(data stored in ACNUC7421 zone)

EMBL: CP000606

ID   CP000606; SV 1; circular; genomic DNA; STD; PRO; 4602594 BP.
XX
AC   CP000606; AALS01000000-AALS01000102;
XX
PR   Project:PRJNA13906;
XX
DT   11-MAR-2007 (Rel. 91, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 5)
XX
DE   Shewanella loihica PV-4 chromosome, complete genome.
XX
KW   .
XX
OS   Shewanella loihica PV-4
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-4602594
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Romine M.F., Serres G.,
RA   Fredrickson J., Tiedje J., Richardson P.;
RT   "Complete sequence of Shewanella loihica PV-4";
RL   Unpublished.
XX
RN   [2]
RP   1-4602594
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Romine M.F., Serres G.,
RA   Fredrickson J., Tiedje J., Richardson P.;
RT   ;
RL   Submitted (05-MAR-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 84f5dce45e9685a00223351436c8aa38.
DR   BioSample; SAMN00623064.
DR   EnsemblGenomes-Gn; EBG00001276098.
DR   EnsemblGenomes-Gn; EBG00001276099.
DR   EnsemblGenomes-Gn; EBG00001276100.
DR   EnsemblGenomes-Gn; EBG00001276101.
DR   EnsemblGenomes-Gn; EBG00001276102.
DR   EnsemblGenomes-Gn; EBG00001276103.
DR   EnsemblGenomes-Gn; EBG00001276104.
DR   EnsemblGenomes-Gn; EBG00001276105.
DR   EnsemblGenomes-Gn; EBG00001276106.
DR   EnsemblGenomes-Gn; EBG00001276107.
DR   EnsemblGenomes-Gn; EBG00001276108.
DR   EnsemblGenomes-Gn; EBG00001276109.
DR   EnsemblGenomes-Gn; EBG00001276110.
DR   EnsemblGenomes-Gn; EBG00001276111.
DR   EnsemblGenomes-Gn; EBG00001276112.
DR   EnsemblGenomes-Gn; EBG00001276113.
DR   EnsemblGenomes-Gn; EBG00001276114.
DR   EnsemblGenomes-Gn; EBG00001276115.
DR   EnsemblGenomes-Gn; EBG00001276116.
DR   EnsemblGenomes-Gn; EBG00001276117.
DR   EnsemblGenomes-Gn; EBG00001276118.
DR   EnsemblGenomes-Gn; EBG00001276119.
DR   EnsemblGenomes-Gn; EBG00001276120.
DR   EnsemblGenomes-Gn; EBG00001276121.
DR   EnsemblGenomes-Gn; EBG00001276122.
DR   EnsemblGenomes-Gn; EBG00001276123.
DR   EnsemblGenomes-Gn; EBG00001276124.
DR   EnsemblGenomes-Gn; EBG00001276125.
DR   EnsemblGenomes-Gn; EBG00001276126.
DR   EnsemblGenomes-Gn; EBG00001276127.
DR   EnsemblGenomes-Gn; EBG00001276128.
DR   EnsemblGenomes-Gn; EBG00001276129.
DR   EnsemblGenomes-Gn; EBG00001276130.
DR   EnsemblGenomes-Gn; EBG00001276131.
DR   EnsemblGenomes-Gn; EBG00001276132.
DR   EnsemblGenomes-Gn; EBG00001276133.
DR   EnsemblGenomes-Gn; EBG00001276134.
DR   EnsemblGenomes-Gn; EBG00001276135.
DR   EnsemblGenomes-Gn; EBG00001276136.
DR   EnsemblGenomes-Gn; EBG00001276137.
DR   EnsemblGenomes-Gn; EBG00001276138.
DR   EnsemblGenomes-Gn; EBG00001276139.
DR   EnsemblGenomes-Gn; EBG00001276140.
DR   EnsemblGenomes-Gn; EBG00001276141.
DR   EnsemblGenomes-Gn; EBG00001276142.
DR   EnsemblGenomes-Gn; EBG00001276143.
DR   EnsemblGenomes-Gn; EBG00001276144.
DR   EnsemblGenomes-Gn; EBG00001276145.
DR   EnsemblGenomes-Gn; EBG00001276146.
DR   EnsemblGenomes-Gn; EBG00001276147.
DR   EnsemblGenomes-Gn; EBG00001276148.
DR   EnsemblGenomes-Gn; EBG00001276149.
DR   EnsemblGenomes-Gn; EBG00001276150.
DR   EnsemblGenomes-Gn; EBG00001276151.
DR   EnsemblGenomes-Gn; EBG00001276152.
DR   EnsemblGenomes-Gn; EBG00001276153.
DR   EnsemblGenomes-Gn; EBG00001276154.
DR   EnsemblGenomes-Gn; EBG00001276155.
DR   EnsemblGenomes-Gn; EBG00001276156.
DR   EnsemblGenomes-Gn; EBG00001276157.
DR   EnsemblGenomes-Gn; EBG00001276158.
DR   EnsemblGenomes-Gn; EBG00001276159.
DR   EnsemblGenomes-Gn; EBG00001276160.
DR   EnsemblGenomes-Gn; EBG00001276161.
DR   EnsemblGenomes-Gn; EBG00001276162.
DR   EnsemblGenomes-Gn; EBG00001276163.
DR   EnsemblGenomes-Gn; EBG00001276164.
DR   EnsemblGenomes-Gn; EBG00001276165.
DR   EnsemblGenomes-Gn; EBG00001276166.
DR   EnsemblGenomes-Gn; EBG00001276167.
DR   EnsemblGenomes-Gn; EBG00001276168.
DR   EnsemblGenomes-Gn; EBG00001276169.
DR   EnsemblGenomes-Gn; EBG00001276170.
DR   EnsemblGenomes-Gn; EBG00001276171.
DR   EnsemblGenomes-Gn; EBG00001276172.
DR   EnsemblGenomes-Gn; EBG00001276173.
DR   EnsemblGenomes-Gn; EBG00001276174.
DR   EnsemblGenomes-Gn; EBG00001276175.
DR   EnsemblGenomes-Gn; EBG00001276176.
DR   EnsemblGenomes-Gn; EBG00001276177.
DR   EnsemblGenomes-Gn; EBG00001276178.
DR   EnsemblGenomes-Gn; EBG00001276179.
DR   EnsemblGenomes-Gn; EBG00001276180.
DR   EnsemblGenomes-Gn; EBG00001276181.
DR   EnsemblGenomes-Gn; EBG00001276182.
DR   EnsemblGenomes-Gn; EBG00001276183.
DR   EnsemblGenomes-Gn; EBG00001276184.
DR   EnsemblGenomes-Gn; EBG00001276185.
DR   EnsemblGenomes-Gn; EBG00001276186.
DR   EnsemblGenomes-Gn; EBG00001276187.
DR   EnsemblGenomes-Gn; EBG00001276188.
DR   EnsemblGenomes-Gn; EBG00001276189.
DR   EnsemblGenomes-Gn; EBG00001276190.
DR   EnsemblGenomes-Gn; EBG00001276191.
DR   EnsemblGenomes-Gn; EBG00001276192.
DR   EnsemblGenomes-Gn; EBG00001276193.
DR   EnsemblGenomes-Gn; EBG00001276194.
DR   EnsemblGenomes-Gn; EBG00001276195.
DR   EnsemblGenomes-Gn; EBG00001276196.
DR   EnsemblGenomes-Gn; EBG00001276197.
DR   EnsemblGenomes-Gn; EBG00001276198.
DR   EnsemblGenomes-Gn; EBG00001276199.
DR   EnsemblGenomes-Gn; EBG00001276200.
DR   EnsemblGenomes-Gn; EBG00001276201.
DR   EnsemblGenomes-Gn; EBG00001276202.
DR   EnsemblGenomes-Gn; EBG00001276203.
DR   EnsemblGenomes-Gn; EBG00001276204.
DR   EnsemblGenomes-Gn; EBG00001276205.
DR   EnsemblGenomes-Gn; EBG00001276206.
DR   EnsemblGenomes-Gn; EBG00001276207.
DR   EnsemblGenomes-Gn; EBG00001276208.
DR   EnsemblGenomes-Gn; EBG00001276209.
DR   EnsemblGenomes-Gn; EBG00001276210.
DR   EnsemblGenomes-Gn; EBG00001276211.
DR   EnsemblGenomes-Gn; EBG00001276212.
DR   EnsemblGenomes-Gn; EBG00001276213.
DR   EnsemblGenomes-Gn; EBG00001276214.
DR   EnsemblGenomes-Gn; EBG00001276215.
DR   EnsemblGenomes-Gn; EBG00001276216.
DR   EnsemblGenomes-Gn; EBG00001276217.
DR   EnsemblGenomes-Gn; EBG00001276218.
DR   EnsemblGenomes-Gn; EBG00001276219.
DR   EnsemblGenomes-Gn; EBG00001276220.
DR   EnsemblGenomes-Gn; EBG00001276221.
DR   EnsemblGenomes-Gn; EBG00001276222.
DR   EnsemblGenomes-Gn; EBG00001276223.
DR   EnsemblGenomes-Gn; EBG00001276224.
DR   EnsemblGenomes-Gn; EBG00001276225.
DR   EnsemblGenomes-Gn; EBG00001276226.
DR   EnsemblGenomes-Gn; EBG00001276227.
DR   EnsemblGenomes-Gn; EBG00001276228.
DR   EnsemblGenomes-Gn; EBG00001276229.
DR   EnsemblGenomes-Gn; EBG00001276230.
DR   EnsemblGenomes-Gn; EBG00001276231.
DR   EnsemblGenomes-Gn; EBG00001276232.
DR   EnsemblGenomes-Gn; EBG00001276233.
DR   EnsemblGenomes-Gn; EBG00001276234.
DR   EnsemblGenomes-Gn; EBG00001276235.
DR   EnsemblGenomes-Gn; EBG00001276236.
DR   EnsemblGenomes-Gn; EBG00001276237.
DR   EnsemblGenomes-Gn; EBG00001276238.
DR   EnsemblGenomes-Gn; EBG00001276239.
DR   EnsemblGenomes-Gn; EBG00001276240.
DR   EnsemblGenomes-Gn; EBG00001276241.
DR   EnsemblGenomes-Gn; EBG00001276242.
DR   EnsemblGenomes-Gn; Shew_R0001.
DR   EnsemblGenomes-Gn; Shew_R0002.
DR   EnsemblGenomes-Gn; Shew_R0003.
DR   EnsemblGenomes-Gn; Shew_R0004.
DR   EnsemblGenomes-Gn; Shew_R0005.
DR   EnsemblGenomes-Gn; Shew_R0006.
DR   EnsemblGenomes-Gn; Shew_R0007.
DR   EnsemblGenomes-Gn; Shew_R0008.
DR   EnsemblGenomes-Gn; Shew_R0009.
DR   EnsemblGenomes-Gn; Shew_R0010.
DR   EnsemblGenomes-Gn; Shew_R0011.
DR   EnsemblGenomes-Gn; Shew_R0012.
DR   EnsemblGenomes-Gn; Shew_R0014.
DR   EnsemblGenomes-Gn; Shew_R0015.
DR   EnsemblGenomes-Gn; Shew_R0016.
DR   EnsemblGenomes-Gn; Shew_R0017.
DR   EnsemblGenomes-Gn; Shew_R0018.
DR   EnsemblGenomes-Gn; Shew_R0019.
DR   EnsemblGenomes-Gn; Shew_R0020.
DR   EnsemblGenomes-Gn; Shew_R0021.
DR   EnsemblGenomes-Gn; Shew_R0022.
DR   EnsemblGenomes-Gn; Shew_R0023.
DR   EnsemblGenomes-Gn; Shew_R0024.
DR   EnsemblGenomes-Gn; Shew_R0025.
DR   EnsemblGenomes-Gn; Shew_R0026.
DR   EnsemblGenomes-Gn; Shew_R0027.
DR   EnsemblGenomes-Gn; Shew_R0028.
DR   EnsemblGenomes-Gn; Shew_R0029.
DR   EnsemblGenomes-Gn; Shew_R0030.
DR   EnsemblGenomes-Gn; Shew_R0031.
DR   EnsemblGenomes-Gn; Shew_R0032.
DR   EnsemblGenomes-Gn; Shew_R0033.
DR   EnsemblGenomes-Gn; Shew_R0034.
DR   EnsemblGenomes-Gn; Shew_R0035.
DR   EnsemblGenomes-Gn; Shew_R0036.
DR   EnsemblGenomes-Gn; Shew_R0037.
DR   EnsemblGenomes-Gn; Shew_R0038.
DR   EnsemblGenomes-Gn; Shew_R0039.
DR   EnsemblGenomes-Gn; Shew_R0040.
DR   EnsemblGenomes-Gn; Shew_R0041.
DR   EnsemblGenomes-Gn; Shew_R0042.
DR   EnsemblGenomes-Gn; Shew_R0043.
DR   EnsemblGenomes-Gn; Shew_R0044.
DR   EnsemblGenomes-Gn; Shew_R0045.
DR   EnsemblGenomes-Gn; Shew_R0046.
DR   EnsemblGenomes-Gn; Shew_R0047.
DR   EnsemblGenomes-Gn; Shew_R0048.
DR   EnsemblGenomes-Gn; Shew_R0049.
DR   EnsemblGenomes-Gn; Shew_R0050.
DR   EnsemblGenomes-Gn; Shew_R0051.
DR   EnsemblGenomes-Gn; Shew_R0052.
DR   EnsemblGenomes-Gn; Shew_R0053.
DR   EnsemblGenomes-Gn; Shew_R0054.
DR   EnsemblGenomes-Gn; Shew_R0055.
DR   EnsemblGenomes-Gn; Shew_R0056.
DR   EnsemblGenomes-Gn; Shew_R0057.
DR   EnsemblGenomes-Gn; Shew_R0058.
DR   EnsemblGenomes-Gn; Shew_R0059.
DR   EnsemblGenomes-Gn; Shew_R0060.
DR   EnsemblGenomes-Gn; Shew_R0061.
DR   EnsemblGenomes-Gn; Shew_R0062.
DR   EnsemblGenomes-Gn; Shew_R0063.
DR   EnsemblGenomes-Gn; Shew_R0064.
DR   EnsemblGenomes-Gn; Shew_R0065.
DR   EnsemblGenomes-Gn; Shew_R0066.
DR   EnsemblGenomes-Gn; Shew_R0067.
DR   EnsemblGenomes-Gn; Shew_R0068.
DR   EnsemblGenomes-Gn; Shew_R0069.
DR   EnsemblGenomes-Gn; Shew_R0070.
DR   EnsemblGenomes-Gn; Shew_R0071.
DR   EnsemblGenomes-Gn; Shew_R0072.
DR   EnsemblGenomes-Gn; Shew_R0073.
DR   EnsemblGenomes-Gn; Shew_R0074.
DR   EnsemblGenomes-Gn; Shew_R0075.
DR   EnsemblGenomes-Gn; Shew_R0076.
DR   EnsemblGenomes-Gn; Shew_R0077.
DR   EnsemblGenomes-Gn; Shew_R0078.
DR   EnsemblGenomes-Gn; Shew_R0079.
DR   EnsemblGenomes-Gn; Shew_R0080.
DR   EnsemblGenomes-Gn; Shew_R0081.
DR   EnsemblGenomes-Gn; Shew_R0082.
DR   EnsemblGenomes-Gn; Shew_R0083.
DR   EnsemblGenomes-Gn; Shew_R0084.
DR   EnsemblGenomes-Gn; Shew_R0085.
DR   EnsemblGenomes-Gn; Shew_R0087.
DR   EnsemblGenomes-Gn; Shew_R0088.
DR   EnsemblGenomes-Gn; Shew_R0089.
DR   EnsemblGenomes-Gn; Shew_R0091.
DR   EnsemblGenomes-Gn; Shew_R0092.
DR   EnsemblGenomes-Gn; Shew_R0093.
DR   EnsemblGenomes-Gn; Shew_R0094.
DR   EnsemblGenomes-Gn; Shew_R0095.
DR   EnsemblGenomes-Gn; Shew_R0096.
DR   EnsemblGenomes-Gn; Shew_R0097.
DR   EnsemblGenomes-Gn; Shew_R0098.
DR   EnsemblGenomes-Gn; Shew_R0099.
DR   EnsemblGenomes-Gn; Shew_R0100.
DR   EnsemblGenomes-Gn; Shew_R0101.
DR   EnsemblGenomes-Gn; Shew_R0102.
DR   EnsemblGenomes-Gn; Shew_R0103.
DR   EnsemblGenomes-Gn; Shew_R0104.
DR   EnsemblGenomes-Gn; Shew_R0105.
DR   EnsemblGenomes-Gn; Shew_R0107.
DR   EnsemblGenomes-Gn; Shew_R0108.
DR   EnsemblGenomes-Gn; Shew_R0109.
DR   EnsemblGenomes-Gn; Shew_R0110.
DR   EnsemblGenomes-Gn; Shew_R0111.
DR   EnsemblGenomes-Gn; Shew_R0112.
DR   EnsemblGenomes-Gn; Shew_R0113.
DR   EnsemblGenomes-Gn; Shew_R0114.
DR   EnsemblGenomes-Gn; Shew_R0115.
DR   EnsemblGenomes-Gn; Shew_R0116.
DR   EnsemblGenomes-Gn; Shew_R0117.
DR   EnsemblGenomes-Gn; Shew_R0118.
DR   EnsemblGenomes-Gn; Shew_R0119.
DR   EnsemblGenomes-Gn; Shew_R0120.
DR   EnsemblGenomes-Gn; Shew_R0121.
DR   EnsemblGenomes-Gn; Shew_R0122.
DR   EnsemblGenomes-Gn; Shew_R0123.
DR   EnsemblGenomes-Gn; Shew_R0124.
DR   EnsemblGenomes-Gn; Shew_R0125.
DR   EnsemblGenomes-Tr; EBT00001808545.
DR   EnsemblGenomes-Tr; EBT00001808546.
DR   EnsemblGenomes-Tr; EBT00001808547.
DR   EnsemblGenomes-Tr; EBT00001808548.
DR   EnsemblGenomes-Tr; EBT00001808549.
DR   EnsemblGenomes-Tr; EBT00001808550.
DR   EnsemblGenomes-Tr; EBT00001808551.
DR   EnsemblGenomes-Tr; EBT00001808552.
DR   EnsemblGenomes-Tr; EBT00001808553.
DR   EnsemblGenomes-Tr; EBT00001808554.
DR   EnsemblGenomes-Tr; EBT00001808555.
DR   EnsemblGenomes-Tr; EBT00001808556.
DR   EnsemblGenomes-Tr; EBT00001808557.
DR   EnsemblGenomes-Tr; EBT00001808558.
DR   EnsemblGenomes-Tr; EBT00001808559.
DR   EnsemblGenomes-Tr; EBT00001808560.
DR   EnsemblGenomes-Tr; EBT00001808561.
DR   EnsemblGenomes-Tr; EBT00001808562.
DR   EnsemblGenomes-Tr; EBT00001808563.
DR   EnsemblGenomes-Tr; EBT00001808564.
DR   EnsemblGenomes-Tr; EBT00001808565.
DR   EnsemblGenomes-Tr; EBT00001808566.
DR   EnsemblGenomes-Tr; EBT00001808567.
DR   EnsemblGenomes-Tr; EBT00001808568.
DR   EnsemblGenomes-Tr; EBT00001808569.
DR   EnsemblGenomes-Tr; EBT00001808570.
DR   EnsemblGenomes-Tr; EBT00001808571.
DR   EnsemblGenomes-Tr; EBT00001808572.
DR   EnsemblGenomes-Tr; EBT00001808573.
DR   EnsemblGenomes-Tr; EBT00001808574.
DR   EnsemblGenomes-Tr; EBT00001808575.
DR   EnsemblGenomes-Tr; EBT00001808576.
DR   EnsemblGenomes-Tr; EBT00001808577.
DR   EnsemblGenomes-Tr; EBT00001808578.
DR   EnsemblGenomes-Tr; EBT00001808579.
DR   EnsemblGenomes-Tr; EBT00001808580.
DR   EnsemblGenomes-Tr; EBT00001808581.
DR   EnsemblGenomes-Tr; EBT00001808582.
DR   EnsemblGenomes-Tr; EBT00001808583.
DR   EnsemblGenomes-Tr; EBT00001808584.
DR   EnsemblGenomes-Tr; EBT00001808585.
DR   EnsemblGenomes-Tr; EBT00001808586.
DR   EnsemblGenomes-Tr; EBT00001808587.
DR   EnsemblGenomes-Tr; EBT00001808588.
DR   EnsemblGenomes-Tr; EBT00001808589.
DR   EnsemblGenomes-Tr; EBT00001808590.
DR   EnsemblGenomes-Tr; EBT00001808591.
DR   EnsemblGenomes-Tr; EBT00001808592.
DR   EnsemblGenomes-Tr; EBT00001808593.
DR   EnsemblGenomes-Tr; EBT00001808594.
DR   EnsemblGenomes-Tr; EBT00001808595.
DR   EnsemblGenomes-Tr; EBT00001808596.
DR   EnsemblGenomes-Tr; EBT00001808597.
DR   EnsemblGenomes-Tr; EBT00001808598.
DR   EnsemblGenomes-Tr; EBT00001808599.
DR   EnsemblGenomes-Tr; EBT00001808600.
DR   EnsemblGenomes-Tr; EBT00001808601.
DR   EnsemblGenomes-Tr; EBT00001808602.
DR   EnsemblGenomes-Tr; EBT00001808603.
DR   EnsemblGenomes-Tr; EBT00001808604.
DR   EnsemblGenomes-Tr; EBT00001808605.
DR   EnsemblGenomes-Tr; EBT00001808606.
DR   EnsemblGenomes-Tr; EBT00001808607.
DR   EnsemblGenomes-Tr; EBT00001808608.
DR   EnsemblGenomes-Tr; EBT00001808609.
DR   EnsemblGenomes-Tr; EBT00001808610.
DR   EnsemblGenomes-Tr; EBT00001808611.
DR   EnsemblGenomes-Tr; EBT00001808612.
DR   EnsemblGenomes-Tr; EBT00001808613.
DR   EnsemblGenomes-Tr; EBT00001808614.
DR   EnsemblGenomes-Tr; EBT00001808615.
DR   EnsemblGenomes-Tr; EBT00001808616.
DR   EnsemblGenomes-Tr; EBT00001808617.
DR   EnsemblGenomes-Tr; EBT00001808618.
DR   EnsemblGenomes-Tr; EBT00001808619.
DR   EnsemblGenomes-Tr; EBT00001808620.
DR   EnsemblGenomes-Tr; EBT00001808621.
DR   EnsemblGenomes-Tr; EBT00001808622.
DR   EnsemblGenomes-Tr; EBT00001808623.
DR   EnsemblGenomes-Tr; EBT00001808624.
DR   EnsemblGenomes-Tr; EBT00001808625.
DR   EnsemblGenomes-Tr; EBT00001808626.
DR   EnsemblGenomes-Tr; EBT00001808627.
DR   EnsemblGenomes-Tr; EBT00001808628.
DR   EnsemblGenomes-Tr; EBT00001808629.
DR   EnsemblGenomes-Tr; EBT00001808630.
DR   EnsemblGenomes-Tr; EBT00001808631.
DR   EnsemblGenomes-Tr; EBT00001808632.
DR   EnsemblGenomes-Tr; EBT00001808633.
DR   EnsemblGenomes-Tr; EBT00001808634.
DR   EnsemblGenomes-Tr; EBT00001808635.
DR   EnsemblGenomes-Tr; EBT00001808636.
DR   EnsemblGenomes-Tr; EBT00001808637.
DR   EnsemblGenomes-Tr; EBT00001808638.
DR   EnsemblGenomes-Tr; EBT00001808639.
DR   EnsemblGenomes-Tr; EBT00001808640.
DR   EnsemblGenomes-Tr; EBT00001808641.
DR   EnsemblGenomes-Tr; EBT00001808642.
DR   EnsemblGenomes-Tr; EBT00001808643.
DR   EnsemblGenomes-Tr; EBT00001808644.
DR   EnsemblGenomes-Tr; EBT00001808645.
DR   EnsemblGenomes-Tr; EBT00001808646.
DR   EnsemblGenomes-Tr; EBT00001808647.
DR   EnsemblGenomes-Tr; EBT00001808648.
DR   EnsemblGenomes-Tr; EBT00001808649.
DR   EnsemblGenomes-Tr; EBT00001808650.
DR   EnsemblGenomes-Tr; EBT00001808651.
DR   EnsemblGenomes-Tr; EBT00001808652.
DR   EnsemblGenomes-Tr; EBT00001808653.
DR   EnsemblGenomes-Tr; EBT00001808654.
DR   EnsemblGenomes-Tr; EBT00001808655.
DR   EnsemblGenomes-Tr; EBT00001808656.
DR   EnsemblGenomes-Tr; EBT00001808657.
DR   EnsemblGenomes-Tr; EBT00001808658.
DR   EnsemblGenomes-Tr; EBT00001808659.
DR   EnsemblGenomes-Tr; EBT00001808660.
DR   EnsemblGenomes-Tr; EBT00001808661.
DR   EnsemblGenomes-Tr; EBT00001808662.
DR   EnsemblGenomes-Tr; EBT00001808663.
DR   EnsemblGenomes-Tr; EBT00001808664.
DR   EnsemblGenomes-Tr; EBT00001808665.
DR   EnsemblGenomes-Tr; EBT00001808666.
DR   EnsemblGenomes-Tr; EBT00001808667.
DR   EnsemblGenomes-Tr; EBT00001808668.
DR   EnsemblGenomes-Tr; EBT00001808669.
DR   EnsemblGenomes-Tr; EBT00001808670.
DR   EnsemblGenomes-Tr; EBT00001808671.
DR   EnsemblGenomes-Tr; EBT00001808672.
DR   EnsemblGenomes-Tr; EBT00001808673.
DR   EnsemblGenomes-Tr; EBT00001808674.
DR   EnsemblGenomes-Tr; EBT00001808675.
DR   EnsemblGenomes-Tr; EBT00001808676.
DR   EnsemblGenomes-Tr; EBT00001808677.
DR   EnsemblGenomes-Tr; EBT00001808678.
DR   EnsemblGenomes-Tr; EBT00001808679.
DR   EnsemblGenomes-Tr; EBT00001808680.
DR   EnsemblGenomes-Tr; EBT00001808681.
DR   EnsemblGenomes-Tr; EBT00001808682.
DR   EnsemblGenomes-Tr; EBT00001808683.
DR   EnsemblGenomes-Tr; EBT00001808684.
DR   EnsemblGenomes-Tr; EBT00001808685.
DR   EnsemblGenomes-Tr; EBT00001808686.
DR   EnsemblGenomes-Tr; EBT00001808687.
DR   EnsemblGenomes-Tr; EBT00001808688.
DR   EnsemblGenomes-Tr; EBT00001808689.
DR   EnsemblGenomes-Tr; Shew_R0001-1.
DR   EnsemblGenomes-Tr; Shew_R0002-1.
DR   EnsemblGenomes-Tr; Shew_R0003-1.
DR   EnsemblGenomes-Tr; Shew_R0004-1.
DR   EnsemblGenomes-Tr; Shew_R0005-1.
DR   EnsemblGenomes-Tr; Shew_R0006-1.
DR   EnsemblGenomes-Tr; Shew_R0007-1.
DR   EnsemblGenomes-Tr; Shew_R0008-1.
DR   EnsemblGenomes-Tr; Shew_R0009-1.
DR   EnsemblGenomes-Tr; Shew_R0010-1.
DR   EnsemblGenomes-Tr; Shew_R0011-1.
DR   EnsemblGenomes-Tr; Shew_R0012-1.
DR   EnsemblGenomes-Tr; Shew_R0014-1.
DR   EnsemblGenomes-Tr; Shew_R0015-1.
DR   EnsemblGenomes-Tr; Shew_R0016-1.
DR   EnsemblGenomes-Tr; Shew_R0017-1.
DR   EnsemblGenomes-Tr; Shew_R0018-1.
DR   EnsemblGenomes-Tr; Shew_R0019-1.
DR   EnsemblGenomes-Tr; Shew_R0020-1.
DR   EnsemblGenomes-Tr; Shew_R0021-1.
DR   EnsemblGenomes-Tr; Shew_R0022-1.
DR   EnsemblGenomes-Tr; Shew_R0023-1.
DR   EnsemblGenomes-Tr; Shew_R0024-1.
DR   EnsemblGenomes-Tr; Shew_R0025-1.
DR   EnsemblGenomes-Tr; Shew_R0026-1.
DR   EnsemblGenomes-Tr; Shew_R0027-1.
DR   EnsemblGenomes-Tr; Shew_R0028-1.
DR   EnsemblGenomes-Tr; Shew_R0029-1.
DR   EnsemblGenomes-Tr; Shew_R0030-1.
DR   EnsemblGenomes-Tr; Shew_R0031-1.
DR   EnsemblGenomes-Tr; Shew_R0032-1.
DR   EnsemblGenomes-Tr; Shew_R0033-1.
DR   EnsemblGenomes-Tr; Shew_R0034-1.
DR   EnsemblGenomes-Tr; Shew_R0035-1.
DR   EnsemblGenomes-Tr; Shew_R0036-1.
DR   EnsemblGenomes-Tr; Shew_R0037-1.
DR   EnsemblGenomes-Tr; Shew_R0038-1.
DR   EnsemblGenomes-Tr; Shew_R0039-1.
DR   EnsemblGenomes-Tr; Shew_R0040-1.
DR   EnsemblGenomes-Tr; Shew_R0041-1.
DR   EnsemblGenomes-Tr; Shew_R0042-1.
DR   EnsemblGenomes-Tr; Shew_R0043-1.
DR   EnsemblGenomes-Tr; Shew_R0044-1.
DR   EnsemblGenomes-Tr; Shew_R0045-1.
DR   EnsemblGenomes-Tr; Shew_R0046-1.
DR   EnsemblGenomes-Tr; Shew_R0047-1.
DR   EnsemblGenomes-Tr; Shew_R0048-1.
DR   EnsemblGenomes-Tr; Shew_R0049-1.
DR   EnsemblGenomes-Tr; Shew_R0050-1.
DR   EnsemblGenomes-Tr; Shew_R0051-1.
DR   EnsemblGenomes-Tr; Shew_R0052-1.
DR   EnsemblGenomes-Tr; Shew_R0053-1.
DR   EnsemblGenomes-Tr; Shew_R0054-1.
DR   EnsemblGenomes-Tr; Shew_R0055-1.
DR   EnsemblGenomes-Tr; Shew_R0056-1.
DR   EnsemblGenomes-Tr; Shew_R0057-1.
DR   EnsemblGenomes-Tr; Shew_R0058-1.
DR   EnsemblGenomes-Tr; Shew_R0059-1.
DR   EnsemblGenomes-Tr; Shew_R0060-1.
DR   EnsemblGenomes-Tr; Shew_R0061-1.
DR   EnsemblGenomes-Tr; Shew_R0062-1.
DR   EnsemblGenomes-Tr; Shew_R0063-1.
DR   EnsemblGenomes-Tr; Shew_R0064-1.
DR   EnsemblGenomes-Tr; Shew_R0065-1.
DR   EnsemblGenomes-Tr; Shew_R0066-1.
DR   EnsemblGenomes-Tr; Shew_R0067-1.
DR   EnsemblGenomes-Tr; Shew_R0068-1.
DR   EnsemblGenomes-Tr; Shew_R0069-1.
DR   EnsemblGenomes-Tr; Shew_R0070-1.
DR   EnsemblGenomes-Tr; Shew_R0071-1.
DR   EnsemblGenomes-Tr; Shew_R0072-1.
DR   EnsemblGenomes-Tr; Shew_R0073-1.
DR   EnsemblGenomes-Tr; Shew_R0074-1.
DR   EnsemblGenomes-Tr; Shew_R0075-1.
DR   EnsemblGenomes-Tr; Shew_R0076-1.
DR   EnsemblGenomes-Tr; Shew_R0077-1.
DR   EnsemblGenomes-Tr; Shew_R0078-1.
DR   EnsemblGenomes-Tr; Shew_R0079-1.
DR   EnsemblGenomes-Tr; Shew_R0080-1.
DR   EnsemblGenomes-Tr; Shew_R0081-1.
DR   EnsemblGenomes-Tr; Shew_R0082-1.
DR   EnsemblGenomes-Tr; Shew_R0083-1.
DR   EnsemblGenomes-Tr; Shew_R0084-1.
DR   EnsemblGenomes-Tr; Shew_R0085-1.
DR   EnsemblGenomes-Tr; Shew_R0087-1.
DR   EnsemblGenomes-Tr; Shew_R0088-1.
DR   EnsemblGenomes-Tr; Shew_R0089-1.
DR   EnsemblGenomes-Tr; Shew_R0091-1.
DR   EnsemblGenomes-Tr; Shew_R0092-1.
DR   EnsemblGenomes-Tr; Shew_R0093-1.
DR   EnsemblGenomes-Tr; Shew_R0094-1.
DR   EnsemblGenomes-Tr; Shew_R0095-1.
DR   EnsemblGenomes-Tr; Shew_R0096-1.
DR   EnsemblGenomes-Tr; Shew_R0097-1.
DR   EnsemblGenomes-Tr; Shew_R0098-1.
DR   EnsemblGenomes-Tr; Shew_R0099-1.
DR   EnsemblGenomes-Tr; Shew_R0100-1.
DR   EnsemblGenomes-Tr; Shew_R0101-1.
DR   EnsemblGenomes-Tr; Shew_R0102-1.
DR   EnsemblGenomes-Tr; Shew_R0103-1.
DR   EnsemblGenomes-Tr; Shew_R0104-1.
DR   EnsemblGenomes-Tr; Shew_R0105-1.
DR   EnsemblGenomes-Tr; Shew_R0107-1.
DR   EnsemblGenomes-Tr; Shew_R0108-1.
DR   EnsemblGenomes-Tr; Shew_R0109-1.
DR   EnsemblGenomes-Tr; Shew_R0110-1.
DR   EnsemblGenomes-Tr; Shew_R0111-1.
DR   EnsemblGenomes-Tr; Shew_R0112-1.
DR   EnsemblGenomes-Tr; Shew_R0113-1.
DR   EnsemblGenomes-Tr; Shew_R0114-1.
DR   EnsemblGenomes-Tr; Shew_R0115-1.
DR   EnsemblGenomes-Tr; Shew_R0116-1.
DR   EnsemblGenomes-Tr; Shew_R0117-1.
DR   EnsemblGenomes-Tr; Shew_R0118-1.
DR   EnsemblGenomes-Tr; Shew_R0119-1.
DR   EnsemblGenomes-Tr; Shew_R0120-1.
DR   EnsemblGenomes-Tr; Shew_R0121-1.
DR   EnsemblGenomes-Tr; Shew_R0122-1.
DR   EnsemblGenomes-Tr; Shew_R0123-1.
DR   EnsemblGenomes-Tr; Shew_R0124-1.
DR   EnsemblGenomes-Tr; Shew_R0125-1.
DR   EuropePMC; PMC3480492; 23110226.
DR   EuropePMC; PMC4907195; 27084012.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02223; sX4.
DR   SILVA-LSU; CP000606.
DR   SILVA-SSU; CP000606.
