cttctggtgt     93180
     cagttggctt tgacgacaag ctacaggggg aatgtcgaat gcaacagaat cttcatgttt     93240
     acgacgatca cgcaggcatc atctatctgg ctgatggacg cgaggtgaaa tttgatccga     93300
     aactgtattc cagctcctac caggcgcaca gtgaagcagt gaagtgggcc aaagaaaccg     93360
     gggtcattgg tcaaaacgac gatgtggtga tgttcgtcca ttgagggagt agcctccagg     93420
     agaggctact ctcctcgctc cttaaaagtc ttcttactca tggtgaatac catcagtaag     93480
     cagattttgt tctcttcgga gagcgaaaag tgcgatagct ggtcgccaaa aacaaacagc     93540
     aaattaacgt taatttacta gcccaaccgg gcgcatccgc ccggttcggg acgtggtgcg     93600
     cctgtcacaa taggagcgca cctatgtctc aatactctca attctcagta agcaaggttt     93660
     tcggtatgcc cagcattccg gagaaggtaa cggccatcgg ctacgctgac ggttcaaacc     93720
     ctttcatccc tgccactgat accaactacg ttttccgcaa agagtttctg cgagaggtct     93780
     tggcctatct caaagagcct ggcggtgacg cattgttcgt aaccggccct accgggtctg     93840
     gcaaaacctc aggtatcacc gagatcgctg gtcgtctcaa ctggcctgtt cagcaaatca     93900
     ctgcccacgg gcggatggag ctgacagatc tgattggaca tcacgctctg gtcgcggaaa     93960
     agcctggtca accacctgtc atgaagttca tgtatggacc tctggcagtc gctatgcgtg     94020
     aaggtcatct gctcctcatc aacgaggtgg atttggccga ccctgccgag ctggctggtc     94080
     tcaacgatgt ccttgaaggg cgtccccttg tgatcgctca gaatggcggg gaaatcatca     94140
     agccgcaccc gatgtttcgt gtggtcgtta ctggtaactc tacggggtcc ggtgatgctt     94200
     ctggtttgta ccagggggtg atgatgcaga acctcgcagc tatggatcgc tatcgtttca     94260
     ccaaagtagg gtatgcggat gaggaagctg aactcagcat tcttggccgt gctactccga     94320
     aacttccgga aaatgtgcgg aagggaatgg ttcggattgc taatcaggtc cgcaaactgt     94380
     ttcttggcga aaacggtgaa gatggtcaga tcagcgtcac catgtccact cggacgttgg     94440
     tgcgttgggc gaaactgtct ctagcgttcc gtggtgcccc aaatgctctt gaatacgcct     94500
     tggatcaagc tctgcttatc cgtgcggcca aagaggagcg tgaagccatc ctgcgtgttg     94560
     cgaaggatgt gttcggggac caatggcgct aagaggtgac gcatgaagaa aaatgactgt     94620
     ttgtgccgtc gttacactgc taaagagtgg ggcaatgacg aaaccacaat agaagtcttc     94680
     attggctaca agttgctccg ggagcccagc tcctcggagc caggccaatt cacgatggtc     94740
     gagctacgcc gaaccgtcac tgatgggaaa gctgaaaatt ggtctgagac aaagctcgaa     94800
     ggaccttttg aagctaacgg cccagacacg atcccaatgt cctacaagga caaagaaagc     94860
     cagtatgtgt cacagtttct cagccagggg tacacctttc tggatgaggt gctggtaaac     94920
     gcagagacac agacggtgct ggaagggggg aatgtttcag ccggacaaac agccagcttg     94980
     ggatctctca actggctgtt atctccgccc tctgagttac ctccaggtga cataaacctc     95040
     ttcaaaggtt ttgttgctgg ggtttttgcc aaaggagccg gtttaatcgg ctttgaggtt     95100
     gctcggagcg aaggctcaaa tgacttgcta cccagtgtgc tgatgcgtac tgacagcggt     95160
     tatgagcttg gggttagcac tggactaggc gaaaacacta tccatccagc tacgctggaa     95220
     ggcgctggtg aactccgccc ggaacatggt cacaaacccc tgctgatgtt ggtttacctg     95280
     caacagcgtt tcgcggatga cttttcaaac gtagagaagc cgctggtggc attctgtgat     95340
     gaacagggtg ataccttcga ctacgagcgt tttgattcac taaaacccct cattgaacgg     95400
     tttggtttca gctacgacga agtaagagca gatgcagaaa ggcttggcct tgtatctgag     95460
     ctgattcgcc tggcagagat cgacgccgaa caagaggatc acttttttta acccttacgg     95520
     gggcttgctc cccgaaaggg gcgttggccc tctccaaata acttggaggt catgatgtct     95580
     aaaggcgtca acaaagtaat tctggtcggt aatctcggtt ctgacccgga aattcgctac     95640
     atgccaagcg gcactgccgt tgccaacttc aacgttgcaa caacggatac gtggcgcgat     95700
     aagcagtctg gcgagcaaag agagcatact gagtggcacc gtattgtgct taaaggtcgt     95760
     ttggcggaag tcgctggtga gtacctgaaa aagggctccc aagtctatct cgaagggagc     95820
     aaccgcaccc ggaagtggac tgacagccaa caaatcgagc gctacaccac cgaagtacac     95880
     tgcgttgaaa tgcagatgct tggtggtcgt ggaaatgcac ctcaggacaa ctctcaacgt     95940
     gcagcgcccc aaaaagggca acgtacagga gccggtacgc aatctgctcc tgtgcagcaa     96000
     tcagcaccgc aaggtggtat gggcggaggc tatggtcccg ctcctgatgg ctgggatgat     96060
     gacatcccgt tcatgcggct gcaccacttg gctggcgggt aacaccgcca actcttacta     96120
     aaccccacgg gggcactcat gccccgaggg ggtcatggtg tcctcaaacc gttcattcgt     96180
     gaattggaga aacaccatgt ctgataacaa atctcttgta acccgtatcg caagccggtt     96240
     tggcgtggac acccgaaagt tctatgaaac tttgaaggcg accgcattca agcagcgaga     96300
     tggaagtgcc ccgaccgatg agcagatgat gacgctcctg atcgtggctg aacagtacgg     96360
     tttgaaccct ttcactcggg aaatctatgc gtttcctgac aagcaaaatg ggatcattcc     96420
     ggtagtaggt gttgatggtt ggagccgcat catcaacgag catccccagt atgatggcgt     96480
     cgagttcgtg tattcggaca agatggtcag aatgcagggg gcgaaagttg actgccctga     96540
     gtggattgaa tgcgtgattt accgtaagga cagatctcgc cctatccgca tcaaggagtt     96600
     cattgatgag gtgtaccgtg aaccgtttca gggtcaaggt cgcaatggtg cttacactgt     96660
     tgatggcccc tggcaaacgc acaccaagcg tcaactccgg cacaagtcgc tgatccagtg     96720
     ttctcgtgtc gcatttggtt tctctggtat ttatgaccag gatgaagctg aacgcatccg     96780
     tgaaatggag caggcatcgg ccattaaccc ggctattgcc aatctccctt caccatctca     96840
     agttcaaagc caagagcctt tggctattga gcacaaagag cttgacccga tcctaaccaa     96900
     actcgcaaat cgcgccattg ctgaaaacgc atggtctgcg gcgcatgagt atgtgaaggg     96960
     acggtatgaa ggttcggaac tgcaatatgc gactcaattc cttcgtgaca aggagatgga     97020
     tcaaatggag cctccgaaac ctgactacca ggaagcgcac gagcaagagt ccgccgctgg     97080
     tggttctgca aatgctgaac ctggtgccga agaaatgccg cctttgagtg acgaggacat     97140
     gatccctgtt acagaagagg agggcgcgga aggcagttac tactaacccc aacggggggg     97200
     actcccccgc tgggggagat ctccctccta accattggag agaggtccat gaaaatagtc     97260
     aacctatcgc aacgcgagga agattggctt gattggcggc gtcaaggtgt aacagccact     97320
     gacgccgcta tcctgctcaa tcggtctccg tacaaaacac gatggagact gtgggccgag     97380
     aagactgggt atgcgcgtga agtcgatctg agtcttaatc cgctggttcg ccgggggata     97440
     gaaaacgaag atgctgcaag acgcgctttc gaggagaagt atgatgacat gctgctcccc     97500
     gcctgtgtcg aatcggttca atacccgctc atgagggcct ccctggatgg cctgagagat     97560
     aacggggagc ccgtcgagct gaaaagcccg agtgcgactg tctgggaaga tgtttgtgct     97620
     gagaaagcaa acagcaaggc ataccagctt tattacccgc aggtgcaaca ccagctcctg     97680
     gtaacggggg ccaagcaagg ctggttagtc ttctactttg aaggtcagat tcaggagttt     97740
     ccaatactcc gagacgaagc catgattcaa gaaatcttgg ccgaggctaa aaagttctgg     97800
     caacaggtag tagacaagaa ggagcccgac aaagatccag agagagacct gtacataccg     97860
     caaggtgaag aggtcaaccg ttggattgct gctgctgagg aataccgcct ctatgatgca     97920
     gagattcagg agctgaaaca gcgactgtct gagcttcaag aaaggcaaaa gcctcatctc     97980
     gacaccatga agtccctcat gggggaatac ttccatgccg actactgcgg tgtgatggta     98040
     acgagataca aagcggctgg ccgggtagac tacaaaaagc tgttggctga taaggcgtca     98100
     ggcgtgaagc ctgaggatgt tgaccagtac agagagaagt catcagagcg gtgccgtgta     98160
     acggttactg gctctgtgaa gccacggtac attgttgatg aggacgtgct tgctcctctt     98220
     gatgatttgc cggaagaagt agagacgttc tactggtgag tgggggattt tcccccgctt     98280
     tcccttgggg attctgggag tctccaacgg aaagcaagat tttgttctct tcggagagcg     98340
     aaaagtgcga tagctggtcg ccaaaaacaa acagcaaatt aacgttaatt tactagccca     98400
     accgggcgca tccgcccggt tcgggacgtg gtgcgccccc aactttttgg agtgcatcat     98460
     gactaaagtg aaccatctac aaagcctctg tgttatccac gtagactttg acatctggag     98520
     tggacaaacc cgtttgtctg catctgatct caagctgggc gagggtggtg aaattccacc     98580
     tgagaaagta gctcaactgg gaagtaagaa gatctgtgat ccggctaagc tgaaaggctt     98640
     tcatcgcctg aaaacagaaa ctcgtcgcct cctgctgaaa ttcggtatgc cgttcatgaa     98700
     cggatttgcc gtacccgtca gcaagaccga tgaaatctgt aacaagctga atgacatcaa     98760
     ctttcagttt aaccaactga aacaggattt catcaaaggt tacaacaaag ccgtggatga     98820
     atggtgtcag gagaaccctg agtatgaacg agctatccgt gccggagccc ttccaaagga     98880
     aacggtcgag gagcggattg gctttgagta ccaggtgttc atgatccagc ctgtgaacga     98940
     agatgaggcc aacgccaaac gccttaaccg caaggttgag cgcctgggtg acgatctcat     99000
     ctccgaagtg gttcaggaag cgaataagtt ctatatggaa cgtttggccg gtcgagacca     99060
     atgtgcggtc actactcggc agacactccg taacatccgc gacaaggtgg atgggcttag     99120
     cttcctgaac agcgctttta accctctggt caagctgctc gaccaaaccc tccggggata     99180
     cgagcaacat gccgatggcc gaaacatcgt tgcgcctttc ttttatcagg tcgtggccgc     99240
     agtgctgatc atgagcgaga gggaccgcat cgagcagtat gccaatggct cgattactgt     99300
     agagggcatg gctaatgaca ttggcggttc gggagcccag atgggggacc gttctaaaga     99360
     tgaaaaggcc gaacagaaaa gcgataaagc cggtgagctt atccctgcaa cagagggtgg     99420
     cgaaaccaag cagcaacagg taggtggtac tgaatctgtt caatcagaac agactaacag     99480
     cggtggtaac tctgttgacc tggatgaaga catcgacaac ttcttcaaga gttttgcaga     99540
     acgaggcgag ggtgaatcgg aagatgaatc caatgccggt gatgtggttc gagaagagcg     99600
     tgttgatgtt gaggatgagc tggttttgcc tgaggaaact ccggtagagc aagagcctgt     99660
     ccaagaggag acgacagagg agcctctcaa ccaggagctg cctaaaactg acgacgatgg     99720
     cgactatttc ttctaatagt cacttcaact aaaccgaccc ggaggggata gccattccct     99780
     ccaggggtgg actatctcct tccctaccag gagaaaagat atgtccaaaa aacgcaccat     99840
     ttacagcgct ctaccaatcg tggccgcagc ctatggtgaa aaactcggtg tcaaagtcgc     99900
     catcggtaac gatgacgcat acaccgatgg taagaccatc gtggttccga atatccccga     99960
     cgactatcct cacatggatg ctgtctgggg gtatttggcc catgaagcag cccatgtccg    100020
     gtttacggac tttggtgttg agcgccgcag aggtcttcat gctgagttgt ccaacgtttt    100080
     ggaggactgc cgcatagaac gggccatgat ggaactcttc cccggtacgt cgcagaccct    100140
     gaatgaggtt gctcgctata tggctcaagc tggtcattac gagcacgtca cagacaaaga    100200
     ggcccctgcc tccattctga cagggttttg tttgtactgg ttgcaaacca aggctgtagg    100260
     gcaatccgtc cttcaaccct atctcgattc ggctaccccc gtattcgagc gcgtgttccc    100320
     tcagggtgtt gttgttcggc tgaacgcttt actgcgtaag gctgtgaaca ctaagtcaac    100380
     cgcagaggtg acatccttgg ccgaccaaat catcaagatg atcgaggagg aaaaggagaa    100440
     agaagagcaa aagccccaga atggtcagga tggtaacaac cagcagaatg ctggtggcaa    100500
     ccaacctcag aacagtcagg gcggaagtgg taacgatcaa aaccaagggc ctgatgccaa    100560
     tggtggtgat cagcaaggta aagaccagaa gcaagacgat gctaacggga aatctgatcc    100620
     gaaaggacag ggcgaccaag gcaagtcgga tactgatggt ggcagcaagg caggacaaag    100680
     ccaggctggt ggcaattctg acgcggcgaa acaagacgcg gccaaaatgc tccagcaggt    100740
     tctgaatgcc ggtgccggtg atttgcgtgg tgacgcgcat gatgcactta aagccgagct    100800
     caaccgggtg gctcaagata agggggacag tagctatatg actgttcgct ctgctgtgaa    100860
     cacccaggac aaccctgctg ttggcaaaag cctggtaggg gatgtgaaga gcaccacttc    100920
     aaagataaga acgcagctct acggattggt ccaggccagc cagcgagttg ctcaccgtaa    100980
     ccaacgatca gggaagcgtg tggatgctcg gaaactacat cgtgtagtga cgggtgatac    101040
     ccgcgtattc ctcaagccag aagccaagaa acgccctaat acggcggttc acatcctggt    101100
     tgatatgagc tcctcgatgg cctacaaggc cgccaatgga aaggagcgtc aagacattgc    101160
     gcgggaagcg tccttggcta tttcgatggc tctggaagca atacccggcg taaacccggc    101220
     agtcaccttt tttggtggca accggaacca gccagtgttc agtgtcgtga agcatggaga    101280
     tacggttcag aatcgggccg gtcggtttgg gttcaaagca actggcggta cgcctatggc    101340
     ggaagctatg tggtatgcag cttttgaact caccaagacc cgtgaagagc gaaaaatgtt    101400
     gatcgtagtg actgacgggc agcctcaaag cgccccggca tgtcgctcag tgattgacct    101460
     ctgtgaacga agcgatgttg aggtgatcgg cataggggta gagactaccg cagtgtcagg    101520
     actgttccaa aagaacattg tcattgatga tgcggcagct ctgcaacgca cactgtttaa    101580
     gttgatggag cggtcattga ctgcttttgc agcttaacag gaagtgaaac gacaaacggc    101640
     tatcccttcg ggggtggccg tttttatttg gagagtctat gaaccaattc cattcatctt    101700
     tggatttgta tcatcggaac aaaggtagaa gggctacagt gccggagacg ccttttttac    101760
     tgcttgctaa gcgcattcct ccgatgtact ggagactgtt ccagggtgtt actttggata    101820
     gtcgtatggg atacacaggc aggcggcagt tccaccgtct tgggcaagca atcgactggg    101880
     caaagtcatc agttggcgat tcctggtcaa ataagcgctt tcacaagccg gtaggcctcg    101940
     atgtattgct ggcctgtact gcgagtaagg tgcctgaaca tctggtcgaa gaactgaaaa    102000
     gacggggcag ttgatgcgtc tttgagcttt gcacccgaaa agggcagttt gagcgttcct    102060
     gttcacacag ctctcgtgga acaatcaaag tgaggaggga ataccctccc actttctcag    102120
     aggccttcat tgagggttgc tgagaaagtg aattttgtcc tctctgaggg cgaaacgtgc    102180
     gatagctggt cgccaaaaac aaacagcatt caacctcagc ctaagggcgc actgcgcctg    102240
     acaggctctg tgtgcccaag ttactttaag gagcacacat gtctcatctg aacaatctca    102300
     aatccgtaat gatctctctc gccgccgaac ataagctgcc tgaaatctac caggatgaca    102360
     tcactaccga tgtggagtct ctggatcgat tcgatggttt acgtctggtc tggctgttgc    102420
     ggtcttgcgg cagcgtattg gtgccagcgg aagttggcgt taatccgatc tatatcaccc    102480
     attggttgtg gtctaaccac ggtcaacagg tggttccatt ctctgtggat acccgcacgg    102540
     ggttgattga aaaaatcgac ttcgagcaag ctgaaaagct gatcatgcag atgccttgca    102600
     acctctcttc attgcagaac aaggaatact tggttgacca ggtaaaccga gtattgcaac    102660
     gaggttgtga aatgcgtatc tggggtatct tcgagtctcc aagctcggtg gaatccgttg    102720
     gtggttggaa agagtggcag agctatttca gctctactgg gaatcgactg atggccgatt    102780
     tcgttggtaa agccattcga ttcaccaacc ctcgataaat cgccgttcaa ccattaaccc    102840
     taattaaccc tatggggctc cgatagccct gaggggacgg ggctccgcaa tcgcaataag    102900
     gagtccctat gaaaaaccta tcagctttgg aagcagttct tgactacgac aaaccttctc    102960
     gacgttttct tgatgagctc aacgaaaacc agatgaagga tttgtccggg gaaatcttcg    103020
     ccaagctcta ctggagcaag cgtaatcccc agtggtacga gaaagacacc aatcggctgt    103080
     ttgcacgact tcgttgggtt cagcgcatca tcaagaagcg cttgaaaacc ggcaaggtta    103140
     aacctgaact gacagaaaat ggttcagtga tggagcgctt caacttccct tatggtgaca    103200
     ctctcgattt cttccatcgg tacttgcgac atcccaaatg ggaggttgtg tatcaagaat    103260
     cggggtgcag tgccttttgg aaaaatgaag caacgcttga gctatgcacc tactgcgaag    103320
     gtgatgtggt catgatgaag gctcctgatg aagcaacctt ctttcgtgat tgcaatcgcc    103380
     ttagctggtg gtatgcagat aacgcttgat cttaatccct aaccaggggc gaaccggccc    103440
     ctgatgggag catggtgcgc cccatctatg atggaggacg ccatgttcaa atcatcagta    103500
     tgctcctacg aaaacagggg gccttacgga aacaacaagt accgaggcaa ctgctcgggc    103560
     tttatcgtta aagacttcat tgagtcttac atgagaaagc cgaacgggct ggtggcagac    103620
     ccaagtgttg ggggtggctc tagcatcgac gttgccaatg aacttggtgt ccgtttcaaa    103680
     gggacagact tgcatcaggg gttcaacctg ttgcgggatg acttcctttc gttcctcgga    103740
     gagcctgcac acctgatctg gtggcaccct ccttactggg acatgatcca gtattcaggt    103800
     aagcagtggg gcgagcccaa caaatgggat atgagccgca tgaatttgcc tgagttcgtt    103860
     gaagcccttg agctggccgt tatgaatatt catgacgcct gtgagcgagg agggcattac    103920
     ggaatcctca tgggaaacct gaggcgcgat ggggattatt tcaacctgtc cagccttgtg    103980
     gaacgtatcg cacctgggaa gctggtggat gagatcatca aaacacagca caactgtgtg    104040
     agtgaccgaa ctcagtattc cgggaagctg gtgcgtatcg cccatgaaaa gctgttggtg    104100
     tttcgtcgta acgacgttgc ctcatcgctc tgtcttcttg ctgccgtaca ccgtcgagca    104160
     accaatatgg tttcgactac gtggaaagct gcaatacgcc gaaccctaca ggggaaaacg    104220
     ttgaagctgg agcagattta caaagagatt gaaccctacg caaagcatcg agagaacaac    104280
     cactggcaag caaaggtcag gcaagttctt caagatgcca ggttctttat tcgcatcgag    104340
     gtaggtgtct atgcacttgc tgagtagccc aaccggggcg tgacatcccg gaggggattg    104400
     gtcgcgctca tcaacaacaa aggagcgtga ccatgaacgt acaacttcaa gccagcaaca    104460
     atgtgctgtt ggcgcaaatc gaaagcaaag gcctcactgt tgaaacgcat tgtcgcagtg    104520
     gcttttgtgg catgtgccgg gttcgtctac tcgaaggtca agtggcttat gacgagacgc    104580
     ccatcgcatt tgtcaaagaa ggggaagtgt tggtttgctg cgctaaagca aaaaccgatg    104640
     tgaccttgga aatttaaccc atccggagga gcctttcctg cgggtggggc tcctctatcc    104700
     attacgagga gaaacactat gtctatcaat accaaagttg aacaaatcgc atacggtcat    104760
     gctaccgctc tagtgctcag tgaactgggc caacaagaga attggtgcaa ggcttatgag    104820
     tatttgtctg agtgtgtaga acggggagac gaacctgagg atctggtcgt ttggcaaccg    104880
     tttgagcact gggaatggaa agacattctg gagcagatcg agagcgaagc cgagtctctg    104940
     ctttcgacta ttaagtcggt tttaggcttg gcccacaaag gcatcattca gtcagcaatt    105000
     gactgctctc tggattcgga catgacccag cttgacctga ttggaatggt cgagctcgga    105060
     agtgaaatcg aagatgggga gtgtgctgga ggtggctatg cagcttaacc gatacacggc    105120
     cagggagtct gacaaaagtc ggatacttcg gaccataggc tggtgcaagc gcaaccacct    105180
     tacacttgcc ggtcttccat acgaggacaa tcttgcagga agtgatggga tcagcataga    105240
     gatcatcact cctcctggta tgtcgcggga aatgttggag caagccgtca gagaggggta    105300
     ttcagagcga gatgtcgtaa ggcatcgcat tctggagtgc cctgtcggtt ggttcatgga    105360
     agctgatggc aaggcatttg atcatgaagt gttccacgat tacgtggtgg ctcatggtta    105420
     tggcgaacct tccagcgaag cctatgagct ggcggagcgg tggttctggc agggcaacga    105480
     ttatgcgttg atagctgcgg aaatagttgc tcgtgatctt tgtgttcgtg atgacgaaga    105540
     tgaggactga tcctatggat gctgtagcgc atatagcagc agataacctt gtaccggcat    105600
     gtggaggtgc agagaagccg tttaccgtta gtggtagaca gtggctttac tgctatcacc    105660
     cagccagtgg gaggcactgc tacttagacc tcgataatga ccgtccagtc tggcatcgag    105720
     gatttcatcc tgcttttcat cctgagcttg agttcgctga tgaagctgag ttgcttcgac    105780
     cagttgagcg aaagcctgac catgaagagc tggaggattt ttacttttaa cccacggggc    105840
     cgctcttcct gatgggagac ggtcctccat tctcaaagga gaagaccatg aaagatcaca    105900
     gtcaaacgat tgtgttccct gggaacaatg ttgaatcact tgctgaggct aacgccatgt    105960
     tgagcgctgt gtcggaagat gcacgtaaag ccagcaatac ggaagacaaa cgtgaccttg    106020
     aatcgcttca aggctggctg gaagagaaca tcaattctca actggcaggc gtgaagtaac    106080
     tatgactgta accccactgg gggcttcatg cccctgtggg ggcatggtgc ccgtaaaagg    106140
     agtcaccatg aatgcagtga agatgatcca gaaggaaaac cagcttgagc tgccgctttt    106200
     cttcctggat gaagagccga agaccgcaga agtcattcca tttgagccaa agcctgaatg    106260
     gactgatgat gaggtaaggc agttacgtga tgggctttta tggcatagcc ttagagtcct    106320
     tgctgatggt cgagctggaa gtgaaatcaa gcaggaaacg atggcttggg tgatgtccga    106380
     tgaggtacat ccattctcat ttgtggtctg ctgcgatgaa gcaggttacg atccatctgg    106440
     agtaagggaa ggcgtgaagt ctatcctaaa ccgcttagcg cgggttaaag cggggggtta    106500
     accccctgct ttcccagtgg catcgacttt cacatgtgaa agtttgtgcc cctcggaaag    106560
     caagattttg ctctctgtcg agagtgaata gtgaggtagc tggcctcccc aaacaaacag    106620
     cattctacat aacccttggg ggatcactgc ccctcgggct ggtggttccc tgacaaacat    106680
     ggagccacaa ctatgactac tcttgccagc tttgcgaatc cgatttctgt tattcaacgc    106740
     tcaccaacca gtggggtgtt tggcacaaat cagttcgtag gagacaaaga gggatttgta    106800
     caaaaggtgc tcggaaagtg gtactgcaat ccagggaata ccattcccgt tgagagcatg    106860
     tcccaccttg agcaggcgga gaaactgtat gacttctatg tcaagtatct ccaagtgaaa    106920
     gaaaagatct ctgtgaacct tggccgggtg ctgcataagc tgtacagcac tggttctatc    106980
     aaggaagcag agatcgtgct tgaagcaata aaggctcagg ctggcgtaac agcttgagca    107040
     atctactaac cctaaaccgg gtgcatccgc ccggttcggg acgtggtgcg cccccaaact    107100
     atttggagtg catcatggaa aaacataacc tcaaatccgg attcagcatc tatttcgctg    107160
     acgtccattt cgagaaacaa gtctacgcat tcggctcagg acttggcttc acctctgtga    107220
     tttacgccta ctcgctgggc cgagatccgg aagaagctga gaagctggcg cttgaaaagt    107280
     acgactctga cgaaacgaag gtgaagaagg tgcatgtcaa tctggctcgc agccaggaca    107340
     tcaaccgcta caccttccct gaacaaatgg ctggctttgc taatgccatt cagtctcacg    107400
     gcatcgctgt gaactgagaa ccactttaaa cccatcgggg ccattacttc ccgattggga    107460
     cggtagtggc ctctcaaccg aaaggagaga gctcatggct actatcgtaa acaccaagtt    107520
     aggagaacat cgaggcaaga agcgcgtctg gctggaaggc caaaagctac tgcgtgaagg    107580
     ttactatcct ggcatgaagt atgatctgga gctgaaagat tcccaggttg tgcttcgcgt    107640
     caaagaggag ggtaagttca ccatcagtaa gcgtgagcgc aatggccggg tgtctccaat    107700
     catcgatctg accgtgcagg agcttgctac cgtttttgac ggtgtagaga tgctccgcgt    107760
     gttcatccgt aacggcgcaa ttgtgatctc tgctcaccat caacaagagc gagtgatcga    107820
     gcgcgtcaac cggcttatca gtaagctgga gaatggagaa tcgctttcgg tatgcagcct    107880
     ctttcatggg ggtggtgtgc ttgataaagc gattcacgcc ggttttcaca aggcgggaat    107940
     tgccagtgcc atatctgtgg ccgtggagat ggaagggaaa tatctcgatt cgtctttggc    108000
     aaataacccg gagctttgga acgaagattc tattgttatc gaatcgccaa tccaggctgt    108060
     gaatctcagc aaacgcccac cacaggtgga tgttttgatg gggggcatac cgtgtaccgg    108120
     cgcgtcaaag tcaggtcgca gtaagaacaa gttggagttt gccgaatcgc atgaggcggc    108180
     aggtgccatg ttcttcaact tcctgcaatt cgtagaagcg ctaaacccag ccgttgtgct    108240
     gattgagaac gtgcctgagt accagaacac cgcttcgatg gaagtgattc gttcggtgct    108300
     ctcttcgttg ggttactccc tacaagagcg cattctcgac ggcaatgagt ttggggttat    108360
     tgagcgccgc aagcgtcttt gtgttgttgc gctttcccac gggatcgacg ggtttgaact    108420
     tgagaaggtt cagcctgttc gcaccaagga aagtcgcata caggacatcc tggagccagt    108480
     tccgctcgat tctgaacgtt ggaagtcatt tgactatctg gctgagaagg agttgagaga    108540
     caaagctgct ggcaaggggt tctctcgcca gcttctgact ggcgacgatg agttttgcgg    108600
     caccataggt aaggactatg caaaatgcag aagtaccgaa cctttcattg ttcatccaga    108660
     acagccggag ttgtctcgca tctttacacc gacagaacat tgtcgagtga aagggatacc    108720
     agaggaactc atccaaggtc tgtcggacac tattgcccac cagattctcg ggcaatcggt    108780
     agtctttccc gcgttcgagg ctttagccct cgcattaggg aacagcctgt ggagctgggt    108840
     tggaatgatg ccaatcatgg tcgaagtcgt ggatgaatca cagccggtga tcggtggtga    108900
     agacttccat tgggcaacgg cattggttga cgcaaagggc actctcaagc tgtcaccggc    108960
     agcgaaaaaa caggggatgc ccttcaacat tatggatggt caattggctg tctattcacc    109020
     taacggaact aaaaagagct gcggccatga gccttgcgaa tatctcccgg taatgatgtc    109080
     cggagacgca atcatggtca cttcatcttt ggttcattag taactcaccg gggcaatgcc    109140
     gaaaggcctt tgctccggcc tatccgaaag gagagtaatc atgaaaatcg aaactgttgt    109200
     gcctttacct cccgaggatt caggccttca acactgcatt gccaggttcc ataaccgcaa    109260
     catggattcc aagcgaaaag acaagacccg ttttttcagg agggagccgg ttatgatcgt    109320
     aaacccagag accaaagcaa aggttctccg gtatgcgatg ggcaaccctg ggaatttatc    109380
     catcacaaag ctggcggtcg cgctggatta cgatgcggta gatgctctgg gtgttcgttt    109440
     taaagacact gtaaatcttg aggttcgcag agccaggcgc tgggaagtct ggcagtggtt    109500
     ctggaaccat ccggatcaaa gtgtccaact gtcaatcaaa ttgggcgtgg ttggcgctgt    109560
     gttgggagtc atgggcttcc tgactggcgt agctccgtac ctcttgggat aaaccaataa    109620
     agccgttaac gggcaatgta agtccggaga cggcttgcat tgctctctcg aaagtggaga    109680
     gtcaaatgaa cacattagaa caacttgtaa atcagagagt gcttgaggaa ggtctgaaaa    109740
     aggcgaagcc attggccgcg caaatggggc ttgaatctgt acctgatgag atgcttgaaa    109800
     tgatctgccc aaacttgaac tactctgggc agtttacgcc agctctgtac gcgagatttc    109860
     aaagcgtaaa gcgattactg aaagagttgt cggaacaaac ctcacctaag cacgggcata    109920
     ttgtgaagtt taccaaccaa tatgggagct acgatgagtc agctttgctg ttcaaagaag    109980
     gcgacgtcag aaaccagaac ttggttgctt gtgtgggcgg gaagacgata aatctcggag    110040
     agctagagct tcgagattat gggctcaata tgcacatcgg ttgcggtgga ccatttgagc    110100
     cgatctcaga agcgcagatt cagtccttgt ctgagtttga cttctatgag acgacctaca    110160
     gattctgggg ccagaatcca tgtggaaacg ggatgataga catcaccgtc cctatgaaac    110220
     gttggttctt gactgtgtag cttcaacctg agtgcgccga gaaatcggcg taccggcccc    110280
     ttaaaaaggg taatcagcgc agggggaaac cccgcgcttt cccaagcatc tcggtttccc    110340
     agggtgcttc ggaaagtgcc ttaggcgctc aagtgcggta gctggctgcc aaaaacaaac    110400
     agcaaattat caaccctgac gggagcacct cctgttaggg gggctccgtc ataaactgaa    110460
     cggagatata gcatgtctaa aaacgtcaac gatgtttttt caaaccgaac ttctttggaa    110520
     tgtactgtga atgcagcgct ggatcgtcgt atcggtctgc gtgtcgggtt ccctcattac    110580
     agagaaggag caaacggtgt ggtttgtgag atcgaagcag agtacccatt gctcaacact    110640
     cattcgagtg ttgcatggcc cctgctcgat gaactcaaca gttacaccat ccaaaaaaac    110700
     caatcgctca ttgatcacat tgataatgcg gtcgctgaac tgttgaaaca caaggctcgt    110760
     ctacagcttg atattcaaaa gctgcaagac ggtgacattg atctggtgaa acaggccaag    110820
     cagcaatacg aagacaacca gatgtcgagt agcagctagt tcaggtctga tagccaggat    110880
     tcaattttaa ccctaccggg gtgctttccc ggaagggatg ggcaccctgc taatccagga    110940
     ggccctatgc aacaaacatt aaactttgat ctatcagaac aacccatccc agtgcttttg    111000
     cgtggggata agtgggattc tgtttggtca gaactgactg ataacgagga tttgaacttc    111060
     gttgatgcca gtagaggaac cagtctgtca tcgttgatca cgtcatcggt tgagtccatt    111120
     cacacggcct taattgatgg gtggaccatg atgatcggct attccagtgg taaagattct    111180
     gaaacggtct tgcacctgtt cctgatggcc ctgatccggg ctgtaaggag tggggcgacc    111240
     atcagccagc accacttcat cttgcacact gacacactga tcgaaagccc agaggtaagg    111300
     tggctggcgg atcagaaact ggccgagctg gagcgtttca ttgcgaagga aaaccttcct    111360
     ctgaccatcg ttctagcaaa gcctgggatc tcgcagagtt ggacgggccg aatccttact    111420
     gggagggggt tgcctacgtt ttccaactcc acggcccgcc agtgtagcca ggatttaaaa    111480
     atcacctctg ccaaaagagc gaaggcagct tatatgcgag agcttcccaa agaggttcga    111540
     cagaaagtct gccttttgct gggcagtcgt gatgctgaaa gcactattcg tgcggccaac    111600
     attgcaaaac agcgaggaag ctcagatcgc gtcattaaga cgaaagatgg gggtgagctg    111660
     tatgtggtga aaaactggtt ggcgagtgat gtctgggagt tcttactatc cgctggcatg    111720
     ggctcagcat atcctctgcc aagttacttg gagagcaatg tcactacggc agagctttac    111780
     aaggcggcaa caggggagtg cgtgtggtcg gcaacagaga agaaggccag tgacgcctgt    111840
     ggcgctcgct tcggttgctg ggcttgccag gctgttgggt tggataagtc aatggagacg    111900
     ttgcttgcca cggaccctga aaggcatggc tatatgtcgg ggctgaaccg catccagcgc    111960
     tacttggcaa aacgccggta cgcatgggaa gaccgccatc ccgtaggtcg aacgatttac    112020
     gagggcggat acatcaaaat acagccggac gtttacagtc ctgttttcct agaacgattg    112080
     cttcatgtct gttgcagcat ggactacatg gagcaaaaga gagctgatga gctggcatac    112140
     aagctggcta ctggtcaagc agaggataac gactggaacc gtcgaatggc agagccacaa    112200
     ttccggatca tatcggaaga ggctttagtc catatcgact tcatgtgggc cttccatcat    112260
     ttcaatgata agcctttcca tgccctggag atttaccaca gggtttggtc gatgggtgat    112320
     ctggacttgc tggaagacga gccgcagtgt gaaaccgttc ctcagtcacc aattccgaag    112380
     ccattgtggt tgaaggttgg tcgctggggc gatggttcgc tttctgatgg cttggccgat    112440
     ccgttagcgg aaatggctta ctttgacggc ggggatgacc cgttggcagc gcaagtgatc    112500
     aataccgcag acggaaagag aagggtggtt tgcttcgcag aagatgatga agtgaaagtc    112560
     gatcccgact ccgctgcgtt catcatctgg aacgaatacc cgcgactaag ggagtctgta    112620
     ctaaagggac attatacgcc cggtagtgca gcgcagttct accttcggtt cggagcaatc    112680
     cagcttgcga aaggaaaagg cgctttgtat caccgtatga tgcaaagagg tcaaacctac    112740
     caccagatgg gccttacagg gctacagacg atggaaggaa tccaacagcg caaggatgtc    112800
     aaagtgctta gcgatgctaa gtacaaagat ctggtgaagc gaaaaatcaa gggaagactg    112860
     gcaacggtac gctggtgggt caacttgcac ttaacgttca agtaccatct gcaccaccgt    112920
     actccgacgg ggttgttcat cgagaagcaa cttgaccagg aagcaatgga agaacagaaa    112980
     cggcatcagg agcgatggtt taactacgtg actgacgcga tgctttgtta ctccagcgca    113040
     ttctgtatga gcgtcatgga agggcgagag gggagcggaa acgccaacat tcgtcgttac    113100
     atggccgcga ccagaaggaa ggcttatacg gccctctgcg agctcttgga caatactgac    113160
     gcccagtgga tgaatgatgt ggtccagagt gccgtagggc agtatgaggc gatacaggca    113220
     gccctaaccg aaggttccgc gcttgctatc tatctcgact ggatcaacct actgtcaaaa    113280
     cgccatccag cctctttgga gcgacatgtc agaacgatga tcaaggcggt tcaacgctta    113340
     catcgccgcg acgacacaga gttgcaaaga ggacagcaag gcttgtcctt ggccgcataa    113400
     aaagccctcc ttcgggaggg ctttttcttt tgcaccccaa aagggcaatt acagcgtttt    113460
     acccttttag gtggctgtca tactctttgt tcattgtcag cgcttgctgg ctataacggt    113520
     agctggccca aaacagcaat aacctaaccc ctcgggagga aacccctcct gggttctctc    113580
     ccacaaacaa aggagagaag catgagccta gacaagttaa gtcggctggt ggaccaacaa    113640
     cgaaagatcc aggatgaaat cgacaatgaa atcattctgg ccgtcaaaga ggtgttggct    113700
     acaaactcag tcggtttagc ccgtgagctt gttgggggtg tcccgcaaga tcatccattc    113760
     catccgtttt tactcgctat agctaagcag cttgacccga gataactaag taacccaacc    113820
     gggtacacca aggcccggtc ggctttggtg tacctccaac caattttgga ggcactatgt    113880
     ctaattcaaa tttcggcttt ctagctctgg ccttgcgcca acgcctgatc aaacgctggt    113940
     cactgatgca ctctgttcaa ccggagtctg tgttggaaca cagcgctgtt gttaccctgc    114000