DR   StrainInfo; 690434; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634499
CC   Source DNA and bacteria available from Jim Fredrickson
CC   (Jim.fredrickson@pnl.gov)
CC   Contacts: Shewanella Federation (shewanella.org)
CC             James Tiedje (tiedjej@msu.edu)
CC             Jim Fredrickson (Jim.fredrickson@pnl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Additional Notes:There is one region (190008-190149) of the genome
CC   that was covered only by reads from the 454 sequencing machine.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4602594
FT                   /organism="Shewanella loihica PV-4"
FT                   /strain="PV-4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:323850"
FT                   /type_material="type strain of Shewanella loihica"
FT   gene            111..1490
FT                   /locus_tag="Shew_0001"
FT   CDS_pept        111..1490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: shm:Shewmr7_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21874"
FT                   /db_xref="GOA:A3Q8S6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q8S6"
FT                   /protein_id="ABO21874.1"
FT                   /translation="MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAEMDGETLVLYAPNR
FT                   FVLDWVRDKYLNTINQFFTEQMGSDAPKLRFDIGSRPASKPAAPAASTKSPVAPAAKSP
FT                   SKPSFNSNEPAATANHRSNMNPTYQFDNFVEGKSNQLGKAAALQVSENPGGAYNPLFLY
FT                   GGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVD
FT                   ALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQVILTSDRYPKEIDGVEDRLKSRFGWG
FT                   LTVAIEPPELETRVAILMRKAQESGINLPDEVAFFIAKRLRSNVRELEGALNRVIANAN
FT                   FTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVARPR
FT                   QMAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLIRTLS
FT                   S"
FT   gene            1511..2611
FT                   /locus_tag="Shew_0002"
FT   CDS_pept        1511..2611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: son:SO0009 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21875"
FT                   /db_xref="GOA:A3Q8S7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8S7"
FT                   /protein_id="ABO21875.1"
FT                   /translation="MKFSIDRDALLKPLQLVSGAVERRHNLPILANLLVEVSGHSLKLT
FT                   GTDLEVELVGQAELQGEVQEGRTTVPAKKFLDIVKSLPDQVELKIEQQDNRLLLRSGRS
FT                   RFTLATLPAEEYPNVDAFQADIEFTLKQGTLKSLIDATQFSMANQDVRYYLNGLLLETE
FT                   GNVLRAIATDGHRLALSHRMVQDSLPEKQVIVPRKGVLELQRLFEGEDLDVTLSIGENA
FT                   IRATTQSAVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALLRASILSNEKFRGV
FT                   RVQLEQNLIKITANNPEQEEAEEILDIEYDNAPLEIGFNVSYLLDVLNNLPSDDVRITL
FT                   IDGNSSALIENHVEEDSMYVVMPMRL"
FT   gene            2684..3766
FT                   /locus_tag="Shew_0003"
FT   CDS_pept        2684..3766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: son:SO0010 DNA replication
FT                   and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21876"
FT                   /db_xref="GOA:A3Q8S8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q8S8"
FT                   /protein_id="ABO21876.1"
FT                   /translation="MSLSRLHIDSFRNIASAQLQLGDGLNLIYGQNGSGKTSILEAIFF
FT                   LGMGRSFRSHLSQRVIQNDQDKLTLFAQLEQGEQETKIGLRRYRSGETEVKMNGEKVKR
FT                   LSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHTDKSFYTAWANVRRILKHRNQ
FT                   MLKSETPYQQIQFWDKELVRYAEIVTEIRKRYVGSLNERLKGIIEEFLPQVDVKVSFTR
FT                   GWDSKTDYQTLLQAQYPRDLAAGHTASGPHKADLRLRVGTLPVQDALSRGQLKLLVCAL
FT                   RIAQGKLLKQQIDKNSIYLVDDLPSELDARHRQLLLQQLSDTGAQVFVTAIEPAAIMDS
FT                   LNTPPVKVFHVEQGRVTVIE"
FT   gene            3783..6200
FT                   /locus_tag="Shew_0004"
FT   CDS_pept        3783..6200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: son:SO0011 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21877"
FT                   /db_xref="GOA:A3Q8S9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8S9"
FT                   /protein_id="ABO21877.1"
FT                   /translation="MSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNSIDEALAGYCNDVIITIHADGSVSVKDDGRGIPVAIHPEEGVSAAQVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSEKLKLTIRRDGKLYEQFYTMGEPDAPIAEIGDATN
FT                   TGTEIRFWPSAETFSDTLFHFDILAKRVRELSFLNSGVGIRLIDERDNKDEFFKYEGGI
FT                   SAFVDYLNLNKTPVNKEIFHFVQEREDGITVEVAMQWNDGFQENIFCFTNNIPQRDGGT
FT                   HLAGFRAALTRNLNSYMDKEGFNKKGKTSATGDDAREGLTAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKSAVEQTMGEKLGDYLLENPNEAKLIVGKIIDAARAREAARKAREMTRRKGAL
FT                   DLGGLPGKLADCQEKDPALSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGRDEYDPDKTRYHNIVIMTDADVDGSHIRTLLLTFFFR
FT                   QMPELIERGYVFIAQPPLYKVKKGKQEQYLKDDPALTEYLTNLALDGGEIHPSQDAPAM
FT                   SGAPLEKLVYQYREVEAIFDRLEQRFPIMLTERMLYQPGLSNDILADEAKVKQWCDNYV
FT                   AALTEAESGGFIFSAEAFLDPERQVYLPKVTVRKHGIDTHYLFSYDFLQSSDYQRMTAL
FT                   AEALEGLIEEGGYVKRGERMKEISSFVDALDWLMNDSKRGLYIQRYKGLGEMNPEQLWE
FT                   TTMDPESRRMLKVTIEDAIAADQLFTCLMGDQVEPRRDFIESNALNVANLDV"
FT   gene            6322..7041
FT                   /locus_tag="Shew_0005"
FT   CDS_pept        6322..7041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21878"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8T0"
FT                   /protein_id="ABO21878.1"
FT                   /translation="MKKAYLAALSILLLALGFGLFLSHTDTGAVVEQGAMQELVKHLQA
FT                   QDEADIKAAIVDNQPPLEQDSKISLSNGQPDADLASADQQNSSTRSAPLSSYRVTPSQA
FT                   EYASLMDLYLAAEGPFMREGTAYFYVANLQEPYFLASPPELNDLMANDTDQYIELKVEE
FT                   FNQIDEAYGDNWGGDFTELVVNYHYCKQSRCLLRASHESVTFLRDYVARYEQSHPELEV
FT                   DSMTTAAGDLLLIYRRR"
FT   sig_peptide     6322..6399
FT                   /locus_tag="Shew_0005"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.924 at
FT                   residue 26"
FT   gene            complement(7075..7803)
FT                   /locus_tag="Shew_0006"
FT   CDS_pept        complement(7075..7803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0006"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: reu:Reut_A0089
FT                   LamB/YcsF"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21879"
FT                   /db_xref="GOA:A3Q8T1"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8T1"
FT                   /protein_id="ABO21879.1"
FT                   /translation="MGVKPLRIDLNADLGEGGPQDEALLTLVTSANIACGGHAGDRQSM
FT                   LATVKLAKAHHVKVGAHPSYPDRANFGRLSIAIEAEPLFNSLLQQINALKAVCDELGVD
FT                   LHHVKPHGALYNDAAQDPALGRILIRVIETINPTLKLMILAGSPLVMQARRAGLEVIEE
FT                   AFADRGYLADGRLAPRSQPGALIEDAQKVLEQVSSIVEEQKVTAVTGESVSCHATSLCL
FT                   HGDTPKALEFARAIRASLDH"
FT   gene            complement(7793..8725)
FT                   /locus_tag="Shew_0007"
FT   CDS_pept        complement(7793..8725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0007"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: eca:ECA1352 putative
FT                   allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21880"
FT                   /db_xref="GOA:A3Q8T2"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8T2"
FT                   /protein_id="ABO21880.1"
FT                   /translation="MMRLDRVNGLASIQDLGRQGQGHLGIPSGGAMDSFSLILANRLLG
FT                   NEDNAPAIELASGSYEFTFKTPSWVALCGASFEAKIDDRPLWHSWRGRVNPGERLTLKG
FT                   PRQGVWGYLAILGGIEVPEVLGGHGTFLAGRFGGHQGRQLASGDTLSLNPHTEANFSRP
FT                   VGAVHRANDGILRALPGPEMSQFSDQDRKAFWHGHWTVSPQNDRMGARLTGESLDSGKH
FT                   LSLRSHAVLPGVVQVPPGGQPIVLQADAQTSGGYPRMAMVIEADRWKLAQARAGQAIRF
FT                   QHVSPNQVEDANLEWQHYFYRLARAMDGS"
FT   gene            complement(8722..9408)
FT                   /locus_tag="Shew_0008"
FT   CDS_pept        complement(8722..9408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0008"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   sfv:SFV_0624 putative carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21881"
FT                   /db_xref="GOA:A3Q8T3"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8T3"
FT                   /protein_id="ABO21881.1"
FT                   /translation="MMRDSHRFIPSLQINIYPLGERALVLDPSPEATLSWAVQSKLCWI
FT                   AEQLRQFPIVEEAIPGMNNLTIVVRETRQLKAMQARLAELWQSAPAETRESRTIEIPVS
FT                   YGGDAGPDLLSVAQFHHLSPEEVVKLHSQACYQVFFIGFQPGFAYLEGLPKHLHTPRLA
FT                   TPRLTIPAGSVGIGGEQTGIYPLTSPSGWQIIGQTQLALFDPTSDTLCLLKPGDRVRFI
FT                   PVEIAL"
FT   gene            complement(9507..11576)
FT                   /locus_tag="Shew_0009"
FT   CDS_pept        complement(9507..11576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0009"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: shm:Shewmr7_0008 glycyl-tRNA synthetase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21882"
FT                   /db_xref="GOA:A3Q8T4"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q8T4"
FT                   /protein_id="ABO21882.1"
FT                   /translation="MKFENLLIEVGTEELPPKSLRTLAESFLANFEEELQKAELSYESA
FT                   TWYAAPRRLALKVNALVTAQADKVVEKRGPAIAQAFDADGNPTKAAMGWARGNGITVEQ
FT                   AERLTTDKGEWLLHKAKVVGVETKSLVAEMAQRALDKLPIPKPMRWGSNKTQFIRPVHT
FT                   VTMLMGDELIPGELLGIESARTIRGHRFMGVDTLELDHADNYLTALETQGKVMADYQAR
FT                   MAIIKADAQAAADAMGGIAEIDEDLLEEVTSLVEWPVVLTANFEEKFLDVPAEALVYTM
FT                   KGDQKYFPVFDKAGTLLPHFIFVSNIESKDPAQIIAGNEKVVRPRLADAEFFFETDKKH
FT                   SLESRLASLETVVFQQQLGTIKDRVERISALAAFIAQGIGADSEQAGRAGLLSKSDLMT
FT                   NMVMEFTDLQGTMGMHYARLDGETEAVALALEEQYKPKFSGDSVPTQPISISVALAEKL
FT                   DTLVGIFGIGQAPKGAADPFALRRAAIGILRICVENNLPLDLVDLVAKAQELHGANLSN
FT                   ADTAEQVLEFLMGRFRAWYQDQGISVDVILAVLARRPTSPADFDSRIKAVTHFRSLEQA
FT                   AALAAANKRVSNILAKVEGDIASDIDSNLLQESAEQALASKLNELQPQLEPLFANADYQ
FT                   QALALLASLRESVDTFFEDVMVMADDEALKQNRLALLSKLRAQFLHAADISLLQ"
FT   gene            complement(11589..12494)
FT                   /locus_tag="Shew_0010"
FT   CDS_pept        complement(11589..12494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0010"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: glycyl-tRNA synthetase, alpha subunit; KEGG:
FT                   shm:Shewmr7_0009 glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21883"
FT                   /db_xref="GOA:A3Q8T5"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q8T5"
FT                   /protein_id="ABO21883.1"
FT                   /translation="MTTKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPMT
FT                   FLRSLGPEPMSSAYVQPCRRPTDGRYGENPNRLQHYYQFQVVLKPSPSNIQELYLGSLE
FT                   ALGVDMNIHDVRFVEDNWESPTLGAWGLGWEVWLNGMEVSQFTYFQQVGGLECSPVTGE
FT                   ITYGLERLAMYIQEVDSVYDLVWTDGPMGKIMYGDVFHQNEVEQSTYNFEHANVEVLFK
FT                   QFDDCEKACNELLALETPLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMA
FT                   KSVAESYYQAREALGFPMCK"
FT   gene            12604..13173
FT                   /locus_tag="Shew_0011"
FT   CDS_pept        12604..13173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0011"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: shm:Shewmr7_0010 DNA-3-methyladenine
FT                   glycosylase I; TIGRFAM: DNA-3-methyladenine glycosylase I;
FT                   PFAM: methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21884"
FT                   /db_xref="GOA:A3Q8T6"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8T6"
FT                   /protein_id="ABO21884.1"
FT                   /translation="MDVKRCGWVGEDPLYKAYHDEVWGRPVYDSRELFAKLCLDGQQAG
FT                   LSWITILKKQQNYESAFADFDPYVIAKFDEAKVEELLQNPGIIRNRLKVNSIIKNAKGY
FT                   IAFVEQGNDFSEFLWSFVGGQPKLNHFQRLDQLPAQTPESEAMSKALKKLGFNFVGPTI
FT                   CYAFMQAVGMVNDHTADCFCYQDKSN"
FT   gene            complement(13179..13859)
FT                   /locus_tag="Shew_0012"
FT   CDS_pept        complement(13179..13859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21885"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8T7"
FT                   /protein_id="ABO21885.1"
FT                   /translation="MKSLKLPLLILLSASAIAYLMLEADHAQPRDEPKIPIAQADQDRS
FT                   AQRQSPAQTQTDSKVETESLVSDTDNGNKVDTDTPEWNEVEVEEDKQTSAKLLVAQIID
FT                   AQGVVDGEQIKKLFDEDLEAYVDLIESLDNHDATSQQRQTALADRLTHLPETIYSEKYA
FT                   CGDRICVLSLTTDTISQQSIDKLSEFDKNYAFIKQTQLDTGETQFQAIYLQTDDPSTMR
FT                   FKGY"
FT   sig_peptide     complement(13776..13859)
FT                   /locus_tag="Shew_0012"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.477 at
FT                   residue 28"
FT   gene            complement(14072..17275)
FT                   /locus_tag="Shew_0013"
FT   CDS_pept        complement(14072..17275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0013"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; WD40 domain protein beta
FT                   Propeller; KEGG: sfr:Sfri_0009 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21886"
FT                   /db_xref="GOA:A3Q8T8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8T8"
FT                   /protein_id="ABO21886.1"
FT                   /translation="MKLGTPMLKQKLTPLCTAIALTLALPTWAADKDAPPAWQVNAPAK
FT                   APLEQVKIDVTEGTWMNVSVSPDGKQIVFDLLGDIYQMPIEGGEAKPLAQGIAWQMQPV
FT                   YSPDGKYIAFTSDEDGGDNIWVMNADGTDPRPVTKETFRLLNSPAWSPDSQYLIGRKHF
FT                   TGSRSLGAGEVWLYHVAGGTGVKLTERPNEQKDLGEPAYSPDGRYVYFSQDATPGKTFH
FT                   YSKDSVKGIYKIKRYDTQTGDIEVLVEGTGGAIRPTPSPDGTKLAYIKRDGFQSTLYLL
FT                   DLKSGKKTKLYDKLDRDMQETWAIHGVYPTMSWTANNEELVFWAGGKINRLDIESKSAK
FT                   EIPFKVKTELAVQPSVRFKQNLDQDSFDVKMLRMAQVSPDGDKVVYEALGKLWVKRLPE
FT                   GKVSRLTDLDDQVRELYPQWSRDGKKIVFTTWDDDQQGSVRVINARGGRSKTLTQEPGK
FT                   YVEPTFSPDGELVVYRKIKGGYITPRTWSQEPGLYVVDIKGKESRKITPDGFQPQFGAE
FT                   SDRVYFMDHGETPQLASINLHGFQKRVHYTSKHATEFRVSPDGKQLAFAERFKVWVTPF
FT                   AKHGETIEIGPKADNLPVTQLSVRAGESISWNGDSDQLYWTLGPELYQMDVDADYQSDE
FT                   KAAAIEPKITQIGFDKRADVPRGTIAFVGGRVITMEEDKVIENGVVIVENNKIVAVGDA
FT                   NTQVPKGAQVIDIKGKSIMPGLFDAHAHGAQGENEIIPQQNWELYANLALGVTSIHDPS
FT                   NDTTEIFAASEQQKAGNIVGPRIFSTGTILYGANMPGYTSHIDSVDDAKFHLERLKKVG
FT                   AFSVKSYNQPRRNQRQQVIAAARELEMMVVPEGGSLLQHNLTMIADGHTTVEHSLPAAA
FT                   IYSDIKQFWSQTEVHYTPTLVVAYGGISGENYWYDKTDVWAHPRLSKYVPSDLLEARSM
FT                   RRPTAPDAHYNHFNVARVANELNELGVKPNIGAHGQREGLAAHWEMWMFAQGGMSNMEV
FT                   LKTATINPAETFGMDHQLGSIKTGKLADLIVIDGNPLENIRVTDKVSYTMVNGKLFDAE
FT                   SMNQLNGDKTKRKPFFFEI"
FT   sig_peptide     complement(17186..17275)
FT                   /locus_tag="Shew_0013"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            complement(17578..18018)
FT                   /locus_tag="Shew_0014"
FT   CDS_pept        complement(17578..18018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21887"
FT                   /db_xref="GOA:A3Q8T9"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8T9"
FT                   /protein_id="ABO21887.1"
FT                   /translation="MASLQGISYKVVKGGPMLETSAALVTTSTGVAQDVFGKPGKRQVT
FT                   LLSAQQWLAACEALDTELPWTTRRANLLIDGISFSEKDLGKVIHVGALQLEITGETDPC
FT                   KKMEMAYAGLEAALRPDWRGGVTCRVLNDAEISIGDSVQLAD"
FT   gene            complement(18184..18429)
FT                   /locus_tag="Shew_0015"
FT   CDS_pept        complement(18184..18429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0015"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: sdn:Sden_0013
FT                   SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21888"
FT                   /db_xref="GOA:A3Q8U0"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q8U0"
FT                   /protein_id="ABO21888.1"
FT                   /translation="MSDPFAQAQHQLDALGLRCPEPVMMVRKSVRKMNEGETLLIIADD
FT                   PATTRDIPSFCEFMDHTLIASQTESTPYQYLIKKGL"
FT   gene            complement(18563..19027)
FT                   /locus_tag="Shew_0016"
FT   CDS_pept        complement(18563..19027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0016"
FT                   /product="ybaK/ebsC protein"
FT                   /note="TIGRFAM: ybaK/ebsC protein; PFAM: YbaK/prolyl-tRNA
FT                   synthetase associated region; KEGG: vfi:VF1792 regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21889"
FT                   /db_xref="GOA:A3Q8U1"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8U1"
FT                   /protein_id="ABO21889.1"
FT                   /translation="MTPATKMLDKAKIPYRLHEYQHDANAGAYGLEAAEKLQLPLEWVF
FT                   KTLVAELDNGTLVVAIIPVDKKLNLKQLAKAAKAKKAAMAAPEKVQRSTGYVLGGVSPI
FT                   GQKKRLATFIDESAQQLAQIYVSGGRRGLDIELTPTALQDVTQARFVSLV"
FT   gene            complement(19011..19499)
FT                   /locus_tag="Shew_0017"
FT   CDS_pept        complement(19011..19499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0017"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ppr:PBPRB1061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21890"
FT                   /db_xref="GOA:A3Q8U2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8U2"
FT                   /protein_id="ABO21890.1"
FT                   /translation="MDIIRLIDKPEAIGQVATWYHEEWGHLGPNRSQAELTHTLSQYLQ
FT                   LAGIPQLWLALHNNVPVGAIQLRYQENPQYPADSVWLGGIYVSPSYRGLGIAKALIAVA
FT                   EQYALAFDADDLYLQTEAKNLALYHSLGWQLVATLPYSDLLVSVMRKSLERENHDTRN"
FT   gene            complement(19854..21017)
FT                   /locus_tag="Shew_0018"
FT   CDS_pept        complement(19854..21017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0018"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: she:Shewmr4_0017 acetyl-CoA C-acyltransferase
FT                   FadA; TIGRFAM: acetyl-CoA acetyltransferases; acetyl-CoA
FT                   C-acyltransferase FadA; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21891"
FT                   /db_xref="GOA:A3Q8U3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q8U3"
FT                   /protein_id="ABO21891.1"
FT                   /translation="MKQAVIVDCIRTPMGRSKAGVFRNMRAESLSAELMKALLVRNPQL
FT                   DPNTIEDVIWGCVQQTLEQGFNIARNAALLAGIPKQAGAVTVNRLCGSSMEAIHQAARA
FT                   IMTGMGDTFIVGGVEHMGHVPMNHGVDFHPGLATNVAKASGMMGLTAEMLGKMHGITRQ
FT                   QQDEFAVRSHQRAHAATVEGRFANEIHAIEGHDANGALIKVMHDEVIRPETSLESLATL
FT                   RPVFDPANGTVTAGTSSALSDGASAMLVMEEEKAKALGLPIRARIRSMAVAGCDAAIMG
FT                   YGPVPATQKALQRAGLTMNDIDLIELNEAFAAQSLPCVKDLGLMDLVDEKVNLNGGAIA
FT                   LGHPLGCSGARISTTLINLMESKDATLGLATMCIGLGQGIATVFERA"
FT   gene            complement(21039..23189)
FT                   /locus_tag="Shew_0019"
FT   CDS_pept        complement(21039..23189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0019"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase / short chain
FT                   enoyl-CoA hydratase"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="4.2.1.17"
FT                   /note="TIGRFAM: fatty oxidation complex, alpha subunit
FT                   FadB; PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding; KEGG:
FT                   she:Shewmr4_0018 fatty oxidation complex, alpha subunit
FT                   FadB"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21892"
FT                   /db_xref="GOA:A3Q8U4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q8U4"
FT                   /protein_id="ABO21892.1"
FT                   /translation="MIYQSPTIQVELLEDNIARLCFNAEGSVNKFDRETLNSLNDALDA
FT                   LAQTQGVKGLMLTSGKDAFIVGADITEFLGLFAQDDNVLQGWLEDANKVFNKLEDLPFP
FT                   TISAIKGFALGGGCETILATDLRIADTSARIGLPETKLGIIPGFGGTVRLPRVIGADNA
FT                   LEWITTGKDQRPEAALKVGAIDAVVAPELLETAACQMLQDAISEKIDWQARRQRKLSPL
FT                   TLPKLEAMMSFATAKGMVFKVAGKHYPAPMAVVEVIEKAALSERAEALQVEHQAFIKLA
FT                   KTDVAKALIGIFLNDQLVKGKAKKAAKQAQAVNSAAVLGAGIMGGGIAYQSASKGTPIV
FT                   MKDINQAALDLGLNEAAKLLTAQINRGRSTPAKMAGVLNNITATLDYNALKQADVVVEA
FT                   VVEHPKVKATVLAEVEQVVGEDAIITSNTSTISINLLAKSLQKPERFCGMHFFNPVHKM
FT                   PLVEVIRGEHSSEETVASVVAYAAKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLEDG
FT                   ADFAAIDKVMEKQFGWPMGPAYLLDVVGLDTGHHAQAVMAEGFPDRMAKEGKDAIDVMF
FT                   EADRFGQKNGKGFYQYSVDRRGKPKKEVDPLSYELLGNAFGEQKEFSSDEIIARTMIPM
FT                   IIETVRCLEEGIIATPAEADMGLVYGLGFPPFRGGVFRYLDTLGVANFVALADQYAHLG
FT                   GLYQVTDKMRELAATNGSYYPA"
FT   gene            23495..24817
FT                   /locus_tag="Shew_0020"
FT   CDS_pept        23495..24817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0020"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="PFAM: peptidase M24; KEGG: shm:Shewmr7_0017 Xaa-Pro
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21893"
FT                   /db_xref="GOA:A3Q8U5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q8U5"
FT                   /protein_id="ABO21893.1"
FT                   /translation="MENLATLYPAHIIELNRRVAEITAREQLAGLVIHSGQPHRQFLDD
FT                   LDYPFKVNPHFKAWLPVIDNPHCWLIVNGRDKPQLIFYRPVDFWHKVADLPEDFWTTEI
FT                   EIKVLTKADKVADLLPGKLQEWAYIGEHLDVADVLGFGSRNPEAVMSYLHYHRASKTAY
FT                   ELACMRRASEIGVRGHVAAKSAFYAGASEFEIQQAYLAATDMGENDVPYGNIIALNQNA
FT                   AILHYTALEHVSPKQRLSFLIDAGGSFHGYASDITRTYAFEKNLFGDLIAAMDKLQLAI
FT                   IEMMRPGVKYVDLHLATHQKLAQLLLDFKLVQGDPQGLIEQGITSAFFPHGLGHMLGLQ
FT                   VHDMGGFLHDERGTHIAPPEAHPFLRCTRTLAANQVLTIEPGLYIIDSLLNELKQDGRA
FT                   DWINWQMVDQVRPFGGIRIEDNVIVHSDHNENMTRDLGLHG"
FT   gene            24832..25446
FT                   /locus_tag="Shew_0021"
FT   CDS_pept        24832..25446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0021"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; KEGG:
FT                   she:Shewmr4_0020 protein of unknown function UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21894"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8U6"
FT                   /protein_id="ABO21894.1"
FT                   /translation="MSESYPIPAKPITIEEEIKHSRFISFLFHCPSEDVLKCVLTNIKA
FT                   EYPGANHYCYAFIAGAPDNNVAMGSSDDGEPSGSAGRPMLASLQGAEIGEIGAVVVRYF
FT                   GGTKLGVGGLVRAYSSGIKQGLAQLETEIKQIRYPGRLACDYHQLKDVEHFLELCEGLV
FT                   VDKVFTDRVSLSFEMPKATQSRFNQELATLSQGRLKAEFSN"
FT   gene            25599..27056
FT                   /locus_tag="Shew_0022"
FT   CDS_pept        25599..27056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0022"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: shm:Shewmr7_0019 potassium
FT                   uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21895"
FT                   /db_xref="GOA:A3Q8U7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8U7"
FT                   /protein_id="ABO21895.1"
FT                   /translation="MQYRTIIRITGLLMGLFSLSLLPPALVAVIYKDGGGTAFLQAFFL
FT                   SLLLGFVLWYPNRRHKKDLRTREGFMLVVLFWGVLGSIGAVPFIFSSQPDLSLTDSFFE
FT                   SFSALTTTGATVLVGLDSLPKAILFYRHLLQWLGGMGIIVLAVAILPVLGIGGMQLYRA
FT                   EIPGPVKDSKMTPRIAETAKALWYIYLALTIACAFAYWVAGMDVFDAICHSFSTIAIGG
FT                   FSTHDASMGYFDSTAINMVCVVFLLIAALNFSLHFAAFTRRGINLKVYLRDAEFKALIV
FT                   IQLALTLICFATLYHTGIYDSAEETFDFALFQAVSISTTAGFGTESFHMWPLFLPMLLI
FT                   FSSFIGGCGGSTAGGIKVMRMILLLLQGSRELKRLVHPRGMFSIRINGKALPDRIIDAV
FT                   WGFFSAYALVFVVCMLILMALGMDNITAFSATAACLNNLGPGLGEVASNYASIGDGEKW
FT                   VLVVAMLFGRLEVFTLLVLFTPTFWKN"
FT   sig_peptide     25599..25685
FT                   /locus_tag="Shew_0022"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.701 at
FT                   residue 29"
FT   gene            27056..27583
FT                   /locus_tag="Shew_0023"
FT   CDS_pept        27056..27583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0023"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: shm:Shewmr7_0020 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21896"
FT                   /db_xref="GOA:A3Q8U8"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8U8"
FT                   /protein_id="ABO21896.1"
FT                   /translation="MSRTLIIYSTVDGQTKAICDQIAEQCKSDTQPVTMVSLEEAQSVN
FT                   LSYFDKVIIGASIRYGKHRPELFQYVNRHRAVLNGKKNAFFTVNVVARKPEKNTPETNP
FT                   YMKKFLQLSLWQPQQLGVFAGKIDYPKYRFFDKFMIRFIMWITKGPTDTSGTYEFTDWD
FT                   KVQEFAKAFSER"
FT   gene            complement(27605..27910)
FT                   /locus_tag="Shew_0024"
FT   CDS_pept        complement(27605..27910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0024"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG:
FT                   shm:Shewmr7_0021 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21897"
FT                   /db_xref="GOA:A3Q8U9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8U9"
FT                   /protein_id="ABO21897.1"
FT                   /translation="MQKDIDVDAMVTNAQSAAKWLKAIANPYRLMILCQLLDNELSVTQ
FT                   LNENVPLSQSALSQHLAVLRAEDLVATRKSSQIVYYTLKNEQVTEVISILYKRYCV"
FT   gene            28183..28716
FT                   /locus_tag="Shew_0025"
FT   CDS_pept        28183..28716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0025"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: sfr:Sfri_0019 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21898"
FT                   /db_xref="GOA:A3Q8V0"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8V0"
FT                   /protein_id="ABO21898.1"
FT                   /translation="MASVLIVYYSRGGHTAKIAQAIAAHLDAQGHSCDALRIGEFEHID
FT                   WEKYDYVAVGACVLYGSYHKSVFEFVTRYQAELAAKPNSFFSVNVVARNPEKRIPENNK
FT                   YLQKFIELSPWKPNDVKVIAGKVDYPSWRWYDRWMIQLIMKITDGPTDPKAVIDYTDWE
FT                   DVKLYAEHLLTLKD"
FT   gene            28832..29368
FT                   /locus_tag="Shew_0026"
FT   CDS_pept        28832..29368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21899"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8V1"
FT                   /protein_id="ABO21899.1"
FT                   /translation="MNLYFRLFWLMFWRVRHCRRIDFLGTSTISYRALPLDCDINLHLT
FT                   NSRYPALMDLARTYMLAEMGLLKRFLKLKWLPIVNAAEFTYIRDIKPLCKFDIQSRVVG
FT                   WDEKYFYVEQRFVSGDTLHCIVHVRGVFVNNRKQVPIPEMLKEAGFDGPEPCLPPEIEK
FT                   WKAFLTLKKERNLPA"
FT   gene            complement(29381..30028)
FT                   /locus_tag="Shew_0027"
FT   CDS_pept        complement(29381..30028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0027"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   KEGG: son:SO4697 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21900"
FT                   /db_xref="GOA:A3Q8V2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8V2"
FT                   /protein_id="ABO21900.1"
FT                   /translation="MELFYHPLSRYSQKVLIALYEKQANFYPRVIELSDPFSRNEFKQQ
FT                   YPLGKLPLFKTRTGDLLPESSIIIDYIDHEFATGTRLLPQDYSQRLQVRLYDRLIDNDL
FT                   NNPLYLLEQMEAREEENPIKVRQLEKEIMLLLNELNDKLQRHHWLCGDAFTMADCALIP
FT                   CLIHARNRLKLYQLDPIDRYLNQANTRGAWIQVQEEIELTRIAVQAGFRPIP"
FT   gene            complement(30110..31009)
FT                   /locus_tag="Shew_0028"
FT   CDS_pept        complement(30110..31009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0028"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pen:PSEEN2735 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21901"
FT                   /db_xref="GOA:A3Q8V3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8V3"
FT                   /protein_id="ABO21901.1"
FT                   /translation="MDASQLYRMLVFASVVEHGSLTRAAESLNISRSMVSQHLKKLEHR
FT                   CQSRLLNRTTRSLSLTQEGQSFYRYCAELLKLAKQAETSLQPADAELQGSITLAVPQAL
FT                   GDGEIAPIIKTFHQHYPKVHLSLLIQDRQLDLTEHQIDVAIQIGAASQPSVNETRLGRF
FT                   DEYLVASPDYVAHHGAPVHPDNLSHHHWIGLAGDRLPRHWQFENSEGERVRLQLSPFIN
FT                   CNSLQGTLSLAMQGLGVALLPSPLISQHLANGQLVQLLPDYHLGRGALYLVHPYLEVIP
FT                   PRVRALIELLTERLTPAA"
FT   gene            31239..31928
FT                   /locus_tag="Shew_0029"
FT   CDS_pept        31239..31928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0029"
FT                   /product="conserved hypothetical 3-methyladenine DNA
FT                   glycosylase"
FT                   /note="KEGG: shm:Shewmr7_3932 conserved hypothetical
FT                   3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21902"
FT                   /db_xref="GOA:A3Q8V4"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8V4"
FT                   /protein_id="ABO21902.1"
FT                   /translation="MARLESFDSIYQRACERKGGEAGLAARLPEVLSQDQIAEYTDAEL
FT                   LSELSKKVFQSGFVWRIVDNKWPAYEAAFFNFEPHKILMLSPEQIQQRASDPELIRHLK
FT                   KTMAIYDNALMVHDIKLAHGSFAKFIAQWPSDNIIGLWAELKRLGCRLGGNTGPYFLRT
FT                   IGKDTFLLTEDIKGYLQAHKLIDAGFTSTRGLTQVQEVFNEWQAQSGRSLAEISRILAC
FT                   GVGDNRI"
FT   gene            complement(32076..32831)
FT                   /locus_tag="Shew_0030"
FT   CDS_pept        complement(32076..32831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_1989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21903"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8V5"
FT                   /protein_id="ABO21903.1"
FT                   /translation="MKMMKTLTQLKCSILLGSLLAASGVMAEAQDTQVLGGNITGKLTF
FT                   ASDYVFRGESETMDGDVPVVQGTLGWGNVQGWYGGVYASNIKFADPNLEIVTAPYIGKA
FT                   GTFGDSGITYDVMLFSYLYPGASYSNYTELWLKVGKQFGRTNLQLEVTPTVDDWFGVDG
FT                   WQGVNYAVHPSYQFDNGINLSASVGYQDLDGNGAEGWGHWNLGVSKTFAGLSFDLRYHG
FT                   STVDESHKVYGTQTKIFDDRVVIGVSKSF"
FT   sig_peptide     complement(32748..32831)
FT                   /locus_tag="Shew_0030"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.754 at
FT                   residue 28"
FT   gene            33256..34416
FT                   /locus_tag="Shew_0031"
FT   CDS_pept        33256..34416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0031"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   she:Shewmr4_3837 efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21904"
FT                   /db_xref="GOA:A3Q8V6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8V6"
FT                   /protein_id="ABO21904.1"
FT                   /translation="MRQIVKIASLVSVALWITGCGQDENQGHSAAAPRSMEVGVVQVVE
FT                   QPQAIQVELPGRSKAYLEAEVRPQVSGIITERGFVEGGEVTEGQSLYQIDSSTYKAALV
FT                   SAEADLARANASLVSAKAKAARYKALIKTDAISQQDFDEADALYKEALANVTVAKAAIN
FT                   TAKINLEYTQVKAPISGRIGKSSVTAGALVTANQSAALATIQQLDPINVDIAQSSAQLL
FT                   RLKAKLKQGQLQAADNADVRLILEDGTAYEHMGSLRFAEVSVDENTGSVTLRAEFPNPD
FT                   GVLLPGMYVRAVLNAGTDPKAILVPQKAVTRNTKGQAVAMVIGAESKVEPRVVTTAEVI
FT                   DHQWRITSGLKAGDQLIVEGLQKIRPGAPVVGKPLSEMQSDKQPQK"
FT   gene            34426..37575
FT                   /locus_tag="Shew_0032"
FT   CDS_pept        34426..37575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0032"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   shm:Shewmr7_3929 transporter, hydrophobe/amphiphile
FT                   efflux-1 (HAE1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21905"
FT                   /db_xref="GOA:A3Q8V7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8V7"
FT                   /protein_id="ABO21905.1"
FT                   /translation="MARFFIDRPIFAWVIAIIVMLAGVLSIMKLPVSQYPSIAPPTVVI
FT                   NAIYPGASAKTMEDTVTQVIEQRMTGIDHLRYISSTSDSFGNAQITLTFNAEADPDIAQ
FT                   VQVQNKLQLAMPLLPQEVQAQGVKVNKSSSGFLMVLGFVSQDGSLEKNDISDYVGSNIL
FT                   DPMSRVPGVGEIQLFGAQYAMRIWLDPLKLTQYNLTSLDIMASIREQNAQVSAGQLGGA
FT                   PSIAGQELNATVTAQSRLQTAEEFRKIIIKSDPSGAKVYLEDVARVELGSESYSVESFY
FT                   NGRPAAGLAIKLATGANALATAERVREKVDEMKPFFPQGLEVVYPYDTTPFVEKSIEGV
FT                   VHTLLEAVVLVFVIMYLFLQNFRATLIPTIAVPVVLLGTFAILSATGFSINTLTMFAMV
FT                   LAIGLLVDDAIVVVENVERVMSEDGLSPIEATKKSMDQITGALVGIGLTLSAVFVPMAF
FT                   MSGSTGVIYRQFSVTIVSAMALSVLVAIILTPALCATMLKPIAKGHHAVETGFFGWFNR
FT                   TFDKMTSRYEAGVAAMIKRAGRVMLIYVALTVAVGWIFMRMPTAFLPDEDQGILFTQAI
FT                   LPTNSTQESTKKVMSKISDFYLNETGDSVKSVFSVSGFSFAGSGQNMGLAFVGMKDWSE
FT                   RTGPGQDVKSVAGRAMGMFMQMKEAFVFAFVPPAVIELGTANGFDFYLQDRNGQGHEKL
FT                   LEARNMLLGMASQNPNLVGVRPNGQEDAPMYRIHIDHAKLRALSIDIDAVNSVLGTAWG
FT                   GSYVNDFIDRGRVKKVYVQGDAQYRMQPEDLDTWYVRNSQGEMVPFSAFATGTWEYGSP
FT                   RLERFNGLPAMNIQGGTAQGYSTGAAMADIEAMVAKLPPGFGVEWNGLSYEERLSGNQA
FT                   PALYALSIMVVFLVLAALYESWSVPFAVILVVPLGIIGALLAMNGRGLPNDVFFQVGLL
FT                   TTVGLATKNAILIVEFAKEFYEKGAGLVEATLHAVRVRLRPILMTSLAFGLGVVPLAIS
FT                   SGVGSGSQNAIGTGVLGGMMSSTFLGIFFIPIFFVIVERIFSKREKKGAATQVADSTPQ
FT                   E"
FT   gene            37798..39639
FT                   /locus_tag="Shew_0033"
FT   CDS_pept        37798..39639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0033"
FT                   /product="peptidase M14, carboxypeptidase A"
FT                   /note="PFAM: peptidase M14, carboxypeptidase A; KEGG:
FT                   son:SO0152 hypothetical carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21906"
FT                   /db_xref="GOA:A3Q8V8"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8V8"
FT                   /protein_id="ABO21906.1"
FT                   /translation="MSLYSRATLLCLATFGASAMAETSGPQPAQVSLNKTYINDAILPP
FT                   SITWHGASEALLRAADDPWATPFEQGGLKSSPSYDDTFAWLDKLLATSDKLHKVSLGKS
FT                   PQGRDIWMIVASQEGAATPDELQVNGKPTLLVQAGIHSGEIDGKDAGMMLLRDMVMGDK
FT                   QALLTGANLLFVPIFSVDAHERSGQFNRVNQRGPVEMGWRTTAKNLNLNRDYAKADTLE
FT                   MQHMLAAINLWQPDLYIDVHVTDGIDYQYDVTFGYNLAQGLSPASYRWLNDKYRPKVEQ
FT                   ALSAQGHVPGPLVFAIDNRDLNQGLSLWNASPRYSNGYGDARHLPTILIENHSLKPFKQ
FT                   RVLGTYLMLASTLEVLGEQGTALRSAIKQDSYRYSDRITLTWQSETQPKGWDFKGIDYR
FT                   LEQSPISGETVVRWTGEPKLYENLPVIGKTRADIKVNRPKAYYIPPQWQEVIERLSIHG
FT                   IRMTRLEQSKTLTLTQYRFGEPAFDAKDYEGRQRVSAPVSSHKAKVALPAGTVKISTQQ
FT                   PLGDLAILLLEPQSPDSLLQWGFFNPIFTRTEYIEHYAVEPLAVKMLKEDASLAAEFEA
FT                   ALKDPEFAKDAEARLRWFYERSPYFDKQYRVYPVLRD"
FT   sig_peptide     37798..37863
FT                   /locus_tag="Shew_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            complement(39701..40504)
FT                   /locus_tag="Shew_0034"
FT   CDS_pept        complement(39701..40504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0034"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: shm:Shewmr7_0139 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21907"
FT                   /db_xref="GOA:A3Q8V9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8V9"
FT                   /protein_id="ABO21907.1"
FT                   /translation="MRRAVDYLTLNRTAWNHRTLEHLDSSFYDVSGFLAGNSSLQEIEL
FT                   ADLKVKGKSLLHLQCHFGLDTLSLARLGAEVTGVDLSDTAIHHARRLAEACDLKADFIC
FT                   SDLYQAGTQLQQQFDMVYTSYGALCWLPDLGRWAELIYESLLPGGEFYMVEFHPVQAMM
FT                   EGYSYFTQQEPDVEEEGTYTENASDTKHTMVTWPHSLADVIGALIQAGLKVEAIQEYPF
FT                   SPYDAFDNLVTGESLGLSSDRPRYYQLHQGKPIPMVYSLSARKPE"
FT   gene            40708..41478
FT                   /locus_tag="Shew_0035"
FT   CDS_pept        40708..41478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0035"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: shm:Shewmr7_0138 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21908"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8W0"
FT                   /protein_id="ABO21908.1"
FT                   /translation="MLARVMTMATVLVFGLTGCIVNVNSAGRDDFDYHKQTQLTLDAQS
FT                   LETLVADTGAGSLKIVGDASVEQITLDADIYGFDGAEPELTLTRSGNKAKLVANFDAFH
FT                   RASFSNGKSPYIDLLVKVPAGIKLDIHDGSGSIVIRGVQADMEIEDGSGAIEIDGGHKL
FT                   TIDDGSGSITLTNVAGGIQVKDGSGSLTIASVQGDVEIDDGSGAIEVRGVQGKVTIDDG
FT                   SGGIRVVDTQGLHIIDAGSGSLSFDNIQGQVSID"
FT   sig_peptide     40708..40785
FT                   /locus_tag="Shew_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.866) with cleavage site probability 0.743 at
FT                   residue 26"
FT   gene            complement(41568..42389)
FT                   /locus_tag="Shew_0036"
FT   CDS_pept        complement(41568..42389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0036"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   sde:Sde_1770 4-amino-4-deoxy-L-arabinose transferase and
FT                   related glycosyltransferases of PMT family-like"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21909"
FT                   /db_xref="GOA:A3Q8W1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8W1"
FT                   /protein_id="ABO21909.1"
FT                   /translation="MFRLTQAQTTRETALTMTTDRSRYGTLILLVSMLALLCLNQDLNL
FT                   SLFRAINGLSPSLPQWLQLGITDLGHGSTLGTIVLICLLRRPELMPRVLTASLLSMILV
FT                   PLLKQYFDAPRPAATLDFLYIVGETRLHHSFPSGHSTSAFLFAGSLLMVMQDKKSKWVL
FT                   LMGAAMVALSRILVGAHWPVDTLAGALLGLSCAYVASYVPLVHLSPRHWKILMGILLLT
FT                   LLVCQYKETSSQMAWQIIGLRWGLLLLAGVLVLRQYLQSRQPLTPRKWVRA"
FT   gene            complement(42482..43300)
FT                   /locus_tag="Shew_0037"
FT   CDS_pept        complement(42482..43300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0037"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   sde:Sde_1770 4-amino-4-deoxy-L-arabinose transferase and
FT                   related glycosyltransferases of PMT family-like"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21910"
FT                   /db_xref="GOA:A3Q8W2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8W2"
FT                   /protein_id="ABO21910.1"
FT                   /translation="MNLQQQAKAMGMPAQDKYQGRGFIGLLLFLLCLHLLVLNSAVNLS
FT                   LFRFFNGIAAYAPADLLLLITDLGDGITLGVITLCCLVKRPELLLRVVIASVLSLILVP
FT                   LLKQTFDAPRPAVILETLNIVGEIRLKHSFPSGHTATAFLFAGTLFFAYRQTQIKCLAI
FT                   AFASLVGLSRIVVGAHWPEDVIMGAFVGLFCAYAAAHCPLVKLTQFHKALILAFLWCVL
FT                   VVSELDKSFDKDHIWPILMLRWGLIATAALLIWREYGAMHRVRRWLAFQG"
FT   gene            complement(43463..43756)
FT                   /locus_tag="Shew_0038"
FT   CDS_pept        complement(43463..43756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0038"
FT                   /product="Excinuclease ABC, C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC, C subunit domain protein;
FT                   KEGG: she:Shewmr4_0137 excinuclease ABC, C subunit domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21911"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8W3"
FT                   /protein_id="ABO21911.1"
FT                   /translation="MPQEKLASTTWSLYMIRCANGHLYTGITTDIDRRFKEHSDNGPKT
FT                   AKYLRGKGPLTLVYHEQVGCRSDALKREIAVKRLTKTQKVALIHFDANGECP"
FT   gene            complement(43758..45818)
FT                   /locus_tag="Shew_0039"
FT   CDS_pept        complement(43758..45818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0039"
FT                   /product="Oligopeptidase B"
FT                   /EC_number="3.4.21.83"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site domain protein; peptidase S9A, prolyl oligopeptidase
FT                   domain protein beta-propeller; KEGG: son:SO0144 protease
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21912"
FT                   /db_xref="GOA:A3Q8W4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8W4"
FT                   /protein_id="ABO21912.1"
FT                   /translation="MSGITPPVARKQAHPLKHHGIERIDDYHWLRDDERQSPEVLAHLE
FT                   AENAYHKACFAPFEPLQQTLFQELIGRVDKDESSVPYRWHQHWYYKRYQGEQEYPLFGR
FT                   KRELEGEEQLLLDANERAQGKEFYSMGGLSVSPDETLLAISEDTLSRRLYRISIKRLDT
FT                   GEWLSDSLSDTDGEIVWAKDNQHIFYIAKDPQTLLGNRVYCHRLGDPQANDRLVYQEAD
FT                   DSFYLSIGKSLDESRILLTHESTLTSEVSILDANQPEACFKPLLARETGHEYSVAKRGE
FT                   EYYILTNWQAVNFRLMKATESSFADKRSWQEIIPADESRRLEDLLVLKDYLVVQYRQQG
FT                   LSQIRILPLNGAPEYELDFDDAAYVVGLDVNPTQDSHHLRIYYASPSTPESIYLVDLTQ
FT                   ASPRRLLKQERVLGGFDSQHYQTERLFIDARDGAKVPVTLVYRKDKFRQDGSNPLYQYG
FT                   YGAYGYTIEPDFDSAILSLLDRGVVYAVAHVRGGEMLGRPWYDAGRLMQKQNSFNDFID
FT                   VTLALVELGYCARDKVVASGGSAGGLLMGAVINQAPQHYLAVAAHVPFVDIVTTMLDES
FT                   LPLTTNEYDEWGNPNQAEAYRYMLSYSPYDNISRQAYPHLLVTTGLHDSQVQYFEPAKW
FT                   VAKLREYKQDEHLLLFHIDMEAGHGGKSGRYRHFEDTAEEYAFFFGLLGLA"
FT   misc_binding    45958..46157
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 64.97"
FT   gene            46327..46980
FT                   /locus_tag="Shew_0040"
FT   CDS_pept        46327..46980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0040"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase;
FT                   KEGG: shm:Shewmr7_0129 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21913"
FT                   /db_xref="GOA:A3Q8W5"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q8W5"
FT                   /protein_id="ABO21913.1"
FT                   /translation="MNQSLLSPFGDAITRVEAALTALRAGQGVLVVDDEDRENEGDLIY
FT                   SAEHLTQEQMALLIRECSGIVCLCLTDERVKQLELPPMVEDNSSQYGTAFTVSIEAKVG
FT                   VTTGVSAADRVTTIKAAIADDAKPSDLARPGHVYPLRAQPGGVLTRRGHTEGTIDLMKL
FT                   AGLKPAGVLCEVTNVNGTMARLPEIIAFGEQHKMPVLTIEDIVCYRKSLLEKAS"
FT   gene            47293..50577
FT                   /locus_tag="Shew_0041"
FT   CDS_pept        47293..50577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0041"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: she:Shewmr4_0134 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase,
FT                   HAMP region domain protein; Nitrate and nitrite sensing
FT                   domain protein; PAS fold-3 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21914"
FT                   /db_xref="GOA:A3Q8W6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8W6"
FT                   /protein_id="ABO21914.1"
FT                   /translation="MLLLSDPKFLASAFVIIEQGALKMSSMLNRYSLSQKLILLATIPM
FT                   LLLLIFGSLRMLDLIERQQTAQRNALGVMITEQTQKLIFALQNERGLSAGFVASQGNRF
FT                   ERRLQTQRRQTDKALQDLLDAPNIANLHLSLSDIDRPSVNLQQSVDTIHALGARLKQVR
FT                   QGIDSRTEGSGFNFYSEFTQHLLVLISQIQSQVQNTLLAKAYNDLIHMLKLQELAGKDR
FT                   DLLNRLLAADSLDHQAYLAQYSMQDDLLDAFHEMLSTTSPADLALIKETLDNEATQELL
FT                   LMKGRVKAQVNLILLANRLRERLGYGGLIDHYQDYLLSGEETNIILFEEDCLAIQGLLQ
FT                   QAQKLPHVTSPQREALAQIDNTVEQYRQAVDAQRQHRLSGHAGPLPQEGRAIIADQAML
FT                   AALSQLQHQHPAVASEAWWALATEALGQMNQASLTLSNNIANLVQRQGREALSFLVLGI
FT                   MAAMCNFLFLIVLGRLIVNNLVTRIGTIASLMQRMAQNTQLQLSVPVDGRDEVAKMAMA
FT                   LNAMLSERQEANRELSLASAVFEYCAEGIVVTDKDNLIEAVNPAFTQITGYTLEEVKGR
FT                   SPAVLNSHQQPHHFYEQMWQSLKQYGKWQGEIWNKRKNGQIFPEYLAITVVKDDKGRVV
FT                   QHIGLFLDISNRKKYEQDIWYKSNYDALTNLPNRQLYTSRLSQMLQLAEQRCCSVAVLF
FT                   IDLDRFKYINDIYGHAVGDELLQVAAARLEALLEQHDFVARLSGDEFVVVMGHTKHQGE
FT                   IEQRAQNILQHLSSPFGINRNELLISASVGISCYPSNGTSVEVLTRNAETAMYQAKQDG
FT                   RNCFGYFSPDMNNNMLARITLEQSLRSAVLQHEFCLHYQPIVDTSSGEGVALEALLRWR
FT                   HPQRGLVPPDEFIPIAEETGLIEPIGEWVIQQALRDLRQCHSQGIMINMAINVSGRQLA
FT                   HGDPSHFACMLNGLLQKYDVAPQYVHIEITESILMADTELSLKALTAIRHLGVEIYLDD
FT                   FGTGYSSLSYLKQFPISVIKIDKSFVDNMLEDRADANLIKAIITMGQSLDMRLVAEGVE
FT                   SEPQRSFLQGLGCDFVQGYLVAKPMPLKELEPLLRRIVREKPTSLL"
FT   gene            complement(50756..51280)
FT                   /locus_tag="Shew_0042"
FT   CDS_pept        complement(50756..51280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0042"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG:
FT                   shm:Shewmr7_0127 ferritin, Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21915"
FT                   /db_xref="GOA:A3Q8W7"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8W7"
FT                   /protein_id="ABO21915.1"
FT                   /translation="MLAQTMIDQLNAQINVEFFSSNLYLQMSAWCEDKGFEGAAKFMRA
FT                   HAEEEMQHMHRLFTYVSETGGMPLLGAIEAPQSQFDSLLALFEYTYEHEQMITSKINAL
FT                   AHTAFTNQDYSTFNFLQWYVSEQHEEEKLFKSIVDKIRLVGEDGKALFFVDKDLAQMAQ
FT                   QESASVMTVGE"
FT   gene            51408..51596
FT                   /locus_tag="Shew_0043"
FT   CDS_pept        51408..51596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_4517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21916"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8W8"
FT                   /protein_id="ABO21916.1"
FT                   /translation="MRATKCRARLDEPIGQRLQAISTALSPVCVEPLHDSGSALYQSPS
FT                   NCCKNKQERSIGPIYCV"
FT   gene            51810..54920
FT                   /locus_tag="Shew_0044"
FT   CDS_pept        51810..54920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0044"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   sdn:Sden_3430 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21917"
FT                   /db_xref="GOA:A3Q8W9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8W9"
FT                   /protein_id="ABO21917.1"
FT                   /translation="MNLTKLSTNNPAGTLVALLLIAIFGVLAIGKLPIQLLPDIQRPQI
FT                   SVFNNWRSAAPQEMESNIIEPQENVLRQVPGVVEMTSNISQGFGGITLTFEVGSDMQAG
FT                   MINVINALNQTPPRPLDANEPFINVGGGNGAPNLASLLIRMAPDNPATDFAQYQKLIDD
FT                   VVEPRLRLISGVGSVRLQSRLPKELHIEFDPYRAAALGITLDQLRSTLSRAADISGGTA
FT                   NVGRRQYTVRFIGQYTPENLGNLIVTYNEGRPIYLNELADVEVSSADVQGFTKRNGYPA
FT                   YYMTVEGTFDANTVKVLDGVNEAIAELNQGPLKEAGLVLDLSFDASVHIKRAIWLVKGN
FT                   LAIGVVLALVILYAFLRSFRATLMIASTIPVALLIAFFFLEMMGRTLNVISLAGLAFAV
FT                   GLVLDAAIIVQENIVRILQQGTPIREAIAKGTDQVKGALLASTATTVAIFLPILFMPGV
FT                   EGQLFSDLALTLSVAVVSSFISAITLIPVFSLLWLKLSPQDDGQQSGRLWRWISATVQR
FT                   LTGDTKRAVFWCVTLILGAAMLTAVLMPRPDFLPQARSDGIFAFFALPPGANVKTLEKE
FT                   VGDVIIERLKPYYDKEKQPYIKGYNFSMYSAFNVLFIYPEDPSQADAMIELLNKEILVG
FT                   LPDTQAFTNRGSLLQFGFNGGRAINIDLQGADMEALMETAGKGMGLIQEALPGAVVRPI
FT                   PGLSMAQPELQLIPNERRLAQAGVDRIQIANAIRAYTSGLFVGEYFDGNERMDVLLKGP
FT                   KWQVPEQLSATPVYTQAAGIQTIGELATLKRTVGPTQLQRVNGKRSVSLLIFPPADMSL
FT                   DEALEKLNQSAVPTLRASLPENSSLGYRGSADKLDSTIKDMGANFALAVVILFLLMAAM
FT                   FKSAKDSLLVLLSMPLAICGGVVSLRLLNLFSFQSLDLLTMIGFIILLGLVVNNAILLV
FT                   DQTRQSYRETPDIDLAIAQAVATRARPVYMSTLTSIFGMLPLMLVPGVGSEIYRGLAAV
FT                   IVGGMTFSALFTLILMPSLLRLTHRLSPVTNRLADEPALSSTTGVKS"
FT   sig_peptide     51810..51896
FT                   /locus_tag="Shew_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.688 at
FT                   residue 29"
FT   gene            54917..55987
FT                   /locus_tag="Shew_0045"
FT   CDS_pept        54917..55987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0045"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   sdn:Sden_3429 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21918"
FT                   /db_xref="GOA:A3Q8X0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8X0"
FT                   /protein_id="ABO21918.1"
FT                   /translation="MRSLIAAVLALSLIGPTSWAQGEAPERLVQVVQVENRALSPKIMV
FT                   IGSVHSRNYAELTAGIEGKLEWVIEAGTLVKAGEVVARIEKTRLELQKAQQEAQIEYET
FT                   VGLSRLNRELKRLQKLMANKNASETELDKARSDRDLAAANLKLAQIKLEMILDDIARTQ
FT                   VKAPFAGIITARQRQAGEDISRAESIVAITDPDNLEIRLHAPLKHSRRVKVGDELRVYH
FT                   GLGEFSAKIRSLIPVSDVRSQTFEARIDLPLERQDMLNVGELVSLALPIAPKQLTTLVP
FT                   RDAVVLRSAGAFVFKIDESNKAVKVAVELGDGEGEWIAVKGELSDSDQVVIRGAETLQD
FT                   GQQVKVQANNQELSAG"
FT   sig_peptide     54917..54979
FT                   /locus_tag="Shew_0045"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            56169..57416
FT                   /locus_tag="Shew_0046"
FT   CDS_pept        56169..57416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0046"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG: son:SO0138
FT                   molybdopterin biosynthesis MoeA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21919"
FT                   /db_xref="GOA:A3Q8X1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8X1"
FT                   /protein_id="ABO21919.1"
FT                   /translation="MSMQADPCAKPSLMHPDEAIIKLLEQVRPLEESEMVQLPHALGRV
FT                   LAEDLASSIDLPPFDNSAMDGYAFRFEDLAQGNRFTLIGHSFAGHPFEGEASANTCVRI
FT                   MTGAPVPPGYDTVQMQEKVEVDGDSIVIEAPKALGANVRRRGEEVMTGGKVLCAGTQIG
FT                   AAEMGVLATIGASQVRVTRLVKVAFFSTGDELRPVGTELAPGQIYDSNRYSIQGLLSRA
FT                   NVEWIDLGVIEDDPEAIRAAFRNAAANADMVLTSGGVSVGDADFTKQILDEEGEITFWK
FT                   LAIKPGKPFAFGRIGEAVFCGLPGNPVSSMVTFYKLVWPLLNKMQGLPQVKPLQLQAKL
FT                   KGNLRKFPGRVEYQRGVLSQNAQGEAEVSVTGGQGSGMLTSMSLANCFIILAQEQGDTP
FT                   DGSLVTVEPFNSVLAL"
FT   gene            57427..58194
FT                   /locus_tag="Shew_0047"
FT   CDS_pept        57427..58194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0047"
FT                   /product="[molybdopterin synthase] sulfurylase"
FT                   /note="TIGRFAM: molybdopterin synthase sulfurylase MoeB;
FT                   PFAM: UBA/THIF-type NAD/FAD binding protein; MoeZ/MoeB
FT                   domain protein; KEGG: shm:Shewmr7_0125 molybdopterin
FT                   synthase sulfurylase MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21920"
FT                   /db_xref="GOA:A3Q8X2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012730"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8X2"
FT                   /protein_id="ABO21920.1"
FT                   /translation="MEPNTQEEILSDAEILRYSRHISIKAMDFEGQERLKQAKVLVIGA
FT                   GGLGCASTQYLAVAGVGQLTLVDFDTVELSNLQRQVLHHDATIGQPKVESAKTSLMQLN
FT                   PHLRVETINAVLDDEQILALVAEHDLVMDCTDNIVVREQLNQACFQHKVPLVSAAAIRM
FT                   EGTVTVFDYGEQSPCYHCYSKLFGDQQLTCVESGILAPVVGMIGCLQAVEAIKVLAKMG
FT                   KTLSGRILMIDAMTMEFREMKLPKQPHCQVCGM"
FT   gene            complement(58313..59020)
FT                   /locus_tag="Shew_0048"
FT   CDS_pept        complement(58313..59020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0048"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sdn:Sden_0827 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21921"
FT                   /db_xref="GOA:A3Q8X3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8X3"
FT                   /protein_id="ABO21921.1"
FT                   /translation="MQKTILITGVGKRIGLYLAEAFLTRGYKVIGTYRSHYPSIDALTK
FT                   LGADLYPCDFTVQSQLEELIQTLKQNYRQLDAVIHNASLWLDDNDPAGADQVIAQMMQV
FT                   HVYAPYQLNLALTPLLQNQQAMTDIIHITDYVAQKGSKKHIAYAASKAALENMTLSFAA
FT                   KLAPKVKVNAIAPALICFNEHDDAAYREKARAKSVLAREGGEVEVLQAIDYLMQSQYVT
FT                   GRSLALDGGRQLK"
FT   gene            59401..60972
FT                   /locus_tag="Shew_0049"
FT   CDS_pept        59401..60972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0049"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: vpa:VP1905 transporter, BCCT
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21922"
FT                   /db_xref="GOA:A3Q8X4"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8X4"
FT                   /protein_id="ABO21922.1"
FT                   /translation="MTKGIDKYSIESTDYTIGQDNVQKWGFDVHNPVFGVSAGLIAAFL
FT                   LATLLTDAETAKSVLDGIKWKIIGAFDWLFIWSGNIFVIFCLGLILSPYGKIRLGGNEA
FT                   TADYSFLSWLSMLFAAGMGIGLMFWSVAEPVAYFTGWYETPLGVEPNTPEAAKLALGAT
FT                   MFHWGLHPWAIYGVVALSLAFFTYNKGMPLSIRSIFYPLLGDRAWGWAGHIVDILAVLA
FT                   TLFGLATSLGLGAQQAASGIHHVFGIEASLGLQMIVIVAVTLLAVVSVVRGIDGGVKVI
FT                   SNINMIVAFLLLILVAMIGYAVSLGSIPTTLMAYVENIIPLSNPHGRTDEAWFQGWTVF
FT                   YWAWWISWSPFVGMFIARVSKGRTVREFITAVLLVPTAVTLIWMSVFGGMAIDQVVNKV
FT                   GELGAKGLTDVPLAMFEMFDVLPFGTLLSIIAVVLVLVFFITSSDSGSLVIDSITAGGK
FT                   IDAPVPQRVFWALLEGAIAMALLWIGGTEAIQALQAGAISTALPFTVILLLMCVSLLKG
FT                   MRTERF"
FT   gene            complement(61076..61795)
FT                   /locus_tag="Shew_0050"
FT   CDS_pept        complement(61076..61795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0050"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: ppr:PBPRA2517 putative DNA
FT                   polymerase III, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21923"
FT                   /db_xref="GOA:A3Q8X5"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8X5"
FT                   /protein_id="ABO21923.1"
FT                   /translation="MLKKLLSPPSIDWPGKFEQRLKTTEHQGLRQYYLGGLPDPDTPLA
FT                   EVELLAMDFETTGLNVDKDDIVSIGTVPFTLRRIFLNRAQHWTVRPREQLAEESVIIHG
FT                   ITHSDILDAPDLSAIFEQVLEQMAGKIMVVHYQAIERLFLERALIRRIHQGIEFPLIDT
FT                   MALESEIQKRQHGGLLQRLKGDKPGSVRLGQSRSRYGLPSYPPHNALTDAIATAELLQA
FT                   QIAHHFDPSRPIKEFWC"
FT   gene            complement(61803..63692)
FT                   /locus_tag="Shew_0051"
FT   CDS_pept        complement(61803..63692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0051"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294,
FT                   nucleotidyltransferase putative; KEGG: vpa:VP1902 CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21924"
FT                   /db_xref="GOA:A3Q8X6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8X6"
FT                   /protein_id="ABO21924.1"
FT                   /translation="MEAELNEIQNFLSQYPPFNALPDEVVAMVSHHVEIAYYRQDTPII
FT                   HFGDQIHDLYMVRSGVVEVYRRKGELYNRLDSGDLFGQMGLLTNNKVRFPVKAIEDTLV
FT                   YCIPEAIFQQLYDQYDTFADFVEVEDSARLRQTVSNTSEQNDLTTSKVKTLLTRDAPVI
FT                   HKGESIQQAAIMMAQENVSALLVIDPDVLEDEDGDTSPLLGIITDRDLCTRVVAEGIDP
FT                   ATELAGVVSTEVITLDHNAYVYEAMLTMLRYNVHHLPVCKGRKPIGIIEATDIVRYESQ
FT                   NSLLLVSSIFQQQSLEELAALATQVKDSFVRLVNEDANSHMVGSAMSVIGRSFKQRILE
FT                   LAEEKLGPPPIPYCFLALGSMGRDEQLIVTDQDNAIILDDDFDKAKHDDYFSQLANFVC
FT                   DGLDSCGYSYCTGDIMATNPMWRMTRKEWEACFADWIDDPNPKALLNASIFFDLDGVYG
FT                   RLKWAEQLNGFIVRRARKNNRFLACLARNALNRTPPLGFFKDFVMEKDGRHNNSINLKR
FT                   RGTAPLADLIRVHALAVGSRARNSFERLDDIIDANILPKGRGEDLRDAMEFISMVRIRH
FT                   QALDVEQGIDPDNNIEPEHLSDFERRNLKDAFQILSNAQNFLKFRYNASNQFK"
FT   gene            complement(63788..64693)
FT                   /locus_tag="Shew_0052"
FT   CDS_pept        complement(63788..64693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0052"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   KEGG: she:Shewmr4_3713 DNA binding domain, excisionase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21925"
FT                   /db_xref="GOA:A3Q8X7"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8X7"
FT                   /protein_id="ABO21925.1"
FT                   /translation="MTEPSELVYMSAKQVAEYLDLNEKKVYSMANDRILPATKVTGKWL
FT                   FPKILIDRWVMDSCHSGMLSDRMHITGSDDPLLSMLVARLMSKIGKSDLISYSSTGSRM
FT                   GLDLLSRGYADVCTLHWGNVEERNIRHPALLKGYPNHQQWVMVHGYTRQQGLMMRSEMH
FT                   HRCQEEEKVIGQPWRWVGRQAGAGSQQHLEHWLIKQGASIEQLNPQITAYSERELAGFI
FT                   ARNEADIGFGCQSVALESGLSFVPLVTESFDFVMPQGIYFRRQLQALFEMLGSTQTRQL
FT                   AAQLGGYDLSQCGQMLWTAH"
FT   gene            complement(64717..65562)
FT                   /locus_tag="Shew_0053"
FT   CDS_pept        complement(64717..65562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0053"
FT                   /product="formate dehydrogenase, subunit FdhD"
FT                   /note="PFAM: formate dehydrogenase, subunit FdhD; KEGG:
FT                   she:Shewmr4_3714 formate dehydrogenase, subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21926"
FT                   /db_xref="GOA:A3Q8X8"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8X8"
FT                   /protein_id="ABO21926.1"
FT                   /translation="MTSFKHPTLVKTQADAPLTMAVKAINEQGEVVDKYIACERPLTLY
FT                   LNWRPIVTLMTLGARPEALALGYLKNQGFISDVHQLESVIVDWEVNSAAVITKESTAHL
FT                   EEKLAEKTVTTGCGQGTVYGGFMDGVEDIRLPTPQLKQSMLYSLLNNISAYNETYKNAG
FT                   AVHGCGLCEGDQIIGFVEDVGRHNAVDTLAGEMWLKQQGGGNKLFYTTGRLTSEMVIKV
FT                   AKMGIPVLLSRSGATQMGLELAQKLGITMIARAKGRHFLIYHGAENIEFDATPPKRNLG
FT                   "
FT   gene            65858..66328
FT                   /locus_tag="Shew_0054"
FT   CDS_pept        65858..66328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21927"
FT                   /db_xref="InterPro:IPR021736"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8X9"
FT                   /protein_id="ABO21927.1"
FT                   /translation="MQHTENQWPMYVSLKKVEKQMGRWTAESWELDQIVPATQPAPTGA
FT                   HIVMLELYKDERGSYRINLDMDNAMLYVVCDELEDGTWVPAYISADQNVAAGCLEGDTP
FT                   VLNFPMPKAIACWIEAFITRHGEVEICAHRRKHVNRRKNEGPSTNPDRGLVS"
FT   gene            66328..66918
FT                   /locus_tag="Shew_0055"
FT   CDS_pept        66328..66918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21928"
FT                   /db_xref="InterPro:IPR021735"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Y0"
FT                   /protein_id="ABO21928.1"
FT                   /translation="MSDKPSGLFARWTQRRQQVQAEEEAARLAEQAQETPVEPSVEAEG
FT                   ADGVEASDQVAPEEKKILTAEDLPDPEKIEVGGSFASFMADNVDPDAKTAALRALWKQP
FT                   HYHEIDGLLEYALDYTDQPKLTAEVSAELAKKVFRHLTKDEEKVEAAAETSETQLAQQE
FT                   NAAAQVEDNLDRASDEVSQNEPEIQASTKPPVV"
FT   gene            67100..68776
FT                   /locus_tag="Shew_0056"
FT   CDS_pept        67100..68776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0056"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: son:SO4506 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21929"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Y1"
FT                   /protein_id="ABO21929.1"
FT                   /translation="MSMHLETSDNLAHLKQVRQQVLGQTQILQNLIPPTVSYTTEGNVL
FT                   IIGPEDLARLAADKLANMGQRAILANESITSQDEDHLEKVMNAAEDVESYYNKLIEIKG
FT                   FLGQFQVKVEHDNGTADLSLVAIRKAHFDLILDLSQAPCINLEMLPPGYFYVGQDEAKL
FT                   TDAIAQLPELIGEFDKPRYVKVNSDICAHHRNGIDGCSRCLNFCPADAIASVDHKIEID
FT                   PYLCHGAGSCTNACPTGAISYDLPTPQALHSYLNKLVTRFRSAAQTAPVILFHDASLGA
FT                   SLIGDELPGAILPVELEEITVASMDHWMAALAWGARQILVLNTEATAPTLTQMLNGELK
FT                   LANEILDEMGQPQRVSVIEAKQIADLATLIEPSASWPMIVPGEFAATTKRETLYEAIDH
FT                   LNSQAASTDACLSKSNIPYGKVSVNTDNCTLCLSCVSTCPTQALTDGGEKPALYFVEQA
FT                   CVQCGLCESACPEKVISLTPQINFDATARQSRQTLNEEAPFECIRCGTPFATQSMVQRM
FT                   LDVVGGHSAFSANTERLKMCSDCRVKDMFEDILQDPEKQLR"
FT   gene            68787..69452
FT                   /locus_tag="Shew_0057"
FT   CDS_pept        68787..69452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0057"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein;
FT                   KEGG: son:SO4507 TorA specific chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21930"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Y2"
FT                   /protein_id="ABO21930.1"
FT                   /translation="MTELVREVSENDQLRADIYQLLAALLRKQPSAELLQFLSTLEIDA
FT                   DDDSDMTKAWLALKLAAEQFTPEQLEDEYFNIFLGVGSGEILPYGSWFMTGSLMDKPLA
FT                   LLRQDLAQLGFERSEEVKEPEDHVAALCEVMGTLILEAPGFRQLAFYQRHIGSWIERFC
FT                   DHLGRAPSAAFYATVAQLAKAFFVIEANEFEQLKLDIPVNCPGSEAEKIEPTASELAS"
FT   gene            69620..69820
FT                   /locus_tag="Shew_0058"
FT   CDS_pept        69620..69820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0058"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: she:Shewmr4_3719 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21931"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014177"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Y3"
FT                   /protein_id="ABO21931.1"
FT                   /translation="MKKQASDMGRRQLLKALALGSAAGAVATVSGQAAAATPAPQKDAA
FT                   HGDGYHETDHIRSYYASLRTK"
FT   sig_peptide     69620..69727
FT                   /locus_tag="Shew_0058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 36"
FT   gene            69872..72721
FT                   /locus_tag="Shew_0059"
FT   CDS_pept        69872..72721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0059"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: sfr:Sfri_0057 twin-arginine
FT                   translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21932"
FT                   /db_xref="GOA:A3Q8Y4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Y4"
FT                   /protein_id="ABO21932.1"
FT                   /translation="MRLTRKTDQAEVAKKPALGLSRRQFLQSAGLATGGIAAASMLGAG
FT                   MMRKAEAKEVPHDAPTEVKRTICSHCSVGCGIYAEVQNGVWTGQEPAFDHPFNAGGHCA
FT                   KGASLREHGHGEKRLKYPMKLEGGKWKRISWDQAIEEVGQKALDIRKESGPDSIFFMGS
FT                   AKFSNEQAYLYRKFAAMWGTNNVDHSARICHSTTVAGVANTWGYGAQTNSFNDIRNAKA
FT                   MMFIGSNPSEAHPVAMQHILEGKERGAKIIVVDPRFTRTAAKADEYVHIRPGTDIPYIY
FT                   GLLWHIFENKWEDQTFIDQRVYGMERIREAAAKWNPEEVENVVGVPKEQMYRVAKTLAE
FT                   TKPGTIVWCMGGTQHHIGNANTRAYCILQLALGNMGVSGGGTNIFRGHDNVQGATDFGL
FT                   LFDTLPGYYGLKTGSWKHWCNVWDLDYEWVKARFDQEQRLGQDPMTSTGIPCSRWHDGV
FT                   LEDKSKIAQKDNIRMSFFWGQSVNTETRGREVREALNKMDTVVVVDPFPTMAGVMHTRK
FT                   DGVYLLPAATQFETYGSVSASNRSLQWRSQVIEPLFESKPDHVIMYKLAKKWGIEKELC
FT                   KHIQVNGDEPLIEDIVREYNKGMWTIGYTGQSPERLKMHQENWGTFDIKSLEAPGGPAK
FT                   GETYGLPWPCWGTPEMKHPGTQILYRTDREVRFGGGNFRARYGVEHDGNNILAEGSYSK
FT                   GSEIKDGYPEFTDKMLKQLGWWDDLTAEEKAAAEGKNWKTDISGGIQRVAIKHGCIPFG
FT                   NAKARCIVWNFPDDIPVHREPLYTPRRDLVSKYPTYDDRMVARLPTLYKSIQDQDFAKE
FT                   FPLALTSGRLVEYEGGGEETRSNPWLAELQQEMFIEINPADAADRGLRDGDVVWVHSPE
FT                   GAKIKVQAMVTPRVIEGECFMPYHFAGMFEGESLEKSYPEGTVPYIIGESANTVLTYGY
FT                   DVVTQMQETKSSLCQITKA"
FT   sig_peptide     69872..70030
FT                   /locus_tag="Shew_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.867 at
FT                   residue 53"
FT   gene            72749..73339
FT                   /locus_tag="Shew_0060"
FT   CDS_pept        72749..73339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0060"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: shm:Shewmr7_3792 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21933"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Y5"
FT                   /protein_id="ABO21933.1"
FT                   /translation="MAVMKFLCDTKRCIECNGCVTACKNENDSALEWGIQRRRVVTIND
FT                   GQPGEASISVACMHCTDAPCQAVCPANCFYKTEDGLTLHNKDTCIGCGYCLYACPFGAP
FT                   QFPKKSTFGSRGKMDKCTFCAGGPEETFSEAERKKYGANRLAEGKLPMCAELCSTKALL
FT                   AGDAEVVSNIYRERIAARGNPNAIWGYTPKTGV"
FT   gene            73390..74397
FT                   /locus_tag="Shew_0061"
FT   CDS_pept        73390..74397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0061"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   son:SO4511 formate dehydrogenase, C subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21934"
FT                   /db_xref="GOA:A3Q8Y6"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Y6"
FT                   /protein_id="ABO21934.1"
FT                   /translation="MLLKSLRSLFTVLLLPLVLAMGLGLTTSAYAVDEQTSQQMANTSD
FT                   AELWRAVKSGDKGYTTAKGAEGGVMINVSAIEGTNVKNDYLTPVMALAVCGVFGAFLIF
FT                   YLVNGPSKLSHGFSGKMVLRWSKADLWIHWVMALSCLALIFTGLNIMLGKHVLQPYVGT
FT                   GIWGSLIYGSKTIHDYAGPLFIVAWAICVVKWMPLQTFKLYDLKWFLVVGGYINFGPFK
FT                   GKHPDSGFANAGEKMWFWTLTLFGLFIAVSGIMLVMPALELPREASMAALLVHGLSAII
FT                   IIAFTIVHIWMATVLSEGGMECMKSGYCDENWAVQHHNLWYDEIKDNGTLTYRD"
FT   sig_peptide     73390..73485
FT                   /locus_tag="Shew_0061"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 32"
FT   gene            74889..75086
FT                   /locus_tag="Shew_0062"
FT   CDS_pept        74889..75086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21935"
FT                   /db_xref="GOA:A3Q8Y7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014177"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Y7"
FT                   /protein_id="ABO21935.1"
FT                   /translation="MKKQQPDLNRRSLLKALTIGGTAGVAIAASGVSVANATESKSQEK
FT                   HADGYHETAHIRSYYNSLRS"
FT   sig_peptide     74889..75002
FT                   /locus_tag="Shew_0062"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.591 at
FT                   residue 38"
FT   gene            75104..77959
FT                   /locus_tag="Shew_0063"
FT   CDS_pept        75104..77959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0063"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: shm:Shewmr7_3795 twin-arginine
FT                   translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21936"
FT                   /db_xref="GOA:A3Q8Y8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Y8"
FT                   /protein_id="ABO21936.1"
FT                   /translation="MKLTRKTNEAVATAKPSLGISRRQFMKHAGITTGGIAAASLLGTG
FT                   MMRRAEAKDIPHDAPIEIKRTVCSACAVGCGLYAEVQNGVWTGQEPAFDHPFNAGGHCA
FT                   KGAALREHGHGEKRLKYPMKLVDGKWKKLSWEQAFNEVGDKMQSIRQESGPDSLYFMGS
FT                   AKFSNEGCYMYRKFAAMWGTNNVDHSARICHSTTVAGVANTWGYGAQTNSFNDIQNANA
FT                   IFFIGSNPAEAHPVAMQHILIAKEKNNAKIIVVDPRFSRTAAHSDLHCALRPGTDIPFI
FT                   YGMLWHIFENGWEDKAFIQQRVFEMDTIREEVKKFPPQEVANITGVSEEQVYQAAKLMA
FT                   ENRPGTVVWCMGGTQHHVGNANTRAYCILQLALGNMGVSGGGTNIFRGHDNVQGATDLG
FT                   LLFDTLPGYYGLKTGSWKHWSHVWDLDFDWVKGRFDQNEYLGRIPMNTPGIPCSRWHDG
FT                   VLETPEKLAQKDRVRMAFFWGQSVNTETRQREVRDALDKMDTVVVVDPFPTMAGVMHRR
FT                   KDGVYLLPAATQFETEGSVSNSGRSQQWREKVIEPLFESKTDIEIMYRLSQKLGFDKEY