     tttcctacct ggctggcaat attgccattc agcaagggaa gtcggtggat ctggcagtca    114060
     tgcttgctca tgcttcgttg catgatgcag ccgaggttct ctgttcggat gttgtaacac    114120
     cggtcaagaa agcaaacgct gttttgcagc gtgagtttga acgactggaa aaggccgcag    114180
     aggacaaact catccagact cttcccgaag aactccagga tgcagtcgcc atagccttcg    114240
     ctcccggtgg ctatgaacaa tcactggtta aggcctgtga tacctactcc gcttacatca    114300
     agtgcaaact tgaggtggcc gcaggtaatg gccttgagtt ccaggatgct ctcagcaaaa    114360
     tggaacgtgt tgttgctcag gtgaaatcgg acttcccgga aatcgacgct ctggacaaat    114420
     ggtttggtaa cggactcggc cattcagtag ataaactgct ggcagggggt aacgatgact    114480
     aatccaatcc ctggcgacat caagattaag gactttggcc gcgaccggaa attccgttcg    114540
     gttgatgagc ttcaaagcac tttgtcagaa cagtacaaag gtcagcatgt cagcatcgtt    114600
     taccctgcaa agcccagcgg tttactccgc acggtttttg tcagtgtcga tgatgctggt    114660
     ggcgtgaatc gaacctatgg ggaccagtct cctgtcgatt tttctgccat caaagatgac    114720
     ctgtatgtac caagtgacct gtaggagagc actagctatg gtggtgatca tcgtaaacac    114780
     aggacactat gagtttatcg gccttggtga gacccacgga caagccacag aagggctttt    114840
     gaaacgctgg gacgaacact gcgaacgtaa tccggatgct gagtctggtt acatgcagga    114900
     gctgatagaa gaaggaagcg cacaagttgt cgagatggag cccggctccg ccgtaattta    114960
     cggacttgac ggctaagcct tctcaactaa cccactcggg cgcatcatcc cgagagggtg    115020
     tggtgcgtcc taaccaaaag gaatgcacta tgtctaactt tgaacaagct ctggagcgta    115080
     ctgacggtaa aacactgatt ctcagcaatg ggagtaagtg ggcaggccaa gacccggaca    115140
     gtattcagac tttactggat gtcctgggtg acaacgttct tgacccgatg tttgagcagt    115200
     atcactgtta tcgcccatac ccgtttgaac caatggtgag gacggggcga aatggcgaaa    115260
     tgttccagcc ttggcttggg gcagcctgct tctttgggaa cttcctgact gtctctcatg    115320
     ttttcaacat catcacgaaa gatgacggtg ttgttgaggc cttaacagag gcgatccgga    115380
     agaatatggc gactgaacag taccagcaga atgcctatga gcgttatgcc ggttggttct    115440
     acgctgaaac cagcgaaggg ttaaggctag tctctccaag tgaggctgcc gacatccgag    115500
     ctggcgcagt ttcaaagctg cgttacccaa gaaacttcga ggttatgaaa actgcggttc    115560
     tcaaaggtcc tcgatttgat actgaattaa gccgcaaggc ttcttaaccc aaacattaac    115620
     cccacggggg acatcggtcc ctgaggggat ggtgtctccc tctgaaatta aggagatacc    115680
     aatgattaaa cagcattttc aaaacgaact ggttaagtgt ggatacccgg atgatctgac    115740
     gattgagtac agtctcggat actgccaggg ggatggcgta gccttctacg gggatttgag    115800
     cgttgatgac gtcaaagctc tcatgaatcg cctattcagc actgagcccg gccaagtgga    115860
     tgctgtcagc cgcgtgaaga acctgatggc acagaaagac attgagaata tgctttctgt    115920
     cctccgcgaa tatggttcct gtgacctgtc cattactcgg aatagtcacg ggcatcacta    115980
     cagccattgg aactgcatga acatcgacga caacgtggac ttcacaggga tcttccctga    116040
     tgatgattcc atgattggca ccggcattga agggattaac caggatatgg tcgagcgctg    116100
     gcaagacctc tgggaacgct ttgtgctgga gctggcggat gatgtaaaaa gtctttccaa    116160
     gaagctcgaa gcggacgggt actcgctgat cgaggcctct ccatgcgaag atgaagtggt    116220
     ttgggaacgg gccactgaaa actacctggt gcgtgttact gaactccctg agcgggattt    116280
     cgatatgggc cactgggatg acgaagtaag agaccaaaca atttgttcta tcctggaagg    116340
     gaaagagcga gtgcttggcc tacgtgttga ggtactctct cgtgaaaacg agattgtcct    116400
     gggtgaagag agtctgcacg gcttgaccgt tgccagtgat gacaagagct acgctggcta    116460
     cagacgagaa cttctccggg gagctatcca gcaaaccagg gactttttct ctcgccacct    116520
     caaagcggca taacaaggca gggggaaacc cctgctttac ttcccaagtc ttcttactca    116580
     tggtgaatac catcagtaag cagattttgt tctcttcgga gagcgaaaag tgcgatagct    116640
     ggtcgccaaa aacaaacagc aaattaacgt taatttatta atccctgcgg gagtctatct    116700
     cctgctggag atacctcccg ttatttctgg aggtatccat gaacaaattc caagacttta    116760
     agttggttta tcgtcaaggt ggtcgtcgct tagagcgtgt ctttacggac actctttacg    116820
     cgaatgtgaa gcgtgtcgct gactcgtttc ctccgaccgt tctttggcgc attcagccag    116880
     cgtaaaactc ggaaccttaa agctcggctt tggccgtgac ctttcaataa cccatgcggg    116940
     tacacttccc cgcacggggt aggtgtaccc attaactttg gagtacacct tatgaaccaa    117000
     gtagctaaat tggacctcgc ccaaatccgt caacaagcca tcaatgatgg tctgctggtg    117060
     gaccaatctt ccatcggtaa acaagctggt ttcctgacca atgtggcagt gaccccggca    117120
     attgtcgatg gagtatttgg tgcagatggt aagcactcgg tagaagactt ccttttcatg    117180
     tttttgcagc tttgtgttgc tcaaacaaag gtcgctttta ccgacaacaa gaattgggga    117240
     aagattcgtc tttattaccc catgcccact gtagatggct ttttcaaacc cactgaggtt    117300
     gtgattaagt cagatcctgt aaccgcagat gtcacaatca tgatggcctc ggaagagggc    117360
     gctcatttgt gcttgtgata ttcacaaaat tcgcctccgt ttcgggggcg acctttttaa    117420
     acccctcgcc ggggagaact ccccggctgg ggagcctcct tggcacattc tcccggtgtc    117480
     ggggtttcct taaaaccctg gcgacggggg tttaaggaag cctcgatgct ggggttcacg    117540
     ctaaggagaa aacctatgtc ttactacaaa gctgacaccg ttcgtgaagc tgcaaacgga    117600
     aactggctat tcatcctggc ggccctagcg ccccatcttg aaccagctct ccgtaaacct    117660
     ggtcgtcatg tttcttgtcc tatccacggc gggaaagatg gcttccgact gttcaaggat    117720
     gcccacctga ctggtggcgg cgtatgcaat acatgcggtg ccaatcatga tggttttgag    117780
     ctgctgatgt ggctcaataa ctgggacttt aaacagtgcc tgagcgaggt tggtgattat    117840
     ctgggcgttg agaaagagca accccagtat caacaagccg ctgcaccgac acgagctcct    117900
     gtccaggcca aagcgcctgt tcagcaagag cctatgaagg tgaataacaa ggttctcgat    117960
     tccaagaatc gtaaaaaatc cattgccggt actctgattg cccacggtaa agctccttat    118020
     gagcataacg aagacaacga gctcagctac tttgccttca tccgtgacaa gagcggtttg    118080
     gaacgcacca tctggggcgt ggatcttgaa agagccattg gtgaaagtga agccaagtat    118140
     ggggatgaga tcgtcatgac aaacctcggg cgcgagcctg taactgtcgt cgttgaagtt    118200
     aaggacgagc aggggaatgt tgtgagagaa caacctatgc aaacgcatcg caacacctgg    118260
     ctggtggaac gtcgcggcgc tacggtaacg cagttccgcg ctcgctcgaa cggtggtgtt    118320
     gagccggtga gtcaccatgt tgagtcggcc cctgtggtca accgcaaggt agaaactccg    118380
     gcaccgcaag tacaacctgc ggccacacaa ccggaagagc aaagcagcga aaataagccg    118440
     aaagttgttc cgatgtttcg tgaacaacct aagccttggt tgcttgagct ccaagaagaa    118500
     atggagaaga gaatggagcg cgaacgcgct tacagtgctc gtctccgtga gaaaatcgag    118560
     aaggtatgga acgagtgttt gccgttctcc agtcatgtga ctgagccaat gcgtctgtac    118620
     ttcaaaaacc gcgagctgct gttcaaagtt gatgaagtag aaaaaacaga ctgtctgcgg    118680
     ttcaatccgg ctatggccta ctacgacgaa gatggcaatg aagttgggaa attcccggct    118740
     atcgtctgcg ctatccgaga tgtggaaggc aacctggtaa cgctccaccg cacctatctc    118800
     acccaaaacg gtaaaaaagc caaggtcggc aacgccaaaa agatgatgcc cattcctgac    118860
     ggtttggatg tcaatggcgc ggccatccgc ctcggtgaac cgactgaggg tatcctgggt    118920
     gttgcagaag ggctggaaac agctctgtca gcttatcgag tcactcaaat cccggtttgg    118980
     tcaacggtca atgccaccct aatggagtcc ttcgaggttc cagaaggtgt tcacaccgta    119040
     ctgatctggg ctgacaaaga taagtctgtg actggggaga agtcagcgaa cgtgctgaaa    119100
     gccaagctgg agaagcgcgg cattcgtgtg tacgtcctgc tgcctaagct cccgatcccg    119160
     cccagagcga aagggattga ctggaacgat gtcctgatga gtcagggaag cctcggtttc    119220
     ccgaatgctc gctacctgcg cgatttcatt gcgagaagga gagctgagta tggccgtcat    119280
     tgatgtctcg aaggttgata caacgcctgg taacgacgcg gtgtgcccct tctctccccc    119340
     tgaggggtgg gagggggact ctgcggccta cgttgagctt atgcggtctc ggtatcgtca    119400
     tctgatgcac ggccagagaa tgatggtgac agcctccttc gcaagaaggg agcctatcca    119460
     agttactggc ccgtttgctg atgaagcgac gaagatcatt aactcaatga agatgaacaa    119520
     ggcgaagcca acagctttgt ctgcctaaaa ctttaaccct gagggggtgt tcatgccctc    119580
     tcaggcatga ttcgcctcct cttcaactat ggaggtaatc atgaaaaagt ttttgcgtat    119640
     taagacgtgg tttgtgcgtc ttttctctcc tgacaagaag actctgggag ctatcggtga    119700
     agacctgcgt aaggtcgccg taacagccat cggtgtcggt attgtagggg tcgtctcaga    119760
     aaacggaatc tatggtcact cccgtttttg caacaccgat tttgacgaca agttggcttg    119820
     cttgaatcta tccggcgtct gaatgggatt ttattcccgc gcctcgatga gttccgcgcc    119880
     tgatgaacct ccagaaaata tacggcttca atgagccttt ccgttttaca ggttcctcaa    119940
     caggccggtg ggccgttagt atcatcaata tcagtattcg caaaaccaga tgaatgattg    120000
     tttaaactgg tgtatttctg cctttatgct tcgtaagttt gctgtcgcgc cgtcagtgcc    120060
     caggctattc tggccagctt gtttgccaga gcacaggtga cgacaaagtt gcttttccga    120120
     cacaacaact ccctgaccca gtcggccaac ttgccagact ggtgttccag tttttgtatg    120180
     aataccctgg cacactgaac caacaaagtt cggatctttt tgttgccccg cttgctaatc    120240
     cctaacaatg tcgtccgacc tcccgtgctg tactgtcggg gtaccagccc tgttgccgcc    120300
     gcaaagtcac ggctgctggc gtactgcttc ccgtcgccaa tctcagttga aatagtactg    120360
     gcagtcagcg ttccaacgca gggaatactc agcaagcgct gtccaacctc atcttcgtcc    120420
     aactttcgtt tcaactgaga ttccagatct ttaatctgct caacaagata gtgataatgc    120480
     tgttgtaatt tcagcagtaa ctggctgaga taaagaggca aactactgtc ctcaagaagg    120540
     gtactcagtc gactaataac ggcagcacct cgcggaacgc tgataccaaa ttccagcaga    120600
     aaagcatgca tctgattagt tgttttcacc ttatcctgaa ccagggattc acggacacga    120660
     tgcagagctc gcattgcctg ctgagattcg gttctgggct gcacgaaacg catagatgga    120720
     cgtgatgctg cttcacagat agcttcagca tcaacgaagt catttttgtt gcttttaacg    120780
     aatgggcgga caaattgcgg tgatatcagc tttggaaaat gccctaactc ttccagcttg    120840
     cgtgccataa agtgagaacc gccacaggct tccatcgcga tggttgttgc cgggcatgtc    120900
     gccagaaatt cgattagctt tggtcgggtg aattttttac ggtaaacggc cttcccacga    120960
     tgatcctgac aatgaatatg gaaagagttc ttacccagat cgataccaat aagcgcaatg    121020
     ttttccatga tggttctccg aatgaaagcc tgtcctcagc atagtactgg gaaggaggga    121080
     gtgaccatct cattaaataa agcacgctaa gccggtggca gcggtcgcaa tggcctaaac    121140
     ttccccgcac cgaccttggc gctgctgcgc cataggtaat cgccggtcag gttgatgtgc    121200
     tcccacccca gcggcgacag atattgcaac aatgtgtcgt ccagcgccgt gccgttgcca    121260
     cgcaaagcac tggtggcacg ctccagatat accgtgttcc acaacacgat ggccgccgtc    121320
     accagattga ggccgctggc ccggtagcgc tgctgctcaa aactgcggtc gcggatttca    121380
     cccaatcggt agaagaagac cgccctggcc agcgcgttgc gcgcctcgcc cttattcagc    121440
     cccgcatgga cgcggcggcg cagctccacg ctttgcagcc aatccaaaat gaacagcgtg    121500
     cgctcgatgc gccccagctc gcgcaacgcc acggccaagc cgttctggcg cgggtagctg    121560
     ccgagtttgc gcagcatcag cgaagccgtt accgtgcctt gcttgatgga ggtggccagc    121620
     cgcagaattt catcccaatg ggcgcgtatt tgcttgatgt tcagcctgtc gctgctaatc    121680
     atcggcttga gcgcgtcata ggcggcatcg cccttgggga tgaatagctt ggtttcgccc    121740
     aagtcacgga tacgcggcgc gaagcgaaat cccagcaaat gcatcaagcc aaacacgtga    121800
     tcggtgaagc ctgccgtgtc ggtgtagtgt tcctcgatgc gcaagtccga ctcgtggtac    121860
     agcaggccat caagcacgta agttgaatca cgaatgccca cgttgaccac cttggcactg    121920
     aagggcgcgt actggtcgga gatatgggtg tagaaagtcc gtcctggact gcttccatac    121980
     ttcgggttga tatgaccagt gctttctgct ttgctgccgg ttctgaagtt ctggccgtcc    122040
     gacgatgacg tggtgccgtc accccagttg ccggcgaagg gttgccgaaa ctgcgcattc    122100
     accagctcgg ccagcgccgt cgaataggtt tcatcgcgga tgtgccaggc ttgcagccaa    122160
     gacagcttgg cgtaggtggt gccagggcag gactcggcca ttttggtcag acccaggttg    122220
     atcgcgtcgg ccaggatcgt cgtcaacagc aaggttttgt ccttggccgt gtcgctggtc    122280
     ttcaggtgtg tgaagtggcg ggtgaagccc gtccattcat cgacctccat cagcaactcg    122340
     gtgattttga ggtgcggcag cagcatagct gtctggtcga tcatggcttg cgcggcgtct    122400
     ggtactgccg cgtccagcgg cgtgatcttc aggcctgacg cggtggtgat gatggcatcc    122460
     ggtaagtcgt tggccgcagc catgcggttg actgtggcga gttgcgcctc caacaattcc    122520
     aaccggtcat gcaggtattg gtcgcagtcg gtggccactg ccagcggcaa ttcgctggcc    122580
     agcttcaaag tggcgaactt ctcgaccggc accaggtatt cgtcgaagtc cttgaactgg    122640
     cgagaaccct gcacccagac atcaccggag cgcagcgcgt tcttcagctc cgacagggcg    122700
     cataactcgt agtaacgccg gtcgatgccg tcgtcggtca gaaccagctt tgcccagcgc    122760
     ggcttgatga atgcggttgg cgcatcggcg ggcaccttgc gcgcgctgtc gctgttcatg    122820
     ccgcgcagca tgtcgatggc atcgagcaca cccttggcgg cgggcgcagc ccgcaatttg    122880
     agcacgccca ggaactgcgg cgcgtagcgg cgtagcgtgg catagctttc accgatgtgg    122940
     tgcaggaaat caaagtcggc aggccgcgcc aatgtttgcg cttcggtgac gctggcggcg    123000
     aaggtgtccc agggcataac ggcctcgatg gcggcgaacg gatcgctgcc gctttgcttg    123060
     gcctcaatca acgcttgacc gatgcgccca tacatccgca ccttgtcgtt gatcgccttg    123120
     ccggaagcct ggaactgctg ctgatgcttg ttcttggccg cgttgaacag cttgccgatg    123180
     atgcgatcgt gaaggtcgat gatttcatcg gtgacggtgg ccatgccttc gatggccagc    123240
     gctaccagcg tggcatagcg tcgttgcacc tcgaactttg ccagatcagc aggcgtcatc    123300
     tggccacctt cacgagcgat tttgagcagg cggttctggt gaacctgccg ctcgatgcct    123360
     gcgggcagat caagtgcttg ccaggatttc aggcgctcaa tatgttcgag catgtggcga    123420
     gagttcggtt tggcaggcga ctggcgcagc catgccagcc acgtcacttt actgccgtcc    123480
     ttgcgcttga gaagttcgtc caggcgctga cggtggggtg ataacaaaga atcggtcagc    123540
     gccgcgtaaa tgcgtcggtt ggcacgggtg atggcctcgg cgcttgcgcg ctcgatggca    123600
     ttcatggcgg gcaggataat gctctgccgc cgcagattct cgacaagtgc gctcgccagc    123660
     acgatgcctt tgtcggtctg caaggccagc tcggtcaatg tatgcacggc ttgccgatag    123720
     tggctcatgg tgaagggctt gaacccaaaa accgtttgca gctcgaccaa gtgctcccgc    123780
     cgtgtctgtt cgcgctggcc gtactcgctc caactttcca ctggcatctt gagttgcgcg    123840
     gccaccatgc gcaacagggg cggaaacgga ggctcatcga cgcccaaaaa ggtgccaggg    123900
     aatcgcaagt agcaaagctg cacagcgaag cccaatcgat tcgcggcgcc gcgacgctga    123960
     cggatcaccg acaggtcggt ttcgttgaac gtgtagtgcc gtatcagttc gtctttggca    124020
     tctggcagtg ccagcaggct ttcgcgctcg gtggcggaca ggattgagcg gcgtggcatg    124080
     gtcagtcttc ccgcaggtac tggtacaagg tttcgcggct gatgccgaag tcacgggcca    124140
     ccaaggtttt ttggtcgcct gccgcaactc gccgtttcaa ctcggcaatt tgttcgctgt    124200
     tcagcgattt ctttcgtccc cggtaggcac cgcgctgctt ggccagcacg attccctcgc    124260
     gctgacgttc gcggatcagg gcgcgctcga actcagcgaa ggctcccatg accgacagca    124320
     tcagattggc catcggtgag tcctcgccgg tgaacttcag cccttctttg acgaactcca    124380
     tgcgcacgcc ccgttgtgtc agcccttgga cgatgcggcg caggtcatca aggttgcgtg    124440