FT                   TKRIAKDAKDMLVIEDITREINRGMWTIGMSGQSPERLKLHTQNWGTFSNKTLEAEGGP
FT                   AKGETYGLPWPCWGTPEQKHPGTQILYNTNKHVLQGGGNFRARYGVEYQGKNLLAEGSF
FT                   SKGSEIQDGYPEFSDKLLKQLGWWDDLTAEEKAEAEGKNWKTDLSGGIQRVAMKHGCIP
FT                   FGNAKARCIVWTFPDQVPVHREPLYTPRRDLVSKYPTYDDMQVHRLPTLYKSIQEKDTA
FT                   TKYPLGLTSGRLVEYEGGGEESRSNPWLAELQQEMFVEIHPGDAADRGIRNGDTVWLEG
FT                   AEGGRIKIKAMVTPRVKQGVTWMPYHFAGVMHGESLENNYPEGTVPYVIGESANTALTY
FT                   GYDPVTQMQETKASLCQITKA"
FT   sig_peptide     75104..75262
FT                   /locus_tag="Shew_0063"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.923 at
FT                   residue 53"
FT   gene            77980..78549
FT                   /locus_tag="Shew_0064"
FT   CDS_pept        77980..78549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0064"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: she:Shewmr4_3725 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21937"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Y9"
FT                   /protein_id="ABO21937.1"
FT                   /translation="MATMKFLCDTKRCIECNGCVTACKNENDSALEWGIQRRRVVTIND
FT                   GQPGEASISVACMHCTDAPCQAVCPANCFYKTEDGLTLHNKDTCIGCGYCLYACPFGAP
FT                   QFPKKGAFGSRGKMDKCTFCAGGPEENHSDAERQKYGSNRIAEGKLPMCAELCATKSLL
FT                   AGDAEVISNIFRERVAYRGSKNAIWG"
FT   gene            78618..79610
FT                   /locus_tag="Shew_0065"
FT   CDS_pept        78618..79610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0065"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   shm:Shewmr7_3797 formate dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21938"
FT                   /db_xref="GOA:A3Q8Z0"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Z0"
FT                   /protein_id="ABO21938.1"
FT                   /translation="MNKWFKQFSVILALVIGTTFSALSFAHGDATDHTHAATEGQIWSE
FT                   IQAGATGYTTSHGQFHNQPINSYDLRVLELRSDWLAPALMAALFGMIIIFVLFIKVNGI
FT                   SKLHHGFSGKMVYRWSKFDVSIHWLGAIPCLLLILTGLTLLAGRFFFQPYLGEGFWAGL
FT                   VYGAKQIHDYMAIPFMIGWALMTTLWAKNQLPKMYDVKWFLVVGGYINFGPFKGKHPDA
FT                   GFANAGEKMWFWAFAFFGLIISASGMLLLFPNLFEPSRTLSLIALVLHSVSAIVICAFS
FT                   IVHIFMATVMSEGGMECMVSGYCDENWATQHHNLWYDEIKANGTLKYKA"
FT   sig_peptide     78618..78698
FT                   /locus_tag="Shew_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.906 at
FT                   residue 27"
FT   gene            79885..80250
FT                   /locus_tag="Shew_0066"
FT   CDS_pept        79885..80250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21939"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Z1"
FT                   /protein_id="ABO21939.1"
FT                   /translation="MIRRILMALALSVSVSLSLSVSFSSLADTYRMTSEVSLQGEVLGA
FT                   PTLVIDKAEAERVMLADKYQFSVKVTPHDAAQVLVDFSLSGEGYETESQAIVDLDKAAL
FT                   LTFGDQTFIFLINRVGD"
FT   sig_peptide     79885..79968
FT                   /locus_tag="Shew_0066"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 28"
FT   gene            complement(80252..80761)
FT                   /locus_tag="Shew_0067"
FT   CDS_pept        complement(80252..80761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3099 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21940"
FT                   /db_xref="GOA:A3Q8Z2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Z2"
FT                   /protein_id="ABO21940.1"
FT                   /translation="MRVTMRHKGASGFTLIEMVVVIIILAILSVAAASRWISLTREARI
FT                   AQLKQLEASVQAANQLVYARSAILGLEKQPKASFFLNPGDSQKIQVRYGNPVWGGDAVT
FT                   QLLTVTMSEWFYGGRWTVEDIELRIGDRSLYKTPGDLMADGALACYLRVDTTADSVTTK
FT                   IMDNDC"
FT   sig_peptide     complement(80663..80761)
FT                   /locus_tag="Shew_0067"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.721) with cleavage site probability 0.619 at
FT                   residue 33"
FT   gene            80976..82355
FT                   /locus_tag="Shew_0068"
FT   CDS_pept        80976..82355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0068"
FT                   /product="fumarase"
FT                   /EC_number="4.2.1.2"
FT                   /note="PFAM: fumarate lyase; KEGG: pen:PSEEN1085 fumarate
FT                   hydratase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21941"
FT                   /db_xref="GOA:A3Q8Z3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Z3"
FT                   /protein_id="ABO21941.1"
FT                   /translation="MESKAVSDSMGDLNIPADALYGAQTARAIKNFPVSGRPMPRSFIR
FT                   ALLLAKLAAVEANVALRLLPPNIAPAVAQAVQELLADPQMMRHFPIDMFQTGSGTSSNM
FT                   NANEVLATLVSKSLGQAVHPNDVINLGQSSNDIIPSTIHISALLAVEQSLLPSLTLLSQ
FT                   TITTKAQQLADVTKTGRTHLMDAMPVRFDQVLGGWASQIDDCRERIASQGDALAQLPVG
FT                   GTAVGTGVNTHEEFSRLFCERLSALTRTQFRPADNLFSRMASHDTAVALSGQLKTLAVA
FT                   IMKISNDLRWMNSGPLAGLGEISLQPLQPGSSIMPGKVNPVIPESACMVAAQVMGKDMA
FT                   ITIAGQSGNFELNVMQPLIAVNLLESIEILSNVSRLLADKAIASFVVNRGKIADSLHRN
FT                   PILVTALSPKVGYVQAAKIVKQAYQEQRPILEVAMELTDLSEEELRRLLDPERLTRGGL
FT                   A"
FT   gene            complement(82400..83503)
FT                   /locus_tag="Shew_0069"
FT   CDS_pept        complement(82400..83503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdn:Sden_0559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21942"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Z4"
FT                   /protein_id="ABO21942.1"
FT                   /translation="MPRLTLPLLLVFSSLLGCNADQPRVEPPLANFAFTQAKLEALIQE
FT                   REPIFSSIQLEYQHTHYDRLEYADIFLDTQKQVPYLLLALSSEKGHSLTLGIKFDEWQL
FT                   LDCQIFSGPHRIDSFDCSDAQRLTQDDKSIFELRTREKQQYLRLSFVSDWLEYASSIGS
FT                   TLFSPREVDAGIEILTSNYFEPLINNQWCTADCDNPASSTLGITSYQALKRLVEHYPKR
FT                   KKVLVFDNFVGGSADDEVNMYTGLLIREQGLDTKVSRAGRVFSGATDLFAAGVRRTLEL
FT                   QDSKFSVAGNQQIGVHSWSDGELGRDATEISYSNAAHRSQATYFSRMLGKQGIPFYLFT
FT                   LTSAPSEGAHWMTQQEMARYRLTTEIR"
FT   sig_peptide     complement(83441..83503)
FT                   /locus_tag="Shew_0069"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.922 at
FT                   residue 21"
FT   gene            complement(83682..84845)
FT                   /locus_tag="Shew_0070"
FT   CDS_pept        complement(83682..84845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0070"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   sfr:Sfri_0073 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21943"
FT                   /db_xref="GOA:A3Q8Z5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Z5"
FT                   /protein_id="ABO21943.1"
FT                   /translation="MLNFDYRNPTQIVFGKDRLAELDKLIPAGARVMVTYGGGSVKRFG
FT                   TLDKVLSALGDRTVVEFGGIEANPQYETLAKAAKLAREESIDFLLAVGGGSVMDGTKFI
FT                   ALATRFEGDSDSLLFHGFAPVPVEADQVLPLGTIATLPATGSEMNAFGVVSYNGGKFPV
FT                   NHPSIYPTFSLLDPTLTFTLPKIQVANGVVDAFVHVLEQYATYPVDGRVQDRTAEGIMR
FT                   TLIEIGPITLEEPENYNARANLMWSATSALNGMIGAGVPFDWTTHMIGHELTAQFGIDH
FT                   AQTLAAVLPSVWRVRKIQKHAKLLQYAERVWDITEGDEASRVDLAIDKTEQFFQQLGLK
FT                   THLRDYDIAQEQIDDIVAALEAHGMTALSESGDLGLDISREILQLAW"
FT   gene            85050..85916
FT                   /locus_tag="Shew_0071"
FT   CDS_pept        85050..85916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0071"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein; KEGG: sfr:Sfri_0074 transcriptional regulator,
FT                   AraC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21944"
FT                   /db_xref="GOA:A3Q8Z6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Z6"
FT                   /protein_id="ABO21944.1"
FT                   /translation="MKSIAELMSELAPDEGMNDSVLPGIKLFRCSAYGARGPLCYSQGI
FT                   MIVGQGKKRIYLDNRVFDYDPQNTLVMTVPMPVECETFASKEEPVLVMMIDIDLAQLNR
FT                   LIPVMDNHHRVPQALNESRLPGYFIAPTGEAIECSIHRLLQALQSPLEAEALGEAMVLE
FT                   ILYRLLALPNAAPLYALALSHTRLSRIDKALSYLHKHYAASIEVDQLAALVNMSPSAFH
FT                   RCFKEVTASSPIQYLKKVRLNKAKELLQRPGVKVKQAAIEVGYESPAQFSREFKRYFSH
FT                   SPGECAR"
FT   gene            complement(85924..86445)
FT                   /locus_tag="Shew_0072"
FT   CDS_pept        complement(85924..86445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21945"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Z7"
FT                   /protein_id="ABO21945.1"
FT                   /translation="MKWNLLVSVLLTASLALFGYVKYTELAANNLANTQGLSALSKQIA
FT                   ETGSIIPAKTVAYFDLAACPEGWQPYTEGRGRFTLAVNHQENALSVRKLNDSGGEEKHK
FT                   LTLAELPKHTHVYDDWYYYDSGDEPEYATGEGDDVGMRQHQKRRTEPEGHSVAHNNMPP
FT                   FVVLLQCIKQ"
FT   sig_peptide     complement(86386..86445)
FT                   /locus_tag="Shew_0072"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.967 at
FT                   residue 20"
FT   gene            86819..88162
FT                   /locus_tag="Shew_0073"
FT   CDS_pept        86819..88162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0073"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; HemN domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   son:SO4520 coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21946"
FT                   /db_xref="GOA:A3Q8Z8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Z8"
FT                   /protein_id="ABO21946.1"
FT                   /translation="MSSSSIIQTAPGALIKPYQANITVPNWMLSSMERVMQYYVDKNLR
FT                   LDTQSASMMPAPVEGKKYMLYAHVPFCHTLCSFCTFHRFLFKEEKARAYFVSLRKEMEM
FT                   VKALGYDFESMYIGGGTTTVLEDELARTIEFAKKLFPSIKEVSCESDPQHLDSPGFKQL
FT                   EGLVDRMSIGVQSFNDDILAMTDRLEKFGSGQQTFDKIMAAKELFPIINVDLIFGFRGQ
FT                   TDEVIQHDLDMASRLDPRQITTYPLMITHQTRKSVKGKLAAPQGDMARQYRQILNSLNG
FT                   QYNQLSAWAFGKANNEGFDEYVIDYDEYLGVGSGSFSFLNDTLYVNTFSLRKYQENIAS
FT                   GRMGVEQQKNYSQKDVMQYRFLLGMFSGRLSRKYFRDTFGVNLDWALFKEMTSMKAIGA
FT                   IKNDPNDPDNLIVTDNGKMMGLLMMKEFYSGMDNVRAQLRKPLKPCDM"
FT   gene            88262..88885
FT                   /pseudo
FT                   /locus_tag="Shew_0074"
FT   gene            complement(88882..89097)
FT                   /locus_tag="Shew_0075"
FT   CDS_pept        complement(88882..89097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21947"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q8Z9"
FT                   /protein_id="ABO21947.1"
FT                   /translation="MDSILTLEELMDKPLCKEEKLRRYQQCLREFELLGYQDLFIEQIR
FT                   QEARQLEQKLARRAKANHRQAPKRLP"
FT   gene            89390..89677
FT                   /locus_tag="Shew_0076"
FT   CDS_pept        89390..89677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0076"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   nar:Saro_1420 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21948"
FT                   /db_xref="GOA:A3Q900"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q900"
FT                   /protein_id="ABO21948.1"
FT                   /translation="MIVRIGEFQAAPGQAEALKAFLLSLSDYICNSPGCLSYEVLCPVD
FT                   EAGRLMVIERWESAEQHRASVQAYPKDKMQAAMSLFAAPPSGGYYSLAQA"
FT   gene            89699..90652
FT                   /locus_tag="Shew_0077"
FT   CDS_pept        89699..90652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0077"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   she:Shewmr4_0961 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21949"
FT                   /db_xref="GOA:A3Q901"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q901"
FT                   /protein_id="ABO21949.1"
FT                   /translation="MIYFETERLICRAFERADLQAFTAYRADPEVARYQSWQDYQYQDA
FT                   LALFENLQQTPFGANGTWMQLALVCRQTQALVGDLALHFIDAQQVEIGFTLASEHQGKG
FT                   LAREALQGLLVYLFERLGKHRVSAITDVKNRAAWGLLERLGFRREAHYRDNIFFKGSWG
FT                   SEYGYGLLAREWRQAQVGEPLQEFRLIKRVAPLNDFLRLRQITGLTPRSREAAELGLPL
FT                   SLFGVHLLAGDRVLAMGRVVGDGALNFELVDIAVDPEYQGRGLGSAIMSAIMAYLDEMA
FT                   PKGAYITLMADVPALYLKFGFEYSRPASEGMYKLQA"
FT   gene            90789..91649
FT                   /locus_tag="Shew_0078"
FT   CDS_pept        90789..91649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0078"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: she:Shewmr4_0267
FT                   PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21950"
FT                   /db_xref="GOA:A3Q902"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q902"
FT                   /protein_id="ABO21950.1"
FT                   /translation="MAKILLVANLNCDRILRLDKPLKMGGRFHYQDGGQRLGGGGANTG
FT                   IGLVWAGHEVALVSQVGRDEIGDWLLAETSTLGIDCRLMQRYQQHTCEMLLVMTPDGER
FT                   TIIRPERPRFELAAPPNWRQWDALYINSSAEGAVSWAKTALPHSLVVAQLAKDNRERPC
FT                   HVLIASRADMQGRSELSPWQYGLSIAGDSLQAFIVTDGESGAILYQADSQTHVAAESAS
FT                   VVDTTGAGDAYAAGLIHGLVRGDEFCQAMAEGARWAAFAVATESSIPGAELKNYLENER
FT                   AKEEA"
FT   gene            complement(91853..93310)
FT                   /locus_tag="Shew_0079"
FT   CDS_pept        complement(91853..93310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0079"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; TAP domain protein;
FT                   KEGG: cps:CPS_0147 hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21951"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q903"
FT                   /protein_id="ABO21951.1"
FT                   /translation="MSLTHKPNLLAFGTLVMATALLGGCNQSSKSDTKKEVTSKVGTYA
FT                   SVDCSTFTKSKDLPKGASCGYLTVPEKHAIKGQSASKKTMEIAVLKIPATKTEAKADPV
FT                   VYLQGGPGYSAIDSLEDFTQSKAKYLWNDRDFYLVDQRGTGHAKPAYKCTEFNTVKGSI
FT                   EQVKACKARLKAKGVDFSAYQSVQSAHDFIMLRKALKLDSWNLYGASYGTRLAETIIRE
FT                   DSQGVRSVILDGVFPIEVNGLSDTPWATYATLDRIVANCDASINCASEILKPMIESIIE
FT                   RLQNQGEEQAAIRFVNYIASLAGDARVVPLILAIDKDLNIIINEKDNEEAEGYFAPMAL
FT                   SVVCAEEYAFLNQTALEGRNDKNWSTTTTLTVNKMFHEGFDIDSCKAWDVAAADSIETQ
FT                   AVTSNLPILVINGGNDHQTPPAWGELVVKNMPNAQLFTNPQGGHVQLTSQNPYRNCIDG
FT                   ITMAFLAAPDQKIKTQCTSMIPVFKYN"
FT   sig_peptide     complement(93218..93310)
FT                   /locus_tag="Shew_0079"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.469 at
FT                   residue 31"
FT   gene            complement(93574..94866)
FT                   /locus_tag="Shew_0080"
FT   CDS_pept        complement(93574..94866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0080"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: vpa:VPA1277 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21952"
FT                   /db_xref="GOA:A3Q904"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q904"
FT                   /protein_id="ABO21952.1"
FT                   /translation="MTRLFILIYSTALAIFFIAVIAMDQFELFSTDSLDATSLANEITA
FT                   TRNLVDKIGEAQGAQAAELALQGFAKDIHLALTRYDIKDDTLSEAIKQGVKDYGLYIED
FT                   VDENQAYFSLKSNPEVVFGIINDPDSPFINTLNRKEWFVFVELCAALALISIMVLFVIS
FT                   RRLARLEKTCIAFAYGDFSARASTSSLHSVGQLNLSFNIMADRISQLIQSHKNLTNAIA
FT                   HESRTPIFRIQCNLDMLDDSGVRPEQMQYLEGIQEDLNELGGMIEELLHFAKLERPDAQ
FT                   LSLTPTRLYPLLASQLEHLQFETPKRLQLSGDDSLIAPIANHLLLRATSNIIRNGYKYA
FT                   QSCVNVTLSSDETSVLIEIANDGPPIPRDYWQSIFEPFVRLDKARDRQSGGHGLGLAIA
FT                   KQIVRQHQGELTLGDSELGGPCFTLRLPKAE"
FT   sig_peptide     complement(94798..94866)
FT                   /locus_tag="Shew_0080"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.966 at
FT                   residue 23"
FT   gene            complement(94873..95607)
FT                   /locus_tag="Shew_0081"
FT   CDS_pept        complement(94873..95607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0081"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: hch:HCH_04118 response
FT                   regulator consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21953"
FT                   /db_xref="GOA:A3Q905"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q905"
FT                   /protein_id="ABO21953.1"
FT                   /translation="MLDLSTHSHDDSLDMSIKVVLVEDDEKISQLLSSYLTMQQIETVC
FT                   VHDGADAVATILAEQPDLVILDLMLPNLDGFSICRQLQPVFDGKILFLTASEDDMDQVA
FT                   ALEMGADDFIIKPIQPRVLLARIRMLMRRAKVSAPQEQHHLSFGELELNQQRKQCLLAG
FT                   EEISLTTSEFDLLWLLAAHADEILTREYLVKQIRGIEYDGIDRTIDNKIVVLRKKLGDN
FT                   PALPRRIITVRARGYLFVPDRW"
FT   gene            complement(95660..96109)
FT                   /locus_tag="Shew_0082"
FT   CDS_pept        complement(95660..96109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_0560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21954"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q906"
FT                   /protein_id="ABO21954.1"
FT                   /translation="MKTTPLAAFILSFILLLSGCATSYDTEKSFWSFGEGFDVVQIADD
FT                   SWQISFVGNDMTDRALARKYVLRKSAEIVQAHGYPYFALTTEQNHRDAVGNDTLGFGHK
FT                   DWGYGLGKVENETSVIVEVTGLQDKESMQTTKVYDAAYLIDHLTW"
FT   sig_peptide     complement(96038..96109)
FT                   /locus_tag="Shew_0082"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            96244..96936
FT                   /locus_tag="Shew_0083"
FT   CDS_pept        96244..96936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0083"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: 3-alpha; MOSC domain containing protein; KEGG:
FT                   she:Shewmr4_0269 MOSC domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21955"
FT                   /db_xref="GOA:A3Q907"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q907"
FT                   /protein_id="ABO21955.1"
FT                   /translation="MPSLVNKISGLYRGDKAEAFEGIPSMIDAKRACTRLVVGELGVEG
FT                   DGQADPKHHGGADRVLHHFPREHYGQYRRWDMMQGFKDVPAMGENISTVGLDETQVNIG
FT                   DIIAIGEVRLQVTQPRSPCFKLNHQFGHPEFALAMQTSGLCGWFYRVITPGEISLEDDI
FT                   RLIERRTDISLREAMSIYFSPTFDAGAYDRLASCDGLAKSWVNSLQRRLESRKIEPWEM
FT                   RLFGPNRP"
FT   gene            97018..97338
FT                   /locus_tag="Shew_0084"
FT   CDS_pept        97018..97338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21956"
FT                   /db_xref="GOA:A3Q908"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q908"
FT                   /protein_id="ABO21956.1"
FT                   /translation="MGVAVHLASFSGYLIPFGSILGPLIVWLMKREEIAFVDSCGRNCL
FT                   NFKISVMVYAIISMILMFVGIGFILLGVLAIFDIVVTIIAAMKASEGISYQYPLTIKFL
FT                   KA"
FT   gene            complement(97414..99330)
FT                   /locus_tag="Shew_0085"
FT   CDS_pept        complement(97414..99330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0085"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: shm:Shewmr7_3750
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21957"
FT                   /db_xref="GOA:A3Q909"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q909"
FT                   /protein_id="ABO21957.1"
FT                   /translation="MKLNMLTIKQKILLTVTVAVLLSTVLVGVLSQRSAKEVVEQRMLT
FT                   SELPNTLQAIRNKVEMDIATLMNAAEQLASSKMLKQWLVEGRPAETEPLVIAQLKDVQQ
FT                   QYKLVQASYADRQTAAYYTQDGFLRILTPDQDGWFFNYKNSGTERMLNVFTEANGEVKL
FT                   FINYQQPNDRGLVGLAKSLDDMVRLLKSFKIEDTGFVYLVDAKGDVKLHSDTSQIGKAS
FT                   LSSLYGGNVTRELLNKGDFGLTQTELDGETLLVASSYIPSMDWYLVAQVPRAEVFALLE
FT                   ESAYQILVWTVLIAAAFIGLSTFVSASVSQPIAKVADMLQDIGQGEGDLRQRLPVEGND
FT                   ELAQLAKGFNSFIEKIQHSIIEVTDTSVQLSHAAKDVANQAQQTQDDSQLQKDQTMMVV
FT                   TAINEMGATVHEIAGNAAQAADNAKDADNASSNGQIVVTRARDTINQLSQDVEQVGNVI
FT                   ESLATHTTSIGSILDVIRAVSDQTNLLALNAAIEAARAGEAGRGFAVVAEEVRNLASRT
FT                   AASTDEVQKMIDNLQSEAARAVEAMTQSKSRSQEGVQAVDEASHTLTEISQQIGAITDM
FT                   NIQVAAATEEQSTVVEDINRNVTEISEITQRTSETSQAVAQASQSLNQLAHRLDTLVAG
FT                   FKV"
FT   sig_peptide     complement(99223..99330)
FT                   /locus_tag="Shew_0085"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.701 at
FT                   residue 36"
FT   gene            complement(99591..101240)
FT                   /locus_tag="Shew_0086"
FT   CDS_pept        complement(99591..101240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0086"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; electron
FT                   transfer flavoprotein-ubiquinone oxidoreductase; KEGG:
FT                   son:SO4453 electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21958"
FT                   /db_xref="GOA:A3Q910"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q910"
FT                   /protein_id="ABO21958.1"
FT                   /translation="MERESMEFDVVIVGAGPAGLATACRLMQISQDAGQELTVCVVEKG
FT                   SEVGAHILSGAVFEPKVLEELFGDWKEQGAPLHTAVTHDELFMLSSDSASRAMPNAFIP
FT                   KTMHNDGNYIISVGNLARWLAERAEALGVEIFPGFPASELLFNEDGSVKGIIIGDMGVG
FT                   ADGEPKDSYEPGMELHAKYTVFSEGCRGHLGKQLIEKFHLDNGKTPQHYGLGFKEIWKV
FT                   PAEQHQQGKVVHTGGWPLTDGASGGGFLYHMEDNQIAVGLIIDLNYQNPHLSPFDEFQR
FT                   YKTHPVISQYLQGGERLCYGARAITKGGLNSLPKMSFPGGLIIGCDAGTLNFAKIKGTH
FT                   TAMKSGMIAAETICHALHAGVEGGKDLDCYQEKFEQSWLQDELYCSRNFGPAMHKFGAY
FT                   LGGAFNYIDQNWFGGKFPITLRDEKADYAQMAEVSAYSKIDYPKPDGKLSFDKLSSVYL
FT                   SNTFHEEDQLCHLRLKDERIPIEVNLVKFDEPAQRYCPAGVYEVVEEAGEKKFVINGQN
FT                   CIHCKTCDIKDPSQNITWVTPEGGGGPNYPNM"
FT   gene            101556..102569
FT                   /locus_tag="Shew_0087"
FT   CDS_pept        101556..102569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0087"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /note="KEGG: she:Shewmr4_0273 molybdenum cofactor
FT                   biosynthesis protein A; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein A; PFAM: Radical SAM domain protein;
FT                   molybdenum cofactor synthesis domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21959"
FT                   /db_xref="GOA:A3Q911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q911"
FT                   /protein_id="ABO21959.1"
FT                   /translation="MTHLPLLGKVIMSQLQDNFGRRFHYLRMSVTDVCNFKCTYCLPDG
FT                   YRPDGKPKFLDLNEIENLVGAFAEVGTQKIRITGGEPTLRKDFTDIVRIVADNDKIKTL
FT                   ATTTNGYRLEKHAKEWFDAGLRRINVSVDSLDPRMFYQITGENKFDEVMRGVDAALEAG
FT                   FERVKINAVLLKGLNDKDLPRFLHWIKHTPIDLRFIELMETGLGREYFKAHHLAGADIK
FT                   SQLVQDGWQLDQSAVDDGPAQNFSHDDFKGRIGLIMPYEKNFCASCNRLRVSAKGKLHL
FT                   CLFTEHGVDLRDLLQSHEQRAELIERLHGQLRAKKETHFLHDGITGVTQHLASIGG"
FT   gene            102681..103211
FT                   /locus_tag="Shew_0088"
FT   CDS_pept        102681..103211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0088"
FT                   /product="molybdenum cofactor biosynthesis protein B"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain;
FT                   molybdenum cofactor biosynthesis protein B; PFAM:
FT                   molybdopterin binding domain; KEGG: pat:Patl_2158
FT                   molybdenum cofactor biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21960"
FT                   /db_xref="GOA:A3Q912"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q912"
FT                   /protein_id="ABO21960.1"
FT                   /translation="MGHCTRTQFEPLNIAVLTLSDSRELSQDTSGQFLQDALLEAGHKL
FT                   AERRLIKDDKYQIRSVLSQWIASNDVQVIITTGGTGFTERDNTPQAVRPLFDREIEGFG
FT                   ELFRHITYTELGTSTVQSRALGGFANKTAIFCLPGSTGACKTGWNKILREQLDATHRPC
FT                   NFVMHVKKVAIDE"
FT   gene            103204..103680
FT                   /locus_tag="Shew_0089"
FT   CDS_pept        103204..103680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0089"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: shm:Shewmr7_3747 molybdenum cofactor biosynthesis
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21961"
FT                   /db_xref="GOA:A3Q913"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q913"
FT                   /protein_id="ABO21961.1"
FT                   /translation="MSSEFTHINADGNAHMVDVTEKAVTEREARAEAFIEMAPETLEMI
FT                   MSGSHHKGDVFATARIAGIQAAKKTSDLIPLCHPLMLTKVEVDLEAQPAHHRVRITSLC
FT                   KLSGKTGVEMEALTAASVAALTIYDMCKAVQKDMVISQTRLLEKRGGKSGHFKV"
FT   gene            103730..103981
FT                   /locus_tag="Shew_0090"
FT   CDS_pept        103730..103981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0090"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /note="TIGRFAM: molybdopterin converting factor, subunit 1;
FT                   PFAM: thiamineS protein; KEGG: shm:Shewmr7_3746
FT                   molybdopterin converting factor, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21962"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q914"
FT                   /protein_id="ABO21962.1"
FT                   /translation="MINVLFFAQVRELLGESTIEVEASEQTTTAEGLRALLAAKDDKWG
FT                   KVLASDKLLVAVNQTISSWDTQVEDGDEVAFFPPVTGG"
FT   gene            103983..104450
FT                   /locus_tag="Shew_0091"
FT   CDS_pept        103983..104450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0091"
FT                   /product="molybdopterin synthase subunit MoaE"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE; KEGG:
FT                   she:Shewmr4_0276 molybdopterin biosynthesis MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21963"
FT                   /db_xref="GOA:A3Q915"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q915"
FT                   /protein_id="ABO21963.1"
FT                   /translation="MSQASDRVLVQTQDFSVPDEYARIAADDSDGAVVTFVGKVRDFND
FT                   GSAVTDLTLEHYPGMTEAVLNQIAVEARERWPLTHVTIIHRVGTMALGEQIVFIGVTSA
FT                   HRKAAFAACEFLIDFLKTKAPFWKLEAGDQGKNWVEAKDADEQAAKMWEKQ"
FT   gene            104484..105308
FT                   /locus_tag="Shew_0092"
FT   CDS_pept        104484..105308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0092"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein, family 1; KEGG: shm:Shewmr7_3744
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21964"
FT                   /db_xref="GOA:A3Q916"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q916"
FT                   /protein_id="ABO21964.1"
FT                   /translation="MDLLRGFVLGCLLLLGVTPSWAAEVPAIAAASNIKFALDKIAADF
FT                   TQDTGKRVRISYGSSGNFVAQLRHGAPFELFLSADDKYIYQLHKLGVTQSDGEIYAIGR
FT                   LALAAPKRSPLSLDTELVGVKRLLEQGELKRFAIANPDHAPYGERAREALQHLGLWQPL
FT                   QPYLIYGENVSQAAQFALSGSTDGGIVALSLAMAPQFRAASHYVALPSEWHSPMNQRMV
FT                   LTPKAGETAKAFYAYLSQAKARAVFLEFGFGLPADSQGDEVVDAANQPAGDH"
FT   sig_peptide     104484..104552
FT                   /locus_tag="Shew_0092"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            105308..105988
FT                   /locus_tag="Shew_0093"
FT   CDS_pept        105308..105988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0093"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: shm:Shewmr7_3743 molybdate
FT                   ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21965"
FT                   /db_xref="GOA:A3Q917"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q917"
FT                   /protein_id="ABO21965.1"
FT                   /translation="MDWQALLLSIKLSCVTVLVLIPFAIWAGRFLAYRQFRGKSWLEAL
FT                   IMVPLVLPPTVIGYYLLVGLGSQSWLGQTLEALLGQQLVFHFSGLVVASVLVNIPFAIQ
FT                   PIQRAFESVPEEVRDAGACCGMSPAKVLFKIELPLVWPGVLTALVLCFSHVLGEFGVVL
FT                   MMGGNIAGETKTIAISIYDSVQAFDFAAAGQMSLLLLLFAITALALTTSLSRRLGGVSV
FT                   SRRR"
FT   gene            105969..107078
FT                   /locus_tag="Shew_0094"
FT   CDS_pept        105969..107078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0094"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter-related protein; SMART: AAA
FT                   ATPase; KEGG: shm:Shewmr7_3742 ABC transporter-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21966"
FT                   /db_xref="GOA:A3Q918"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q918"
FT                   /protein_id="ABO21966.1"
FT                   /translation="MSQDVADLSCKIFQQEGIALDAEFVCKAGEVLAVVGPSGGGKSTL
FT                   MRMIAGLTKPESGEIRYGDSVWFSSESGRYLTPQQRHLGYVPQHFGLFPNMTALANVVA
FT                   ALDHIPKAERVARAKDWLERVNLHGLPDRLPANLSGGQRQRVALARALAREPRVLLLDE
FT                   PFSAVDRETRERLYLELARLKEQLAIPVIMVTHDLNEALLLADRMILISQGTLLQQGSP
FT                   REVLSRPRNEAVAKQMGLRNLFDAHVVAQEAERQITWLRFGEHLIAGNYCEQLAIGAKV
FT                   RWVIPNQGVRFNSITKGRLCRSFNKLSITIESCLSMGETMRILASIKGVKHHLNAEVPL
FT                   HFAQKMGLAPGVETEVALKSELIHILEND"
FT   gene            107182..107541
FT                   /locus_tag="Shew_0095"
FT   CDS_pept        107182..107541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0095"
FT                   /product="conserved hypothetical protein 156"
FT                   /note="PFAM: nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; conserved hypothetical protein 156;
FT                   KEGG: vpa:VPA0694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21967"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q919"
FT                   /protein_id="ABO21967.1"
FT                   /translation="MMQKKLTGTLILSCVLTLPAFAAYNGPKAGGVIQQASDAHTAKDD
FT                   TPVELTGKLIKSLGDEKYLFRDSSGEVEVEIDNALWRDIEVSSDTTVTLRGEVDDEWRG
FT                   IEIEIDSIELVDQAH"
FT   sig_peptide     107182..107250
FT                   /locus_tag="Shew_0095"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 23"
FT   gene            107692..108228
FT                   /locus_tag="Shew_0096"
FT   CDS_pept        107692..108228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21968"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q920"
FT                   /protein_id="ABO21968.1"
FT                   /translation="MARWFISLMLLSGLAGVNAAQANPAVLELLSDSQSLTPQKMILQA
FT                   EKSYPGVISEFQIDVENGQLIYEISMINTKDDTISEFEFWAKDGRLIRQKVEALEADDK
FT                   DELKAVRLLKEMEQSFSQLLKLAMGDSNAHILEAQLDHDLGISYLELKLIDANGKHKIA
FT                   FDIENQRPLPLLKWD"
FT   sig_peptide     107692..107760
FT                   /locus_tag="Shew_0096"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.922 at
FT                   residue 23"
FT   gene            108232..108909
FT                   /locus_tag="Shew_0097"
FT   CDS_pept        108232..108909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0097"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: shm:Shewmr7_3740 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21969"
FT                   /db_xref="GOA:A3Q921"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q921"
FT                   /protein_id="ABO21969.1"
FT                   /translation="MKILLVEDDATTTEYVVKGFAEQGHNIETASDGHQGLLLATSMQY
FT                   DLVILDRMLPQLDGLKLLAALRATGNQTPVLILSALSHVDERVKGLRAGGDDYMTKPFA
FT                   FSELLVRAEKLMQRGNSAPAQTELKVGELVMELLTRKVTLAGSEILLQPKEFQLLKYLM
FT                   EHPNQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGFGELIETVRGAGYRLR
FT                   QGH"
FT   gene            108959..110218
FT                   /locus_tag="Shew_0098"
FT   CDS_pept        108959..110218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0098"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: son:SO4427 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21970"
FT                   /db_xref="GOA:A3Q922"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q922"
FT                   /protein_id="ABO21970.1"
FT                   /translation="MTLIIGTLLFGMYRQLINEQELQTNQHLAAEKLRYQQMALTLDRR
FT                   SFATQIRTADPKTALVVWRSSLDLVGALSLMPDDMPLLPETRDFPILTSGPDKLHILTG
FT                   GLVITRYGPVLIATRTDQLATLIERFVNAAITALMLTIVLTLALGYLFSKAILRRLVQY
FT                   NRLSRRIERGEYSTRLPVSWRQDEFDMLAGNFNQVLDTLEANLHAVRGATDNIAHDLRT
FT                   PLSHLRIGLEQLPQRPAEELDEASAILIEELDHCLATFDAMLSLTRIEEGQQDLELQPL
FT                   SLNDLCQDLFEMAEAMAESNGQTLSLSLDQDYSVMGDKYLLFQALFNLVDNAIKYSGEG
FT                   AKIEIIQQGNEILIRDNGPGIPDDATEKVFDRLVRLDPSRHNKGTGLGLSLVKAILQRH
FT                   NARIELSDNQPGLQVSIRFS"
FT   gene            110231..110905
FT                   /locus_tag="Shew_0099"
FT   CDS_pept        110231..110905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0099"
FT                   /product="pseudouridine synthase Rlu family protein,
FT                   TIGR01621"
FT                   /note="TIGRFAM: pseudouridine synthase Rlu family protein,
FT                   TIGR01621; PFAM: pseudouridine synthase; KEGG:
FT                   she:Shewmr4_0283 pseudouridine synthase Rlu family protein,
FT                   TIGR01621"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21971"
FT                   /db_xref="GOA:A3Q923"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006508"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q923"
FT                   /protein_id="ABO21971.1"