     ccagcctgtc catgctatgc accaccacgg tgtcgccctc gcggacgaag gccagcagcc    124500
     tttccagctc gggacgctgg gtgtccttgc cagaagcctt gtcggtgaac acccgcgcca    124560
     cctgaacacc ctccaattgc cgttccgggt tctggtcgaa gctgctgacg cggacatagc    124620
     cgatgcgttg accttgcaag atgcctccaa aggcaaaagt gtcaggatga aatctattac    124680
     ctttgacgga atatgtcaat caataggaaa tttaactcta ttctgacatc gtttgcacat    124740
     ggtgtcgttt tcagaagacg gctgcactga acgtcagaag ccgactgcac tatagcagcg    124800
     gaggggttgg atccatcagg caacgacggg ctgctgccgg ccatcagcgg acgcagggag    124860
     gactttccgc aaccggccgt tcgatgcggc accgatggcc ttcgcgcagg ggtagtgaat    124920
     ccgccaggat tgacttgcgc tgccctacct ctcactagtg aggggcggca gcgcatcaag    124980
     cggtgagcgc actccggcac cgccaacttt cagcacatgc gtgtaaatca tcgtcgtaga    125040
     gacgtcggaa tggccgagca gatcctgcac ggttcgaatg tcgtaaccgc tgcggagcaa    125100
     ggccgtcgcg aacgagtggc ggagggtgtg cggtgtggcg ggcttcgtga tgcctgcttg    125160
     ttctacggca cgtttgaagg cgcgctgaaa ggtctggtca tacatgtgat ggcgacgcac    125220
     gacaccgctc cgtggatcgg tcgaatgcgt gtgctgcgca aaaacccaga accacggcca    125280
     ggaatgcccg gcgcgcggat acttccgctc aagggcgtcg ggaagcgcaa cgccgctgcg    125340
     gccctcggcc tggtccttca gccaccatgc ccgtgcacgc gacagctgct cgcgcaggct    125400
     gggtgccaag ctctcgggta acatcaaggc ccgatccttg gagcccttgc cctcccgcac    125460
     gatgatcgtg ccgtgatcga aatccagatc cttgacccgc agttgcaaac cctcactgat    125520
     ccgcatgccc gttccataca gaagctgggc gaacaaacga tgctcgcctt ccagaaaacc    125580
     gaggatgcga accacttcat ccggggtcag caccaccggc aagcgccgcg acggccgagg    125640
     tcttccgatc tcctgaagcc agggcagatc cgtgcacagc accttgccgt agaagaacag    125700
     caaggccgcc aatgcctgac gatgcgtgga gaccgaaacc ttgcgctcgt tcgccagcca    125760
     ggacagaaat gcctcgactt cgctgctgcc caaggttgcc gggtgacgca caccgtggaa    125820
     acggatgaag gcacgaaccc agttgacata agcctgttcg gttcgtaaac tgtaatgcaa    125880
     gtagcgtatg cgctcacgca actggtccag aaccttgacc gaacgcagcg gtggtaacgg    125940
     cgcagtggcg gttttcatgg cttgttatga ctgttttttt gtacagtcta tgcctcgggc    126000
     atccaagcag caagcgcgtt acgccgtggg tcgatgtttg atgttatgga gcagcaacga    126060
     tgttacgcag cagggcagtc gccctaaaac aaagttagac atcatgaggg tagcggtgac    126120
     catcgaaatt tcgaaccaac tatcagaggt gctaagcgtc attgagcgcc atctcgaacc    126180
     gacgttgctg gccgtacatt tgtacggctc cgcagtggat ggcggcctga agccacacag    126240
     tgatattgat ttgctggtta cggtgaccgt aaggcttgat gaaacaacgc ggcgagcttt    126300
     gatcaacgac cttttggaaa cttcggcttc ccctggagag agcgagattc tccgcgctgt    126360
     agaagtcacc attgttgtgc acgacgacat cattccgtgg cgttatccag ctaagcgcga    126420
     actgcaattt ggagaatggc agcgcaatga cattcttgca ggtatcttcg agccagccac    126480
     gatcgacatt gatctggcta tcttgctgac aaaagcaaga gaacatagcg ttgccttggt    126540
     aggtccagcg gcggaggaac tctttgatcc ggttcctgaa caggatctat ttgaggcgct    126600
     aaatgaaacc ttaacgctat ggaactcgcc gcccgactgg gctggcgatg agcgaaatgt    126660
     agtgcttacg ttgtcccgca tttggtacag cgcagtaacc ggcaaaatcg cgccgaagga    126720
     tgtcgctgcc gactgggcaa tggagcgcct gccggcccag tatcagcccg tcatacttga    126780
     agctagacag gcttatcttg gacaagaaga agatcgcttg gcctcccgcg cagatcagtt    126840
     ggaagaattt gttcactacg tgaaaggcga gatcaccaag gtagtcggca aataatgtct    126900
     aacaattcgt tcaagccgac gccgcttcgc ggcgcggctt aactcaagcg ttagatgcac    126960
     taagcacata attgctcaca gccaaactat caggtcaagt ctgcttttat tatttttaag    127020
     cgtgcataat aagccctaca caaattggga gatatatcat gatgactgat ccccgcaaaa    127080
     acggcgattt gcacgaaccc gcgacggcac ccgcgacgcc ctggtccaaa agcgagctgg    127140
     tccggcaatt gcgcgacctc ggcgtgcgct caggcgatat ggtgatgccg catgtgtcgt    127200
     tgcgcgccgt cgggccgctg gcggacggac cgcagacact tgtcgatgcg ctgatcgagg    127260
     ccgtcggccc caccgggaat attctcgcct tcgtctcgtg gcgcgattcg ccctatgaac    127320
     agacgctggg tcatgatgcg ccgcccgccg ccatcgccca aagctggcct gcgttcgacc    127380
     ccgaccatgc gcccgcctac cccggctttg gcgcgatcaa cgaatttatc cgaacctatc    127440
     cggggtgtcg gcgcagcgcc catcccgacg catcgatggc ggcgatcggg cccgatgcgg    127500
     cgtggctggt ggcgccgcac gagatgggcg ccgcttatgg cccccgctcg ccgatcgcgc    127560
     gttttctcgc ccacgcagga aaaatcctgt cgatcggcgc cgggcccgat gcagtcaccg    127620
     cgctccatta tgccgaagcg gtggcgcgga tcgagggcaa gcgccgcgtc acttattcga    127680
     tgcccttact gcgcgaaggc aagcgcgtct gggtcaccac gtccgactgg gattcgaacg    127740
     gcatcctcga cgaatatgcc gcgcccgacg gccccgacgc ggtcgaacgg atcgcccgcg    127800
     actatctcgc ccgcaccagg gttgcgcaag gcccggtcgg cggcgcgcaa tcccggctga    127860
     tcgacgcggc cgatatcgtt tccttcggca tcgaatggct cgaggcgcgc cacgccgcgc    127920
     cagcggcggc agcgctgaag ccgaaacaac gccgcgactg agtcgtcgat tattccggac    127980
     atatattcct ccctctcgcc cagccgcata gcatcaggcc cacaagcccg ccgcctcttc    128040
     aacaaggatg tcgggacgtt cttcagtaaa gaacagcttg gcaccctcga caaggatgat    128100
     tgcccgaggc gatcaggcgg cgaatttttg cgcgcgcgca cggtcgcggc ggcgcgcgat    128160
     aaaggcgatg ggtagcccca cgaggaagat atgcgcggcg attaacatca agccgctgta    128220
     cgaccgcgtc gtcatcaagc gcaccgagga agagaaggtc tccgccggtg gtatcgtgat    128280
     cccggattcg gccaccgaga agccgatcaa gggccaggtc gtcgccgtgg gcgagggcaa    128340
     ggtgttcgac aacggcaacg tgcgcgcgcc gaaggtcaag gtcggcgacc aggtgctgtt    128400
     cggcaagtac gccggcaccg aggtcaagct cgacggcacc gagtacctgg tggtgaagga    128460
     agacgacatc ttcgccgtgc tgggctgagc ccgccgcttc gccgcatccc aacccgcaat    128520
     cacagaactg aggtaattcc gcaatggctg ccaaggatat tcgtttcggt gaagacgccc    128580
     gcgcccgcat ggtccgcggc gtgaacgtgc tcgccaacgc cgtcaaggcg accctgggcc    128640
     cgaagggccg caacgtcgtg ctcgagaaga gcttcggcgc cccgacgatc accaaggacg    128700
     gcgtgtccgt cgccaaggag atcgaactgg ccgacaagtt cgagaacatg ggcgcgcaga    128760
     tggtcaagga agtcgcttcc aagacctccg acaacgccgg cgacggcacc accaccgcca    128820
     ccgtgctggc ccaggccctg atccgcgagg gcatgaaggc cgtggccgcc ggcatgaacc    128880
     cgatggacct caagcgcggc atcgacaagg ccgtcacctc ggccgtcgag gagctgaaga    128940
     agatctccaa gccctgctcg accagcaagg agatcgccca ggtcggttcg atctcggcca    129000
     actccgacac cgacatcggc gagctgatcg ccaaggccat ggacaaggtc ggcaaggaag    129060
     gcgtgatcac cgtcgaggag ggctcgggcc tggagaacga gctcgacgtc gtcgagggca    129120
     tgcagttcga ccgcggctac ctgtcgccgt acttcatcaa caacccgcag tcgatgcagg    129180
     ccgagctgga ggatccgttc atcctgctgc acgacaagaa gatctcgaac gtccgcgacc    129240
     tgctgccgat cctcgagggc gtggccaagg ccggcaagcc gctgctgatc gtcgccgagg    129300
     acgtcgaggg cgaggcgctg gccacgctgg tggtcaacac catccgcggc atcgtgaagg    129360
     tctgcgcggt caaggccccg ggcttcggcg accgccgcaa ggcgatgctg gaggacatgg    129420
     ccatcctcac cggtggcacc gtgatctccg aggaagtcgg cctctcgctc gagaaggcga    129480
     ccatcaacga cctcggccgc gcgaagaagg tgcaggtctc gaaggagaac accaccatca    129540
     tcgacggcgc cggcgacacc gcggacatcg aagcccgcat caagcagatc aaggcgcaga    129600
     tcgaggagac cacctcggac tacgaccgcg agaagctgca ggagcgcgtg gccaagctgg    129660
     ccgggggcgt tgcggtgatc aaggtcggcg ccgccaccga agtcgagatg aaggaaaaga    129720
     aggcgcgcgt cgaagacgcc ctgcatgcca cccgtgcggc ggtcgaggaa ggcatcgtcc    129780
     cgggcggcgg cgtcgccctg atccgtgcca aggccgcgat cgccgagctg aagggcgcca    129840
     acgaggacca gaaccacggc atcgcgatcg ccctgcgcgc gatggaagcc ccgctgcgcg    129900
     agatcgtcac caacgccggc gacgagccga gcgtggtgct gaaccgcgtc gccgaaggca    129960
     ccggcgcgtt cggctacaac gccgccaacg gcgagttcgg cgacatgatc gagttcggca    130020
     tcctggaccc gaccaaggtc acgcgctccg cgctgcagaa cgcggcgtcc atcgccggcc    130080
     tgatgatcac caccgaagcg atggtggccg aagcgccgaa gaaggaagag ccggccgctc    130140
     cgggcggcgg catgggcggc atgggcggca tggatttcta agccccgcga tccatcaagc    130200
     aagaccacaa agcccggcct cgtgccgggc tttgtgcgtt ctggcgtccg aggcgggaga    130260
     cttcctaccc gccccgcggc aatgtctgac gcgaagatca gaaaacgccg atatgaacgc    130320
     gtgctcgcgg gcgcaaccct gagcagccgt ccctgcaacg gagcgctgcg tgccgcgcct    130380
     gaccgcaccc cggcggcagg ccgaggtgtg cgcgccactg ccggccgccc acgccgctgc    130440
     gcgttacgcg cgccacctgc ccgagcgcac gctgctgtac gcgctagtgc aggcgcacta    130500
     cccggacttc atcgcgcgtc ttgaggccga agaccgcccg ctgcccgagt atgtgcgcga    130560
     ggagttcgag acctacctgc gttgcggcgt gctcgagcac ggtttcctgc gcgtggtgtg    130620
     cgagcagtgc cgggccgaga ggctggtggc cttctcctgc aagaagcgcg gcttctgccc    130680
     cagctgcggg gcgcggcgca tggccgagag cgcgcggcac ctggtggagg aggtgtttgg    130740
     cccgcggccg gtgcggcaat gggtgctgag ttttccgtac ccgctgcgct tcctgttcgc    130800
     cagcaagccg gaggccatcg gcccggtgct gggcatcgtg catcgtgtga tcgccggctg    130860
     gttggccgat caagccggcg tcgaccacgc cagcgcgcaa tgcggcgcgg tgaccctgat    130920
     ccagcgcttc ggcagcgcgc tgaacctgaa tgttcacttc cacatgctgt ggctcgacgg    130980
     cgtgtacgag gacaccaccg agcgtccgca gcgcaagccg cgcctgcacc gcacccgtgc    131040
     gcccacatcg gcgcaactga cggaactggc cggcaccatc gcgcatcgcg tgtgccggca    131100
     cctgtcgcgc cgcggctggc tcgaaggcga agacgaatcc gtgttcctgt ccgacagcgc    131160
     gggtagcgac gacggcatgg atgggctgcg gatgagttcg atgacctacc gcatcgccac    131220
     cggtcgcgac gctggccgca aggtcgtcac gctgcaaaca ttgcccggtg acgcaggctc    131280
     gctggagggc gacgccggca aggtcggcgg cttctcgctg catgccggcg tggccgcgga    131340
     agcacacgaa agccacaagc tcgaaaagct gtgccgctac atcacgcgcc cggcgatcag    131400
     cgagcagcgg ctgtcgatct caccgcaggg tagggtgcgg tatcagctca agacgccgtg    131460
     gcgaaatggg accacgcatg tcgaatggga tgcggtggac ttcatcgcca agctggcggc    131520
     actggtcccg ccacctcgcg cgcatctcac ccgcttccac ggcgtattcg ccccgaatgc    131580
     aaacctgcgt gcgcagctga cgccctcggg gcgcggcagg cggcctgcgg gcgatgcggt    131640
     gccggttgac gcaagcgccc acgacgagcc gcgcagcccc gagcagaagc gccgtgcgat    131700
     gagctgggcg caacggctca agcgggtctt ttccatcgac gtcaccacct gtgcccactg    131760
     cggcggcgcg gtgcggatcg tcgccagcat cgaagacccc aaggccattc gcgccatcct    131820
     cgcccacttc gagaaacacg gcgcgctgga gcaagcgcac taccggcccg cagcgcgcgc    131880
     gccgccgccg gccgcgtgac gaggtgccgg ccacacagcc ggcagccaag ccagagtccg    131940
     atccgatgcg gccacgaccc cgcagggctg cgctcggccc tgtgccgggt ttcggtgaga    132000
     aatggctacg cactgagccg ctgcgtggcc ccgcgatgtc gaaaacccac gcatgaaccc    132060
     ccgatctgtg cccgatctgt gcccaaagcg gcgcttgcgc ggccgcttcc gagggtgtca    132120
     gaaattttgt gtgagaggca taccatgatg ctgccaagga gcatgtatgc cacgcaagaa    132180
     gaagacgccg gtggtcacgc cggccattga tctgccgaag gaatttctcg agaagctgat    132240
     cccgggtccg atggacgcgg ccggggtcga agccgtgttc cagcagctga agaaggccgt    132300
     gatcgagcgg gcgctgggcg cggagctcgg cctgcacctg gccgacgccg agggcgggag    132360
     cggcaaccac cgcaacggcc gcagcggcaa gacggtgctg accgacgagg gtccgctgcg    132420
     catcgacgtg ccgcgcgacc ggacgggtac gttcgagccg cagctgatcc ccaagcacga    132480
     gcgtcgcttc gccgggttcg acgatcggat cgtctcgatg tacgcccgcg gcatgacggt    132540
     gcgtgagatc caggggcacc tggccgagat gtacagcgtc gaggtgtcgc cggagttcat    132600
     cagcaaggtc accgacgagg tgatggccga ggtcaccgca tggcaggcgc ggccgctgga    132660
     agcgatgtat ccggtggtgt tcttcgacgc gctgcgggtg aagatccgcg aggacggcgt    132720
     ggtgcgcaac aaggcggtgt atctggcgct gggcgtgctg gccgacggca cccgcgacat    132780
     cctcgggctg tggatcgaga acaccgaggg cgcgaagttc tggatgaagg tgttcaacga    132840
     cctcaagacg cgcggcgtca acgacatcct gatcggcgtg gctgacggcc tgaagggctt    132900
     cccggaggcg ctggaagcgg tgttcccggc gaccacgctg cagacctgca tcgtgcacct    132960
     gatccgcaac agcctggact atgcgggctg gaaggaccgc aaggcgctgg cggcggcgat    133020
     caagccgatc tacacggccc cgaccgccga ggccgcagag gccgagctgg atgcgttcga    133080
     ggccggcgac tggggcgagc gcttcccgac ggtggtcgcc gcctggcgcc gtgcctggac    133140
     gcgcgtggtg ccgttcttcg cgttcccgcc ggacgtgcgc cgggtgatct acacgaccaa    133200
     cgcaatcgag agcgtgcatg cgcgcctgcg caagatcatc aagacccgcg gccacttccc    133260
     cagcgacgag gccgccacca agctgatctg gctggcgctg cggaacatca ccgccgagtg    133320
     gagccgcgcg tctcagcact ggaaggcggc gatgaaccag ttcgcgataa tctacgaaga    133380
     ccgattcacg ctggctcgct gaaagagact tccggactaa accgcctcac acacaaaaaa    133440
     tcggacacgc ccccgcttcc tacctgccag actcgcaaaa aagggcggtt gaacttccta    133500
     tacccacaaa gttagatgca ctaagcacat aattgctcac agccaaacta tcaggtcaag    133560
     tctgctttta ttatttttaa gcgtgcataa taagccctac acaaattggg agatatatca    133620
     tgaaaggctg gctttttctt gttatcgcaa tagttggcga agtaatcgca acatccgcat    133680
     taaaatctag cgagggcttt actaagcttg ccccttccgc cgttgtcata atcggttatg    133740
     gcatcgcatt ttattttctt tctctggttc tgaaatccat ccctgtcggt gttgcttatg    133800
     cagtctggtc gggactcggc gtcgtcataa ttacagccat tgcctggttg cttcatgggc    133860
     aaaagcttga tgcgtggggc tttgtaggta tggggctcat aattgctgcc tttttgctcg    133920
     cccgatcccc atcgtggaag tcgctgcgga ggccgacgcc atggtgacgg tgttcggcat    133980
     tctgaatctc accgaggact ccttcttcga tgagagccgg cggctagacc ccgccggcgc    134040
     tgtcaccgcg gcgatcgaaa tgctgcgagt cggatcagac gtcgtggatg tcggaccggc    134100
     cgccagccat ccggacgcga ggcctgtatc gccggccgat gagatcagac gtattgcgcc    134160
     gctcttagac gccctgtccg atcagatgca ccgtgtttca atcgacagct tccaaccgga    134220
     aacccagcgc tatgcgctca agcgcggcgt gggctacctg aacgatatcc aaggatttcc    134280
     tgaccctgcg ctctatcccg atattgctga ggcggactgc aggctggtgg ttatgcactc    134340
     agcgcagcgg gatggcatcg ccacccgcac cggtcacctt cgacccgaag acgcgctcga    134400
     cgagattgtg cggttcttcg aggcgcgggt ttccgccttg cgacggagcg gggtcgctgc    134460
     cgaccggctc atcctcgatc cggggatggg atttttcttg agccccgcac cggaaacatc    134520
     gctgcacgtg ctgtcgaacc ttcaaaagct gaagtcggcg ttggggcttc cgctattggt    134580
     ctcggtgtcg cggaaatcct tcttgggcgc caccgttggc cttcctgtaa aggatctggg    134640
     tccagcgagc cttgcggcgg aacttcacgc gatcggcaat ggcgctgact acgtccgcac    134700
     ccacgcgcct ggagatctgc gaagcgcaat caccttctcg gaaaccctcg cgaaatttcg    134760
     cagtcgcgac gccagagacc gagggttaga tcatgcctag cattcacctt ccggccgccc    134820
     gctagcggac cctggtcagg ttccgcgaag gtgggcgcag acatgctggg ctcgtcagga    134880
     tcaaactgca ctatgaggcg gcggttcata ccgcgccagg ggagcgaatg gacagcgagg    134940
     agcctccgaa cgttcgggtc gcctgctcgg gtgatatcga cgaggttgtg cggctgatgc    135000
     acgacgctgc ggcgtggatg tccgccaagg gaacgcccgc ctgggacgtc gcgcggatcg    135060
     accggacatt cgcggagacc ttcgtcctga gatccgagct cctagtcgcg agttgcagcg    135120
     acggcatcgt cggctgttgc accttgtcgg ccgaggatcc cgagttctgg cccgacgccc    135180
     tcaaggggga ggccgcatat ctgcacaagc tcgcggtgcg acggacacat gcgggccggg    135240
     gtgtcagctc cgcgctgatc gaggcttgcc gccatgccgc gcgaacgcag gggtgcgcca    135300
     agctgcggct cgactgccac ccgaacctgc gtggcctata cgagcggctc ggattcaccc    135360
     acgtcgacac tttcaatccc ggctgggatc caaccttcat cgcagaacgc ctagaactcg    135420
     aaatctaacg tccgttcggg catcgaggtc catgtcgggg tgggacgggc ccgtggcttc    135480
     aagatcactt gcagtccgac cgcgatgtct tggttgcgcg agaggttgtc gatatcctcc    135540
     acttccatca tcaaccctgg ataatgccgc cgccgtcatc gccgccgacg cccgtgccgg    135600
     gcttttcggg cctgtcaggc ttgctcggcc ttcagcctgc ctgggcgaga tctccggcgg    135660
     acggattaac ggcggagctt cgccgccttt cgtgcgtgtg aaggccgaag atagttctct    135720
     caaaaacatc cgtttatgag agataccaaa gccgacagtc tgccgaaggt tgaaggtctc    135780
     tcaaaactgc ctctcgcttc cgatctctca ccgatctacg tttctaagtg ttttgagagg    135840
     agaacagcat gttggtgggg tacgccaggg tttcgacacg tgatcaaacc cacgctgttg    135900
     atttgcaccc aaatttgacc cgggatttgc attgaatttt gacccacccc ttgttgtcag    135960
     aattatgtct cgattttcag tttgcgggtc tgtttttcct cctgcttatt ctgagttgaa    136020
     ctgtgtttga agcggtaact ttcattgccg gtttccagga tgtggcagtg gtgggttagt    136080
     cggtccaaca acgctgttgt catcttttca tcgccaaaca ctcggctcca ttccgagaag    136140
     ctcaagttgg tggtcagtat cacgctggtt ttttcgtaca gctttgagag caggtgaaac    136200
     agcagtgccc caccggtttg gctaaaaggc aaatatccca gctcatccag aatcaccaaa    136260
     tcggcataca acagacggtt tgcgatttgt ccctgacgcc cagatgattt ctcttgctcc    136320
     agtgcattga ccaaatccac ggtggagaag aaacgcaccc gtcggttcaa gtgcatcact    136380
     gcttgtgtac caatggctgt ggccaggtga gtcttgcctg tgcctggccc accaatcagc    136440
     accacgttct gggcttgttc catgaagtcg caccggtgca attgtttgac cgtggcctca    136500
     ttaaccaggc tttgactgaa gtcaaagccc accaagtccc gatacacggg gaacttggcc    136560
     acccgcaatt gatagttcac cgaacgtact tcacgctctg ccacttcagc tttaatcaag    136620
     ctgtccagca tgggcaaggc ttgattaaat gctggtgaat tctgattgcc caactcctca    136680
     atggcgtgtg ccatgccaaa gagtttcaag gatttgagga ttctcacatg gccttcatgc    136740
     tgcatcatgg gctctcctta aactgtcata gcggttcacg ttggcctgtg gttccaatgt    136800
     cagccttaac cccttgggaa ttggaatcgg tttgggtgga ggttcttcgg tcaaacgtcc    136860
     caacagatta agcacatgct ccttcgatgg cttgccacac tccaatgcca attccacagc    136920
     actgagtacc gcaccttcat cgtggtgcaa tacaagggcc agaatttcca ccatgtcacg    136980
     gtcaccgccg gggcgttgca gcaagatgga ttgaagcttc ttgaacgcgg gtggcaattc    137040
     agcaaatggc gcaccattgc gcaacgcccc aggtttcttc tgaagcacag acaagtaatg    137100
     gtgccagtcg tattgtgtgt ggccacgccg agcgtggcca ctgccaaaca atcttggatg    137160
     ctcggcaatg tgttggcctt cggcagccat caccagcttg tctgcataaa tccgaaggct    137220
     gatggccctg ttggcgtaac tggcaggaac gctgtagcga ttgccctcgt ggtgaacaag    137280
     gcaggttgaa gtgactcgct tggtttgctc cacgaatgca tcaaaggcat tgggtagcgc    137340
     catcaactcg ccttgttcat cggcaaaggc ctcttgcacg gtttggtcca attcggggtg    137400
     gcgcagctca gaccacagcg ctttgcagcg atgctcaagc cacacattca aatcagcaag    137460
     gctttgaaag tctggtgccc cttgccacag gcgttggcgg gaatcctgca cgttcttctc    137520
     aatctggcct ttctcccaac ccgatgctgg attacagaac tgcgcatcaa acaggtagtg    137580
     gctgaccatg gcagtgaacc gctgattgac cctgcgctct ttgccacgcc ccaccgaatc    137640
     cacagcggtc ttcatgttgt cgtagatgcc gcgcttggga atgccaccga agatttgaaa    137700
     ggcatgccag tgggcatcaa acagcatttc atgtttttgc tggtagtaag cccgaagcac    137760
     aaaggcccgg ctgtgggcca acttaaactg ggcaatctga agtttgacct gtttgcccgc    137820
     tatgcgggca aagtcctcac tccaatcgaa ttggaaggct tcgccacaag caaagcgcaa    137880
     ggggatgaaa caacccttgc ccgaggtttg cgccttgaac tgttcggaat ctttccactg    137940
     tcgggcaaag gcacacactc ggtcataaga cccggtaaag cccaaagcga ccaaatcccg    138000
     gtacatgctg cgcaggtttc tgcgcagctt ctttgtcttt ttgtgctcgg tggagagcca    138060
     ctgccttaac ttgggctcaa aaggacttaa cttgccaacg ctgtctcgcg ctgggtactg    138120
     cggttcaacc accttgcttt gcaaatactt gcgaacggtg ttcctggaca ggccgcttcg    138180
     tcgggctatt tcccgaatcg acgcaccatc gcgaaaatgc cagcgtcgaa ttgcgctcaa    138240
     tatcgccacg tttatcactc cttgatttct cccgccatat ccagacggga aacagtgtca    138300
     tacgtgggtc aaatttcgac gcaaatcttt accctaagtt ggggtgcgga caaaatcttg    138360
     gactacttta ggagtagttc atgtattcgt atgaagatcg ccttcgagcc gtgaggttgt    138420
     acctgaagct tgggcgccgg atgagcgcca cactacggca gctgggatac cccaccaaga    138480
     actcgctgaa ggcctggttg gcagaattcg aacggaatca ggatcttcgc cgaggctatc    138540
     aacggataaa acggcagtac accgatgagc aaaagcaacg ggcagtagat cactatatcg    138600
     aacaaggcta ctgcctgagt cacacaatcc gaagcctggg ctacccaagc cgcgaggcct    138660
     tgcgtgcctg gatccgtgat ttacgccctg aattcgctag gacggtcgtc ggcagcagcg    138720
     ctcccacagt cgcccgctct cgcctcgaga agcagcaagc cgtcattgca ctgaacctgc    138780
     gcgtaggttc ggcaaaggat gtggccgaca ctgtcggtgt atcgcgacca acgttgtata    138840
     actggcagca tcgattactt ggcaaagtgc ccctaaaacc catgacaaag aagaaaggtg    138900
     acacctcgct cgagcagcgg catgaggcac tactcaggga actggccgaa ctggagagcc    138960
     agaaccagcg gcttcgcatg gagaatgcaa ttctggagaa ggcgagtgaa ttgataaaaa    139020
     aagacatggg catcaacccc ctcgaactga caagccgaga aaaaacgaag gtggttgatg    139080
     ccctcagagt cacgtttcca ttagccaatc tgttgtgcgg cctgaagctg gcgcgcagca    139140
     catacttcta tcaacgcctg cggcagacgc ggcccgacaa gtacacgcag gtgcgtgagg    139200
     tcattcggac tatcttcgag gacaactacc gctgctatgg ctatcgacgc attgatagtg    139260
     ccttgcgcct tggtggcatg cgtgtgtccg agaaggtcgt gcgtcgcttg atggcgcaag    139320
     agcgtctggt cgtgagaaca ccgcgccgcc ggcgcttctc ggcgtatgct ggcgacccga    139380
     caccagcggt cccgaatctg ctgaatcgcg actttcacgc gtcggcgccg aatacgaaat    139440
     ggttgaccga tctgacggaa atacacattc cggcagggaa ggtctacgtc tcgccgatcg    139500
     tcgattgctt cgatgggctg gtggtggcct ggaatatcgg caccagcccg gatgcgaacc    139560
     tggtcaatac catgctggat cacgcggtac ggacactgcg acccggtgag catccggtta    139620
     tccattcgga caggggctcg cattatcgct ggcctgcgtg gatccgccgc actgaaaatg    139680
     cccaattaac gcggtcgatg tccaaaaagg gctgctcgcc agacaatgct gcatgcgagg    139740
     gctttttcgg acgattgaag accgaactaa tctacccgag gaattggcag cacgtgacgc    139800
     tgaaagacct catgacgcga atcgatgcct atatccactg gtacaacgag cgccgcatca    139860
     aagtgtcgct tggcgggcgt agtcccatcg agtatcgtca tgcggtcgga ttgatgtccg    139920
     tataaaccgt ccaagaaatc gtccgcaccc ccagtgggtc aattttagat gcaactcaac    139980
     aggccatgct gagtgtgcga tggttgatcg cttcctcgcc gctctccacg gcgacgatgg    140040
     ccgccgccat cagcaagtgc gccagttccc ctatggtgcc ctcgctgcgt gtgagcaggt    140100
     agcgagccat gtccagcgtg gcaattgggg aaggccggcg cagcgggagc gaagcggcga    140160
     agctggccag cagtgagcag caatcgtcgt tggcctccca taccggcagc atcatcggct    140220
     cgaagcgatt ttccaactgg tcatcggagc ggatggctag gtaggcgtcg cgcgtgccta    140280
     ccccaaccaa cgggatgcgc agttcgttgc cgaggaagcg cagcaggttg aggaattccc    140340
     ggcggttgac gctgttgccg gccagcacgt tgtgcagctc gtcgatcacc agcatgcgca    140400
     cgccgacctt gcgcagcagt gccagagcca gttgctccat ttccggcaac cgtgggcgtg    140460
     ggcgcagcgg cgcgcccatc gcggcgagca gcgcgacgta gaagcggatc acggacggct    140520
     cggacggcat ctgcacgacc aacaccggga tgtgctcctg gtcggcgtcg gagctggccg    140580
     ggtgggtgcg gcggaacttc tcgacgatca tcgacttgcc attgttggtc gggccaacca    140640
     gcagcaggtt gggcatgcgt tgcttgtttg gccacgcata aagggcttcc agccggttca    140700
     gcgcctcgac tgcgcgcgga tagccgatcc agcggtcggc gcgaaggcgc tggatgcgct    140760
     cgtccgccgg aagacgggcc aagccctggg ccgccggcag caggtgggac aggtcgatga    140820
     tgggatattc gtccacggct accactcctc aatctggtcg aacggtttgg cgggtggcaa    140880
     gttgtctgcc tgcgggtcgg caatatccgt atccggcgga acgggcttgt ccggccgagc    140940
     tgatgtcttg aggtgctggc ggcgatccgc gtcacgccgc gccttgcgtg tggccttctg    141000
     cgcgctggtc acaatctcac gcatctggcc gatcatgcgg aacagcgccg actcatccac    141060
     ctgttcgcgc ccttgctgcc gcagtttcgc cagcgcctgc cgttgttccc agagggtgac    141120
     agccggatgc gacaaggtac ggtagggaat ttccaggtaa tgctgtccct ccggttccag    141180
     gacccagata cggctgatgt cgcgcggatc gcgccggatc agaaaggacg gccagcgttc    141240
     acgccgcgca atccacggct tgagcgcatc ggcgggcact gttgcaaagt tagcgatgag    141300
     gcagcctttt gtcttattca aaggccttac atttcaaaaa ctctgcttac caggcgcatt    141360
     tcgcccaggg gatcaccata ataaaatgct gaggcctggc ctttgcgtag tgcacgcatc    141420
     acctcaatac ctttgatggt ggcgtaagcc gtcttcatgg atttaaatcc cagcgtggcg    141480
     ccgattatcc gtttcagttt gccatgatcg cattcaatca cgttgttccg gtacttaatc    141540
     tgtcggtgtt caacgtcaga cgggcaccgg ccttcgcgtt tgagcagagc aagcgcgcga    141600
     ccataggcgg gcgctttatc cgtgttgatg aatcgcggga tctgccactt cttcacgttg    141660
     ttgaggattt tacccagaaa ccggtatgca gctttgctgt tacgacggga ggagagataa    141720
     aaatcgacag tgcggccccg gctgtcgacg gcccggtaca gatacgccca gcggccattg    141780
     accttcacgt aggtttcatc catgtgccac gggcaaagat cggaagggtt acgccagtac    141840
     cagcgcagcc gtttttccat ttcaggcgca taacgctgaa cccagcggta aatcgtggag    141900
     tgatcgacat tcactccgcg ttcagccagc atctcctgca gctcacggta actgatgccg    141960
     tatttgcagt accagcgtac ggcccacaga atgatgtcac gctgaaaatg ccggcctttg    142020
     aatgggttca tgtgcagctc catcagcaaa aggggatgat aagtttatca ccaccgacta    142080
     tttgcaacag tgcctacatt tcaaaaactc tgcttaccag gcgcatttcg cccaggggat    142140
     caccataata aaatgctgag gcctggcctt tgcgtagtgc acgcatcacc tcaatacctt    142200
     tgatggtggc gtaagccgtc ttcatggatt taaatcccag cgtggcgttg attatccgtt    142260
     tcagtttgcc atgatcgcat tcaatcacgt tgttccggta cttaatctgt cggtgttcaa    142320
     cgtcagacgg gcaccggcct tcgcgtttga gcagagcaag cgcgcgacca taggcgggcg    142380
     ctttatccgt gttgatgaat cgtgggatct gccacttctt cacgttgttg aggattttac    142440
     ccagaaaccg gtatgcagct ttgctgttac gacgggagga gagataaaaa tcgacagtgc    142500
     ggccccggct gtcgacggcc cggtacagat acgcccagcg gccattgacc ttcacgtagg    142560
     tttcatccat gtgccacggg caaagatcgg aagggttacg ccagtaccag cgcagccgtt    142620
     tttccatttc aggcgcataa cgctgaaccc agcggtaaat cgtggagtga tcgacattca    142680
     ctccgcgttc agccagcatc tcctgcagct cacggtaact gatgccgtat ttgcagtacc    142740
     agcgtacggc ccacagaatg atgtcacgct gaaaatgccg gcctttgaat gggttcatgt    142800
     gcagctccat cagcaaaagg ggatgataag tttatcacca ccgactattt gcaacagtgc    142860
     ccccaatgcg ctgtccagtc atggaattcc ctgcaaaatg tcagggaaga ctctatgacc    142920
     ttcaacgaga tatgtcaata aattcaaaat tcaatcctat cctgacgcaa tttacacatg    142980
     gcatctgaca tcaggttagg gtatgcctca gtctgacagt gatgagtcgc aggcgttcgg    143040
     atcggcatcg gtttcgctcc cggtcttggc gcgcgcctgg aagcgctgat agcactccag    143100
     cccgcagaag tgctcgacgt attccgcgcc ttccggggtg aaggcggcat cgagcgggat    143160
     ttccttgcag cacacgcagc aactggtggc agtcggatca tttgcattca tggtggcacc    143220
     cctccattga ctgacgaaga cggcgaatgc cgccgccggc atcggcttgg cgaacaggaa    143280
     gccttgtcct gtgtcgcagt ccgcttgtcg caacaaatca agactcgccg atgtttccac    143340
     gccttcggcc actacttcca tgccaagccc atgcgcaagc tgaatcacgg tgcgcacgat    143400
     ggtctggtcg cggtggtcgt tggcgagtcc ggcgacaaac gattggtcga tcttgagcgt    143460
     gctgatgggg cagcatttca ggtgttgcag gcaggaatag ccggtgccga agtcgtcggc    143520
     ggcgaagcgc acaccgatct gtcgcaaagc ttccagggcg gggaagatcg ccggatcacc    143580
     gaacgcaacc gattcggtca gctcaatttc aagatacgcg gcgggcaacc cggcatcggc    143640
     cagcacgccc tttacccact tgtcgaaatc tggccccact tggctcgccg aaacattgac    143700
     ggccagccgg aacggttgcc atgccagcac ccgccagtcg cgcatttgac ggcaggctgc    143760
     gcccagcacc catgcgccga tttccggcat caggccggac gattcgatca cgggcaggaa    143820
     ctggcccggc ggcaacagtc cgagcgtcgg atgacgccag cgcaacaggg cttccgcgcc    143880
     gacaatctgc tcactgcgca aatcgacaat cggctggtag tgcagctcaa gctgcccgcg    143940
     ctcgaccgcc tgcgccagtt gcgccactgt ccattcaatt ggctgggaag cgctcatgat    144000
     cgacctctga aggcccgcag cagccgcgtc acagacagga caaacaagcc ggtcagcgtg    144060
     agggctgcaa taccccagtg ctcgccgatg aacgcgccgg ccgtcgtgcc ggccagcaca    144120
     atggcgagaa tcggcaaatg acagggacag gtgagcaccg ccagcgcacc ccacaggtag    144180
     ccggtgaacg gcttgtgtgt ctcggccggc atgcgctcgg ggctgttcat ggcaaactct    144240
     ccgcatgctg tgccggcgcg gtcggcatgg cggccaactg cacttccaga ttggccaacg    144300
     cttcgcgccg gcgttcgacg aactgacgca gcacagcaag ctgcgcggca gtttcatcgc    144360
     agttcgccgc atccagcgcc cggcacagcc gcgccaatgc gccgaggccg atgcccgcct    144420
     cgaaggcggc ccgcacgaag cacagtcgct gcaaggcggc gtcatcgaac aggccgtagc    144480
     cacccgtggt gcaggcgact ggccgcagca atccgcgcag caggtagtcg cgcacgatat    144540
     gcacgctcac cccggcatca agggccagcc gggacaccgt gtaggcgttc atcgaacacc    144600
     tccttttggt cggttcacgg caatgcatat accgtttcgc cgagttcaat ccgcgcgctg    144660
     cgaatccgat gccggtgccg tagaacattg ggtcgatatc cgatcacggt gtcctagatg    144720
     acatggtctg caacagatgt cgattaaact cctggcccaa gccgaaagcc tcgtggacac    144780
     tgacgatcgc caatccttcc aatccttgat gcttggaggc ccagtcttcc gccgtcggga    144840
     cagatgcaaa gaaatgtaca tggcaacaga aggactgacg aacgtcggct gcttcctgcg    144900
     gcaataccaa ggacaccgcc atgccggcag gttcgacagc ctgtatctcg ctgggtgaaa    144960
     ccgtgagtga aacgggtgct ccggttgcag cgcaatgcga tgagacgcga gctgtacggc    145020
     cgatcagcgc cggaaatatc aaggtgtcca gcgcgcacca ggcatacaga cggcggtcgt    145080
     caatttcaaa gacatacgaa gtctcgcgca aggtgaggcc gtagccgatg atgttcccat    145140
     ctttgtcata ttcggtactg gtggcctgtt cgagtacggc ggccactcgc tcagcgggcc    145200
     agtcgagaat cccggcaagt gtcgttcgtg aaaccggacg ccccttggcg agttcccgca    145260
     gtagcgggac caagagatcc gcagtaccat tggtacgatt gaccgaagtg agacgttcta    145320