FT                   /translation="MYKIIADETDFLVIDKAPGVHFHSQDGSAGVMAQLESDLDIKLYS
FT                   VHRLDTMTSGLLLFAKSSEAAAAFTQRFSEHKVQKYYLALAKGKPKKKQGSIVGDMAKS
FT                   RRSMYKLLRSKENPAITQFFSQSVAEGLRLYLLKPLSGKTHQLRVALASLGVPILGDQL
FT                   YGGEDADRGYLHAYALGFEWQGQAYAYHQAPEQGEAFSLDGVKNQLQTWSKPEKLDWPK
FT                   RN"
FT   gene            110927..111094
FT                   /locus_tag="Shew_0100"
FT   CDS_pept        110927..111094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0100"
FT                   /product="protein of unknown function UPF0057"
FT                   /note="PFAM: protein of unknown function UPF0057; KEGG:
FT                   shm:Shewmr7_3736 protein of unknown function UPF0057"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21972"
FT                   /db_xref="GOA:A3Q924"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q924"
FT                   /protein_id="ABO21972.1"
FT                   /translation="MDTNKLLLVIIAILLPPVAVFLKSGVGKDLLINIILCLLFFIPGL
FT                   LHALWVVTKS"
FT   sig_peptide     110927..110995
FT                   /locus_tag="Shew_0100"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.806) with cleavage site probability 0.720 at
FT                   residue 23"
FT   gene            111320..111721
FT                   /locus_tag="Shew_0101"
FT   CDS_pept        111320..111721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0101"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bha:BH3085
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21973"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q925"
FT                   /protein_id="ABO21973.1"
FT                   /translation="MNKIWSPHTLAAPAANYHQCALVSQPSRWLNIAGQLGIDQQGTLA
FT                   PDTEGQIVQAWENLRAVLQANDMDLQDLVSVRLYLVDRGDLPAYQAAKARLGFDVGGLP
FT                   TTLLFVQGLFDPLWRVEIEAQAAKVFEGD"
FT   gene            111823..111978
FT                   /locus_tag="Shew_0102"
FT   CDS_pept        111823..111978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21974"
FT                   /db_xref="InterPro:IPR021677"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q926"
FT                   /protein_id="ABO21974.1"
FT                   /translation="MNRKKKINQTLKAKAKKANAKLHRSGKPKYIAKAERERLAEAAEA
FT                   PAEFVS"
FT   gene            112185..113408
FT                   /locus_tag="Shew_0103"
FT   CDS_pept        112185..113408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0103"
FT                   /product="sodium/glutamate symporter"
FT                   /note="PFAM: sodium/glutamate symporter; KEGG:
FT                   she:Shewmr4_1482 sodium/glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21975"
FT                   /db_xref="GOA:A3Q927"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q927"
FT                   /protein_id="ABO21975.1"
FT                   /translation="MNTVYTVGELESFLVAILVLFIGHSVNRHVASFRKYNIPEPIVGG
FT                   LLVAAVITILHSYNISLEFSLSMQNTLMLMFFSSVGLAASYKLLMKGGSKVFLFLAIAS
FT                   LYIIIQNAVGVSMATALGLEPLMGLIAGSITLSGGHGTGAAWAQTFSDQYGINTLELAM
FT                   AAATFGLVMGGIIGGPVAQRLINKNGLLSSYGVGGNHHKDHPDLVTYDQLEEDRVTAKS
FT                   ILEVLFILLLCVAGAKWFGSLIAYLDIGWLKMPDFVYALFFGVVITNITEVSRGFKINR
FT                   ECVDVLGTVSLALFLAMALMNLKLWEIFDLAVPLLIILLVQTAVLAVFAYWVTFKLMGA
FT                   NYDAAVMAGGHCGFGLGATPTAVMNMGALVSRTGPSPQAFMVVPIVGAFFIDIVNAIIL
FT                   QGYLSFIG"
FT   gene            complement(113461..113712)
FT                   /locus_tag="Shew_0104"
FT   CDS_pept        complement(113461..113712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0104"
FT                   /product="protein of unknown function DUF333"
FT                   /note="PFAM: protein of unknown function DUF333; KEGG:
FT                   shm:Shewmr7_0123 protein of unknown function DUF333"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21976"
FT                   /db_xref="InterPro:IPR005590"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q928"
FT                   /protein_id="ABO21976.1"
FT                   /translation="MKISHTIAALLFPLGLAACQTQVDKEQDAAESKPLSMANPAAVYC
FT                   ESLDGALDLDSGICTLPSGEQIEHWDLYRRDHPQAKNQ"
FT   sig_peptide     complement(113656..113712)
FT                   /locus_tag="Shew_0104"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.316 at
FT                   residue 19"
FT   gene            complement(113788..116325)
FT                   /locus_tag="Shew_0105"
FT   CDS_pept        complement(113788..116325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0105"
FT                   /product="peptidase M14, carboxypeptidase A"
FT                   /note="SMART: peptidase M14, carboxypeptidase A; KEGG:
FT                   pat:Patl_4232 peptidase M14, carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21977"
FT                   /db_xref="GOA:A3Q929"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033848"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q929"
FT                   /protein_id="ABO21977.1"
FT                   /translation="MLRLCLLLLSIVPLLLSFATNAQSVISVASATQSDSSLASPSEFL
FT                   GYPLGQWHLRHDQINYYLKQLAQNSPRVSLESTGQSHETRQQLTAVITSAANQARLAEI
FT                   VQGRQQVKAGKAPESPLIIWLAYSIHGDEASGAHAALEVSYRLSQNQEPWVQELLDKAV
FT                   VLITPSQNPDGLDRFSTWTNNYTGKVKVSDENHNEHRQNWPAGRRNHYFADLNRDWLFL
FT                   RHPESQGRIALFHKWQPHYLGDFHEMGHNQTFFFQPGVPTRTHPLTPKENQVITSKLAS
FT                   FHAKALDESKQRYFTKQMFDDFYYGKGSTYPDINGAVGILFEQASVRGQQQDSENGLLR
FT                   FSQAINNQIATSFSSLKGALALADELKQYQSRFYQRKDKHPPSGREAGFLLGAPGDPGR
FT                   RDDLAQLLSRHGIAFFYLKDKMQQGRHQYSQDDSLFVPINQPQKTLLLAMFDLRTEFED
FT                   ATFYDVSSWNLAFSYNLQMARNVNLNVDDLLTEPHARVPDTLSSNNVAVLIDWRQQNAA
FT                   PMLQTLLSEGVRVKFAAKPFSLKVDGQSLNMEAGTLQIPVAQAAMTPRELIDRLTSLAE
FT                   QYRVQLQGVDSGLASSGIDLGSPDFHDIAPIKALVVTGYGTSSAEVGELWYFMDNLIGA
FT                   PLTQVDISRLPSIELAAYTHLFLMDGSYANLDEKYARKLGQFAIEGGVIVAQKGALQWL
FT                   SKGNLLKSDIREKRYFSQLFATDGLSFGDKAKLDARQAIGGAVLALDLDTSHPITFGLG
FT                   TNRLPVLKNKVFGLSKSQAPFITAASYADEPLLDGFLAEEYQRSLSQTPAIVVERHGKG
FT                   ALVALADNLLFRNIWLGSQKVYANSLYFIPALH"
FT   sig_peptide     complement(116257..116325)
FT                   /locus_tag="Shew_0105"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.935 at
FT                   residue 23"
FT   gene            116533..117111
FT                   /locus_tag="Shew_0106"
FT   CDS_pept        116533..117111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0106"
FT                   /product="HesB/YadR/YfhF-family protein"
FT                   /note="PFAM: HesB/YadR/YfhF-family protein; nitrogen-fixing
FT                   NifU domain protein; KEGG: shm:Shewmr7_3880
FT                   HesB/YadR/YfhF-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21978"
FT                   /db_xref="GOA:A3Q930"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q930"
FT                   /protein_id="ABO21978.1"
FT                   /translation="MITISDAAQAHFVKLLADQPEGTHIRVFVISPGTPSAECGVSYCP
FT                   PDAVEADDIELEFNGFHAMVDEKSAPFLEDASIDFVTDQLGSQLTLKAPNAKMRKVDAD
FT                   APLKERIEYVIQSEINPQLASHGGNIMLVDIDEAGIAILQFGGGCNGCSMVDVTLKDGI
FT                   EKQLLDMFPGELTGVRDVTEHQHGEHSYQ"
FT   gene            complement(117145..118491)
FT                   /locus_tag="Shew_0107"
FT   CDS_pept        complement(117145..118491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0107"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: son:SO4617
FT                   DNA-damage-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21979"
FT                   /db_xref="GOA:A3Q931"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q931"
FT                   /protein_id="ABO21979.1"
FT                   /translation="MSPLNLLLNKQKNSQLFALAVPMILSNITVPLLGLVDTAVVGHLS
FT                   NAYYLGGVAVGSTVITLILWILGFLRMSTTGLVAQAFGAKELHTQYRLLMQSASLALLL
FT                   SLLVLLLQQPIITAAMALSDASEQVQYYSQAYFNIRIWSTPFALVNLALLGWLLGRQQP
FT                   KAAMWQLIAANLTNILLDLLFVIGLGWGVEGAALASVLADMTGFAVAASMVVRTIKREG
FT                   GFEFLPLLRSLSLNSYQRLVRLNLDIFIRSLCLQLAFAFMTFQGANLGDNTVAANAVLL
FT                   NLLLLISYALDGIAYYGEAEVGRAVGEKSHQRMTQSVTLAGLWSAIFALLFTLFFALWG
FT                   EQIIKLLTNISEVRQEALAYLGWVVALPLLAFGSYLFDGVYIGAAQGKAMRNTMILATF
FT                   GVFFPTWLLLQDYGNHALWAAMSLFMVTRSLSLALDYRYRLSKTLTKTG"
FT   gene            118514..119560
FT                   /locus_tag="Shew_0108"
FT   CDS_pept        118514..119560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0108"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   shm:Shewmr7_3874 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21980"
FT                   /db_xref="GOA:A3Q932"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q932"
FT                   /protein_id="ABO21980.1"
FT                   /translation="MFRSVIAALLACLSYSAHAVVILQYHHVSEDTPKVTSVIPAQFRE
FT                   QMSYLRENGFKVKPLTHVVEAIKQGRELADKTVAITFDDGYQNIADTAHPILKEFGYPY
FT                   TIFISIDPIERKHKNVMSWATLKRLSDEGVTLANHSWGHEHLIRRLHGEDEQTWLTRIT
FT                   ENLLATEAEIEAKTGQSVKMLAYPYGEYNTAIETLVQKLGFVGFGQQSGAAGGYSSLTA
FT                   LPRFPVAGAYADLTSLKAKLYSLNMPVLALTPRNTQLPLGQWRPEMQVTLDMADIVASQ
FT                   VMCFVQGQGAMKPSWESEDTFSIQAVTDLPPGRSRYNCTAPSKASGRYYWFSQAWVRPK
FT                   NDGTWVKE"
FT   sig_peptide     118514..118573
FT                   /locus_tag="Shew_0108"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 20"
FT   gene            complement(119619..120665)
FT                   /locus_tag="Shew_0109"
FT   CDS_pept        complement(119619..120665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0109"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: xcb:XC_2323 glutamate methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21981"
FT                   /db_xref="GOA:A3Q933"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q933"
FT                   /protein_id="ABO21981.1"
FT                   /translation="MIKVLIIDDSPLVRQLLTHMLSQAPDIKVVATAEDPYEARSLIKQ
FT                   FNPDVLTLDIEMPKMDGIAFLRNLMKLRPMPVVMVSTLTHKGAEITLEALALGAVDFIS
FT                   KPKSDLTNTLLDYTDELIDKVRTAAVSHVKPLTRPVVQVASNNKFSLTGDKLIAIGAST
FT                   GGTEAIQRVITPLPANTPPIVITQHIPAAFSLSFAKRLDSHSAMKVIEAKGGELIASGT
FT                   AYLAPGDAHLTVEKHGARLYTKLLDSDPVNRHKPAVDVLFNSIADCFGANTIGILLTGM
FT                   GKDGALGLERLKAAGSHTIIQDEASSVVWGMPGAAAELNAHREILHLDKIPARLMQLLN
FT                   TSKTAEIS"
FT   gene            complement(120694..121560)
FT                   /locus_tag="Shew_0110"
FT   CDS_pept        complement(120694..121560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0110"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /note="PFAM: MCP methyltransferase, CheR-type;
FT                   Methyltransferase type 12; KEGG: sde:Sde_3104 biotin
FT                   biosynthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21982"
FT                   /db_xref="GOA:A3Q934"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q934"
FT                   /protein_id="ABO21982.1"
FT                   /translation="MQLEQSNEKEFPMAQQDFEFIRQLAYRESGIVLPDRKQHMVYSRL
FT                   SRRLRALKLNNFHQYCQRLEDDGGELINFINALTTNLTSFFREAHHFDYLERHLVPQWQ
FT                   QRRDRRLRVWSSACSTGEEAYSIAMILAKHFPPASWDLKILATDLDTNVLDKARAGIYS
FT                   QEAMANLPKALLNQYVEPGPHPGEVMLCDSLKRLIHFKQLNLLGEWPMHGPFDLIFCRN
FT                   VLIYFDAQTKVKIIRQFRRLLADDGHLFIGHSETLHNISSDFKLIGQTIYQPQHAALVR
FT                   QRLGVGA"
FT   gene            complement(121633..124227)
FT                   /locus_tag="Shew_0111"
FT   CDS_pept        complement(121633..124227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0111"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; PAS fold-4
FT                   domain protein; SMART: PAS domain containing protein; KEGG:
FT                   cvi:CV3438 probable methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21983"
FT                   /db_xref="GOA:A3Q935"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q935"
FT                   /protein_id="ABO21983.1"
FT                   /translation="MDAMNSKTGNANNLPIIGLLIAGVAALLAFTQQPSLWVGIAQVVA
FT                   IAVIALGIQQQGQTQHSLRQAFEEIHQALEGKNPPSFSAFDYPHWPEISQSLTQQWHAN
FT                   QGNQAQLRALEICQANVMLADPQGNINFLNQSLRQTLEKAESDIQQAIASFSVDTLIGT
FT                   NMDTFHQQPSHQQNIIAKLQRPHSAQIKVGSRIFSLIASPVFDDKHQRIATVVEWQDKT
FT                   EALAKADAENKLAQENSRIKQALDVCRANVMVADADYNIIYLNDSVTQMLKDNEQTLQQ
FT                   TLTKFNTNSLLGSNIDIFHQNPAHQRKMLDRLTGSYDTSIQVAGLDFTLIATPVFENGV
FT                   RTGTVVEWQDVTEKLAKEAKERQLAAENARIKQALDNVSSNTMVADADLNIIYMNKAVS
FT                   QMFKQAQNDIAKDLPNFDASNLMGVNIDNFHKNPSHQRNLLKTLTTTYTSQLKVGGRTF
FT                   QVVANPIRDPNGESIGTVVEWADRTAEVAIEHEIDSIIGAASKGDLSLRVGTQDKEGFF
FT                   LNLSNGLNRLVGIADQVIGDVVNMFDGLAKGDLNRQIQGEYQGQFGKLQADANATAAKL
FT                   TEVLDGINQSANTVTSGAEEIAQGNADLSQRTEEQAASLEETASSMEEMTATVTQSAQN
FT                   ATVANQLAQEANTKAAHGGKVVEQAVTAMEAINESSKRIADIIGVIDEIAFQTNLLALN
FT                   AAVEAARAGEQGRGFAVVAGEVRNLAQRSAGAAKEIKELIRDSVTKVTDGTQLVNQSGE
FT                   TLEDIVQAVTKVADMISQISIASDQQSAGIQEVNKAISQMDEMTQQNAALVEQVSAAGD
FT                   AMAEQARNMKSQLGFFQSQAPMHSGMTSAPLSLVAGDSHGPLNISNEEWNEF"
FT   sig_peptide     complement(124132..124227)
FT                   /locus_tag="Shew_0111"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.700 at
FT                   residue 32"
FT   gene            complement(124250..124807)
FT                   /locus_tag="Shew_0112"
FT   CDS_pept        complement(124250..124807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0112"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: sde:Sde_3106 biotin
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21984"
FT                   /db_xref="GOA:A3Q936"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q936"
FT                   /protein_id="ABO21984.1"
FT                   /translation="MTQADEAGITLTAKDDASDQYLTFIMADEEYGVDILSVQEIRGWE
FT                   PTTVIPNSPSHVKGVINLRGTIVPIIDLRQRFGIASLDYGPTTVVIVIKVCVGDEHKVI
FT                   GIVVDAVSDVFSVHHRDLRDAPDFGEETDLTFIKGLANLADKMVILLDIDTLLSSEVLP
FT                   EAAQLSNIINNIDAASTQAVSA"
FT   gene            complement(124836..126896)
FT                   /locus_tag="Shew_0113"
FT   CDS_pept        complement(124836..126896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0113"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: CheW domain protein; ATP-binding region,
FT                   ATPase domain protein domain protein; Signal transducing
FT                   histidine kinase, homodimeric; Hpt domain protein; KEGG:
FT                   tcx:Tcr_1612 CheA signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21985"
FT                   /db_xref="GOA:A3Q937"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q937"
FT                   /protein_id="ABO21985.1"
FT                   /translation="MEIDLSQFSQVFFEESLEGLESMESELLKLDIAAPDPEAINTIFR
FT                   AAHSIKGGSGTFGFNQVANYTHLLETLLDEIRDGRREMTSHHQDILLLSVDLLRNMLDA
FT                   VMHQQTFDDPMLSDLEQKFAAELSQGESQEDETQREPETPEQTTWQISFKAGTDILRYG
FT                   NDPLLMFNELGQCGELSVELLPQEIPDFTQYDPEACYLAWSLTLTTDQPLSRLKEAFEW
FT                   VEDECDIDYQAQPKASEASEITTEKEIEATAESDIQASTQTTTPASVQPEKPASQTRPS
FT                   VVSSKTQDAGSIRVSIEKIDLLINMVGELVITQAMLGQIGQQEEMTPESFITMKQGLEQ
FT                   LASHTRDLQESVMQIRMLPISFAFNRFPRLVRDIGQQLGKKVELILKGEDTELDKTVME
FT                   KIVDPMVHLVRNSLDHGLETPEVRRQKGKPETGTLTLNAFHQGGNIIIEIIDDGAGLNT
FT                   QKILDKARAKGLVGSDEELSEEAIHQLIFKPGFSTAETVSDLSGRGVGMDVVLRNIHEL
FT                   NGTIELKSTQDKGSRFTIRLPLTLAILDGQLVRIGTHTYVVPLVAIHESLEVPAAHINR
FT                   LSEEHEVIRLRDEYLPVLKVYEAFHHEADAKQIKDGLVMVVDANNDKVGLLVDELLSQQ
FT                   QVVIKSLEDNYSKVAGISGATILGDGTVALIIDIAGLVSLAGINSTQEHAA"
FT   gene            complement(126918..127280)
FT                   /locus_tag="Shew_0114"
FT   CDS_pept        complement(126918..127280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0114"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   hch:HCH_00454 FOG: CheY-like receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21986"
FT                   /db_xref="GOA:A3Q938"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q938"
FT                   /protein_id="ABO21986.1"
FT                   /translation="MKKILAVDDSASMRQMVGFTLKTAGFDVTEACNGDEALTQAKSQD
FT                   YDLVISDVNMPVMDGITLIRNLRSLPNYKFTPLLMLTTESGSEKKQEGRSAGATGWIVK
FT                   PFNPDQLLATVNKVLR"
FT   gene            complement(127277..127576)
FT                   /locus_tag="Shew_0115"
FT   CDS_pept        complement(127277..127576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21987"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q939"
FT                   /protein_id="ABO21987.1"
FT                   /translation="MTQSPIRLASELTIRNIQQVHHDIAEQLTASDTLCIDASQLTRVD
FT                   TSGAQLLYFLHHYCQTHHHAIEWTPPAEEVEHTLAELGLDATQIFALAQERIQE"
FT   gene            complement(127740..128375)
FT                   /locus_tag="Shew_0116"
FT   CDS_pept        complement(127740..128375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0116"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   son:SO4615 SCO1/SenC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21988"
FT                   /db_xref="GOA:A3Q940"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q940"
FT                   /protein_id="ABO21988.1"
FT                   /translation="MKPLWIVLTLFIFSGLGAIAAVNFTGQATPPELLTSYRYPQQRPL
FT                   SPFELTDQNGKAFTNARLKDKWSLFFVGYTSCPDVCPTTLGKLAAAYQQLEGVVDLQVV
FT                   FLSVDPARDTQVKLKDYINFFNPNFIAVTAPHSQLLPLTRELGFVYTMVGEGENYQVDH
FT                   SASMVLISPDGTRVATVKPTSLDPRQLPQIRNKNLIHDVIALATHYGE"
FT   sig_peptide     complement(128313..128375)
FT                   /locus_tag="Shew_0116"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.549 at
FT                   residue 21"
FT   gene            complement(128380..129282)
FT                   /locus_tag="Shew_0117"
FT   CDS_pept        complement(128380..129282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0117"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: sdn:Sden_3524 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21989"
FT                   /db_xref="GOA:A3Q941"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q941"
FT                   /protein_id="ABO21989.1"
FT                   /translation="MAKPMTITKPVATPLPWRAYLEMTKPRVVALMLLTVLVGMCLAVP
FT                   GAVPVQPLIAGLVGIGMMAGAAAAYNHLIDRRIDGLMARTYNRPLPKGRISITKALTFA
FT                   TAMAILGFALLYWAVNPLTAWLTFASLIGYAVIYTAYLKRATPQNIVVGGLAGAMPPLL
FT                   GWTAITGEFHGHALLLVIIIFAWTPPHFWALAIHRRAEYAKVDVPMLPVTHGVEFTKTC
FT                   IMLYTVLLALACLYPVLVGMCGPLYLVGSTLLSCGFIYKAWQLKYRDKPGLAMQVFRFS
FT                   IYHLMLLFLLLLVDHYLWS"
FT   sig_peptide     complement(129151..129282)
FT                   /locus_tag="Shew_0117"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.852) with cleavage site probability 0.839 at
FT                   residue 44"
FT   gene            complement(129295..130278)
FT                   /locus_tag="Shew_0118"
FT   CDS_pept        complement(129295..130278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0118"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   sdn:Sden_3523 cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21990"
FT                   /db_xref="GOA:A3Q942"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q942"
FT                   /protein_id="ABO21990.1"
FT                   /translation="MQMTSLLKLTLVFTLCVILMGAYTRLSDAGLGCPDWPGCYGMIKV
FT                   PTQSHELAKAQDSFPEHTVEPEKAWLEMIHRYIAGTLGLLVAFILFISFRRPDAPKKLP
FT                   SFIALLILFQAALGMWTVTMKLMPVVVMSHLIGGFTLISLLWLLYLRTKPLRLPGGEPR
FT                   LRKLAPYALFCLSLLVLQIILGGWTSSNYAALACTTLPICEGDWVSNLDPLHAFYPLHK
FT                   TEGSYEFGILDYSSRMTIHVAHRFGAIITATALLWLVYCMIKFSHSQLLKRSAWVLLGL
FT                   LCLQIALGISNVVLHLPLGIAVSHNAGAALLLLTLVFINYALWRKA"
FT   sig_peptide     complement(130189..130278)
FT                   /locus_tag="Shew_0118"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.362 at
FT                   residue 30"
FT   gene            complement(130278..130829)
FT                   /locus_tag="Shew_0119"
FT   CDS_pept        complement(130278..130829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21991"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q943"
FT                   /protein_id="ABO21991.1"
FT                   /translation="MRSPKSRGAKPLLILLLVFVLPVAVAKLVLSLNLYHGGVTNKGEL
FT                   LPPDTNYARLAMANPMPKHWQMIYLLPSQCDQACMNRLYILHQSQIALGRDQHRVNPII
FT                   LLQADSDLAALQESEFSFTTAQATEALSQMLTREEIIIVDPLGSLVMRYAQVEDEQAQL
FT                   MLGKAMIADLRKMLKLSRVG"
FT   sig_peptide     complement(130749..130829)
FT                   /locus_tag="Shew_0119"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.952 at
FT                   residue 27"
FT   gene            complement(131002..131757)
FT                   /locus_tag="Shew_0120"
FT   CDS_pept        complement(131002..131757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21992"
FT                   /db_xref="GOA:A3Q944"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q944"
FT                   /protein_id="ABO21992.1"
FT                   /translation="MKAPTVRGGTIFLVLVTLLVFTILVKLGLWQLDRAAEKQALQQAL
FT                   TVKQAAAPLDYQGLLALAESESLTGYRLEVQATPVDAPIILLDNQVYEGHVGYLAYQVM
FT                   RVETESEADDPLLLVELGFIDSGLDRQKLPQLTKLSREVTLSGRVYQRASNPLSQHLLA
FT                   ETGSPMRIQNLNLPELSQTLGLPLAPAILQPEAIPGSALPHPWQPIPMSALKHQGYALQ
FT                   WFSMATAFLILMAYLLIFKRKNKESSKDK"
FT   gene            131798..131974
FT                   /locus_tag="Shew_0121"
FT   CDS_pept        131798..131974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21993"
FT                   /db_xref="GOA:A3Q945"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q945"
FT                   /protein_id="ABO21993.1"
FT                   /translation="MVFIIFNLGRALFVLVKGEGKAPMSQYLGRRVLFSVLVVLLLLIA
FT                   LGLGIITPNPRPY"
FT   gene            complement(131990..132865)
FT                   /locus_tag="Shew_0122"
FT   CDS_pept        complement(131990..132865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0122"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="PFAM: cytochrome c oxidase, subunit III; KEGG:
FT                   shm:Shewmr7_3867 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21994"
FT                   /db_xref="GOA:A3Q946"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q946"
FT                   /protein_id="ABO21994.1"
FT                   /translation="MTSKHEHYYVPAQSAWPIIGAFGLFLIAYGAGSYVQQLQTEQTSG
FT                   GYILTAGIAVILYMVFGWFRTVIGESMSGLYSKQMDRSFRQGMSWFIFSEVMFFAAFFG
FT                   ALLYARTIAVPWLGGASNNAMTHEVLWPNFQAVWPLVTTPDGTKTEAMGWTGLPLYNTI
FT                   ILLTSSVTLHFAHVSLEKSKRTALTLWLGITILLGLAFLFLQAKEYAHAYQEMGLTLSS
FT                   GVYGNTFFLLTGFHGMHVTLGTIFLFVLFLRVLRGHFTPDKHFAFQAGSWYWHFVDVVW
FT                   LCLFVFVYVL"
FT   gene            complement(132862..133431)
FT                   /locus_tag="Shew_0123"
FT   CDS_pept        complement(132862..133431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0123"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: shm:Shewmr7_3866 cytochrome c oxidase
FT                   assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21995"
FT                   /db_xref="GOA:A3Q947"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q947"
FT                   /protein_id="ABO21995.1"
FT                   /translation="MTDTKAYSNRKLIGLLLLGCVGMFGFGFALVPLYDVLCEKLGING
FT                   KTQSTAAEYKAVTIDTSRTVTVEFMAQTQKDMPWVFAPEMKRIQVHPGEVIRTQFHAKN
FT                   LSAQQIIGQAIPSVSPGQGAAYFHKTECFCFNQQKLDANADAQLPLIFYVDTELPEQIS
FT                   TLTLSYTLYNITDKGYVDDVEQGAAK"
FT   sig_peptide     complement(133342..133431)
FT                   /locus_tag="Shew_0123"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.981 at
FT                   residue 30"
FT   gene            complement(133433..135043)
FT                   /locus_tag="Shew_0124"
FT   CDS_pept        complement(133433..135043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0124"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   shm:Shewmr7_3865 cytochrome-c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21996"
FT                   /db_xref="GOA:A3Q948"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q948"
FT                   /protein_id="ABO21996.1"
FT                   /translation="MNAITREADMDATHIGEHSTHHEEHPTGIKRWLFTTNHKDIGTLY
FT                   LWFSFIMFLTGGAMAMVIRAELFQPGLQLVEPNFFNQMTTVHGLIMVFGAVMPAFTGLA
FT                   NWLIPMMIGAPDMALPRMNNWSFWILPFAFAILLSSLFMEGGGPNFGWTFYAPLSTAYS
FT                   PDSTALFVFSVHIMGISSIMGAINVIVTIVNMRAPGMSWMKLPLFVWTWLITAFLLIAV
FT                   MPVLAGTVTMVLTDKFFGTSFFDAAGGGDPVMFQHIFWFFGHPEVYIMILPSFGIISAI
FT                   VPAFSRKKLFGYSSMVYATASIAILSFLVWAHHMFTTGMPVFAELFFMYCTMLIAVPTG
FT                   VKVFNWVATLWRGSLTFETPMLFALAFIILFTIGGFSGLMLAITPVDFQYHDTYFVVAH
FT                   FHYVLVSGAIFSIMAAAYYWLPKWTGHMYSEKLGKLHFWCSVISVNVLFFPMHFLGLAG
FT                   MPRRIPDYSIQFADVNQIVSIGGFAFGLSQLIFLVVVIKCIRGGEPAPSKPWDGAEGLE
FT                   WTLPSPAPYHSFSTPPEVK"
FT   gene            complement(135053..136618)
FT                   /locus_tag="Shew_0125"
FT   CDS_pept        complement(135053..136618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0125"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="PFAM: cytochrome c oxidase, subunit II; cytochrome
FT                   c, class I; cytochrome C oxidase subunit II, transmembrane
FT                   region; KEGG: shm:Shewmr7_3864 cytochrome c oxidase,
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21997"
FT                   /db_xref="GOA:A3Q949"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q949"
FT                   /protein_id="ABO21997.1"
FT                   /translation="MKQVLCCLLALLFTPTILAADMPLNMTSGVTEISNKVFSLHMTIL
FT                   YICCAIGLVVFGVMIYAIINHRRSKGAVAANFHESTKVEIAWTLVPFVILILMAIPATK
FT                   TLIAMEDPSNADLTIKITGSQWKWHYSYFDQDISYYSLLATPREQIEGKETKGEHYLLE
FT                   VDKPLVLPVNRKIRFLMTSEDVIHSWWVPAFAVKKDANPGFINEAWTRIDKPGIYRGQC
FT                   AELCGKDHGFMPIVVQVLSEADFDNWIVEQEAQASAAAAEAQAALSKTLSKEELMAQGE
FT                   QVYMARCAACHQPNGAGLPGVFPSLIGSPIIKGPVADHLDVVLHGRSGTAMQAFAQQLT
FT                   ATEIAAVVTFERNAWGNDTGDTVQAADVNQANSGASSGADTGADAAAEAVQSVPTPAAD
FT                   SSAAASSTAEDPQAPVLDDLTMDELMAKGEQVYLGHCAACHQATGMGLPGAFPALKGSA
FT                   IATGPVKNHLDIVLHGKPGTAMQAFASQLTPQEIASVITFERNAWGNNTGDMVQATDVK
FT                   QQGQ"
FT   sig_peptide     complement(136559..136618)
FT                   /locus_tag="Shew_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 20"
FT   gene            complement(137017..137526)
FT                   /locus_tag="Shew_0126"
FT   CDS_pept        complement(137017..137526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21998"
FT                   /db_xref="GOA:A3Q950"
FT                   /db_xref="InterPro:IPR004596"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q950"
FT                   /protein_id="ABO21998.1"
FT                   /translation="MNNLMGMAPRHPGLWVDLDSSLKRGDGNTISTTASSTQGKQELQA
FT                   LTPELARLSQQGQWVVLISPPNIGYKQMLADGGVRMDRILLVHTKDEVETLWAMEKALT
FT                   SGTSSAVICWAQTLDARDSRRLQIVAKNTRALGVVIEDANGHLPANPFPQEDLGGQTMS
FT                   LFSSLH"
FT   gene            complement(137523..138140)
FT                   /locus_tag="Shew_0127"
FT   CDS_pept        complement(137523..138140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0127"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /note="KEGG: shm:Shewmr7_3862 SOS-response transcriptional
FT                   repressor, LexA; TIGRFAM: LexA repressor; PFAM: peptidase
FT                   S24, S26A and S26B; LexA DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABO21999"
FT                   /db_xref="GOA:A3Q951"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q951"
FT                   /protein_id="ABO21999.1"
FT                   /translation="MRPLTPRQAEILDLIKRNIADTGMPPTRAEIARRLGFKSANAAEE
FT                   HLKALAKKGCIEIMPGTSRGIKLTQEEEPEDLGLPLIGQVAAGEPILAQEHVEQHYQVD
FT                   PSMFRPSADFLLRVRGDSMKDIGILEGDLLAVHKVEQARNGQIVVARVEDDVTVKRFEK
FT                   RGSTVYLHAENEEYSPIVVDLTTQSLSIEGLAVGVIRNGDWQ"
FT   gene            complement(138259..138933)
FT                   /locus_tag="Shew_0128"
FT   CDS_pept        complement(138259..138933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0128"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: shm:Shewmr7_0162 HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22000"
FT                   /db_xref="GOA:A3Q952"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q952"
FT                   /protein_id="ABO22000.1"
FT                   /translation="MFPWNKIDTVLLDMDGTLLDLHFDNHFWLSLVPQALCEQRQIPKA
FT                   DAQQLVESAYAKVFGTLEWYCLEYWQQELGLDILALHHTLVDRIQLRQDSMPFLTALAR
FT                   HSKRRILVTNAHPHSLALKLEHTDLANGLDEMLSSHATGYPKEHPQFWRHLFNQYSLDP
FT                   SRCLFIDDSEPILQAAKKAGVGYQLGIKNPDSQQPHKQFADFPAIDDYHHLLLSLEQAR
FT                   LG"
FT   gene            139031..139576
FT                   /locus_tag="Shew_0129"
FT   CDS_pept        139031..139576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0129"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: she:Shewmr4_0169 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22001"
FT                   /db_xref="GOA:A3Q953"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q953"
FT                   /protein_id="ABO22001.1"
FT                   /translation="MPDKKPQILHAEVVAQSRLFQIEQVHLKFSNQVERQYERMKGNAR
FT                   GAVMVVPVHGEELLLGREYAAGTHSYELGFPKGLVDPGETHAEAANRELQEEIGFGARK
FT                   LTHLMELSLAPGYFASKMQIFVAEDLYESRLQGDEPEPIEVVRWPLSQWSELLLEDDFS
FT                   ESRSVSALFLAQKHLKLK"
FT   gene            139630..140442
FT                   /locus_tag="Shew_0130"
FT   CDS_pept        139630..140442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0130"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase; KEGG: sfr:Sfri_0118
FT                   3'(2'),5'-bisphosphate nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22002"
FT                   /db_xref="GOA:A3Q954"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q954"
FT                   /protein_id="ABO22002.1"
FT                   /translation="MKPEEYVEQAISIAIEAGEAIKGIYLEGSFDKEVKSDNTPVTSAD
FT                   IAAHEIISSQLSSLTPEIPVLSEEDADIPFSERADWQRYWLVDPLDGTGEFIAGSGDFS
FT                   VIIALVEHNRPIMGIVYVPMTGVVYYAVAGLGAYKRSSKGEVRIASKQLTKDDEPCLRL
FT                   AVSRRQDPQSVLKLFNHPKHCELVVLGGAALKSCLVAEGRADCYVRIGPTGEWDTGAAQ
FT                   IIIEEAGGQVMDLELQPLSYNERESLENPNFIVVGSTHLPWDELLTGE"
FT   gene            140435..140890
FT                   /locus_tag="Shew_0131"
FT   CDS_pept        140435..140890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0131"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   she:Shewmr4_0171 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22003"
FT                   /db_xref="GOA:A3Q955"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q955"
FT                   /protein_id="ABO22003.1"
FT                   /translation="MNNPNLISVEAACKTQLPAIYRLEQGLFGDHAYPDFFFRQSFDCW
FT                   PSGLLVACDNAERLLGYILLARSEQADCAWILSVAVDDAAQGRGIGRRLITESLSALPD
FT                   GVAQVKLTVAPENPARHLYSKLGFVEQGLEADYFGPGEDRILMILQR"
FT   gene            140998..141654
FT                   /locus_tag="Shew_0132"
FT   CDS_pept        140998..141654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0132"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="KEGG: she:Shewmr4_0172 transcriptional regulator,
FT                   TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22004"
FT                   /db_xref="GOA:A3Q956"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q956"
FT                   /protein_id="ABO22004.1"
FT                   /translation="MARRKEHTHDEIRAMATAAVLRHLEVEPLDSLSLRKVAAAIGYVP
FT                   STLVNLFGSYQGLLLAVAEQTLDELYKRLAAKAQAFQDYASQEQAAQSQASESSQLEAM
FT                   AGAYQQFAFAQPRAFQLIFELKATEEQGLSDHHAQLIAQLFGLIESCLARLLPELPAEQ
FT                   LLLASRALWGGVHGLVSLALDDKLFAPGIGIEQAISHHLAVQLKGLGYHKEALCC"
FT   gene            141645..143507
FT                   /locus_tag="Shew_0133"
FT   CDS_pept        141645..143507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0133"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; major
FT                   facilitator superfamily MFS_1; KEGG: son:SO0194
FT                   acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22005"
FT                   /db_xref="GOA:A3Q957"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q957"