     aaatatatgg ggcgagcttc atggttccat ctcctttcat cctgcgcagc aggacaattg    145380
     tttgacatcc ttggtgaagg tctgcgccgc gagcttcagc ccctcgacca tcgtcaggta    145440
     ggggaacaac tggtcggcca gttcctgcac cgtcatgcgg ttgcgaatgg cgagaacagc    145500
     cgtctggatc aattcgccgg cttccggggc gacgacctgc acgccgatga gccgtccgct    145560
     accttcctcg atgaccagct tgataaagcc gcgtgtgtcg aagttggcaa gcgcacgcgg    145620
     cacgttgtcg agcgtgagcg tgcgactgtc ggtttcgatc ccgtcgtgat gcgcttccgc    145680
     ttcgctgtag cccacggttg ctacttgcgg atcggtgaac accacggccg gcatcgcggt    145740
     tagattgatg gcagcatccc ctccggtcat gttgatcgcg gcacgggtgc cggccgctgc    145800
     cgccacatag acgaattgtg gctggtccgt gcagtcgccg gccgcgtaaa tgtgtggcgt    145860
     gctggtgcgc atgcccttgt cgatgacgat ggcaccctgc gcattgacgg tgactcccgc    145920
     cgcgtcgagt gccaggctgc gcgtgttcgg tgtccgtccg gtagcgacca gcagcttgtc    145980
     ggcacgtact tcaccgtgtc ccgtggtcag cacgaattcg ccgttcacat gcgcgacctg    146040
     gctggcttgc gtgtgttcca gtaccttgat cccttcggca cggaaggccg ctgtgacggc    146100
     ctcgccgatg gacgggtcgt cgcggaagaa cagcgtgttg cgagctagga tcgtgacctg    146160
     gctgcccagc cgggcgaagg cttgcgccag ttccagcgcg accaccgacg agccgatcac    146220
     ggctaggcgt tcgggaatgg tgtcgctgac caaggcctcg gtcgaagtcc agtagggtga    146280
     ctctttcagg cccggaatcg gcggcatggc cggactggca cccgtggcga ccaggcagcg    146340
     gtcgaacatc acgacgcgct caccaccctc gttcaaacta acgataaggc tctggtcgtc    146400
     cttgaaacgc gcttcaccgt gcagaacggt gatggctgaa ttgccgtcca ggatgccttc    146460
     gtacttggca tgacggagtt cttcgacacg ggcctgctgc tgggccagca gccgctcgcg    146520
     caagatcgtc ggcggtgtgg gtggcatgcc gccgtcgaat gggctttccc ggcgcagatg    146580
     ggcgatgtgg gcggcgcgga tcatgatctt ggacggcaca caaccgacgt tgacgcaggt    146640
     gccgccgatg gtgccgcgct caatcagcgt gacctgcgcg ccttgctcga cggccttcag    146700
     tgctgccgcc atcgcggctc caccgctgcc gatcacggcg acttgcaacg ggcgctcgcc    146760
     gccgctgccc ttgtcggcgg cacccatcca gccgcgcacc ttgtcgaaca gcccagtgcg    146820
     gttgtcggtc ggcggggcat cggcgagcat cgctttgtag cccaggccag ccacggcggc    146880
     ggtcagtgcg tccggcgctg tgcctggatc aagggcgagc tgggccgcgc ccttggcata    146940
     ggacactatg gcagattgga cgccgggtac tttttccagc gcttccttga cgtgcgccgc    147000
     gcacgagtcg caggtcatgc cggtgatttt tagatgggtc atgcgacaga tcctttttcg    147060
     tttgtggtag cagacaaggg cgtcagatgt gctgcgctgc cgttttcagt gcctcacttc    147120
     ttgacgctgg acggatagcc cgcgtcttcg gtggccttgg tcagcttctg cacgctggtc    147180
     ttggcatcat cgaaggtgac aaccgcttcg cgtgtctcga aggtcacgtt aactttgctg    147240
     acgccttcga ccttggaaat cgccttctta acggtgatcg gacaagcgga gcaggtcatg    147300
     cccggtacgg acagcgtgac ggtctgggtg gcggcccaca cgggggcaac aacggcagcg    147360
     atggcgagag aggcaaacag ttttttcatg atgaactcct gtgattaata gaaaaatggc    147420
     atgacgtagg gaaatccgag cgcgaccaga accagcgcgg ccacgaccca gaaaatgagc    147480
     ttgtaagtag cgcgcacttg gggaatcgca cacacatccc ctggtttgca ggcttgcgcc    147540
     ggtcggtaga tgcgccgcca ggcgaaaaac agcgccacca acgccgcgcc gatgaagatc    147600
     gggcgataag gttccaacac cgtcaagttg ccgatccaag cgccgctgaa ccccagggcg    147660
     atcagaacca gcggccccag gcagcaagcc gaggcgagga tggcggctag cccgccagtg    147720
     aagagcgccc cgcgcccgtt ttgaggttca gacatacgct tgtcctttca aatctggatt    147780
     ggatagctta agcttacttc cgtaccaatg tacggagtca agcgatatgg aaaaaaattt    147840
     ggagaatctg actattggcg ttttcgccaa ggcggccggg gtcaacgtgg aaacaatccg    147900
     gttctatcag cgcaagggct tgttgccgga gccggacaag ccctatggca gcatccgccg    147960
     ctatggcgag gcggatgtga cgcgggtgcg cttcgtgaaa tcagcccagc ggctcggatt    148020
     cagcctcgac gagatcgcag agctgctgag gctggatgac ggcacccact gcgaggaagc    148080
     cagcagcctg gccgagcaca agcttcagga cgtgcgcgaa aaaatgaccg acctggcgcg    148140
     catggaaacc gtgctatccg aacttgtgtt cgcctgccat gcgcggcaag ggaacgtttc    148200
     ttgcccgctg attgcttcgc tgcaagggga gaaagagccg cgtggtgccg acgcggtgta    148260
     gccgagggta gttacgcctt agcgtgcttt atttaatgag atggtcactc cctccttccc    148320
     ggtactatgc tgaggacagg ctttcattcg gagaactatc atggaaaaca ttgcgctcat    148380
     tggtatcgat ctgggtaaaa actctttcca tattcattgc caggatcgtc gcgggaaggc    148440
     tgtttaccgt aaaaaattta cccggccaaa gttgatcgaa tttttggcga catgccccgc    148500
     tacaaccatc gcaatggaag cctgtggcgg ttctcacttt atggcacgca agttggaaga    148560
     gttggggcat tccccaaagc tgatatcacc acaatttgtc cgcccgttcg ttaaaagcaa    148620
     taaaaacgac tttgtcgacg ccgaagctat ttgtgaagct gcatcgcgtc cgtctatgcg    148680
     ttttgtgcag cccagaacgg aatctcagca ggcaatgcgg gctctgcatc gtgtccgtga    148740
     atccctggtt caggataagg tgaaaacaac caatcaaatg catgcttttc tgctggaatt    148800
     tggcattagc gttccccgag gagctgccgt tattagccga ctgagtacca ttcttgagga    148860
     taatagtttg cctctttacc tcagccagtt attgctgaaa ttacaacagc attatcacta    148920
     tcttgttgag cagattaaag atctggaatc ccagttgaaa cgaaagttgg acgaagatga    148980
     ggttggacag cgcttgctga gcattccctg cgtcggaaca ctgacagcga gtactatttc    149040
     aactgagatt ggcgacggga agcagtacgc cagcagccgt gactttgcgg cggcaacagg    149100
     gcttgtacct cggcagtaca gcacgggagg taggacgaca ttgctgggaa ttagtaagcg    149160
     aggtaataaa aagatccgaa ctttgttggt tcagtgtgcc agggtattca tacaaaaact    149220
     ggaacaccag tctggcaaat tggccgattg ggtcagggat ttactgtgcc ggaaaagcaa    149280
     ctttgtcgtc acttgtgctc tggcaaacaa gctggccaga atagcctggg ccctaacggc    149340
     acgacagcaa acttatgtag cataacggca gaaatacacc ggtttaaaga attactgatc    149400
     tggttttgcg aatactgata ttgatgatac taacggccca ccggcctgtt gaggaacctg    149460
     taaaacggaa aggctcattg aagccgtata ttttctggag gttcatcagg cgcggaactc    149520
     atcaaggcgc gggaataaaa tcccattcag acgccggata gattcaagca agccaacttg    149580
     tcgtcaaaat cggtgttgca aaaacgggag tgaccataga ttccgttttc tgagacgacc    149640
     ccttgtagga ttggctgtat ctggggacac tataaccgtc aaagaagccg gtttggtgtt    149700
     ggtcattggg gttatcctgt ggatctatgg tataatctta accaaggtca gcaattccta    149760
     agggggtcaa atggacgctt tcacattagg catgttgggg ttgctcattt ttttcactgt    149820
     cgtcactggc ggcagtctgt atctctacca tgagaaacag aaggaaaaaa agcatcacaa    149880
     cgcctaaaga gtaactgcga caatgaacgt aaaggccagc aatagctggc ctttttttat    149940
     acttgcagtt tgaggtgtta catgtcacga taaggtaagt gtgacatgta acggaaaagg    150000
     tgattttttg aaagtatcca atgaagatgc tcaggctacg gcgatctatc tcctcagagc    150060
     tgcttcgcgc ccagctttct ggcgtgacgt cccattcgat aagaaacttg aagccgtgga    150120
     cagcctgaac agcatagggc gatcaccatc agaactcact gaatggatta ataaatacct    150180
     gacagcagag caaatcaata aactcgggac atcaattagg caacgtcgca gaaggggata    150240
     tggtgttggt aaaagcataa ctataagcga taaagcccac aggattttga agcggttgtc    150300
     agaagtcgat ggttgcagtt tgtcagaagt gatcgagaaa cgcctagccc gagcttataa    150360
     aaatacatgg gaccataaat agagtgacac taggggttgc atttttaaaa cccgtgatag    150420
     catctaaatg aacccaaacg aatagggggg ctggcggcga tgccgaccat tatcccgaca    150480
     atggagaaat agaccatgat gacattgact accgtctcga agaaaacttc aaataattca    150540
     gcccttgtat tctggcgcgt tggtacaaaa cggaaaggca tccttgatgt ccatattgat    150600
     tttgaccacg aagaagcgga tcttttggct gagctcgtag ccattcgcta tctggcgctg    150660
     gacaaacagg ttttttgcag agagccaggt gctggtgctg gttacaagct ggtggtatcc    150720
     aaaggtgcaa tcaagaagct ggcgctgggc aaatccacca aggcttttgc tttcaagttt    150780
     gcggcttgcc tcactgggcg tttaaagggc gctactattg aagtctcgca gagcatggag    150840
     tttatggatg agccgggaga gggcaacatt gagctcctcg atgtggacaa gcaagcctat    150900
     acccagaccc atgacgaaat atctacacct gccattggcc ccgtcctggt tactcaacat    150960
     gccatcgatc agtatcaggc ccggataacc tctggagacc ctaaaaaacc gtgggcctca    151020
     cttgttggcc gcctccagca tccagagtta caggttcagc cctttgacga gaaagtggct    151080
     cgccataaag ccagaaagta tggccgcgta gataacgtgg aagtctgggg ccatagagat    151140
     tccaagttca agtacctgat ggtgatcaac gacgacaacc aaaaacgtgt tcttgtcaca    151200
     gtgtttgagc gaaatgagta acctgcttct catttgttct gaatacacaa cctctccaaa    151260
     tcacgtattc ataccctaaa agggcaataa cgcagtcgtt gataacgact ctcccacctg    151320
     aaaatagctc cagcataaaa actggagctg taaatgagat cgagaccttc ccttttactg    151380
     atgcgaaacc tgcggtcatt ggccgttgtg gtgctcgcaa ctttgccatg cgttgctttt    151440
     gcacaatggc gggttgtagc cgtgagcacc gaagtagaca aaatgcgctt caacaccatc    151500
     atagacgcgc attccttcat gaagaattat cgctctggtg aggagcaagg gaagggaacg    151560
     ccagttgggg atgcgcttta tccggttgcc agttatggtg atggccgtta tgtctccagg    151620
     atctgtttta agtatctagg tgctactggc gattatgacc ccactacctg cactggcgac    151680
     ccagctacgg tctactggcg ctcaacctat gttctgccgg gtgagatgga taaaacaccg    151740
     ttcctggaca gggatctcgg cttaccaaca acgaccatgt gtgtagggaa ccctatccat    151800
     cttggcaccg gcaacaagtt ccaggctgaa ctggattatc aaagcggagg ctccgaccct    151860
     ttcacattca ccagatacta caatagccac cttcctgatg aagagctcgg cggctggcgg    151920
     catacctact cgcggagcgt cgaggtcaac gcctcgaagt acggtgagaa catggttgtc    151980
     ctgcaccggc cagaagggca acaactcgcg ttctacaact cgtcctctgt ctgggtgcca    152040
     acatggaaaa ccgatgatac cttgacgaag gatgctaccg gctggcgcta cactcaatct    152100
     gacggggtag tcgaggccta tgatgaaacc ggacgactga ccggcatcga gaagcccaac    152160
     ggcaatcaca tcaccctgag ctatctgaac ggagagctat cctcgatcac tgacggcttt    152220
     ggccgcacca tccagttcca gtatcaagat ggccgcatgg tcagtgtcac cgatcctgct    152280
     ggtggcagta ttcagtacca gtacaacagc gctggcaagc tggcggaagt gatctaccag    152340
     gacaatacga gccgcagcta tctctacgat gacccgaatg caccgggttt gctctctggg    152400
     ctggtggacg agaacggcaa ccgtttcgcc acatggggat atgatactca ggggagagcg    152460
     gttctaagcg aacacgccgg gggcgcagag aaaactcagg taagctacaa cgctgacgga    152520
     agcgtctctg tcaccaatgc cctcggccac gttcagcgat acacctacag tcgccacaat    152580
     gggatgctca agcctgatgt ggttgagggt gcgccgtgta ccggctttgt gggcggcaag    152640
     gaaacctacg tctacgacag caaaggcctc gtctccagca ttactgaccg cgctgggcag    152700
     aagcgcacgt tcacccataa cgaccgggga ttggaaacca cccagataga ccaggacggg    152760
     ggtaaggtta cgaccgactg gcttccttcc aagtcgctcc cggcaaaaat cacagaacca    152820
     accaggatca ctgagctcac ctacgacact catctccggg tgataagccg caaggtcact    152880
     gatcgcagct cgggcgcttc ccggacatgg acctacacct atgcccctgt tggtacagga    152940
     aagccgagcc tgttggcctc ggttgatggt ccgcgcaccg acgtcagcga tgttacgaca    153000
     tttgactacg atgaccaggg caacctgatc cggacaacga acgcgctggg gcaggtgacg    153060
     cagtttggtg actacgacgc gaacggtcgc gccgggacca ttcagggtgt caatggtgta    153120
     acccaaaccc tcacctatga cgccagagga agacttgtca gctccactgg gccagaagga    153180
     accacggtct acaactatga tgctgtgggc ctcctgagtt cgctgaccaa gccaaatggt    153240
     gcaaccgtca gctatgagta cgacgctgca catcggctgg tggcggaaac agatgcacag    153300
     ggcaaccggc gcgagcttga gctcaatgac ctcgggaacc cagtagaaga gcgactgctc    153360
     gatgcgctgg gccagacccg ttggatagag cgccggatct tcaacgaaat cggctggctc    153420
     tccagtgtct ccgacgccta tagcaatcag tcatcgtttt cctacgatgt ggtggcaaac    153480
     ctgatacagg agaccagtcc ctctggtaac acacactcct acaagtacga cggcttccat    153540
     caccggacac aaacgaccga tcccctcggg aaggtcacgc aggtgctcta caaggatacc    153600
     ggcgatgttt accgtgtctc cgaccctcgt tcgcgcctga cctactacag ctacaacggc    153660
     tttggcgaag tgacccaggt ccggagcccg gacaccggca ccaccgacat tacctatgac    153720
     gaagccggta acgtggcaac gcgcaaaacg gccaaggggc aaaccacaag ctacagctat    153780
     gacgcgctga accggatcat cgaaacctcc agcgatgtcg ctggcgaatc gccaattctg    153840
     tacgggtacg acgaagcaac ctcaccatac ggcataggcc gcttgacctc agtcgatgat    153900
     ggcaacggtg tccggagatt tggctacacc cccgaaggat ggctggctta cgaaacctgg    153960
     gaaacccacg ggcagagcct gactacccag taccaatacg atggtgcagg cctcgtcacg    154020
     aagatcacgt atcccagtgg ccgtgaggtc tcctacaccc gtgactcagc cggtgacgtc    154080
     atcgaggtga caacgacaca agcaggcacc acaacaaacc tggcaagcca gattgagcga    154140
     gcgccctttg gccccgtcac cagtatggtc agagggaacg gcatttcaga aagccgcact    154200
     ctggatctcg attaccgtgt caccggcatc gacgctgcta gggtgcattc gctggtctat    154260
     cggtacacgc cagactcgtt gatttcagcc atagacgaca atctcagctc atcagtcaat    154320
     cagtcactcg gttatgacgc ggttggccgc atcacctctg ctgaggggat ctatggcgtt    154380
     ttgggctatg gctatgacgc caccggcaac aggacctcga tcacgaccga tggcctgagc    154440
     caaagctaca ccatcaacta catgaacaac tggttggtga aggccgggca aacctccaga    154500
     agctatgacg ccaatggcaa cctgacgaag cagggggcgg ataccttcac ctatgacagc    154560
     cagaaccggc tggtggccgc aacggtcgcg ggagtgactg taagctacac atacaaccat    154620
     ctggatcagc gtgtaaccaa gaccctaaac gggcataccc ggctgctggt ttacgacctg    154680
     gcaggaaacc tcatcgagga gctggacgcg gccactggag acgtgctggc ggagtacatc    154740
     tggctcgatg ggacaccctt gggctttgtt cagtcaggac agacctacca agtccacgtc    154800
     gatcacctgg gcaccccgaa ggcactgacc gacgtcagcg gccaagtcgt ttggaaggcg    154860
     agctacagcc cgttcggtaa ggccagcatc atcatccagg ggccaacctt caacctgcga    154920
     ttcccaggac agtattacga cgcggagacc gggttccact acaactggcg gcgttactac    154980
     gacccagcga ccgggcggta cattaccagc gaccctcttg gcctgatcga tggagtaaac    155040
     acctacgggt atgtgcatgg aaaccctatg tccaataccg acccgacggg tgaatttgcg    155100
     tttgttggtg caggtattgg agctgggttg gagctactta gccaactaat cgaaaataat    155160
     gggagttgga aatgtgttag ttggtcaaaa gttggaatcg ccggagcgat tggggctata    155220
     ggtggcggct gggcgtcagg agttttcaga catgccagct ccggtaaatc gtggttcaaa    155280
     ttaagccaaa aatggagcaa tgtctcaccc agagtaagga aagttcaagg ggttccacga    155340
     ggtaatgagc ttcaccattg ggctattcag agaaatggca agtttggcaa atatgttcct    155400
     gactcaataa aaaaccatcc ttggaacttg aagtccattc caagagatat tcaccaaaac    155460
     attcacggca atggacctac cccatatagc gcatttggtc gttggtggca cgggacgcct    155520
     gaatgggcaa aagtagctca agcctctcct gttagtggtg gtttagctga ttcaataaat    155580
     gatgagggat gcggttgtgc aaattgaatt tccagcgctg cttgtgagca gcaagaaaag    155640
     gtcgctcttc gtagtggcat cagaatccga gttcgggaaa tgtactattc agtctttgag    155700
     gaacggttat tttgagctga tggacattta tgattcggaa ggtcgtcact acaaaataga    155760
     cgaggttgcg agctacaagc cgctaagtcc attctggtac tggcctgtag aaattgtgat    155820
     gtatggttct cgactgttta aggctaattt caatgctgtt cttatctcta atctggattg    155880
     caaggagtta aaatctgaac tttgtgattt ggctaaaaag tacagaagta atttggattc    155940
     cggcgtcgga attgaaaaga ttatggagga aatggagtct gccagaacaa ttaaagaatt    156000
     gataaaggtt tttggctagt tattcattga atacgctggt gttagtctag ctaaccgacg    156060
     ccagcggcca agtgtttgga aggcgagcca tcatagagtc agtagagaga gatacttttg    156120
     gaaatcaata gtattatgat tggtacaaat gagttgtagc tccatatttt aaagggggat    156180
     ttcagagaaa tgaagaataa gaaggtaata actttgataa tggccgcagc cgcatcatgc    156240
     tcgtcagtct acgccgcgac attaccgacc agtgaggtag acgcatacat acttgcgatg    156300
     aacaccatgt cacctatcac tgcaaagtac accatctagt acaagcaagc ggttgagcag    156360
     aaatgcaata cagccctgag cgttgagcag ctcaactcaa aggcattcac caatgttgtc    156420
     caggcaatgg tgagtagtga gaccgtcgat agaatggggc ttgatgctgc tggtggatca    156480
     ctccaggata ccctgtctgt gatcggcaag aacgtcacat gcagtgacct gaacgcgcca    156540
     tttaaagcac tcttggatga taaggacttc accagaaagc atcagcacct atcgaaggtg    156600
     ctgcatactt ggaatgaagt tgtttctcaa agcaaaccct gagtaacaaa aaggagccta    156660
     actggctcct tttttaatgg ggatgatgtt acgttcgtgg acgttatttt cactcgggat    156720
     atgtaacgtt gaaaaaggcg taccgacaag agagtggtca catagctctc cataatagat    156780
     gagcgacaaa atctcttgct cgttgatttt tcccacctta aaaaggtaat tgattattgc    156840
     tgtatccagt aggtcgtgac acccattaag cagatccacg atattggccg cagcttcatt    156900
     ttcctctccg tcatctcgac cggctaatac tgattcaacc caagcctcaa ggctcggatg    156960
     tccctcagcg agctctattt gacggcactc gttctcgatc aaccctgtga ttgcttcgtt    157020
     gagcgttccg ccataagtcg gcatgttgag aacaactcca aatccgggga tttctttttg    157080
     gattggcttc gcatccttgg gagctgattt cagccacagg aaaaaccaga tcccagagct    157140
     tatgtcttcc ggcttgacct ggttggccgc aaggaatttg gaaacctcgt tacagatgat    157200
     gccatctggc gctgccatct cgtaaatacc cgccatcaga tcttcaaggc tcttatacat    157260
     attatctctc gcacctgtac atgatgtttt cactatcgtt gttaagcgtt ttttcagcaa    157320
     gtatgttcca gcgagacatc ttataccatt ccatctaaat ctgtaaaatt accgtattac    157380
     cgtattaccg taattatgat aattacggta aataaattta agttcttctt gctgttgttc    157440
     tacttattaa aatgtatctt tgaaaaagta gagtttttgg aataggatag gtggtgctga    157500
     atgcccactt tttacaagga gcgcgaccag tgatttttga tgtaagagcg acctttgaag    157560
     tggcactcca gacggacacc cacctggtac ttatcgatct ggatcaggga gcatcagtta    157620
     cgaacgatgc tgatgcagtg atcgcctggt tggccgcaaa cctcgaaggt ggaattggaa    157680
     aacgtaaggt gtactaccgg gacaccgatg gacgctttga tgagctcaag gttaatgccg    157740
     gtgcttttgc cggatttgca ccttgtagcg aaggccagca gaccaccttg gctgggatgc    157800
     tcggccagta actttgtgtg gagaactcga tgttaaacaa aaacaaattt gagaaagttt    157860
     taaagagaat cctcgataag aactttgagc gctgctctat ttgcaggaaa ccattccctg    157920
     gaccgtgcca tacttttgct ggtttggatt cggacaataa agttcagaac gtaggttctt    157980
     gctgtcggac cagtattgtg gacttgcggc atggaggtgt gtatacgacc gctcctgtag    158040
     atactcaaga ggggcaaagt caggcgcgtg agctactcgc aacacatcct tgtaagggga    158100
     tgatgggaca tgcttagcaa aaaagtcttt ttcattagtc aagcggaggc cgaaagactg    158160
     gagccggttc ccggtgcggc catgatctcc ataactgacc cagacaagtc ccctgccgct    158220
     ctcggacagt gggggcagtt gtaccgcgat agcttctatg acggcggcta ttctgagaac    158280
     accatccaca cgatgaaggc agcgttccgg atgaattacg cctcttacat tgactcatcc    158340
     caggctgaaa agctgtccac cttcctggat ggattggttg gtagcggtat cgatcagatc    158400
     ttcgttcatt gctattacgg agaatccaga agtggcgcgg tagcgctgta cctccagaac    158460
     aaacatggat tcactccgaa taagccgatc accaagccca accgaacagt ttacgaattg    158520
     ctgtgcaatc caaccaagtt tgaaccactg atgcaaagct acgaaacgca acatatggag    158580
     gaggaactac ctcttcacct caaaatatgg gattttcttc tcgttgcggt cgggcttagg    158640
     aggtaacttt gcacgacaca aacaatgaca aggaagagct agtttcacat gcgaaagtaa    158700
     atgttccggc agaacaaagc attcgcggtg aactgttgcc gtcatcgagc tcgctccgga    158760
     acatccagga caaccccgcc gtcgcctatc tggtgagcct cgggtcaaag cgaagcaggc    158820
     agaccatgag ctcattcctc aacattgtcg ccaagatgat cgggtttcag aaccttcgtg    158880
     actgtgcatg gagctcaatg aggcggcacc acatattggc ggtgctggaa atgctggggg    158940
     atgcagggaa ggctccggca acgatcaaca cctacctgtc agcgctcaaa ggggtggctc    159000
     ttgaagcctg gacgatgaag caaattgata cggatagctt ccagcacatt aagcaagtcc    159060
     gttcagtacg tggatctcga cttcctaaag ggcgggcact tgaacgccat gagattcgca    159120
     gcctcttttt cacatgtgaa agtgattcaa gcgccaaagg gcttcgggat gcggccattc    159180
     tcggggtgct cctcgggtgt ggcttgcgcc gctcggaaat cgttgcgctg gacatgggaa    159240
     gcatgatcta caaggaccgc gctctcaagg ttcttggcaa gggcaacaaa gagagaatgg    159300
     cgtatgtgcc tggtggcgca tggaaaagac tggataagtg ggttgaagag gttcgaggaa    159360
     cgcatgaagg gcctttattc ccgaggatca ggcggtttga tgatgtgact ggagagcgga    159420
     tgtcggatca ggccatctac cacatcttgg agaccagaag agttgaagcc ggtctggaga    159480
     tgtttgcgcc ccatgacctg cgacgcacct ttgcctcctc gatgctggat aacggtgagg    159540
     atattgtgac cgtgaaggac gcaatgggcc actcaagcat tgcaactacc cagaaatatg    159600
     acagacgcgg cgatgagcgt ttgaagagag cgagccaacg cctcgatata gcggattaac    159660
     agcatgaatg atgaagaact cgaacttgcc agagccgaag ccatgaaagc cgataggtgc    159720
     ttttcaaaag gacggctcag ggacgaattt aggatgaagc ctaagccagg agtagagcca    159780
     gtttcgttct acaaaaacgg gtatggtggc caatttggag tgtaccggat agcagattgc    159840
     caaccaatgc ggagaagggg ttgttcaccg gcatcacaaa agcaaataag ggcgcaatcc    159900
     atcctttcgg tcaaggcaag aatgcgtagc aacctggcaa aggcctctgt catggcacaa    159960
     aggtgggtcg ctctggaacc tctggttctc gataccgaga cgaccggact tggtgaaaga    160020
     gaccaggtga tcgagctggc tgttactgac atcagaggcg cggttctcct ctgcaccaga    160080
     ttacggccaa ccgtggaaat agaccctcag gcaatgggtg ttcatggcat caccgagact    160140
     gagctgtcga atgagcctac gtggactcaa gttgcgccag ctctcgcccg gcttttgtcg    160200
     ggccgtcatc tggtgatatt taactccagt ttcgacagta ggatgttgag gcaaacagcc    160260
     agtgcatttg gagaccaact ctcttggtgg caagagcaga actgtctgtg cgcgatgaag    160320
     ctggcggctg atgcctttgg ctcaaccaac cggcacggca caatctcact tgcggatgcc    160380
     acctgcgagg caggtgtgag ctggaaaggt cgagcccatt cagcagcgac cgacgctatt    160440
     gccaccgccg acttggtgac agagatagcc aaagtccaac gtgacctcgt ggtccagctc    160500
     caggagcttc aaagcaaagg taatttggaa tgacagaaca atcctacggc gaaagtctca    160560
     aatttttctc agactggcag aaggaccccg cgaaacgcac cggcctgaat gtgcaacaca    160620
     cgctaaccag aggtgaatat cctacggtca gcatcgagat tgcgccgatc agggcatcgg    160680
     ggtccagccc agactggaaa agcaagatca cggtgcagct cactcgcggc gaactgacgg    160740
     cgttttgcag cgttctcttt ggtttgcgta gcaaggctga gggttcctat cacggcgacg    160800
     cgaagaataa gagctttgcg gtttacaaca acggcaaggc cggtgttgcg atcatcctta    160860
     gtgagcgagg aaaccagctc cagaatttca tcaatgatga cgaccgaatg gagctcgcag    160920
     tcttcgcagt tcgccagctt tccaacgcat ggaaagttac cccttctgat gccatcgcgc    160980
     tgctacgcca atcagcgtgg atggaccgaa atttgtccta atcgagcaaa tctaggcact    161040
     ctaaaagtcg tcctataacc acaaagttag accatcatgc aaagtggggt atagagggtg    161100
     ccagccccac cccagcagtc cccctcagcc acatttctgg cttgccccgc gcttttcttc    161160
     tttctctctt tttctctctt tttctctctc tttctcaatc taatctcaca cacgaaggtc    161220
     aaacagggca cccgccgacg cgaagcggag gcgtattctt gcccctcccc ctcgttgcat    161280
     gatggtctaa atctgtctac tatgtaacca atgaactgtt agaacaaacc cacacatagg    161340
     cggcagcatg gctaaaaact tcatatcaga acaattctcg gccatgtgcc gcgacttaac    161400
     gaacctgtcc tctcttatca aacgactacc gccacggtac gcaaaagttg cggccatccc    161460
     tcctaccgga aaaggaatgg agaacgagcc cgtcaacaag attgtcgtaa ctgaacaaac    161520
     tgggcgcgaa gctcttgagc tggcagcgca cagctacaga gatcttcaca tcaacccaga    161580
     ctattcgcag aagtctgcca ggcgcaccgt gggggtactc tggttctccc cttccaggat    161640
     tggtgtagct gacgaaattg cggcgacggt tgaacgcatc aacgcggcca aagctggtat    161700
     cgaggagttc attatctcga cgtaccccac caggcaagag aggtttgaag cacttcgagc    161760
     ggactgccct ggtgtcatga ctctccacct ttacagacaa attcggtgct ataccaatgg    161820
     cgacatcgac tctatccgct tcacctggca acggaaggac tccttgaaga agcccgtaaa    161880
     agaggagctt ttgcaacgca tcagagagga gctggagcga tctgggccag actatcaact    161940
     tcccctggag cagcttatcc agaagatcgc cagcaccccg gagccttatc tccgggagcg    162000
     aagggaagta aaggttcaac cggtggcaaa cgtcatggcc gcaggggtac tcaaaaccgt    162060
     taccgcgcca atgcccctga tcgtgctcca ggataaggat gttcagctca aattgcttcg    162120
     taactttgac gcctcagaac aacgcaaaac tcgatctgat aaagcggcat cggaaatcct    162180
     tggcaccttc ggtggagtca ctatcgaatc cttccctgga tgaatcagcg tgaccgcgta    162240
     acaaggcttt tccgcagccg gaagggcttt gtcccacaca aacaattcca atcgacagca    162300
     gcatgatata taattatgat aattaccgta ttatcgtaat tatcgtaatt atcgtaaaca    162360
     ttacaaatta aaaggaacgt tctcatggca agaaaattgg ttgagtttga cgatgtagcg    162420
     gctgcggccc aaaagctcaa ggacgccggt aaacgcccaa cggtcatcgc tatcagagac    162480
     atcattggca aggggagctt taccaccatt tcaacgtatc tcaaacagtg gtcagaggaa    162540
     cactccctcg atgaagagct ggtagaggta gtccttccag aatcggttat gagcgatgct    162600
     gagctcttcc tacagaagat ctatacggta gccaaagcaa gcgccgatga acagcttgag    162660
     cgcgagcgtg aactgctacg acagaaagaa attgagtacc aggaagatat gcagcaagcc    162720
     gtggacatgg caaatgatgc caccgaacgg gctgagctac tggaggaaca acttgaagct    162780
     ctcaccaaca aaaaatcaga gctcgatgcg gcccttggta aggcagaaaa ctcgctatcc    162840
     ctcaagtctg cggagctaga acgctcactg gctgacattg ataagctgga aaagcggatc    162900
     gttgagttgg agggcaagct ggaggcgaaa gccgcagatc tgacccgagc acaggatcac    162960
     ctggagcaag ctaaaagcga aaatcgctct ttgagccaaa aattggcaac tacagagggt    163020
     gagttggagg agcaaaaagg caagagtata gagcagacag aaaagctccg ggccgctcag    163080
     gaacaaaaaa catcgttgaa agagcagctc gaaaatgtac aggccaaact ggcccaatca    163140
     caggactccc ttgccacagc caaagctcat ggcgaatccg ctgaacgaga gtgccagcgc    163200
     ctatctggag aggtagaaaa gctggacgcc aaattatcca gcgccgaagc agaagctcgc    163260
     gctcttgttc aagacaaagg catgatggct ggtcagttgc aggaaaaaga ccagcaggcc    163320
     aagagcctcg aacaaagact caatgatgca ctgaccaaaa tttctgggtt ggagcaagag    163380
     ctcgctaaag ctggtaaggg agggaaaaag aaagaggaaa actgatggcg cgaaaggcta    163440
     aatattcaga agagtggcga cacagagctg cggctcttca aaccaagatt gaggaggcta    163500
     tgacactagc cacctcatct attggcgact atcgctggtt acaccgtctc catagttggg    163560
     ttacggaggt ggctcaaggt aaagccccag actggtggac agatctggat tgtgaagtat    163620
     ccctcccccg agaagaaaag cggatcagta cgttcctctc gacacaaaag aagcgcatca    163680
     ctctccagat gtgtttgtcg tagggggcct catgaaacaa cttcctcctg acacaccaga    163740
     acaatcactg atcactcagt acaaagggcc tcgccttgtc gttaaggcct acgctggaac    163800
     gggtaaaacc acgacactgg tgaagtacgc ccacaacaac ctcgattcac gtatcctcta    163860
     cttggcatac aacagggcta tccgcgacga ggcaagagaa aagtttcctg caaacgtaga    163920
     ctgcaaaacg tcccaccagc ttgcctacgc cactatagga aggggctacc agcacaaact    163980
     ctccggcaac ctaaggctca ccgatattgc ccaagcggtg aataccaaga actggacgtt    164040
     tgccaaagat attctcgata cgctcaacgc ctttatgtgt agtgcagaca tgcggattct    164100
     ttatacgcat tttgctcgcg ccgatacggg taaagtgctt acgtccaaac aggagagata    164160
     ccaaatccag gtggtcgaag gtgctgagct catatggaaa cggatgacaa acgttcaaga    164220
     tccgttcccg accgtacacg attgctacct caaacagtat cagctcggga tgccgaatct    164280
     gtctcgccgg tacaccacca ttctttttga tgaagcacaa gacgctaacc ccgtaacaag    164340
     tagcatcgtc ctacagcaga actgcaaggt aatcctggtt ggagatcgcc accagcagat    164400
     ctataggttc agaggcgcaa acaacgccct tgatagcaaa gagctcatga acgccgacca    164460
     actctatctc actcatagct tccgctttgg ccccaacgtt tcgctggtgg caaacgccct    164520
     tcttgaactc aaaggtgaaa cacgacctgt tgttggccgg ggaccagcag atcaggtact    164580
     catgttttta ccaggtgacg tgggccaccg cgcaatactt caccgaaccg tcatgggggt    164640
     tatagagacg gcgctctctg cgaccgaatc cggagcgcag gtattctggg tcggtggaat    164700
     cgacgcttac cagatcaatg agctccagga tttgtactgg ttttcgatgg cagagccaga    164760
     ccgggtaaag aataagaaac tgcttgatga gtatgaagac tacttcgagt atcaagaagt    164820
     agcgaaggcg accaaagacc ctgagatgat gagggctgtc aagatcatca acagctacga    164880
     tgaaatccct gaacgactca ccactctacg acgcaataca gtcaaagaag agtttggggc    164940
     tgacattacg gtctcaacag ctcatcggtg caaagggttg gagtgggact ttgttcagct    165000
     ctatgacgac tttccggatg tcctggaccc agagctcgac ccaatggccc gtgacgatga    165060
     aataaacctg ctctacgttg catccaccag agcgatgcga atccttgcgt tgaacagcgc    165120
     tgtcgagatg gttatccgct acatcaccca aaaacgcatg gtcgagaagc agatgaagat    165180
     ggccgcagaa gcgacagaag ttgaagagga cacgaccaaa tagtttggtc aattctttca    165240
     catgtgaaag ttgacaaata aaacgctcta agcgccctaa atgggcgctt acacctgcct    165300
     aatttcacgc ctcccacctc taccatatcg agcatgggaa aatacgtgcg tgagactatg    165360
     aaaaaatcac ctttgaattt actgctcctt gcagcgctca cgctgggggc atcacaccag    165420
     gcttgggctc aagatggcac aagacctggt ttttatgagc gaaaggaaga gggttggttc    165480
     tggtacaagg aagagcccaa agaaccagag aaaaaacccg aaaagcccaa accaaagcct    165540
     gtggcagaag cgaagcctac acagcctaag cctgctgctc cgcttccgag cggcccagaa    165600
     atgttctcag cggaatggtt ccgggaaaac ttacccaagt acaaagacct tgcttggaac    165660
     aatcctaccg ttgaaaacgt caggacgttt ctctacttgc aacgatttgc gatagatcgc    165720
     tctgaacaat tttccgatgc tacagagctg gcggtcgtag gtgatccttt cttggatgaa    165780
     attactcgac gtcctgctgc cacgtttgcc tcacaacaag ttgatcgtga cgctggtaac    165840
     gccaaaaaca tgctactcaa aagcgtagcc gaacgcgtag ggatattctt cttctacaag    165900
     tccgacgatg actacagtga cttgcaagca ccgctcatca agatgttgga acaaggagaa    165960
     ggattctcga tcattcctgt atctatggac ggcaaaccac tccccagtgg gcttttcccc    166020
     cattacaaaa ccgatgaagg ccatgccaaa caacttggta tcgtaacttt ccctgctgtt    166080
     tacctcgcat ctccagacgg tcagttcgct cctataggac aagggccaat gtctcttcct    166140