FT                   /protein_id="ABO22005.1"
FT                   /translation="MLLTKRFFPYFATQCLGALNDNIYKNVLLLMVTYSQIESLPISVN
FT                   LFVNLAAGVFILPFFLFSAHAGVVADNMDKAKLIRRLKQLELVIMSCAAMAILTQSYMM
FT                   MLLLLFLTGSQSAYFGPVKYSLLPQALAEDELVTGNAWVEMGTFLSILIGTLSAGLLVA
FT                   SDKGIIATAATVFVLAVAGYLASRAIPAMPPQGNVTKIRFAPLSGTWRSIAKVRKTPSI
FT                   WMAILAISWFWFLGATYLTQFPNFAKLHLHADATVVSLLLALFSIGIAAGSFLCERFSF
FT                   GHVELGLLPFGVAGLTLFGVDLLWSLPELPAQAETIYSFSSFIAESQHYRVMFALFMVG
FT                   VSGGLFIVPLYAFIQSRADRGECAQAIAANNIMNALFMVVSAVMSILLLEVFGWQITEL
FT                   FLLLALLNAVVALYVYSQVPEFTQRFVSYLLSHILYRVTVTGRDKLPSEGAGIIVCNHV
FT                   SYVDALIIMGASTRPIRFVMDKSISEMPLLKYLFRHAGVIPICSPRQSEATYNQAFESI
FT                   HQALADGELVCIFPEGRLTPNGELGEFRPGIDKILARDSVPVIPMALNGLWGSYFSHKD
FT                   GHALSTRPKRFWSKISVDLDDVVSGTEANRHLLRERVEAMLPAS"
FT   gene            complement(143555..144673)
FT                   /locus_tag="Shew_0134"
FT   CDS_pept        complement(143555..144673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0134"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /note="SMART: Rhodanese domain protein; KEGG: son:SO0195
FT                   YbbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22006"
FT                   /db_xref="GOA:A3Q958"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q958"
FT                   /protein_id="ABO22006.1"
FT                   /translation="MDNHQLANVIPASEYGRILASGHPIMDVRAPIEFTKGAFPASSNH
FT                   PLMRDDERQQVGTCYKEHGQDAAIALGHSLVCGAVKQQRVDAWLAYLDAHPDAYLYCFR
FT                   GGLRSQLTQQWLAEAGRDVPYIQGGYKAMRQYLIDTIDRAPEARPMLILSGITGSGKTD
FT                   FLLQRQEAVDLEGLAHHRGSSFGRYHEGQPTQINFENSLGVALLKHQQSPARILLLEDE
FT                   SYLIGRSALPKAFYMGMQAASVVILEEPLEARLTRLLDEYVHKMHRGYVERLGEEAGFE
FT                   AFAEYLANSISGIKKRLGGKQHDELQQMITDALAVQTQRGDTQAHLEWIALLLSKYYDP
FT                   MYQYQIGKKADRVIFQGDHQAMHQWLDEYATR"
FT   gene            complement(144673..145716)
FT                   /locus_tag="Shew_0135"
FT   CDS_pept        complement(144673..145716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0135"
FT                   /product="selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /note="TIGRFAM: selenide, water dikinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein; KEGG: shm:Shewmr7_0170 selenide, water
FT                   dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22007"
FT                   /db_xref="GOA:A3Q959"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q959"
FT                   /protein_id="ABO22007.1"
FT                   /translation="MSAEKIKLTEYSHGAGCGCKISPKVLGTILASQLPSFDDPNILVG
FT                   NQTRDDAAVYRLNDETGIISTTDFFMPIVDDPFTFGRIAATNAISDIYAMGGTPMMAIA
FT                   ILGWPVNVLPAEIAQQVVDGGRQACKDAGIMLAGGHSIDAPEPIFGLAVTGQIPLNELK
FT                   QNDTAKAGDRLFLTKPLGIGILTTAQKQKKLADEDIDIAPGAMCQLNKIGAAIAKISGV
FT                   TAMTDVTGFGLAGHLIEMCQGATLAAKIDLNALPMLPKAMDYLRLGCIPGGTHRNYDSY
FT                   GEHLPEVNEEQKALLCDPQTSGGLLIAVSNSHEAELLALLGKEGLPTQCIGHLAPQTES
FT                   QPLVELI"
FT   gene            complement(145879..146985)
FT                   /locus_tag="Shew_0136"
FT   CDS_pept        complement(145879..146985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0136"
FT                   /product="Delta-9 acyl-phospholipid desaturase"
FT                   /EC_number="1.14.19.-"
FT                   /note="PFAM: fatty acid desaturase; KEGG: she:Shewmr4_0176
FT                   stearoyl-CoA 9-desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22008"
FT                   /db_xref="GOA:A3Q960"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q960"
FT                   /protein_id="ABO22008.1"
FT                   /translation="MKKPPLIWTNILLFAITFLGAVILVPWYGITYGYGMAEWVAFVGL
FT                   AFASGLSITAGYHRLWSHRTYKAHWSVRFLFALGGALALQNSALHWSSDHRIHHKHVDD
FT                   NDKDPYSANMGFWYSHIGWMLREYQAQRYHDYKNVRDLQNEKIVMWQHKYYLPLLIIMN
FT                   IGLPALLGWLNGDVWAMLLMAGLLRLVVVHHCTFFINSLAHIWGSQPYTDKNTARDNGV
FT                   LALFTYGEGYHNFHHIFENDYRNGILWWHYDPTKWLINAMAWTGLANNLRVTPQERIES
FT                   AKLQMQLKKAQHKVTQLANHEEILEKIHAEYELLKTHIADYYQAHKELLEAKRKQLTTH
FT                   QLMQQVEHLKQELLARQKQWKSLTTGFA"
FT   sig_peptide     complement(146872..146985)
FT                   /locus_tag="Shew_0136"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.483 at
FT                   residue 38"
FT   gene            147125..147742
FT                   /locus_tag="Shew_0137"
FT   CDS_pept        147125..147742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0137"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   shm:Shewmr7_0172 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22009"
FT                   /db_xref="GOA:A3Q961"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q961"
FT                   /protein_id="ABO22009.1"
FT                   /translation="MMGIRAQQKEKTRRALVDAAFNQLSAERSFSSLSLREVAREANIA
FT                   PTSFYRHFKDMNELGLTMVDEGGLTLRQMMRKGRQRAEAGGSVIRISVDTFMEVLESNP
FT                   NVFRILLHERSGTSAPFRAAVAREIEHFISELAHYTEATTKRTPELARAQAEALVTLVF
FT                   NAGAAALDMKRVDRKILADRLVIQLRMVAKGAESLQQKMEHR"
FT   gene            complement(147823..148920)
FT                   /locus_tag="Shew_0138"
FT   CDS_pept        complement(147823..148920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0138"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="KEGG: shm:Shewmr7_0173 tRNA
FT                   (uracil-5-)-methyltransferase; TIGRFAM: tRNA
FT                   (uracil-5-)-methyltransferase; PFAM:
FT                   (Uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22010"
FT                   /db_xref="GOA:A3Q962"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q962"
FT                   /protein_id="ABO22010.1"
FT                   /translation="MNVDAMDPQQYDAQLDVKRQKLAQLFVDFETPELEVFASQKAHYR
FT                   MRAEFRVWHEGEDLYYYMFDKAQNQKIRCEQFLPASQLINDMMPELMAALRPNPVLRHK
FT                   LFQVDFLSTLSGEILVSLLYHKQLDAQWQEEAQALKEALSSKFKVDIIGRARKQKLVMD
FT                   RDFVIESLPVNGKQLTYKQVENSFTQPNGEVAIKMLEWAIDITRDSSGDLLELYCGNGN
FT                   FSIALAQNFNRVLATELAKPSVDSAQYNIEANQIDNLQIIRMSAEDFTDALAKKRSFRR
FT                   LEGVDLDSYDCNTIFVDPPRAGLDDNTLSMVQGYERILYISCNPNTLLDNLKVLDKTHK
FT                   ITRFALFDQFPYTDHMESGVLLERR"
FT   gene            149128..149928
FT                   /locus_tag="Shew_0139"
FT   CDS_pept        149128..149928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0139"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: sdn:Sden_0232 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22011"
FT                   /db_xref="GOA:A3Q963"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q963"
FT                   /protein_id="ABO22011.1"
FT                   /translation="MSANILVFDSGVGGLSILAAVREQLPSANYCYLFDNARLPYGELD
FT                   EQELIQGCVTLISQAVIQCQADIVVVACNSASTLILPALRACLKVPVVGVVPAIKPAAA
FT                   LSQKKHLGLLATPGTVNRQYTQDLIDQFASDCRVDRFGSSELVYLAEDKMAQRPVDSEA
FT                   LHRILAPIKASGLDTLILGCTHFPILREELQSYLGEGVHLLDSSNAIAARVVSLLEPSM
FT                   SGEIGKSQALYTTDSICEGLRKTLAAWGFRSATAFRDSLMPIGS"
FT   gene            complement(149997..150455)
FT                   /locus_tag="Shew_0140"
FT   CDS_pept        complement(149997..150455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0140"
FT                   /product="RNP-1-like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; KEGG:
FT                   shm:Shewmr7_0175 RNP-1 like RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22012"
FT                   /db_xref="GOA:A3Q964"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q964"
FT                   /protein_id="ABO22012.1"
FT                   /translation="MQKPFLIVLIVAILGALAISQFTPELYSAVAFFTGAIIASVIFTL
FT                   QSSPANATGGDTYTGPTMTLYVGNLPYRVHEGEVKELFGKYGPVSSVRLVRDRKTGRRK
FT                   GFGFIEMSEAGAKKAMTKLNEFEFQERTLKVREAKSQDAEKNEGAQAS"
FT   sig_peptide     complement(150399..150455)
FT                   /locus_tag="Shew_0140"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.423 at
FT                   residue 19"
FT   gene            151093..152627
FT                   /locus_tag="Shew_R0001"
FT   rRNA            151093..152627
FT                   /locus_tag="Shew_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            152699..152775
FT                   /locus_tag="Shew_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            152699..152775
FT                   /locus_tag="Shew_R0002"
FT                   /product="tRNA-Ile"
FT   gene            152828..152903
FT                   /locus_tag="Shew_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            152828..152903
FT                   /locus_tag="Shew_R0003"
FT                   /product="tRNA-Ala"
FT   gene            153149..156041
FT                   /locus_tag="Shew_R0004"
FT   rRNA            153149..156041
FT                   /locus_tag="Shew_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            156164..156279
FT                   /locus_tag="Shew_R0005"
FT   rRNA            156164..156279
FT                   /locus_tag="Shew_R0005"
FT                   /product="5S ribosomal RNA"
FT   gene            157198..158238
FT                   /locus_tag="Shew_0141"
FT   CDS_pept        157198..158238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0141"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: she:Shewmr4_0181
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM: FAD
FT                   linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22013"
FT                   /db_xref="GOA:A3Q965"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q965"
FT                   /protein_id="ABO22013.1"
FT                   /translation="MDSKNTDSLTQFNTLGLKADCFRLVRARQEAELIAVCLQAFKQLE
FT                   PLLLIGGGSNIVLTETFQGTAVLVETKGIEVSQDEKYYYLSVEAGEVWHDLIKFCLDNK
FT                   MPGLENLALIPGSVGAAPIQNIGAYGAELAQFCNWVEYLDLASGEIKRLKGAECEFAYR
FT                   ESIFKNALKHSAVILRVGFVLSKAWQPNLSYGPLQALSERTQGVTPREVFDCICETRMA
FT                   KLPDPAVLGNVGSFFKNPVVSQQTFDALKQQYADIVGYALEDSQVKLAAGWLIDRAGLK
FT                   GQSVGNAVVHLKQALVIVNRGGCSGQDVCDLAELVIDRIFEQFGVRLEVEPRVIGATGQ
FT                   KELADA"
FT   gene            158231..159190
FT                   /locus_tag="Shew_0142"
FT   CDS_pept        158231..159190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0142"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: she:Shewmr4_0182
FT                   biotin--acetyl-CoA-carboxylase ligase; TIGRFAM:
FT                   biotin--acetyl-CoA-carboxylase ligase; PFAM: biotin protein
FT                   ligase domain protein; biotin/lipoate A/B protein ligase;
FT                   Helix-turn-helix, type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22014"
FT                   /db_xref="GOA:A3Q966"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q966"
FT                   /protein_id="ABO22014.1"
FT                   /translation="MHDQWARRRDIIRLLSQGHFVSGEALASELGISRAAVSKQVANLE
FT                   EFGVDIYSVKGKGYKLATPISLIDEAKLKTAIKNRCFYFNEINSTNGFLLEHVKDLSSG
FT                   DICVAEYQSAGRGRRGRQWVSPYGCHLYTSFYWQFSQGMAQAMGLSLVVGCSLVTVLRS
FT                   LGVDGIGVKWPNDIYLNHKKLAGILIEMSGQADSVCDLVIGIGINLSMSPAQADKIDQP
FT                   WSDLSELTQLPDKTELMIALQQQLVTDLELFQRQGLKAFQSRWREADLFDGEPIKLLMG
FT                   ENSVEGICCGIDEQGAILLKTEEGTKAFVGGEISMRPA"
FT   gene            complement(159254..160204)
FT                   /locus_tag="Shew_0143"
FT   CDS_pept        complement(159254..160204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0143"
FT                   /product="pantothenate kinase"
FT                   /note="TIGRFAM: pantothenate kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase; KEGG: shm:Shewmr7_0178
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22015"
FT                   /db_xref="GOA:A3Q967"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q967"
FT                   /protein_id="ABO22015.1"
FT                   /translation="MRANNQIHNALYLAFARQQWAELRKSVPLTLSESDLDDLRGINES
FT                   ISLDEVTDIYLPLSRLLNLIVGAKQQRGLVLNQFLGRVPPKRPYIISIAGSVAVGKSTT
FT                   ARILQALLRQWPEHPKVDLVTTDGFLYPLSELKRRGLLQRKGFPESYDMKLLVEFISKI
FT                   KAGESLVHAPIYSHISYDRVADTQQAIEQPDILIIEGLNVLQTGQDTHVAIQQPFVSDF
FT                   VDFSIYVDAEEPLLKEWYISRFLKFRTGAFSDPNSYFHHYSELTDDEATKIAANIWDSI
FT                   NGPNLNLNILPTRDRAHLILRKGTDHMMHQVLMRK"
FT   gene            160440..160515
FT                   /locus_tag="Shew_R0006"
FT                   /note="tRNA-Thr1"
FT   tRNA            160440..160515
FT                   /locus_tag="Shew_R0006"
FT                   /product="tRNA-Thr"
FT   gene            160523..160607
FT                   /locus_tag="Shew_R0007"
FT                   /note="tRNA-Tyr1"
FT   tRNA            160523..160607
FT                   /locus_tag="Shew_R0007"
FT                   /product="tRNA-Tyr"
FT   gene            160644..160717
FT                   /locus_tag="Shew_R0008"
FT                   /note="tRNA-Gly1"
FT   tRNA            160644..160717
FT                   /locus_tag="Shew_R0008"
FT                   /product="tRNA-Gly"
FT   gene            160907..162091
FT                   /locus_tag="Shew_0144"
FT   CDS_pept        160907..162091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0144"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   shm:Shewmr7_0192 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22016"
FT                   /db_xref="GOA:A3Q968"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q968"
FT                   /protein_id="ABO22016.1"
FT                   /translation="MAKEKFERSKPHVNVGTIGHVDHGKTTLTAAISHVLTKTYGGEAK
FT                   DFAQIDNAPEERERGITINTSHIEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVASTDGPMPQTREHILLSRQVGVPFIIVFMNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDLPVIQGSALKALEGEPEWEAKILELAEALDSYIPEPERAIDGAFILPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGDEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENCGVLLRG
FT                   TKRDEVERGQVLAQPGSITPHTQFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKIIA"
FT   gene            162374..162745
FT                   /locus_tag="Shew_0145"
FT   CDS_pept        162374..162745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0145"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: son:SO0218
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22017"
FT                   /db_xref="GOA:A3Q969"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q969"
FT                   /protein_id="ABO22017.1"
FT                   /translation="MTTNTENQGSSLDIVKWGIVVVLLAAAIIANQMYSEASVLVRAIG
FT                   VVVAFAIAGFIALQTEKGKQALTFARESHIEVRKVVWPTRQEALNTTFIVLLATGVLAL
FT                   VLWGMDAVLLRIVNFITGV"
FT   gene            162755..163297
FT                   /locus_tag="Shew_0146"
FT   CDS_pept        162755..163297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0146"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="KEGG: sfr:Sfri_0136 NusG antitermination factor;
FT                   TIGRFAM: transcription termination/antitermination factor
FT                   NusG; PFAM: transcription antitermination protein NusG; KOW
FT                   domain protein; SMART: NGN domain protein; KOW (Kyrpides,
FT                   Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22018"
FT                   /db_xref="GOA:A3Q970"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q970"
FT                   /protein_id="ABO22018.1"
FT                   /translation="MTEAKKRWYVVQAFSGYEGRVCKSLLEHIKMHGMEHYFGEVLVPT
FT                   EEVVEMRAGQRRKSERKFFPGYVLVQMEMNDESWHLVKSIPRVMGFIGGTSDRPAPISD
FT                   READAILQRLQETTESPTHRVMFEPGEVVRVTDGPFADFNGTVEEVDYEKNRVKVSVMI
FT                   FGRSTPVELDFSQIEKS"
FT   gene            163424..163852
FT                   /locus_tag="Shew_0147"
FT   CDS_pept        163424..163852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0147"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11; KEGG: sfr:Sfri_0137
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22019"
FT                   /db_xref="GOA:A3Q971"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q971"
FT                   /protein_id="ABO22019.1"
FT                   /translation="MAKKVDGYIKLQVAAGAANPSPPVGPALGQKGVNIMEFCKAFNAR
FT                   TEKFEKGMPIPVVITVYTDRSFTFETKTPPASFLLLKAAGLKSGSGRPNTEKVGTIKRS
FT                   AVQEIAETKAADMTGADIEAMTRSIEGTARSMGLVVED"
FT   gene            163857..164558
FT                   /locus_tag="Shew_0148"
FT   CDS_pept        163857..164558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0148"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1; KEGG: shm:Shewmr7_0184
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22020"
FT                   /db_xref="GOA:A3Q972"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q972"
FT                   /protein_id="ABO22020.1"
FT                   /translation="MAKLTKRARLIREKVEATKSYDINEAVALLKELATAKFVESVDVA
FT                   VNLGVDPRKSDQNVRGATVLPHGTGREVRVAVFTQGANADAAKEAGAELVGMDELAAQV
FT                   KAGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKTGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFEPVQLKENLDALLGALIKAKPAAAKGVFVKKVSISTTMGAGV
FT                   AVDQSTLNPTA"
FT   gene            164826..165323
FT                   /locus_tag="Shew_0149"
FT   CDS_pept        164826..165323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0149"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10; KEGG: shm:Shewmr7_0185
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22021"
FT                   /db_xref="GOA:A3Q973"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q973"
FT                   /protein_id="ABO22021.1"
FT                   /translation="MALRLEDKKAIVAEVNEAAKGALSAVVADSRGVTVGDMTGLRKTA
FT                   RESGVYIKVVRNTLVKRAVEGTDFECLSETFTGPTLIAFSNEHPGAAARLLKDFAKAQG
FT                   NFEIKAAAFEGELIPASDIDRLAKLPTYEEALAQFMMTMKEASAGKFVRTLAALRDQKE
FT                   AA"
FT   gene            165377..165745
FT                   /locus_tag="Shew_0150"
FT   CDS_pept        165377..165745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0150"
FT                   /product="LSU ribosomal protein L12P / LSU ribosomal
FT                   protein L12P"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12-like; KEGG: she:Shewmr4_0191 ribosomal
FT                   protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22022"
FT                   /db_xref="GOA:A3Q974"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q974"
FT                   /protein_id="ABO22022.1"
FT                   /translation="MSITKDQILEALAAMSVMEVVELIEAMEEKFGVSAAAAVVSGGAD
FT                   AGAAAEEKTEFDVVMTSHGDNKVAVIKALRGATGLGLKEAKGMAESAPVAVKEGISKEE
FT                   AEALKKELEEAGAQVEIK"
FT   gene            165984..170015
FT                   /locus_tag="Shew_0151"
FT   CDS_pept        165984..170015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0151"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: shm:Shewmr7_0187 DNA-directed RNA polymerase,
FT                   beta subunit; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2, domain 6; RNA
FT                   polymerase Rpb2, domain 7; RNA polymerase Rpb2, domain 2;
FT                   RNA polymerase beta subunit; RNA polymerase Rpb2, domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22023"
FT                   /db_xref="GOA:A3Q975"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q975"
FT                   /protein_id="ABO22023.1"
FT                   /translation="MVYSYSEKKRIRKDFGKRPQVLDIPYLLSIQLDSFKKFTDQDPTG
FT                   ERGLEAAFRSVFPIKSFSGNSELQYVSYKLGEPVFDVKECQIRGVTYSAPLRVKLRMVL
FT                   YDREAAPGTVKDIKEQEVYMGDIPLMTENGTFVINGTERVIVSQLHRSPGVFFDHDRGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDALFVRIDRRRKLAASIILRALDYSTQDILD
FT                   LFFERVQYKIKKDSLVMALVADRLRGETASYDIKDAEGNIIVEKGRRITARHIRQLEKT
FT                   NTTELEVPVEYISGKIAAQDYIDPDTGEVLVSANAEISLEDLAKLSMAGIKDIDTLYVN
FT                   ELDHGAYISDTLRIDSTTNRLEALVEIYRMMRPGEPPTKDAAEALFQNLFFSEERYDLS
FT                   KVGRMKFNRRLGIDDDEGTGILTKEDIVAVMQKIIEIRNGNDEVDDIDHLGNRRIRSVG
FT                   EMAENQFRVGLVRVERAVRERLSLGDLNELMPQDLINAKPISAAVKEFFGSSQLSQFMD
FT                   QNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRLCPIETPEGPNIGLINSL
FT                   ASFARTNSYGFLETPYRKVVDGVITDQVDYLSAIEEGRYVIAQANIEVDADGRMVEEQI
FT                   ACRHKGESTFMRAADVQYMDVSPQQIISVAASLIPFLEHDDANRALMGANMQRQAVPTL
FT                   RADKPLVGTGIERTLAVDSGVVVAAKRGGYVDYVDASRIVVKVNEDELTPGEAGIDIYN
FT                   LTKYTRSNQNTCINQRPCCSVGEPVVRGDVLADGPSTDLGDLALGQNMRIAFMPWNGYN
FT                   FEDSILISERVAQEDRFTTIHIQELSCIARDTKLGSEEITADIPNVGESALSKLDESGI
FT                   VYIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVKGTII
FT                   DVQVFTRDGVEKDKRAVEIEEMHIAQAKKDLTEEFKILEEGVFGRARNLLIGAGFAEAE
FT                   LDALPRPQLLVQTIEDETKQTELEQLAEQHEELKADFDKKFEIKRRKITQGDDLAPGVL
FT                   KIVKVYLAVKRTIQPGDKMAGRHGNKGVISKINPIEDMPYDENGNPVDIVLNPLGVPSR
FT                   MNIGQVLEVHLGAAAKGIGDRITAMLEEQRELAELRGYIKKVYELGEDVQQQVDIDSFT
FT                   DEEVLRLAKNLKGGIPTATPAFDGAKEKEIKDMLELAGLPTSGQLKLFDGRTGNEFERP
FT                   VTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGA
FT                   AYTLQEMLTVKSDDVNGRTQMYKNIVDGNHQMQPGMPESFNVLLKEIRSLGINIELDQE
FT                   "
FT   gene            170098..174312
FT                   /locus_tag="Shew_0152"
FT   CDS_pept        170098..174312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0152"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: shm:Shewmr7_0188 DNA-directed RNA polymerase,
FT                   beta' subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase, alpha subunit; RNA
FT                   polymerase Rpb1, domain 3; RNA polymerase Rpb1, domain 1;
FT                   RNA polymerase Rpb1, domain 5; RNA polymerase Rpb1, domain
FT                   4; SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22024"
FT                   /db_xref="GOA:A3Q976"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q976"
FT                   /protein_id="ABO22024.1"
FT                   /translation="MKDLLKFLKQQSKTEEFEGIKIGLASPDLIRSWSFGEVKKPETIN
FT                   YRTFKPEREGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IDLASPVAHIWFLKSLPSRIGLMLDMTLRDIERVLYFESFVVIEPGMTSLERGQMLTEE
FT                   NYLDALEEYGDEFEAKMGAEAVLELLRAIDLEKEIEEMREELPSINSETRRKKITKRLK
FT                   LIEAFYQSGNKPEWMILKVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIYGKLEGRGLATTIKAAKK
FT                   MVEREVPEVWDVLDDVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARSLMMSTNNILSPANGEPVITPSQDVVLGLYYTSRER
FT                   INGRGEGMAFESVAEVEKAYRTGVAELHARVKVRITETTIAEDGERTESRRIVDTTVGR
FT                   ALLSQVLPKGLSYDLVNQNMGKKQISKLLNTCYRQLGLKDTVIFADQLMYTGFHFATVS
FT                   GASVGINDMVIPDEKYSLVADAEAEVLEIQEQFQSGLVTAGERYNKVIDIWASANEKVS
FT                   KAMMDNLSTETVINRDGEEETQASFNSIYMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVIED
FT                   DCGTHEGLTMKPLIEGGDVVEPLRERVLGRVVAEDVYYPGTEDVLAPRNTLLDEAWCDK
FT                   LEEHSIDEVKVRSVISCDTDFGVCAACYGRDLARGHLINQGEAIGVVAAQSIGEPGTQL
FT                   TMRTFHIGGAASRASAENNVQVKNAGTVKLHNAKHVTNSDGKLVIVSRSSEIAIIDELG
FT                   REKERYKVPYGTVLEKLEDATVNAGEVIANRDPHTHPIVSEVAGSIKFVDMIEGVTMTR
FT                   QTDELTGLSSIVVMDVGQRPTAGKEMRPAIRLVGADGNDLMIPGTEVPAQYFLPGKAIV
FT                   NQDDNAQIAVGDALARIPQESSKTRDITGGLPRVADLFEARKPKEPAILAEYSGTISFG
FT                   KETKGKRRLVITPADGGKPYEEMIPKWRNLNVFEGEKVERGEVIADGPEAAHDILRLRG
FT                   IHKVANYIVNEVQDVYRLQGVKINDKHIEVIIRQMLRKCEITEAGDSEFLPGEQVEVSR
FT                   VKIANRELEAQGKEPAKFERELLGITKASLATESFISAASFQETTRVLTEAAVGGKSDK
FT                   LRGLKENVIVGRLIPAGTGYAYHTSRNQAAQNGPAEEVPAISASEAEQNLADLLNLAGS
FT                   PE"
FT   gene            174503..174877
FT                   /locus_tag="Shew_0153"
FT   CDS_pept        174503..174877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0153"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: sfr:Sfri_0143 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22025"
FT                   /db_xref="GOA:A3Q977"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q977"
FT                   /protein_id="ABO22025.1"
FT                   /translation="MATVNQLVRKPRSPKVIKTNVPALNACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
FT                   AGVSERRQGRSKYGAKRPKS"
FT   gene            174958..175428
FT                   /locus_tag="Shew_0154"
FT   CDS_pept        174958..175428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0154"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: sfr:Sfri_0144
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22026"
FT                   /db_xref="GOA:A3Q978"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q978"
FT                   /protein_id="ABO22026.1"
FT                   /translation="MPRRRVVGQRKILPDPKFNSELLAKFINVIMQDGKKSTAEKIIYK
FT                   ALDVVAEKKGEEHLVILEAALDNVRPTVEVKSRRVGGSTYQVPCEVRPVRRNALAMRWL
FT                   VEAARKRGEKSMALRLAGEMLDAAENKGTAVKKREDVHRMAEANKAFAHYRW"
FT   gene            175504..177600
FT                   /locus_tag="Shew_0155"
FT   CDS_pept        175504..177600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0155"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: shm:Shewmr7_0191 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22027"
FT                   /db_xref="GOA:A3Q979"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q979"
FT                   /protein_id="ABO22027.1"
FT                   /translation="MARTTPIERYRNIGICAHVDAGKTTTTERVLFYTGMSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWRGMDAQFTEHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCGSSGVEPQSETVWRQADKYHVPRLVFVNKMDRAGADFERVVGQIRNRLG
FT                   ATCVPIQLNIGAEEEFKGVIDLIKMKAINWNESDQGMTFNYEEIPAELADKAAEMREYL
FT                   VESAAEASEELMDKYLEEGELSEEEIKAALRQRTLANEIVLATCGSAFKNKGVQAVLDA
FT                   VIDYLPSPVEVPAIKGIDDNENEVERPADDNAPFSALAFKIATDPFVGTLTFVRVYSGV
FT                   LEAGSGVYNSVKQKRERIGRMVQMHANDRKEIKEVRAGDIAAAIGLKDVTTGDTLCDAD
FT                   HKVILERMEFPEPVITIAVEPRSQADQDKMGIALQKLAAEDPSFRVETNEESGQTLISG
FT                   MGELHLDIIVDRMRREFSVECNVGKPQVAYRETIRSSVEVEGKFVRQSGGRGQFGHVWL
FT                   KLEPQEEGFGYEFVNEIVGGVVPREYIPAVDKGIQEQMKNGVLAGFPVLDVKVTLFDGS
FT                   YHDVDSNEMAFKVAASMGFKKGALEADPVLLEPCMKVEVTTPEDYMGDVVGDLNRRRGM
FT                   IEGMDDGIGGVKIVRAVVPLSEMFGYATDLRSATQGRASYSMEFLKYSDAPQNVAKSVI
FT                   EARG"
FT   gene            177680..178864
FT                   /locus_tag="Shew_0156"
FT   CDS_pept        177680..178864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0156"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   shm:Shewmr7_0192 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22028"
FT                   /db_xref="GOA:A3Q980"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q980"
FT                   /protein_id="ABO22028.1"
FT                   /translation="MAKEKFERSKPHVNVGTIGHVDHGKTTLTAAISHVLTKTYGGEAK
FT                   DFAQIDNAPEERERGITINTSHIEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVASTDGPMPQTREHILLSRQVGVPFIIVFMNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDLPVIQGSALKALEGEPEWEAKILELAEALDSYIPEPERAIDGAFILPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGDEVEIVGIKETTKTTCTGVEMFRKLLDEGRAGENCGVLLRG
FT                   TKRDEVERGQVLAQPGSITPHTQFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKIIA"
FT   gene            179226..179537
FT                   /locus_tag="Shew_0157"
FT   CDS_pept        179226..179537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0157"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: shm:Shewmr7_0193
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22029"
FT                   /db_xref="GOA:A3Q981"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q981"
FT                   /protein_id="ABO22029.1"
FT                   /translation="MQNQRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERYTVLISPHVNKDARDQYELRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            179565..180203
FT                   /locus_tag="Shew_0158"
FT   CDS_pept        179565..180203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0158"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: shm:Shewmr7_0194
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22030"
FT                   /db_xref="GOA:A3Q982"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q982"
FT                   /protein_id="ABO22030.1"
FT                   /translation="MAIGLIGRKVGMTRIFTEDGASIPVTVIEIAANRVAQVKTLETDG
FT                   YRALQITTGTKKANRITKPEAGHFAKAGVEAGRGLWEMRLADGEGEGIEVGAELNVDIF
FT                   ADVAKVDVTGQSKGKGFQGGIKRWNFRTQDATHGNSLAHRANGSIGQNQTPGRVFKGKK
FT                   MSGHMGAERVTTQNLDVVRVDAERNLLLVKGAVPGATNGDLIIKPAVKA"
FT   gene            180220..180825
FT                   /locus_tag="Shew_0159"
FT   CDS_pept        180220..180825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0159"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: sdn:Sden_0171
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22031"
FT                   /db_xref="GOA:A3Q983"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q983"
FT                   /protein_id="ABO22031.1"
FT                   /translation="MELVLKDAQSALEVSETTFGRDFNEALVHQVVVAYAANARQGTRA
FT                   QKTRAEVTGSGKKPWRQKGTGRARAGTVKGPIWRGGGVSFAAKTQDHSQKVNKKMYRGA
FT                   LKSILSELVRQDRLVVVESFGVEAPKTKELKAKLKDMKLEDVLIVTPEIDENLFLAARN
FT                   LYKVDVRDVAGIDPVSLIAFEKVLVTADAVKQIEEMLG"
FT   gene            180822..181121
FT                   /locus_tag="Shew_0160"
FT   CDS_pept        180822..181121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0160"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: sdn:Sden_0172
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22032"
FT                   /db_xref="GOA:A3Q984"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q984"
FT                   /protein_id="ABO22032.1"
FT                   /translation="MISEERLLKVILAPHISEKSTVCAENNNTVVFRVAIDATKAEVKA
FT                   AVAKLFEVEVDSVRTLVNKGKTKRHGARTGRRSDWKKAYVTLAAGADIDFVGAE"
FT   gene            181138..181965
FT                   /locus_tag="Shew_0161"
FT   CDS_pept        181138..181965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0161"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: shm:Shewmr7_0197
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22033"
FT                   /db_xref="GOA:A3Q985"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q985"
FT                   /protein_id="ABO22033.1"
FT                   /translation="MAVIKCKPTSAGRRHVVKVVNSDLHKGKPFAGLLAKKAKSGGRNN
FT                   TGRITVRHVGGGHKQHYRIVDFKRNKDGIPAKVERLEYDPNRTANIALVLYADGERRYI
FT                   LAAKGMQAGDQIQSGIDAEIKAGNALPLRNIPVGSVVHAVEMKPGKGAQIARSAGTYVQ
FT                   VVARDGAYATLRLRSGEMRKVPVDCRATLGEVGNAEHMLRQLGKAGAKRWRGVRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVTPWGVPTKGYKTRSNKRTDKYIVRRRNKK"
FT   gene            181977..182255
FT                   /locus_tag="Shew_0162"
FT   CDS_pept        181977..182255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0162"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: shm:Shewmr7_0198 ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22034"
FT                   /db_xref="GOA:A3Q986"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q986"
FT                   /protein_id="ABO22034.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAMEAGDKKPIKTWSRRSMIIPNMI
FT                   GMTIAVHNGRQHVPVFVTDEMIGHKLGEFSPTRTYRGHAADKKAKKR"
FT   gene            182271..182603
FT                   /locus_tag="Shew_0163"
FT   CDS_pept        182271..182603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0163"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: shm:Shewmr7_0199 ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22035"
FT                   /db_xref="GOA:A3Q987"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q987"
FT                   /protein_id="ABO22035.1"
FT                   /translation="MEVLAKHRFARTSPQKCRLVADQIRGLPVAKALEILTFSPKKAAV
FT                   LVKKVLDSAIANAEHNEGADIDELKVGKVFVDEGPTMKRIMPRAKGRADRIIKRTSHIT
FT                   VVVSDR"
FT   gene            182613..183302
FT                   /locus_tag="Shew_0164"
FT   CDS_pept        182613..183302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0164"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: sdn:Sden_0176 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3-C-terminal
FT                   domain protein; KH, type 2 domain protein; Ribosomal
FT                   protein S3, N-terminal domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22036"
FT                   /db_xref="GOA:A3Q988"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q988"
FT                   /protein_id="ABO22036.1"
FT                   /translation="MGQKVHPNGIRLGITKPWISTWYADKSDYANNLSSDWEVRKFLEK
FT                   KLKQASVSKIVIERPAKSVRVTIHTARPGVVIGKKGEDVEKLRNEVAKLTGIPAQINIA
FT                   EIRKPELDAKLVAEGIASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RSEWYREGRVPLHTLRADIDYSTAESHTQYGVIGVKVWVFKGEVLDGVVPALEEPKQQP
FT                   KRKPRGK"
FT   gene            183314..183724
FT                   /locus_tag="Shew_0165"
FT   CDS_pept        183314..183724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0165"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16; KEGG: shm:Shewmr7_0201
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22037"
FT                   /db_xref="GOA:A3Q989"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q989"
FT                   /protein_id="ABO22037.1"
FT                   /translation="MLQPKRMKFRKMFKGRNRGLANGTEVSFGEFGLKAVGRGRLTARQ
FT                   IESARRAMTRHIKRQGQIWIRVFPDKPITSKPLEVRMGKGKGNVEYWVCQIQPGKVLYE
FT                   MNGVSEELAREAFTLAAAKLPIKTTFVTKTVM"
FT   gene            183724..183915
FT                   /locus_tag="Shew_0166"
FT   CDS_pept        183724..183915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0166"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: shm:Shewmr7_0202
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22038"
FT                   /db_xref="GOA:A3Q990"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q990"
FT                   /protein_id="ABO22038.1"
FT                   /translation="MKASELTQKSVEELNAELLGLLREQFNLRMQHATGQLTQTHQLKI
FT                   VRRNIARVKTIITSKAGA"
FT   gene            183915..184163
FT                   /locus_tag="Shew_0167"
FT   CDS_pept        183915..184163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0167"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: sdn:Sden_0179
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22039"
FT                   /db_xref="GOA:A3Q991"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q991"
FT                   /protein_id="ABO22039.1"
FT                   /translation="MTDKIRTLQGRVLSNKMDKSITVAIERKVKHPLYGKFIKRTTKIH
FT                   AHDETNQCNAGDIVTIRECRPLSKTKSWTLVEVVTKA"
FT   gene            184343..184711
FT                   /locus_tag="Shew_0168"
FT   CDS_pept        184343..184711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0168"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: sdn:Sden_0180 ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22040"
FT                   /db_xref="GOA:A3Q992"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q992"
FT                   /protein_id="ABO22040.1"
FT                   /translation="MIQMQSTLEVACNSGARRVQCIKVLGGSHRRYAGIGDVIKVSVKE
FT                   AIPRGKAKKGDVYNAVVVRTKKGVRRPDGSVIRFDRNAAVLLNANLAPIGTRIFGPVTR
FT                   ELRTEQFMKIVSLAPEVL"
FT   gene            184723..185037
FT                   /locus_tag="Shew_0169"
FT   CDS_pept        184723..185037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0169"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="KEGG: sdn:Sden_0181 ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22041"
FT                   /db_xref="GOA:A3Q993"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q993"
FT                   /protein_id="ABO22041.1"
FT                   /translation="MAAKIRREDEVIVLAGKDKGKRGKVSRVLPTGKLIVEGINLIKKH
FT                   QKPNPQMGVTGGIVEKEAPIQASNVAIFNSATGKADRVGFRFEDGKKVRFFKSNSELVK
FT                   "
FT   gene            185050..185589
FT                   /locus_tag="Shew_0170"
FT   CDS_pept        185050..185589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0170"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: sfr:Sfri_0160
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22042"
FT                   /db_xref="GOA:A3Q994"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q994"
FT                   /protein_id="ABO22042.1"
FT                   /translation="MAKLHDKYKETVIAELSKKFGYTSVMQVPRIEKITLNMGVGEAVA
FT                   DKKVMEHALRDMTAIAGQKPVVTVARKSVAGFKIRDGYPIGCKVTLRGERMWEFLERLV
FT                   DIAIPRIRDFRGLSAKSFDGRGNYAMGVREQIIFPEIDYDKIDKIRGMDIVITTTAKND
FT                   EEGRALLDAFNFPFKK"
FT   gene            185600..185905
FT                   /locus_tag="Shew_0171"
FT   CDS_pept        185600..185905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0171"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: sfr:Sfri_0161
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22043"
FT                   /db_xref="GOA:A3Q995"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q995"
FT                   /protein_id="ABO22043.1"
FT                   /translation="MAKSSMKAREAKRAKLVAKYAEKRLALKAIISNPTTSDEDRWDAV
FT                   LKLQGLPRDSSAARQRNRCSQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW"
FT   gene            185929..186321
FT                   /locus_tag="Shew_0172"
FT   CDS_pept        185929..186321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0172"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: shm:Shewmr7_0208
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22044"
FT                   /db_xref="GOA:A3Q996"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q996"
FT                   /protein_id="ABO22044.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVSVSMPSAKLKVAIAQTLKEEGY
FT                   ITDYTVAGEAKPVLEITLKYFQGQPVVETIQRVSRPGLRIYKGKNDLPKVMGGLGVAIV
FT                   STSKGLMTDRAARQQGMGGEVICYVA"
FT   gene            186332..186862
FT                   /locus_tag="Shew_0173"
FT   CDS_pept        186332..186862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0173"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: son:SO0246 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22045"
FT                   /db_xref="GOA:A3Q997"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q997"
FT                   /protein_id="ABO22045.1"
FT                   /translation="MSRVAKAPVAIPAGVEVTLNEQTITVKGAKGSLTRVINADVSVVV
FT                   ENNEIKCSPAEGVTSAAQAGTARALINNMVVGVNEGFERKLTLVGVGYRAKIAGNGIDL
FT                   TLGFSHPLVHQLPDGVTAECPSQTEIVLKSTDKQLVGQVAAEIRGYRPPEPYKGKGVRY
FT                   ADEQVRRKEAKKK"
FT   gene            186873..187223
FT                   /locus_tag="Shew_0174"
FT   CDS_pept        186873..187223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0174"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: shm:Shewmr7_0210 ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22046"
FT                   /db_xref="GOA:A3Q998"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q998"
FT                   /protein_id="ABO22046.1"
FT                   /translation="MDKKTSRLRRATRARKKIQELGVNRLVVHRTPRHTYAQVIDANAQ
FT                   VVAAASTAEKAVSEQLKYTGNVEAAKAVGKTIAERAIEKGVTVVAFDRSGFKYHGRVAA
FT                   LADAAREAGLQF"
FT   gene            187237..187740
FT                   /locus_tag="Shew_0175"
FT   CDS_pept        187237..187740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0175"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like; KEGG:
FT                   shm:Shewmr7_0211 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22047"
FT                   /db_xref="GOA:A3Q999"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q999"
FT                   /protein_id="ABO22047.1"
FT                   /translation="MAKFEAPQKDDLQEKLVAVNRVSKVVKGGRIFSFTALTVVGDGNG
FT                   KVGYGYGKAREVPAAIQKAMEKARRNIVSVELVNGTLHHPVKGRHTGSRVYMQPASEGT
FT                   GIIAGGAMRAVLEVAGVHNVLSKAYGSTNPINIVRATVDALVHMKSPAQIAAKRGLNVD
FT                   EIRG"
FT   gene            187746..187928
FT                   /locus_tag="Shew_0176"
FT   CDS_pept        187746..187928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0176"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30; KEGG: she:Shewmr4_0217
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22048"
FT                   /db_xref="GOA:A3Q9A0"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9A0"
FT                   /protein_id="ABO22048.1"
FT                   /translation="MATKTLKVTQTKSSIGRLPKHRATLTGLGLRRINHTVELEDTPAV
FT                   RGMINKVYYMVKVED"
FT   gene            187932..188366
FT                   /locus_tag="Shew_0177"
FT   CDS_pept        187932..188366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0177"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15; KEGG: sfr:Sfri_0167
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22049"
FT                   /db_xref="GOA:A3Q9A1"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9A1"
FT                   /protein_id="ABO22049.1"
FT                   /translation="MKLNTLSPAAGAKSAAKRVGRGIGSGLGKTAGRGHKGQKSRSGGG
FT                   VRVGFEGGQMPLKIRLPKFGFTSRKAMVTAEIRVSELAKVNGDVVDLNALKDANLVTRN
FT                   IQFAKVVLSGTIERPVTVKGLKVTKGARAAIEAAGGKIEE"
FT   gene            188374..189714
FT                   /locus_tag="Shew_0178"
FT   CDS_pept        188374..189714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0178"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: shm:Shewmr7_0214 preprotein
FT                   translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22050"
FT                   /db_xref="GOA:A3Q9A2"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9A2"
FT                   /protein_id="ABO22050.1"
FT                   /translation="MAKPGLDLKSAKGGLSELKARLLFVIGAIIVFRAGSFVPIPGIDA
FT                   AVLAELFNQQKGTILGMFNMFSGGALERASIFALGIMPYISASIIMQLLTVVHPALAEL
FT                   KKEGESGRKKISQYTRYGTLVLGTFQAIGIATGLPNLVPGLVVNLGFGFYFVAVVSLVT
FT                   GTMFLMWLGEQITERGIGNGISILIFAGIVAGLPSAIGQTAEQARQGDLNVLVLLLIAV
FT                   IVFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFAAQSTHLPLKVNMAGVIPPIFASSII
FT                   LFPGTLAQWFGQNEGLSWLSDFSLAVSPGQPLYSLLYATAIIFFCFFYTALVFNPRETA
FT                   DNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGALYITFICLIPEFMLIAWKVQFYFG
FT                   GTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLVNKANLDRFGR"
FT   gene            189736..189849
FT                   /locus_tag="Shew_0179"
FT   CDS_pept        189736..189849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0179"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: ribosomal protein L36; KEGG: shm:Shewmr7_0215
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22051"
FT                   /db_xref="GOA:A3Q9A3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9A3"
FT                   /protein_id="ABO22051.1"
FT                   /translation="MKVRASVKKICRNCKIVKRSGVVRVICVEPKHKQRQG"
FT   gene            189967..190323
FT                   /locus_tag="Shew_0180"
FT   CDS_pept        189967..190323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0180"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13; KEGG: shm:Shewmr7_0216
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22052"
FT                   /db_xref="GOA:A3Q9A4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9A4"
FT                   /protein_id="ABO22052.1"
FT                   /translation="MARIAGINIPDQKHTVIALTAIYGIGLTRAQQICAATSIAEDAKI
FT                   KELSEAQIDTLREEVAKYIVEGDLRREISMNIKRLMDLGCYRGLRHRRSLPLRGQRTKT
FT                   NARTRKGPRKPIRK"
FT   gene            190341..190733
FT                   /locus_tag="Shew_0181"
FT   CDS_pept        190341..190733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0181"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: sfr:Sfri_0171
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22053"
FT                   /db_xref="GOA:A3Q9A5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9A5"
FT                   /protein_id="ABO22053.1"
FT                   /translation="MAKVPSRSTRKRVRKQVADGMAHIHASFNNTIITITDRQGNALSW
FT                   ATSGGSGFRGSRKSTPFAAQVAAERAGVAAQDYGVKNLEVFVKGPGPGRESAIRALNAV
FT                   GYKITNITDVTPIPHNGCRPPKKRRV"
FT   gene            190770..191390
FT                   /locus_tag="Shew_0182"
FT   CDS_pept        190770..191390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0182"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: shm:Shewmr7_0218 ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22054"
FT                   /db_xref="GOA:A3Q9A6"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9A6"
FT                   /protein_id="ABO22054.1"
FT                   /translation="MARYLGPKLKLTRREGTDLFLKSGVRAIDSKCKLEAAPGQHGARK
FT                   ARLSEYGVQLREKQKVRRTYGVLEKQFRNYYKDAARLKGNTGENLLTLLETRLDNVVYR
FT                   MGFGATRAEARQLVSHKSIMVNGRVVNIPSFKVSANDVISVREKSQKQARIKAALEVAS
FT                   QREKPTWVEVDAAKMEGAFKRLPERSDLSADINEQLIVELYSK"
FT   gene            191415..192404
FT                   /locus_tag="Shew_0183"
FT   CDS_pept        191415..192404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0183"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: sdn:Sden_0195 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase, alpha subunit domain
FT                   protein; RNA polymerase, dimerisation; RNA polymerase,
FT                   insert; SMART: RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22055"
FT                   /db_xref="GOA:A3Q9A7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9A7"
FT                   /protein_id="ABO22055.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVNPTRAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSSKEGVQEDILEILLNLKGLAVVIEGKDEAMLTLSK
FT                   SGAGPVTAADITHDGDVTIMNPDHVICHLTGNNDISMRIRVERGRGYVPASARAQTEDD
FT                   DRPIGRLLVDSSFSPVARIAYNVEAARVEQRTDLDKLVIDMTTNGTIDPEEAIRRSATI
FT                   LAEQLDAFVELRDVTEPEQKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLV
FT                   QRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASLADDL"
FT   gene            192444..192836
FT                   /locus_tag="Shew_0184"
FT   CDS_pept        192444..192836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0184"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17; KEGG: shm:Shewmr7_0220
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22056"
FT                   /db_xref="GOA:A3Q9A8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9A8"
FT                   /protein_id="ABO22056.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMASSLVRHEVIKTTVAKAKELR
FT                   RVVEPLITLAKSDSVANRRLAFARTRDAEVVGKLFNELGPRYQERPGGYTRILKCGLRT
FT                   GDKAPMAYIELVGRPEAAEAVEEAAE"
FT   gene            complement(192893..193870)
FT                   /locus_tag="Shew_0185"
FT   CDS_pept        complement(192893..193870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22057"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9A9"
FT                   /protein_id="ABO22057.1"
FT                   /translation="MRILVCLLLLWTSLPASAARLMFIHSYHEGYPWVKDYRQAILENL
FT                   SEPTKMTEIYLDSKRLPRNAYVKRADDAWEAVKRDKPDIIILADDNAISLLSERIATTK
FT                   TPVVFLGLNTNPRDHGLQGYRQFTGILERPLFKRSLLLVDCLLPGKETKKLLILSDNSA
FT                   TSRAAFSPISTDFKPIQIGKLTIAFTLTNSAKEWQQAVIDAKKAGYQGVFTGLYHTLSK
FT                   DGGDYMDPSEMIAWTADHSPVPHFGFWDFTVGRHANPGGYVLNGYEHGLLTAKLINRLL
FT                   AGEQASNLGYVSDSKGAFRFSLSGVAKWHLSIPKEIAEKADWVE"
FT   sig_peptide     complement(193814..193870)
FT                   /locus_tag="Shew_0185"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 19"
FT   gene            complement(194005..194490)
FT                   /locus_tag="Shew_0186"
FT   CDS_pept        complement(194005..194490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0186"
FT                   /product="CcmE/CycJ protein"
FT                   /note="PFAM: CcmE/CycJ protein; KEGG: shm:Shewmr7_0222
FT                   CcmE/CycJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22058"
FT                   /db_xref="GOA:A3Q9B0"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9B0"
FT                   /protein_id="ABO22058.1"
FT                   /translation="MNARRKKRLALATALIGGVAAIASLLLYALNSNLNLFYTPTEIVH
FT                   GKKDTGVKPEIGQRIRVGGMVTVGSLVRDPESLHVEFAVHDAAGGEVMVTYDDLLPDLF
FT                   REGQGIVAQGVLIEGGKLEATEVLAKHDENYMPPEVAEAMGQTHEKLEYDSTQKTGY"
FT   sig_peptide     complement(194401..194490)
FT                   /locus_tag="Shew_0186"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.751 at
FT                   residue 30"
FT   gene            complement(194487..194687)
FT                   /locus_tag="Shew_0187"
FT   CDS_pept        complement(194487..194687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0187"
FT                   /product="Heme exporter protein D (CcmD)"
FT                   /note="PFAM: Heme exporter protein D (CcmD); KEGG:
FT                   son:SO0260 heme exporter protein CcmD"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22059"
FT                   /db_xref="GOA:A3Q9B1"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9B1"
FT                   /protein_id="ABO22059.1"
FT                   /translation="MQFDSLADFFNMGGYAFYVWLSYGITAFALGTLIVVSLRQKRKIL
FT                   TEISKKMQREERLKANRSKEQ"
FT   gene            complement(194687..195433)
FT                   /locus_tag="Shew_0188"
FT   CDS_pept        complement(194687..195433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0188"
FT                   /product="heme exporter protein CcmC"
FT                   /note="TIGRFAM: heme exporter protein CcmC; PFAM:
FT                   cytochrome c assembly protein; KEGG: sfr:Sfri_0177 heme
FT                   exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22060"
FT                   /db_xref="GOA:A3Q9B2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9B2"
FT                   /protein_id="ABO22060.1"
FT                   /translation="MWKWLHSYADPQKAYNLSGRLLPWFATLAIAFIGVGSIWGLLFAP
FT                   VDYQQGDSYRIIFIHVPAASMSMSAYMAMATSAFIGLVWQIKSADWAAAAIAPIGAVVT
FT                   FIALITGAAWGKPMWGTWWVWDARLTSELVLLFLYLGVISLYASFEDKVLAARAAGILA
FT                   IVGVINIPIIKYSVEWWNSLHQPATIKITEKSSMAPEMLYPLLINIFGFGLMIGAITLI
FT                   RFRAEILARNGMRPWVRELAQAEGVK"
FT   gene            complement(195435..196121)
FT                   /locus_tag="Shew_0189"
FT   CDS_pept        complement(195435..196121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0189"
FT                   /product="heme exporter protein CcmB"
FT                   /note="TIGRFAM: heme exporter protein CcmB; PFAM:
FT                   cytochrome c-type biogenesis protein CcmB; KEGG: son:SO0262
FT                   heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22061"
FT                   /db_xref="GOA:A3Q9B3"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9B3"
FT                   /protein_id="ABO22061.1"
FT                   /translation="MNKGISFTQAFFTLLRRDLKIAIRHKGDIFNPLLFFILVVTLFPL
FT                   GIGPEPQVLTRVAPGIIWVAALLASMLSLERLFKADFVDGSLEQMLLSPQPLSLMVLAK
FT                   VLAHWILTGVPLILVAPLLAVLLHLEANSYGALMATLALGTPVLSLLGAIGVALTVGLR
FT                   KGGVLLSLLILPLYIPVLIFATSAIDAAGLNLPYSGHLAIIGAMLVGSLILAPFAIGAS
FT                   LRVSTN"
FT   gene            complement(196133..196783)
FT                   /locus_tag="Shew_0190"
FT   CDS_pept        complement(196133..196783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0190"
FT                   /product="heme exporter protein CcmA"
FT                   /note="KEGG: shm:Shewmr7_0226 heme exporter protein CcmA;
FT                   TIGRFAM: heme exporter protein CcmA; PFAM: ABC
FT                   transporter-related protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22062"
FT                   /db_xref="GOA:A3Q9B4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9B4"
FT                   /protein_id="ABO22062.1"
FT                   /translation="MVEEKTATTLVSADNLTCIREERILFDELSFDIQAGEIVQIEGPN
FT                   GAGKTSLLRILAGLSRPYAGEAKYKGTDITRCRDEYNDDLLYLGHLAGVKSELTAEENL
FT                   NFNLRISGYDDFETNQILAKVNLSGFEEALAGHLSAGQHRRTALARLWHTNCKVWLLDE
FT                   PFTAIDKKGVEELEHLFLQHAQSGGCVIMTTHQDMSIIGDDILRKIRLDYRFI"
FT   gene            197116..197409
FT                   /locus_tag="Shew_0191"
FT   CDS_pept        197116..197409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0191"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: sfr:Sfri_0180
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22063"
FT                   /db_xref="GOA:A3Q9B5"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9B5"
FT                   /protein_id="ABO22063.1"
FT                   /translation="MKKLLALSAVAALTLSANTFAQEGEAVYNKACHVCHSMGVAGAPK
FT                   AHDAAAWEPRLAKGLDALLGSVKTGLNAMPPGGMCTDCTDEDYKNAIEFMSK"
FT   sig_peptide     197116..197181
FT                   /locus_tag="Shew_0191"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            complement(197601..198851)
FT                   /locus_tag="Shew_0192"
FT   CDS_pept        complement(197601..198851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0192"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: shm:Shewmr7_0228
FT                   TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22064"
FT                   /db_xref="GOA:A3Q9B6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9B6"
FT                   /protein_id="ABO22064.1"
FT                   /translation="MTTLWIFIALFVLVSLVLIWFPHFRQQKMLQAEEAGVRKATNLEL
FT                   FNNRLATLEKELEDELLDQDEFNALKKELEISLLQDMKQGEDESLVGQIKPKSLLWPTL
FT                   MSVVVLGVSGYFYANLGAYANLDKAVPDNPHAGMDAAQIMTQRIQMMESQLQAEPENSQ
FT                   LLFSLGHAYISANRYDDAVKAFDKAMELVGTHAELLGPKATAMYYKANQRITPAVQAII
FT                   DQSLALDPEDPSTLLLVGMDAFFSAQYKKAIDAWQIILDSDRSDVDRSAIINAIESAKM
FT                   RMQAETGEMPNDATHQQAKATTGKTVTIDVSIAPELLENVSGSDMLFIFARNTQGPKVP
FT                   LAATKVSAKSLPVSITLDDSTGMGGDIKLSDAKQVEVIAVLSKHGSVKAQPGDLQGRLE
FT                   TMDVGSTAKLVIDTLVQ"
FT   gene            199263..201239
FT                   /locus_tag="Shew_0193"
FT   CDS_pept        199263..201239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0193"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcmF;
FT                   PFAM: cytochrome c assembly protein; KEGG: shm:Shewmr7_0229
FT                   cytochrome c-type biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22065"
FT                   /db_xref="GOA:A3Q9B7"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR017563"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9B7"
FT                   /protein_id="ABO22065.1"
FT                   /translation="MIPELGHFSLIIGLAFAFLLASVPLIGVARKDQYLVRYAWPLSYG
FT                   MFFFIALSVIVLGYSFAVDDFSVAYVAHHSNSQLPIFFKIAAVWGGHEGSLLFWVFALS
FT                   VWTASVAFFSKGLEEVFTARVLAILAMIVIGFCLFMLLTSSPFERLFPIPMEGRDLNPM
FT                   LQDVGLIFHPPMLYLGYVGFSVSFAFAIAALMGGRLDSAWARWSRPWTLAAWIFLTGGI
FT                   SLGSWWAYYELGWGGWWFWDPVENASFMPWLIGTALLHSVIVTEKRATFRNWTVLLSIF
FT                   AFSLSLLGTFIVRSGVLTSVHSFAADPSRGMFILLLLGLAIGGSLTLFAFRASDMKSPA
FT                   RFELMSKETMLLVGNILLTVACGTVLLGTLYPLLIDALNMGKISVGPPYFNAVFVPIAL
FT                   VLFAFMGIGPSIRWKRAKAGELRAKLLVPAIVSAVIGVATPFLVDGKFNAWVMFGIGLA
FT                   AWVTVATLRAAYDIMQSKDGLSLARMGRSQLGMIIAHLGIAVSVVGATMVSNYSIEKSV
FT                   RMGPGITQELAGYSFHYIETKNVVGPNYTAQQGQVEVTKDGEFITLLKPDRRQYNVRTM
FT                   DMTEAGIDWGLFRDLYITMGDPISRTEFAVRLNYKPFVRWLWFGSIFMMVGGLFAASDK
FT                   RYRRAKATETAGEKAKQAKLATA"
FT   gene            201257..201814
FT                   /locus_tag="Shew_0194"
FT   CDS_pept        201257..201814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0194"
FT                   /product="periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE; PFAM: Redoxin domain protein; KEGG:
FT                   shm:Shewmr7_0230 periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22066"
FT                   /db_xref="GOA:A3Q9B8"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9B8"
FT                   /protein_id="ABO22066.1"
FT                   /translation="MKKRLVLFIPLILFLVMGVFLYKGLFLNPQQLDSALEGKPIPAFQ
FT                   LQKLEDANEIITNDSIKGQVSLLNVWATWCPSCKYEHPYLMRLARQNILPIYGINYRDE
FT                   RAMAIRELSREGDPYTKNIFDHDGRLGLDLGVYGAPESYLVDHNGIIRFRYAGPIDMRV
FT                   WNETLYPMIQELQAQAKAEGAS"
FT   sig_peptide     201257..201328
FT                   /locus_tag="Shew_0194"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.551 at
FT                   residue 24"
FT   gene            201814..202293
FT                   /locus_tag="Shew_0195"
FT   CDS_pept        201814..202293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0195"
FT                   /product="cytochrome C biogenesis protein"
FT                   /note="PFAM: cytochrome C biogenesis protein; KEGG:
FT                   shm:Shewmr7_0231 cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22067"
FT                   /db_xref="GOA:A3Q9B9"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR017565"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9B9"
FT                   /protein_id="ABO22067.1"
FT                   /translation="MKTLVGFITAILLSFSLVGAAMATPVDTYEFKSVDNQKRALELAH
FT                   SLRCPQCQNQNLIDSNSPVAQDLRLEVYQMVDAGKGDEEIIEFMTSRYGEFVLYKPRME
FT                   AKTYILWLGPIALLLVGLVIGFIFVRQQRISNAVEQEISAEEQAELDRLLKRDDK"
FT   sig_peptide     201814..201885
FT                   /locus_tag="Shew_0195"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 24"
FT   gene            202290..202877
FT                   /locus_tag="Shew_0196"
FT   CDS_pept        202290..202877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0196"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: shm:Shewmr7_0232
FT                   redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22068"
FT                   /db_xref="GOA:A3Q9C0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9C0"
FT                   /protein_id="ABO22068.1"
FT                   /translation="MKSKLATALLSAALALGGYAASVQAYPGMQKKQGGEVQSSVDLIN
FT                   VLPKAYPIDPVPFKDAQGKAIDFSQYRGQVVMVNMWATWCPPCVRELPAIDRFKGKFDP
FT                   KQFRVLPISIDMNGKEKVEPFLASLGMDKFETYYDPQQQLGQVFPLDTIPATFILNQQG
FT                   ELIAFVRTFVDWDDEKAVKLIESFIASETQKQ"
FT   sig_peptide     202290..202367
FT                   /locus_tag="Shew_0196"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.858 at
FT                   residue 26"
FT   gene            203406..204942
FT                   /locus_tag="Shew_R0009"
FT   rRNA            203406..204942
FT                   /locus_tag="Shew_R0009"
FT                   /product="16S ribosomal RNA"
FT   gene            205195..208087
FT                   /locus_tag="Shew_R0010"
FT   rRNA            205195..208087
FT                   /locus_tag="Shew_R0010"
FT                   /product="23S ribosomal RNA"
FT   gene            208191..208306
FT                   /locus_tag="Shew_R0011"
FT   rRNA            208191..208306
FT                   /locus_tag="Shew_R0011"
FT                   /product="5S ribosomal RNA"
FT   gene            208343..208419
FT                   /locus_tag="Shew_R0012"
FT                   /note="tRNA-Asp1"
FT   tRNA            208343..208419
FT                   /locus_tag="Shew_R0012"
FT                   /product="tRNA-Asp"
FT   gene            complement(208521..209021)
FT                   /locus_tag="Shew_0197"
FT   CDS_pept        complement(208521..209021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0197"
FT                   /product="protein of unknown function DUF796"
FT                   /note="PFAM: protein of unknown function DUF796; KEGG:
FT                   pae:PA0085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22069"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9C1"
FT                   /protein_id="ABO22069.1"
FT                   /translation="MYKLAAMGLLALSSFTLNAATDMFLKIDGVDGESLDAQHRNEIDV
FT                   LAWSWGASSDMRRTCIQDISVTKYVDSASPQLLMNQMSHMQYPRATLTVRKAGGTPLEY
FT                   IVIELRDVWVSSLSTGGSGGEDRLTENITLNFEELKYQYTPQKADGSGGPAISATITSE
FT                   KCR"
FT   sig_peptide     complement(208962..209021)
FT                   /locus_tag="Shew_0197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 20"
FT   gene            209239..210513
FT                   /locus_tag="Shew_0198"
FT   CDS_pept        209239..210513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0198"
FT                   /product="competence/damage-inducible protein cinA"
FT                   /note="TIGRFAM: competence/damage-inducible protein CinA;
FT                   PFAM: molybdopterin binding domain; CinA domain protein;
FT                   KEGG: shm:Shewmr7_0233 competence/damage-inducible protein
FT                   CinA"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22070"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9C2"
FT                   /protein_id="ABO22070.1"
FT                   /translation="MKIEMICTGEEVLSGQIVDTNAAWAANALMDHGIEMQQRITVGDR
FT                   LDDLVEVFRQRSEHADVILVNGGLGPTSDDMSSEAMAIAKGEPLVECTLWRERIQEWFT
FT                   RNGRHMPESNLKQAMLPASAIMVDNPVGTACGFRVKLNRAWLFFTPGVPFEFKKMVTEQ
FT                   FIPFVEQIADSHIEVEVQKLLTIGQGESALADKLEGMPLPDGMTLGYRSFMPYIEIKLF
FT                   ARGEAAIGELDRVKAEVLTRLGDAVVGHNVASLAQVIHNGLLASGKRLSIAESCTGGMI
FT                   ANNLVAFAGSSNYLDQGLVTYSNESKVRVLGVKPATLDDHGAVSIATVEEMAKGARGLL
FT                   DSDYALATSGIAGPDGGSEAKPVGTVAIALATRQGVYSQMLKFPARSRELVRQLSTAVA
FT                   LDMLRRELQESPVLVDYSSYPRFAR"
FT   gene            complement(210571..211110)
FT                   /locus_tag="Shew_0199"
FT   CDS_pept        complement(210571..211110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0199"
FT                   /product="protein of unknown function DUF1439"
FT                   /note="PFAM: protein of unknown function DUF1439; KEGG:
FT                   son:SO0273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22071"
FT                   /db_xref="InterPro:IPR010835"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9C3"
FT                   /protein_id="ABO22071.1"
FT                   /translation="MRSLALIGVLMLSLTACVSQYSISERQLTNYLNDEMHFEVKEGNR
FT                   FFGIEMKINDVKVKLGHKADTMAITASSLIKVANPLMPLNATMTAEFEAKPWYDADQHS
FT                   LYLKDLTLVSLSSNPKDLEQAIGQVSPQIMGFMTHFLETQPVYVLDTQEGNQALVAEMT
FT                   KRIQVVPGKINLIFKD"
FT   sig_peptide     complement(211054..211110)
FT                   /locus_tag="Shew_0199"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.376 at
FT                   residue 19"
FT   gene            complement(211110..213746)
FT                   /locus_tag="Shew_0200"
FT   CDS_pept        complement(211110..213746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0200"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   son:SO0274 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22072"
FT                   /db_xref="GOA:A3Q9C4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9C4"
FT                   /protein_id="ABO22072.1"
FT                   /translation="MTDMYASLRSNVGTLGQILGDTIRTHMDEPFLDKIEQIRHLAKSS
FT                   RQGNDTAREQMLTLLAALPDEELVPFAKAFNQFLNLANIAEQFHTISRNCDELVCVPDP
FT                   VDQLLGRMLNGRIDQDKMLECLQTLDIDLVLTAHPTEISRRTLIQKYSAVVDCLATMEN
FT                   PQLTEREKKQNHLRLRQLIAQIWHTNEIRHERPTPVDEARWGLSTIEASLWQAIPDFLR
FT                   QLNEQVEERTGKQLPSDIAPIRFSSWMGGDRDGNPFVTAKVTQEVLDRNRHTAARLYLK
FT                   DVVLLVNELSMEEANEELLALTDNSHEPYRVVLRELRQKLRDTIDYLNARLEGHSPEVD
FT                   LDSLIWHEDDLKQPLTLLYRSLTESGMSLIANGLLLDMLRRLACFGIHMLRLDIRQDAQ
FT                   RHSDVIAELTRYLGLGDFDHWDEHEKQAFLLRELSGKRPLIPHNWEPSAEVAEVISTVR
FT                   LIASQSPKALGSYVISMASQPSDVLTVLLLLKEAGCQHPMRVVPLFETLEDLNNAASCI
FT                   SALFAIDWYRGYCKGSQEVMIGYSDSAKDAGVMAAAWAQYSAQEKLVKVCNQADIKLTL
FT                   FHGRGGTIGRGGGPAHKAILSQPPGSVDGRIRVTEQGEMIRFKFGLPKLAVQSLALYTS
FT                   AVMEATLLPPPEPKPEWREAMERLASDSVTAYRAIVREEPDFVAYFRAATPEVELGKLP
FT                   LGSRPAKRRVDGGIESLRAIPWIFAWSQNRLMLPAWLGAGEALQQAADRGELTLLREME
FT                   QQWPFFETRISMLEMVYAKAEPNLAKYYETCLVPQELHHLGEALRSRMATGIKVVLELT
FT                   QSDALMSHTPWNRESVELRNPYIDPLNFLQAELLARTRKEQAGSSNVELALMLTIAGVA
FT                   AGMRNTG"
FT   gene            complement(213864..215024)
FT                   /locus_tag="Shew_0201"
FT   CDS_pept        complement(213864..215024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0201"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   sfr:Sfri_0190 acetylornithine deacetylase (ArgE)"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22073"
FT                   /db_xref="GOA:A3Q9C5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9C5"
FT                   /protein_id="ABO22073.1"
FT                   /translation="MMKTFPDIKQSFRELIATPSISALEAELDMSNQGVVTLLSQWLTD
FT                   LGFDCQMQAVPDTRGKHNLLAKIGQGRGGLLLAGHTDTVPFDEGRWSQDPFTLTEKDNR
FT                   WYGLGSCDMKGFFALVIEAVRQMPTQDFVRPLYILASADEETTMNGAKAFAQSKAIAPE
FT                   YALIGEPTGLKPVYMHKGHLAQGIRITGRSGHSSDPAKGLNAIEIMHQVIGQLLKLKQH