     gagctgaatc acaggatttt ggtcgcagca aaacgcaatg gttgggtcac agacgaagag    166200
     tttaaccgta cacgtccggt actcaacctg gaaaacaaca tagccgaacg cttggcctca    166260
     ccagagctgg gctctgacct caaacagcta tctcaagcga gcggtgataa agacaacttt    166320
     gtgccaccgg aacaactcat gaagtacatc cgggacaaat tacaggagaa ctaagatggt    166380
     cacgcacaag acattaaaaa ggagcctgct tgccctgagt gtggcggcca gtctcgtcat    166440
     ggcaccgaca ggggcgatag ccgctaacgg cctccaatca cagatggaca aactcttcaa    166500
     tgaaatgagc aacacaacac cacctggggt ttatgaaagc caacgacgtg gcgttttagc    166560
     tggtggccgg ttcactgcaa agacacgaat cttcgacgag aacctggtga gctttgcccc    166620
     tccatcatgg aaagctggtt gcggtggtgt agatctgttc ggcggttcgc tttccttcat    166680
     taacgcggat caaattgtcc aactccttcg ggctgtagca gccaacgcca agggctatgc    166740
     cttccagctt gcgctcgata acgttttccc ggacggagcg aagtggatag agaacttcca    166800
     gaagaaagtg caagcgctca accaacatct gggcaactcc tgccagctcg ctcaaggttt    166860
     cgtgaacgac ctaaccagcg gcatggacct taaacacaaa actgatgctt ctataaccgc    166920
     gacaacttcc ggcctgtatg aagacttctt cgggtccaag caggaaacca gcggcaagag    166980
     tcctctggaa gaactgaaag ccaacaaacc tgacgaatac aacaagatga ttggcaacat    167040
     cgtctggaag caactcaaga gcaacaacgc caacacctgg ttccagtacg gggataacac    167100
     ccttcttgaa gcgatcatgt ctttaaccgg cacagtcatc attggtgatc tggtaaacga    167160
     cccgaactca accggcactg gtgcgaaaac aacccctctg acgaccctac caggtaacaa    167220
     gatcaccttg tcagacctga tttcaggcgg ttctgttgag atctattcct gtgattctga    167280
     tacgaccaac tgcctgagtg ctggctccag caataaaact gtcgtgctca aaggtatcaa    167340
     gaaccagatc accgatatgc tgttaggaac aagctctaca cctggtgtga tctacaaata    167400
     cgcaacgaac tctggaacct taaccgaccc agaaaaggcc tttgtttcta acctccccgg    167460
     agggattggc accattgttc gtaacttgtc tgtcctttca caggacggcg ctaacctgtt    167520
     cgcaacagag tcatcaggag cgatagccct gaccatgatg tatagcttct cggaagagtt    167580
     cttccgcgca gctcgcattg cgatggctaa cagcaaatca ccctacaaga aagaggcact    167640
     agagcttctc gcgcaatcgc aacagcaaat ccgtgctgaa tacacaatcc tgtcctctca    167700
     atacggcgat ctggcaagcc aaattgagaa atacaacaac ctactggaca acatccgcaa    167760
     gcaaaaatac atgctggcaa ctttgtccaa tcctcctagc acgaactaag gagctattgg    167820
     aatgggatct ttttcaatcc actctatcgg tgactctgct tttctggagc aaatcctgat    167880
     tgcagtatca atgatcaccg gcaccgggga tttcgagaag atggtcagta ttggcctgct    167940
     tcttggggtc ttgatgatct gtattcagtc cgtctttcag ggcgcaaagc aaatcaacct    168000
     ccagcaagtg ctggtaggtt ggattctata tgcctgtttc ttcggcccaa ccacaactgt    168060
     gactatcgag gacgcttata cagggcaggt tcgagtcgtc gccaatgtcc ctattggggt    168120
     aggctttgct ggaggtgtca tatccaacgt gggatacacc atcaccaatt tgtttgaaac    168180
     tggatatggg gtaatcgtac ccaatgtcac ggaaagccac ttttccgaaa cactgaaact    168240
     gttgaatgac gtcagacggc gagcctatga cacaggagtt tttactgcgc ttaactcagc    168300
     aaatggaggc ggctatgttg acgtgaggcg ttcctggaac aattacattc gggaatgcac    168360
     gttaaccaaa gtcgatctca acctaatgtc ccttgatgag ttgatgaacc gttcaactga    168420
     ctcagctttg cgattcaact cacagctcta cggaactagg ttgtatttgt ctacagcaaa    168480
     ccctgacggc gctgactaca catgtactga cggatgggtg gctattagca ctgcaaccgc    168540
     caacctaagc agcccggttg ttgttgatgc tcttaacagc ctactgggta ttgacacgtc    168600
     aactggagac aacgctctaa cgaagctgac cgattcgctt caagcgatgg gtgccacaac    168660
     tacgtcatca atcgactatc tgaaagccgc cgttctggag cccctctatt atgaagccgc    168720
     agcaggacgt tatcaggacc tccaggatta tggctctgca ttgatggtca accaggctat    168780
     tcagcaacgg aacacacagt gggccgcaga gcagtcgatg ttcatgaccg tcgtccgacc    168840
     aatgctgacg ttctttgaag gctttattta tgctataacc ccgatcattg cttttattat    168900
     cgtgatgggc agcttcggcc tccagttagc cgggaaatat gtacaaacca tcctctggat    168960
     tcagctatgg atgccagtcc tctcaattat aaacctgttt gttcataccg ccgcgtcaaa    169020
     tgagatgtct agcctcagtg ctggtggtct caactccatg tacgctcttt cctcaactgg    169080
     agatgttctg caacactgga ttgcaaccgg cggcatgttg gctgcggcca ctccggtgat    169140
     ttccctgttt atcgtcacag gtagcaccta cgccttcacc agcttggcat cgagaataag    169200
     tggttctgac cacgttgacg aaaagatgca aacgccagat ctactcaagc aaggtccggt    169260
     tatgcaaagt cagccagcgt acaatcacaa ccagttcagt ggtgcgattg caaacggcgc    169320
     agaaagcatg atcagtacct tctcgcttgg ctccaccttg gcatcaggcg tgagctccgc    169380
     acaggcatta caaagtcaga aatcggaggc tttccaaagc actcttggtc gaggtttttc    169440
     tgatggagta agtcaggatc aagcctattc aagactctcc aatgtcgggc gcaacgtttc    169500
     gtcgcaaaac acagctcaaa gccaattgat caaccagcaa gccaagaact tcatggataa    169560
     gttccaggtg gatgatagcc actctgatgc tgtcaaaggt gcttttgcca tgcaggctat    169620
     gggcacactc gatgttgacg aagctgcgtc catgcttatg cctatggttg gcaaggccag    169680
     ggcagcaatg aaggccgctg ctggtgtgaa atcaaacagt acagccctag ttcctgctgg    169740
     tggtaatggc gaatcaggcg gcggcagtga tgtcctggac atcaaagcgc aagcgaaggg    169800
     agcaacagag tcatcaactc aagactcttc aagctggtca gcgagtgatg tgtcccagtt    169860
     catgaagggt gtgagctatt cgcaaaccga tagccaggcg ttgacaaatc aattagcgca    169920
     gggtttcagc cgttctggaa gcgagtcatt caagcaaacc tggggcgata gcttatccca    169980
     gaacctatcc aagtccgctt ctgaactggt gtctgcatcg gacaccttca caacaatgag    170040
     tcagctccaa aaccaaatgg gctccatgac taataccgac tttaaaactc tcggtggtgc    170100
     agtagcacaa acccctgcgg ccatgaacca actgaatgac tatttccgaa atgccgcgcc    170160
     gcaatcggtt aaagacgagg cggcttcact acagcaaaga taccaagcct acggaatgtc    170220
     tcctcaagtg gcccaggcag cagcgcgaat gacagcaatg accaactcca aaaattacga    170280
     acagggtaag gagcttggcg ggtatcaagc cgcactacag gcgatcaata ccgcgtccgg    170340
     tcgcaacgga gcatttagtg gtgatgctta cggaaataac ggcattgaag gcccgaatgt    170400
     tcaaggccta ccaggtcagg ttcaaggggc tgtaggcagt ggacctaaca tcccaaccgg    170460
     attccgggag aatgtggctg ggatggctgg aactaatccg gcatcagaag ctgggcagtt    170520
     accaacgaat agcccccttg ttcaaaatga acatgcagcc ggtacgtcag ctcttcataa    170580
     ccaagcacag caaacagagc gaaatgtatc tgctcctgaa ctgaaaaaag cccaagataa    170640
     ccttatgaac tcgcttccgg aaatgtcttg gagcgcttcg gcgtggggag cgtgggacaa    170700
     ctccagtgat tggatgggcc gcagagctga acaagcaggt ggagctctca ttgctggtgg    170760
     tcaagctggc gctgatgcgt tctcaagagc gatggatcaa atgagaacga tgacacctga    170820
     acaacgcgac caattcatcg cggccactca acgcggcgac caggccgtgc aagaggagtt    170880
     tggctgggcc ggtgatgcga tggtcggtat ggctaaactt ggccgcaacg tcatgggagc    170940
     tgctgcaagc ggctatgatg cagcgaagga gtggttaact ggtaaatctg atctatcgga    171000
     agccgctaaa gggatgagca ttgaggaacg cggcgcgttc tatgcagcag cgctatcctc    171060
     tgccgcagaa gctggtggtg gagccgcgca gcagtttatg aaccagtacg gtgatgagtt    171120
     caaagaaacg atgcagtcta tcgctcaaag ccgttatggg ctgactgaat cccaagccgc    171180
     tgtttatgcc gaatcgtttg acacaaacga aggtcgcatg aaccaggctg ttcagaatct    171240
     gaaaatggag tatgcagaac gtaacccgga tggctcaccg atgatgcaag gaggtcagcc    171300
     tgttctttct cagcaaaacg aagagtttac ggacaagctg gtaaacgtat tgcagaactc    171360
     gacggaagct ggagaccgtt caggtagcta tttgactgcc gtcagggggt acaacatagc    171420
     aaatcaaagg ttctaaaaga ccaaccaaat aataaggggg ccagcaggcc cccttattcg    171480
     tctccagctc caatatggaa gcgctggtca aaatcatagg aatcttgaaa cccaccagtt    171540
     tgtttttttc tgcgccgggt aggtggtgcc tctttatatg ctgaccgcgc aacgcggata    171600
     aagcacgtta gtccaaacag agccccgaca accaaagcaa cttgccactg gaagtaagcg    171660
     atccctcccc aaaagataac agcagcccaa aggcttttgt gaaccagaaa taggaaacga    171720
     gcaccccaaa cgccgaaggg agccagcgcc acaccaagtc cccaaggtgt gtcagccatc    171780
     atggctattc ccagaagcac cattcccagc agaagaatat tgaccacatg tttcatatca    171840
     acccccttac tctttacctc cagtttacca cggcatcaaa aaatgcaact gtgaaagttt    171900
     gactattttt tgctaaacaa ccattccatt ggcaacttct tcgattagaa tttgccctca    171960
     aactttcaca tgtgaaagtt tgcccttacg gaacaaggcg tttattgaca aagcattaca    172020
     tagttgaaca tgtcaaacaa atcgcataca ctatggaata ggccattgct aacgctttgg    172080
     tccccatctg caacaccgca gagttctctt tctcaaatat ctctttctgt aaacaccatc    172140
     atccttgtgt ggtcgggatg cgcctttgcc ttccctgccc tcctcagctc ctgctgtatt    172200
     cgcaatttca gccctcgctg tatccctaaa atcacttata cctaaacgct atttaatatc    172260
     acaaaatacc gcactccccg tgcgctattt ccgccattct tttggcgcac tttccattac    172320
     tatcgcaaaa atatccgtat cccattgatt actaaaagta ttgtaacttt gttccgtcgg    172380
     tacaaagtta agtgtatgtt tttaaaggtt ttttattgtt gacagcatca ttatttgggc    172440
     ttgtaaaggc gcaaaatgtg tcagtttgtg acaatagaag aactctaaaa gcgttcatcg    172500
     aataacgcac tttttgtatg gctaacaacg cagtttaaag ggtggcaaac aatggataaa    172560
     tgccaattga tagacatccc aagcgaccca gagaagaaac gtgagtggat caagtacaaa    172620
     ctcaagatcc aggggctttc tctggccgca ttgggcagaa aacacaaaac atctcggcag    172680
     gtggtgtcta cggcactcta taagcccagt ccacgctggg aacatgagat agctacagct    172740
     ttgggtgtga agccgtctga gatttggccg gagcggtacg acgaagaaca cgaaataccc    172800
     ctcagacata aggaggcaag ctgatgaaga acaaagccaa ggcgctagtt ctgtctgcgg    172860
     ctctcctttc atcaacagcg aatgctattg acctgagcgg aaccatcttc gacaaagcag    172920
     cgaaagcata taacctcgac cctcttctag tgtattcggt cgcattggcc gaatctgcat    172980
     cagggagagg taatggctct ataagtcctt ggccttggac gcttcgcgtt cctgggcttc    173040
     ctttctatgc taagtcggaa gatcaggcaa aggctaagct cgctgagttt cagcagcagt    173100
     acggtcgtgc cattgatgtc gggtttatgc aagtgagcat ccggtggaat ggtcatagag    173160
     tttcttctcc agcagatctt ctcgacccag agaccaacgt catggttggg gcagaggtgc    173220
     tatcagaagc cattcagtca tctccaaatg acttggagct tggcgttggc cgctatcacg    173280
     cctgggaaga cgaaatccga gccagaaact atggtagccg agtcttggct atctatcgca    173340
     accttcgtga tttgtgaggg gggcggaatg ttggaactgg atattattgg tgcgtgggat    173400
     gcaagagccg tcaacctcga tcaagaagaa gctgatagaa acgtctacga gttcgatctg    173460
     acattgtgga acctgctatc cactctggca aaagaacgtc cagatgatgc ggcctcacaa    173520
     ttttctttgg gcatggacac cgttcaaaag ctgtcactgg caacaccttc ccaattggaa    173580
     gctctggcct ctggcgtgtt gatctctttc aaactcgaaa cagcagagca gaacatcatc    173640
     acgcgactct ctggcgacta cgaccctgta gtttttatca accatagtgt tgatgaattt    173700
     gatgctgcct actggttgct atttaaccgc gtcgcatcga gagacccgga gatggcaaag    173760
     gaagttttcg gggtttcgag agagcttgcg gagctggtgg ctaaggcaac agacagccag    173820
     ttgcgccaca tgtctggaac aacggttacg cattttacgc ttcgttttgc tccgagcatc    173880
     attgaagaaa ttctcgatga cagccgggaa gagttaacac acccggtatt gaaaaaactg    173940
     caacagtctc tacagggacg tgggaggtgg agatgaacat tggcaactct ggtacattgg    174000
     gtcgctgggt tacagctcga cacatggccc ttgctgggta catcacaaaa atcatcatga    174060
     tcgagactgg tctgacctac aaacaggtca gacggcttta ccaggatctg gagagggacg    174120
     gatatactct ggaacgaaaa tccagaactt tccggggtgg tgcgacactg attcatagtc    174180
     acacatccaa gatacaggcc tctcttctaa tgcagctcta cttcaacatt ggtgggaagc    174240
     cgtgttgcgg tctgtgaaca tcaaagcctt gaacaaggca tttagaatgt atcacgcaat    174300
     ccgcaaagaa gtgcccggaa tgaaaggtgc tcggtgggct ccgtttgata ttactgatgc    174360
     ctggtgtctt gcttcggagc tgagaagtgg ggacgcaatg ctggaggtgt gcgacaactg    174420
     caagtgtacg tacttcacct ctgttaatca aagaacctgc gttgaatgtc cgttctgcaa    174480
     agaacaagga aggcatggtg gtggggagaa agagtgtgct tgagtagact atgacatttc    174540
     ggaccagaag atgagcgccc aaactttgcg gcgctcattt ttttacttct tctgtgggat    174600
     acggtagcgc tccagctcga cagctcccaa ccccttgaaa gcatccgggc gacgtccttg    174660
     cccactccac gaaactccgt cttttgaata tttagcatta tcaggttctg atctgctcgt    174720
     gaacatttcg ttgagcaagc cgatgtccac accgcaggat tccatgtcgc tcattattcg    174780
     ctcagcctga gctcgctttt ctttttcttc ttcttctcgc tttttgtact cttcctccag    174840
     ttcattgaga acgcccttca ttctgtcaat gatctcccga acttcatcta acgggagtcc    174900
     tcgcaacagg gtgcgaatgc ggcttttacg ctttaactct gcgattatta actctctacg    174960
     ttcagccgct gatagcgtag agaactcctc gtggtctttc atgtcatacg gagcccatca    175020
     gttttccttt aagtgaatca cgttgagagt tcagttttgc gtcagtctgc actggcgaat    175080
     tttgatgctg tgcaggttga ctctctgaac tctgttgctc aaaagaccca atgttgccag    175140
     aaaatcgaag agaataaaga cccaatagag caagggcgcg gagccgatca ctacgcgcct    175200
     tatgctgcat ctgggacagt tcacgataga gctccggaaa ggcttgctcc gatatgttca    175260
     gattagatat ttttccatcc catttgctac cagccacaac gacctcctat ctatcagccg    175320
     cagaaccaga agcccctggc attggatgcc acggattcgt tgggcagtac gatcctgctc    175380
     ttagggaaaa gctccttggc cgcatcttgg taagcctcgg caccgccgcc agccagcaga    175440
     actacgtcag catccatccc gtcctcacgc attgacttcc gcatagggat caaggcgttt    175500
     tgagcgactt tggttgaggc tttcttgaag tagtctttga tcgatacctt ttcaccgtag    175560
     aggaagattt cggccttacc ggcacgaata gctttctcga tcttttcgat gccaggggca    175620
     ccgccgtggt cttcctgaat tagccggtcc gtttcctgta gcaacaccga catcgccttg    175680
     aggctggtgc cagatgagtg atagcggacc tctccctctt caagagctac ccagtctaca    175740
     gaaaagaacc cagggtcaat tacaacggtt tttcctccct ggataatctc caggaggtct    175800
     tcatctttgg ttgaacttac aacatccatg taagcaccgg caggttgagg tacaaccacg    175860
     acagacttaa ccgctaccga tcgttttggc gtgatctggt gttcaccctc aagccgagat    175920
     ttcaacgcct ctctgcgctc tacgtccatg tactgactaa caggcaggcc agtcaccagc    175980
     acatcgatct ccttctgctc ggacatcagg agtgcagcgt agaaaagagc cttgtatgga    176040
     ttggtcgaag gatagtcacc gtgaagctca cgctcccatc cttgcaatcg gtcaggctcg    176100
     acgcctgcaa cccatttctc tccatcaatc acaacctgaa tgcaggtccc tgcaccgcca    176160
     gttaactgtt gtggcatcag ttccaatgga cctgccccca ccggcatgac gactgtgcga    176220
     gcttcctcac ctttataccc cattgccatt ttcaggttgg agtaaccaat atccaaaccc    176280
     agaacaaatt gactcatgaa atcctccaaa gattgctttt agattgcttt tcgattgctt    176340
     gccgcgtgtt ggatagagaa taaggctaaa agcggggaca gatggcctgt gtaattgccc    176400
     aaaaggggca tataggttgc ttttcggtgg ctttttgatc gttgagtaag ggaacctatg    176460
     ggaacgctgc acg                                                       176473
//

If you have problems or comments...

PBIL Back to PBIL home page