FT                   LAEHYREEAFSVPYPTMNFGHIHGGDAANRICGCCDLHLDIRPLPGLPLEVLEQLLTQY
FT                   LAELSQRYPGSISISQLYPGSQPFAGQADAQWSQLVAQLSNQAPEVVNYATEAPYIQQL
FT                   GCQTLVWGPGSIEQAHQPDEYLDTAYINKTVDLLKQLIYHACIKAP"
FT   gene            215298..216278
FT                   /locus_tag="Shew_0202"
FT   CDS_pept        215298..216278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0202"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: shm:Shewmr7_0236
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase, NAD - binding; Semialdehyde
FT                   dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22074"
FT                   /db_xref="GOA:A3Q9C6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9C6"
FT                   /protein_id="ABO22074.1"
FT                   /translation="MKSIAIIGASGYTGAQVTSLIQADDQLKIQGLYVSENSLDKGKTL
FT                   ASLYPVYSHIDLSLAPLTEQAKQAIVNEADAVVLATDHGVSLHLAAWFYQAGLAVFDLS
FT                   GAYRFADSEQYPKWYGFEHIYPEVLAEAVYGLAEWNTEAIAASKMIAVPGCYPTASLTA
FT                   LKPLKDLMTDSLPVINAVSGVTGAGRKAQLHTSFCEVSLTPYGVLGHRHQPEIATQLGQ
FT                   QVIFTPHLGNFKRGILATITVQMKPGVSEADIAKAYEVYESAPLVNVYHNQFPKVDDVV
FT                   HTPNCLLGWKYDPLNGYLVVASAIDNLMKGAASQAHQCIKIHFNY"
FT   gene            216307..217092
FT                   /locus_tag="Shew_0203"
FT   CDS_pept        216307..217092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0203"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: sfr:Sfri_0192
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22075"
FT                   /db_xref="GOA:A3Q9C7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9C7"
FT                   /protein_id="ABO22075.1"
FT                   /translation="MSANKKTLVLKVGGALMQCEMGLARLMASAANIIKSGQSVILVHG
FT                   GGCLVDEQLKANGMETVKLDGLRVTPEEQVPIVVGALAGTSNKILQASAIKAGITSVGM
FT                   SLCDGAIVNGSIKDEQLGFVGEVSPNDPTYLNFLLAQGWMPIVSSIAVDDAGNLLNVNA
FT                   DQAATVIAKLVEGQLVLLSDVSGVLDGKGQLIKTLDKAHADELTKLGVIEKGMKVKVEA
FT                   ALEVAQWMGQPVQVASWRDAEQLSALEKGESIGTQVMPH"
FT   gene            217135..218040
FT                   /locus_tag="Shew_0204"
FT   CDS_pept        217135..218040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0204"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: shm:Shewmr7_0238 ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase, Asp/Orn-binding region;
FT                   aspartate/ornithine carbamoyltransferase, carbamoyl-P
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22076"
FT                   /db_xref="GOA:A3Q9C8"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9C8"
FT                   /protein_id="ABO22076.1"
FT                   /translation="MNHLLSIKELTQQQLIDLLALAKTIKANPEDYRKALDGKSVVMLF
FT                   EKPSLRTRVSFDIGINKLGGHCLYLDQQNGALGKREPVSDFAANISCWADAIVARTFAH
FT                   STIEQLAEHGTVPVINALSDMYHPCQGLADFLTLAEQFDDVSKVKLAYVGDGNNVTHSL
FT                   MYGAALLGAKMTVICPQGHFPDGKVVLEAQAIAEAHGGELVLSSDVEAIAGHDAIYTDT
FT                   WISMGDKASLDEIKAKFAPYHVDTDMMNKAGAKFFMHCLPAYRGVEVAAEVVDGAGSLI
FT                   LQQAENRMHAQNAVLVTLLS"
FT   gene            218094..219317
FT                   /locus_tag="Shew_0205"
FT   CDS_pept        218094..219317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0205"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG:
FT                   shm:Shewmr7_0239 argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22077"
FT                   /db_xref="GOA:A3Q9C9"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9C9"
FT                   /protein_id="ABO22077.1"
FT                   /translation="MSIENNKASVKKVVLAYSGGLDTSAIIPWLKETYDNCEIVAFCAD
FT                   VGQGEAELEGLHEKAIASGASECYIVDLKEELVADYIYPTIATGAIYEGTYLLGTSMAR
FT                   PIIAKAQVEVARKVGADAVCHGCTGKGNDQVRFEGCFAALAPDLTVIAPWREWSMVSRE
FT                   DLLDYLAERNIKTTASATKIYSRDANAWHISHEGGELEDPWNEPSKEVWTMTVAPEDAP
FT                   DEPEYVSVEMEAGRITKVNGQSYTPYGALMALNEIAGAHGVGRIDITENRLVGMKSRGC
FT                   YETPGGTVMFAALRAIEELVLDKTSREWREQVGAKMAHLVYDGRWFTPLCESLLGASQP
FT                   LANLLNGEVVLKLYKGQAQAVKKRSPNSLYSEEFATFGEDEVYNQKDAEGFIRLYSLAS
FT                   RIRALNVK"
FT   gene            219411..220772
FT                   /locus_tag="Shew_0206"
FT   CDS_pept        219411..220772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0206"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: sdn:Sden_0254 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22078"
FT                   /db_xref="GOA:A3Q9D0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9D0"
FT                   /protein_id="ABO22078.1"
FT                   /translation="MALWGGRFSQESSALFKLFNDSLPVDYRLVEEDIVGSIAWADAIT
FT                   GVGILSQQECQSLKQALQELLAEVKDQPETILASGAEDTHSFVEQALIAKVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKKEGKALLELLAQLKAALLSLAERELDAVMPGYTHLQRAQPV
FT                   AFGHWCLAYVEMFERDISRLQDCLQRLDTCPLGTGALAGTAYPMDRYALAKSLGFASPT
FT                   LNSLDSVSDRDHVIELCSDAAISMMHLSRMAEDLIFFNSGEAGFIELDDQVTSGSSLMP
FT                   QKKNPDALELIRGKTGRVYGSLMGILTTMKALPLAYNKDMQEDKEGLFDVMDSWSICLE
FT                   MAALVLSGLKVNRENTLSAAQQGYANATELADYLVAKGMPFREAHHVVGEVVVEAIAQK
FT                   KPIEEFELASLQVFASVIQEDVYQCLTIDSCLAKREALGGTSLTQVKAALAAKG"
FT   gene            complement(220944..223529)
FT                   /locus_tag="Shew_0207"
FT   CDS_pept        complement(220944..223529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0207"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase; KEGG: sfr:Sfri_0369
FT                   penicillin-binding protein, 1A family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22079"
FT                   /db_xref="GOA:A3Q9D1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9D1"
FT                   /protein_id="ABO22079.1"
FT                   /translation="MKWFKRITIALFSLALLGIGAIAAAYFYVLPDLPDVTTLKTVKLQ
FT                   TPLRIYSADGKLISQFGEKRRIPVEYEQVPQQLINAVLDTEDARFFEHKGIDPIGIIRA
FT                   AVILATTGKKSQGASTITQQVARGFFLSREKTYIRKIKEIFLALKIEQALSKKEILTLY
FT                   LNRSFLGNRAYGVGAAAQVYYGKELEELTLPEMAMIAGLPQAPSAANPIRNPARAMNRR
FT                   NWVLSRMLEKENITPDEYQEAIRAPITAKYHGAEVELYAPYISEMARDYLVEKLGEEEA
FT                   YTGGYNVYTTVDSRLQMLAQEALRNNVYAYDERHGYRGATKVLWDAEGTAKLDETQIVT
FT                   QLKQTQGFQGLEPAAVLEVAEQSVKVINAKGETLTLEWEGLKWARKFISNKRQGKAPKT
FT                   AGEILKAGEQVWIRNNGNIWQLSQIPEVASAIVSLDPKDGAIRTLVGGYSFHTSQYNRV
FT                   TQAKRQLGSNIKPFIYTGALEKGYTLATLINNAPINNADIRQGTAWRPKNSPDKYTGPT
FT                   RLRVGLAQSINVMSVRAMRYTGLESAIDTLVKFGFDRDDLPQNESLALGSPSVTPLQVV
FT                   TAFSVFANGGYRVEPYFIDHIDNAYEQTVEEASPTLACKPELIQPQTLPTDDPFAAMAQ
FT                   ELPKHEVANQEVEGLEVASQEANAEDPSCPSTARHAPQIISKQTAFLITEALKSVIWGG
FT                   GDWSKGTGWNGTAWRAARVVNRHDIAGKTGTTNESKDTWFSGFTPTLATTVWVGFDDHS
FT                   IELGRTAWNTNGAKDQISGAEAGAKTAGPGWNEFMKNALQGTPELPSPPPEGIVSARID
FT                   LATGKLSRKTDYTTKFEYFIQGTEPKEFATEAQTQEDIFIDDSVEDLFQ"
FT   sig_peptide     complement(223458..223529)
FT                   /locus_tag="Shew_0207"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.513 at
FT                   residue 24"
FT   gene            223714..224793
FT                   /locus_tag="Shew_0208"
FT   CDS_pept        223714..224793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0208"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   shm:Shewmr7_0242 type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22080"
FT                   /db_xref="GOA:A3Q9D2"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9D2"
FT                   /protein_id="ABO22080.1"
FT                   /translation="MLSNLWKRQAPQMVGIDIGSHEIKAILLSKTADGYKILSHAAVPV
FT                   KKGAVNDHEIRDSDAVLESLRLIKRSLPKSVKYAAAAVSGSAVMTKVIYMDASLSEEEM
FT                   ETQIEIEADNLIPYSLDEVSIDFETLSVNSADPSKVDVLLSACRTENIDARVDSLDDIN
FT                   LEAKVIDVEGYALGRSFELVAAQLPDGAEDKVVALVDIGANMTTFAVVEKGETTFIREQ
FT                   AFGGEQFTQSILSFYGMSHEQAEKAKLEGDLPRNYMFEVLSPFQTQLLQQIKRTLQIYC
FT                   TSSGKDKVDHIVLCGGTSKLEGMANLLTNELGVHTIIADPFLGCLHADEQVKTQLQPTI
FT                   NKYMVACGLALRSYSQWRT"
FT   gene            224781..225362
FT                   /locus_tag="Shew_0209"
FT   CDS_pept        224781..225362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0209"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   shm:Shewmr7_0243 fimbrial assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22081"
FT                   /db_xref="GOA:A3Q9D3"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9D3"
FT                   /protein_id="ABO22081.1"
FT                   /translation="MANINLLPWREEAREKQKRDYLGILAAVFIGAALVVYLALTVLDM
FT                   MTEEQRGRNAYLQGEIQLLEKQIAEIKKIRERKKDIERRTEIILNLQQARNLPTHVLDE
FT                   LVRVVPPGIYLSSIEKKGSLLWIQGRSESNNNVANMMRKIKASMWLHDPNMQSIVSQND
FT                   EMRQLQRFSLRVSIGEEDADNAKATQGASK"
FT   gene            225359..225982
FT                   /locus_tag="Shew_0210"
FT   CDS_pept        225359..225982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0210"
FT                   /product="Pilus assembly protein, PilO"
FT                   /note="PFAM: Pilus assembly protein, PilO; KEGG: son:SO0283
FT                   type IV pilus biogenesis protein PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22082"
FT                   /db_xref="GOA:A3Q9D4"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9D4"
FT                   /protein_id="ABO22082.1"
FT                   /translation="MKLDLSEFNDIDFENIGGWPTQVKVVFASFLAIIIFVAGYFLFVS
FT                   DAIDVLKREQDKEITLRDDFKAKYQLAANLKLYREQLAVMEVQFAELLKMLPSQNEMPG
FT                   LLDDLTFVATDSGLGIQSLEWQEEIQRDFYIEFPISMSVTGNYHEMGHLVSGVAKLPRI
FT                   VSLHDFVIKRSDSGELAMEILAKTYRFKEGAQLPKDNAAKGAKK"
FT   gene            225979..226494
FT                   /locus_tag="Shew_0211"
FT   CDS_pept        225979..226494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0211"
FT                   /product="Pilus assembly protein, PilQ"
FT                   /note="PFAM: Pilus assembly protein, PilQ; KEGG:
FT                   shm:Shewmr7_0245 pilus assembly protein, PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22083"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9D5"
FT                   /protein_id="ABO22083.1"
FT                   /translation="MKKLPLLIVGLMLAGCMGDRSDLELFVTTTKAQHVARVPPLKEPP
FT                   KFEHFAYQAELMRSPFVPPSRELTEEVVDTTKDCLQPDLQRRKGRLETYALDNLKMRGT
FT                   LSEDKNIWALIETNDGSVYRLGVGEYVGLYHGRIAKVTQQMVEIVELIPDGTGCWAERM
FT                   SNMELTGE"
FT   sig_peptide     225979..226035
FT                   /locus_tag="Shew_0211"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.693) with cleavage site probability 0.349 at
FT                   residue 19"
FT   gene            226517..228568
FT                   /locus_tag="Shew_0212"
FT   CDS_pept        226517..228568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0212"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB, short N-terminal domain; KEGG:
FT                   she:Shewmr4_3699 type IV pilus secretin PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22084"
FT                   /db_xref="GOA:A3Q9D6"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9D6"
FT                   /protein_id="ABO22084.1"
FT                   /translation="MESSAAKSVLLKKSPLFKVAFGLALLLGVAPYSSAANRLIDVKYH
FT                   SIVDHQLELQLVFEEAVKEPEINLNASPAQIILGFDDSLSGLEKDVLPINNVGVKSMST
FT                   LQDSEQLKVLVDLAKVKAYQGKVMGNTYRLTINDEVASRSDVAANPFVNGIKNIDFHRT
FT                   GDGGGELLVKLNNSSVAANVEQVGAKLELKLYNTDIASDLLYVMDVQDFATPVKSFETF
FT                   KDELTARVLVDVSGQYEYNYKQEGNLFRLNVRKAERAAVVKEEKKYEGRSLSLNFQSIS
FT                   VRTVLQIIADYNNFNLVTSDTVEGDITLRLDDVPWDQALDLILQTKGLDKRIEGNILMV
FT                   APAEEIAIRESQELKNQQEVKELAPLYSEYLQINYAKATDIAELLKGDDASLLSARGTV
FT                   AVDDRTNTLLVKDTEESLENIHRLVEVLDIPIRQVLIESRMVTVKDDVSEDLGIKWGIT
FT                   DQQGSKGTSGSLEGANDIANGVVPDIGDRLNVNLPAAVANPTSIAFHVAKLADGTLLDL
FT                   ELSALEQESKGEIIASPRITTSNQKAAYIEQGVEIPYVESASSGAATVQFKKAVLSLRV
FT                   TPQITPDNRVILDLEITQDSQGKTVDTPLGQAVSIDTQRIGTQVLVDHGETIVLGGIYQ
FT                   QQLINRVSKVPVLGDIPFLGYLFRNTTDKNERQELLIFVTPKIISEQL"
FT   sig_peptide     226517..226624
FT                   /locus_tag="Shew_0212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.986 at
FT                   residue 36"
FT   gene            228784..229299
FT                   /locus_tag="Shew_0213"
FT   CDS_pept        228784..229299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0213"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: shm:Shewmr7_0247
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22085"
FT                   /db_xref="GOA:A3Q9D7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9D7"
FT                   /protein_id="ABO22085.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRHLAQMLHLEFHDSDQEIENRTGA
FT                   DIAWVFDVEGEEGFRRRETQVVADLTEKQGIVLATGGGSIQSKDIRNNLSARGIVVYLE
FT                   TTIDKQVARTQRDKRRPLLQVEDPREVLEKLAEIRNPLYEEIADVIVKTDEQSAKVVAN
FT                   QIIDQLGF"
FT   gene            229315..230391
FT                   /locus_tag="Shew_0214"
FT   CDS_pept        229315..230391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0214"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG:
FT                   shm:Shewmr7_0248 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22086"
FT                   /db_xref="GOA:A3Q9D8"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9D8"
FT                   /protein_id="ABO22086.1"
FT                   /translation="MEQIQVELGVRSYPIFIGQNLLENSDYFSSYLQGKKILIVTNDTI
FT                   APLYLAKVQALLASYQCADPVILPDGEQYKTLSQMDAIFTSLLAQNMGRDSVLIALGGG
FT                   VIGDMTGFAAACYQRGVDFIQIPTTLLSQVDSSVGGKTAVNHPMGKNMIGAFYQPKMVA
FT                   IDTACLHTLPAREFAAGMAEVIKYGIIWDGSFFSWLEQNVAALKSLDEAALTYAIAKCC
FT                   QIKADVVAQDETEQGVRALLNLGHTFGHAIEAEMGYGVWLHGEAVAAGTVLAAQTASKM
FT                   GLVDQSIVCRIEAIFEAFDLPTEAPEAMDFEQFIKHMRRDKKVLNGKLRLVLPKAIGQA
FT                   EVYGEVSESLLQEVISRA"
FT   gene            230408..231943
FT                   /locus_tag="Shew_0215"
FT   CDS_pept        230408..231943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0215"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: son:SO0288
FT                   DamX domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22087"
FT                   /db_xref="GOA:A3Q9D9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9D9"
FT                   /protein_id="ABO22087.1"
FT                   /translation="MTFQTAILLPSQESLLHRLQHVVLYGQQLTVLTGETGAGKTTLAT
FT                   ALVDTLDDVSSALVVCPQHVDSAEIRRKILVQLLTEPVFDDELPLPETLLRLGDALPSH
FT                   SHIVLDDAQYLPLELWAECIVLSQLNIAGKKLSLTLTAPADYLNQILTQLPETQRPLLL
FT                   PVAISPLTLPEREGLYYTLLHRSEETPFTPRDIVKDQLQRQQGTPAEVLNLLYLALHGE
FT                   PAAPKKNPWPVYLVIGACMASLLASLYWLWAEPEELMTKSKVQTVAAVRAAAFNTQYGQ
FT                   RLLSAYFEQGSQLRNTLTKSTDAALPATKTKIESGDQIETLTQALPDAQPSSASPRSQS
FT                   DSQLKEVSEEQRPQAEALTYQEASEPEVAEQPSQVAGEIEQTQQSQVSDEARAAKPVET
FT                   FALVPVSEPKESRKLAASQPHPAGFTLQLATVKRLESLDATIAKLPDVNQVQIARYKSY
FT                   WVLLYGQYTDRQAGQQAALDLAQTSQLASPWVRAWVDLSGYELQQGAVSREIH"
FT   gene            231996..232835
FT                   /locus_tag="Shew_0216"
FT   CDS_pept        231996..232835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0216"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: sdn:Sden_0264 DNA adenine methylase; TIGRFAM:
FT                   DNA adenine methylase; PFAM: D12 class N6 adenine-specific
FT                   DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22088"
FT                   /db_xref="GOA:A3Q9E0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9E0"
FT                   /protein_id="ABO22088.1"
FT                   /translation="MIKKQRAFLKWAGGKFKLVDALTQHLPEGDRLVEPFVGAGSVFLN
FT                   THYKRYLLCDINQDLINLYQIVQSTPEKYITEAKAMFVEAKNDKEAYYQVRSEFNQTQD
FT                   PFLRSVYFLYMNRHGFNGLCRYNSKGGFNVPFGSYKKPYFPEEEIKAFADKAQVAEFKC
FT                   IGYEEAFDLTQPGDVVYCDPPYAPLSTTASFTTYVGSGFSLDDQALLARKSRHTAIDRG
FT                   IPVLISNHDIPLTRELYHGARFDTIQVQRNISQNGNSRKKVDELMALYDDSYHSEND"
FT   gene            complement(232910..233083)
FT                   /locus_tag="Shew_0217"
FT   CDS_pept        complement(232910..233083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22089"
FT                   /db_xref="GOA:A3Q9E1"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9E1"
FT                   /protein_id="ABO22089.1"
FT                   /translation="MLQLFLSTLAAFFGVQTEQNRVRDFQSRSPVPFIVMGILLAIALV
FT                   ASLIFIVKLVLA"
FT   gene            complement(233092..233436)
FT                   /locus_tag="Shew_0218"
FT   CDS_pept        complement(233092..233436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22090"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9E2"
FT                   /protein_id="ABO22090.1"
FT                   /translation="MRDKAKASAKMKSATVFTVTAAVVAFTAIGVQSLSEDEANLACVC
FT                   DSNASYNSSLPASHPKNRCAQQADNVSWSNWLTGRSRSNQLHFVDLLELLHGHQDSPMD
FT                   DVTPTSKQRL"
FT   sig_peptide     complement(233329..233436)
FT                   /locus_tag="Shew_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.376 at
FT                   residue 36"
FT   gene            233648..234322
FT                   /locus_tag="Shew_0219"
FT   CDS_pept        233648..234322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0219"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; Orotidine
FT                   5'-phosphate decarboxylase; KEGG: son:SO0292
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22091"
FT                   /db_xref="GOA:A3Q9E3"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9E3"
FT                   /protein_id="ABO22091.1"
FT                   /translation="MRPFLIAPSILSADFARLGEDVEAVLKAGADVVHFDVMDNHYVPN
FT                   LTIGPMVCKALRDYGVTADIDVHLMVKPVDRIIPDFVDAGASIITFHPEASEHIDRTLQ
FT                   LIKESGCKAGLVFNPATPLHYLDHVMDKLDVILLMSVNPGFGGQSFIPSTLDKLRQVRE
FT                   RIDASGFDIRLEVDGGVKVDNIAEIAAAGADMFVAGSAIFNKPDYKAVIDEMRSELAKV
FT                   DA"
FT   gene            234325..235020
FT                   /locus_tag="Shew_0220"
FT   CDS_pept        234325..235020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0220"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="KEGG: son:SO0293 phosphoglycolate phosphatase;
FT                   TIGRFAM: phosphoglycolate phosphatase; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22092"
FT                   /db_xref="GOA:A3Q9E4"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9E4"
FT                   /protein_id="ABO22092.1"
FT                   /translation="MKAQSIKAIAFDLDGTLIDSVPDLAAATQGMLAELALPLCDEEQV
FT                   RSWVGNGAAKLVERALTFARGEAATQAYIDAAMPLFSKHYEANLQQHSRLYDGVKSVLE
FT                   QLVSLGYQLAIVTNKPYRFTVPLLEAFGIAHLFNQVLGGDSLEKMKPDPLPLTHLKQAW
FT                   QLEDEQLLMVGDSRNDILAAKAAGISSIGLTYGYNYGEDIGLSGPTAVCNTFSEVLAQI
FT                   TDSQIALEQ"
FT   gene            235026..236024
FT                   /locus_tag="Shew_0221"
FT   CDS_pept        235026..236024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0221"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: son:SO0294 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22093"
FT                   /db_xref="GOA:A3Q9E5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9E5"
FT                   /protein_id="ABO22093.1"
FT                   /translation="MTKPIVLSGAQPSGELTIGNYMGALRQWVAMQDSHDCLYCVVDLH
FT                   AITVRQDPQKLRDACLDTLALYLACGVDPKKSTVFIQSQVPQHTQLGWALNCYTQMGEL
FT                   SRMTQFKDKSQKHANNINVGLFGYPVLMAADILLYQANEIPVGQDQKQHLELTRDIATR
FT                   FNNAYGETFTIPEPFIPELGAKVMSLQDPLKKMSKSDDNRNNVIGLLEDPKAVMKKLKK
FT                   AMTDSDEPPVVRFDVENKPGVSNLLSLMSGVTGQSIASLEAEFEGKMYGHLKVAAGEAV
FT                   VGMLEPLQERFKEYRADQSFLNQVMHEGAEKAQARAEVTLKKVYEKIGLLL"
FT   gene            complement(236089..236964)
FT                   /locus_tag="Shew_0222"
FT   CDS_pept        complement(236089..236964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0222"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO0295 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22094"
FT                   /db_xref="GOA:A3Q9E6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9E6"
FT                   /protein_id="ABO22094.1"
FT                   /translation="MRKIPPLRALQVFEAAARLQHFSRAAQELCITQSAVSHQVRLLEE
FT                   HFALPLFRREGRSLRLTDKGEQLFQETARIFNELGELNLRLLGEKPEALRLAVYSSFAV
FT                   KWLIPRLSGFRRLHPGIQVRLDMITEDPVLSHSSADMFITGQQDQKGYWQQLLHAERLI
FT                   PVCSPELISSSDKLDLDWLSTQQLLTVDEGPLGLDWQRWFEHHRVAQPEEEQQQLFSHV
FT                   LMAIEAAIAGQGVALASDFMVLDDIAKQRLVALPFAGIDTGFEFNFLCKQRRLQEPAIA
FT                   AFVHWLTQQH"
FT   gene            237090..237959
FT                   /locus_tag="Shew_0223"
FT   CDS_pept        237090..237959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0223"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: she:Shewmr4_3688 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22095"
FT                   /db_xref="GOA:A3Q9E7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9E7"
FT                   /protein_id="ABO22095.1"
FT                   /translation="MQRNLMLGLGLLLLGNVFSALYDVSIKWLPAQSDATMFLLLRQVT
FT                   AIVMMLPLWLYAGRPRTAFLKLHMIRANSGAVGGLLLILGLLSLPLATVSSLFYSAPLM
FT                   IIVMGMLFLKERLSSQQILATVLGFIGILIILRPSEMNLAALAVLVSAIVFAANQLMLR
FT                   WLPSSEAASVTVICYNLLSLPLVIGFAAWQGFAGFSWPVLGIAVLSNIFLLAYQLFSVP
FT                   AYRKAQAGEIAVAEYSGLLFCVLFGWLWFDEWLDPLGWLGAALIVLPTILLPVLTRRWR
FT                   KVRKARLA"
FT   sig_peptide     237090..237149
FT                   /locus_tag="Shew_0223"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.982 at
FT                   residue 20"
FT   gene            complement(237981..238550)
FT                   /locus_tag="Shew_0224"
FT   CDS_pept        complement(237981..238550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0224"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region, bacteria; KEGG:
FT                   shm:Shewmr7_0258 transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22096"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9E8"
FT                   /protein_id="ABO22096.1"
FT                   /translation="MRALLPILAVLLLLQGCAGAVMVGAVGGAMMANDERSFSTQLDDT
FT                   NADFQIASALAAHEDIKNQTNITGVAMNGNVLMIGQAPSSMLRDKAINTVQKLNLGGKI
FT                   HNQIRIGNPTSFTTRSNDTWITTKVKTRMLNDKDLDVTRIKVITENGEVFLLGVVSRDQ
FT                   ADLAVDIARNTAGVRKVIKVFDTPNS"
FT   sig_peptide     complement(238473..238550)
FT                   /locus_tag="Shew_0224"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.412 at
FT                   residue 26"
FT   gene            complement(238547..239140)
FT                   /locus_tag="Shew_0225"
FT   CDS_pept        complement(238547..239140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0225"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG:
FT                   shm:Shewmr7_0259 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22097"
FT                   /db_xref="GOA:A3Q9E9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9E9"
FT                   /protein_id="ABO22097.1"
FT                   /translation="MLERIKDSFTHSIQTKIDAAEALPESIEKAAEMMVQCLLGGNKIL
FT                   ACGNGGSAGDAQHFSAELLNRYEIERPPLPAIALTTDTSTITAIGNDYSYDEIFSKQIL
FT                   ALGQPGDILLAISTSGNSGNVIKAMEAALSRDMTIVALTGKDGGAMAGLMGTNDVEVRV
FT                   PSNVTARIQEVHLLVIHCLCDNIDRTLFPQDDQA"
FT   gene            complement(239209..239553)
FT                   /locus_tag="Shew_0226"
FT   CDS_pept        complement(239209..239553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0226"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   she:Shewmr4_3685 protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22098"
FT                   /db_xref="GOA:A3Q9F0"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9F0"
FT                   /protein_id="ABO22098.1"
FT                   /translation="MTSAEHLTKGQQAEDRALAYLEQQGLKLVERNVRYPFGEIDLIMR
FT                   QGHKWIFIEVKYRQSKQFGGALQAVSRGKIARLNRAASHYMQLNQIDAQCRFDLLAIDG
FT                   DDIQWITNAF"
FT   gene            complement(239550..241454)
FT                   /locus_tag="Shew_0227"
FT   CDS_pept        complement(239550..241454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0227"
FT                   /product="LppC family lipoprotein"
FT                   /note="PFAM: LppC family lipoprotein; KEGG:
FT                   shm:Shewmr7_0261 LppC family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22099"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9F1"
FT                   /protein_id="ABO22099.1"
FT                   /translation="MLKRLNTTKFISAAVLATVLFGCATAPTPVKETSTQVSLVNATQS
FT                   PAEYLADAKQASDAEQKNRLMLLAAHAFINQGDTGNASKTLAAVKPSLVNKPEILAEHR
FT                   YLSARVLEQTANYDQALAQLNYPSKWRLANWQMVSYHQLKARLFQLSKSPIEQAKELTL
FT                   LATYLPSTEASEVNDEIWGILQPLHEQTLLAFSQDSSNPIFAGWLQLAYIAKHYAIDPQ
FT                   QLVQQLGNWQQDNPGHPGAKKLPTDLERALNTKPYKPKKIAVLLPLTGPRAAIADTVKQ
FT                   GIISSYLTNPDDSVSVNFFDTAQGAELAQQQAIAAGADFIIGPLLQSEVESLMQAEQKA
FT                   SQQANGQQQPGAQAQAQAQAQAQAQVQPKVPQLFLNHVDSFTPSNDQFFFALSPTDEAV
FT                   DAAQKLYNDGIEKPLLLASDDAVGRRMAEAFNGKWQELTHEAAEIHYYKRGDEMKVTVQ
FT                   KSLGVIDSKERIARIKTLLGNKIEADFRSRRDIDAIYMIASSQDLPLLKPFIDVNFSVF
FT                   AEPVPLYTTSRSRIESQSRTAAQELNNLTISDIPWLIETNAETAEVARLWPTWGNSQKR
FT                   LYVMGFDALQLVSKLAQMRALPGYQYSGRSGLLSVSPDGTINRQLSWGRYQRGNLRPL"
FT   sig_peptide     complement(241359..241454)
FT                   /locus_tag="Shew_0227"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.392 at
FT                   residue 32"
FT   gene            241543..242385
FT                   /locus_tag="Shew_0228"
FT   CDS_pept        241543..242385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0228"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   shm:Shewmr7_0262 protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22100"
FT                   /db_xref="GOA:A3Q9F2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9F2"
FT                   /protein_id="ABO22100.1"
FT                   /translation="MDLSVALYIVPTPIGNLGDISSRALEVLNQVSLIACEDTRHSGKL
FT                   LSHFGIETRKTALHDHNERDRAQGIIQKLANGESVALISDAGTPLISDPGYHLVSQVRE
FT                   AGFKVVPLPGPCAAITALSASGLPSDRFSFEGFLPAKEKGRLDKLTELKEDPRTLIFYE
FT                   SPHRIVHSLTSIVAALGGDRQVVMAREVTKTFETFLSGPAAEVLATVSEDPNQQKGEIV
FT                   LMCHGHRTDEDAGVPAQALETLKLLSQELPLKKASALAAQIHGLKKNALYKLGLELDL"
FT   gene            242495..242800
FT                   /gene="rnpB"
FT                   /locus_tag="Shew_R0013"
FT   misc_RNA        242495..242800
FT                   /gene="rnpB"
FT                   /locus_tag="Shew_R0013"
FT                   /product="RNA component of RNaseP"
FT   gene            complement(242897..243706)
FT                   /locus_tag="Shew_0229"
FT   CDS_pept        complement(242897..243706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0229"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; KEGG: hch:HCH_06608 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22101"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9F3"
FT                   /protein_id="ABO22101.1"
FT                   /translation="MISPKLRILLLIMLLQLPLSSWAEASDLNIVYHDFAPFSYEDNRG
FT                   RAQGILVELTQAICLQWPGRCDISIRPYRRAMHMFSSGEAKGIFLGWNRERAESMWFSL
FT                   PLVQTEYGFYTLNDFPITDLSQLAGKVIGVYGPSNTYTSLMRQQEKLKQLSLPPLLTDI
FT                   YPQGDALPVRMLQKRRFDAYYVNKDVGRFYAGQVGLSQLHYLSAERAILYCVAFNKAFT
FT                   DSETVRQFNHLFLRLLQEGRLDKIYQKYQMQPIRLPQTDFTPKSMPY"
FT   sig_peptide     complement(243635..243706)
FT                   /locus_tag="Shew_0229"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 24"
FT   gene            complement(243776..245485)
FT                   /locus_tag="Shew_0230"
FT   CDS_pept        complement(243776..245485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22102"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9F4"
FT                   /protein_id="ABO22102.1"
FT                   /translation="MLTGARYSLLFGCLLASGLCAAEPQQASASDKAVAADASTQQLNS
FT                   GGSPADEAQLNQKKSINKIVVVSNAIFDESDPDAFFIHRWANYLHINTRESTILNKLSF
FT                   NDKDKVSQKDLDEAQRILRYEPYIRDARINFAQRDPDAGAEETGEGETILVETWDNWSL
FT                   LPTFSAGHSGGESKFSVGIKEDNLLGLGVRTRLKYKSTADRTGYQLAFRVPTDWLVKHS
FT                   TLTANFYDNSDGQATILDFTKPFYRLDTKDMYSGHFIDDLRTDTIRQNGFDVNEFEHKV
FT                   EYANAQYGWRLNKVDDWRSRIIVGVTQDKHSFANIPQFPTSELPQNRDFLYPWVAYQFI
FT                   EDDYKVLNNVYLINYNEDFNLGWQHYVKLGLETQDTAGSNPLGYHVNWYSSRGYKGDDQ
FT                   LILLRMDGEGVFATSQPDYFKVNATAEYFYQINPKWTAYSKVRLSTSQNNYLDAPFAMG
FT                   DNTGVRGYPNDYQHGDNQWLFSAEIRNYPNINLYQLAELGWAVFTDVGQASGGPDQDNE
FT                   TSGPIGSVGIGARIYSSRSSYGNVAHIDLTLPFTSGAEVNSWEWRFQVKTHF"
FT   sig_peptide     complement(245417..245485)
FT                   /locus_tag="Shew_0230"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.497 at
FT                   residue 23"
FT   gene            complement(245669..246940)
FT                   /locus_tag="Shew_0231"
FT   CDS_pept        complement(245669..246940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0231"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   son:SO0308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22103"
FT                   /db_xref="GOA:A3Q9F5"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9F5"
FT                   /protein_id="ABO22103.1"
FT                   /translation="MRSLEHHPQISPSWTVQLDNAEFLEKRRFIIKLGKALHKFGTPAY
FT                   RLEAHLQSISKVLGIEGYFLISPTSMTFVLQHDTDQEYNHMARVKPGELDLGSLARTDE
FT                   LVEEVLSGKRTLTEALERLEEIANKPNPYGPLLTLLAFGTSAGAFAMLMGTSWNDVFWS
FT                   ALLGFMVYGLVYRAEHSKRMAETLEPLAAILCAIAACGIAYFDPYINIPVVILSGIIVF
FT                   IPGLALTLGLAELAARDLISGTARIMDASMLLFKLYFGAIFGMVIGNAIFGEAIYFEPE
FT                   PLPRWAIWSAVPLLSAALVIIFKARLKDSPWGIFAGIVAFFSAMLAGIYLGESIGIFFG
FT                   ALAVGIYSNLYARWMKSPASIALLQGIVILVPGSKTYIGLNTLILGETMLNQSHIGTQI
FT                   FLIFMSLIAGLIFANVAVPPRRTL"
FT   gene            247133..247528
FT                   /locus_tag="Shew_0232"
FT   CDS_pept        247133..247528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22104"
FT                   /db_xref="GOA:A3Q9F6"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9F6"
FT                   /protein_id="ABO22104.1"
FT                   /translation="MSVSVSGFYIALTAIMAVFFTYRVVRLRRGLKIGLGSGGSEELRL
FT                   ANRVHANLIENAPMALLLLLLAELNGLAPVYLHAAGTVWLVARILHAIGLTQGRGGYHF
FT                   GRFWGVLLSWLVILALAVVNLFYFILA"
FT   gene            247659..250001
FT                   /locus_tag="Shew_0233"
FT   CDS_pept        247659..250001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0233"
FT                   /product="Radical SAM N-terminal domain protein"
FT                   /note="PFAM: Radical SAM domain protein; Radical SAM
FT                   N-terminal domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; KEGG: she:Shewmr4_3670 radical SAM N-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22105"
FT                   /db_xref="GOA:A3Q9F7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9F7"
FT                   /protein_id="ABO22105.1"
FT                   /translation="MQVESTLFTYPKYLGRNEKPAPFLPMSRKEMAKLGWDSCDIIIVT
FT                   GDAYVDHPSFGMAVIGRMLEAQGFRVGIISQPDWSSKEDFMKLGKPNLYFGVTAGNMDS
FT                   MINRYTAERRLRHDDAYTAGNVGGKRPDRAVTVYTQRCKEAYKQVPVVIGGIEASLRRI
FT                   AHYDYWSDKVRRSVILDAKADILVYGNAERPLVELSHRLAAGESVGDIHDVRGTTVIRK
FT                   EPLYGWKGMDSRKLDQLHKIDPVPNPYGADDVGCQNLSGPSDVKVFDNDAPKPISVQPP
FT                   RPKPWEKTYVLLPSYEKVAGDKYLYAHASRILHQEQNPGCARALFQPHGERAIWVNPPA
FT                   WPLNTDEMDGVFDLAYKRVPHPVYGKEKIPAYDMIKTSINIMRGCFGGCSFCSITEHEG
FT                   RIIQSRSQDSIIKEIKDIQDKVPGFTGVISDLGGPTANMYRLGCTSVKAESTCRRLSCV
FT                   FPSICGHLDTNHQATIDLYRAARDVPGIKKVLIASGVRYDLATEDPRYVKELASHHVGG
FT                   YLKIAPEHTEEGPLNKMMKPGMGTYDKFKELFDKYSAEAGKKQYLIPYFISAHPGTTDE
FT                   DMVNLALWLKGEKFKLDQVQNFYPSPMANATTIYHTELNSLKNVKHSSETVEVPKGGRQ
FT                   RKLHKALLRYHDPAGWPMIREALIKMGKEHLIGGGANCLVPAETRQERQGYRAKTANTP
FT                   AGKKAVTRFSANQFDERKGNGQGNAQGKSQGKGKSQGQAAGKGVSGKGSTGKGSAGKSS
FT                   AGKAGSRGKPGKRPVKNAWGTTPKHQR"
FT   gene            250076..250435
FT                   /locus_tag="Shew_0234"
FT   CDS_pept        250076..250435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0234"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   she:Shewmr4_3655 protein of unknown function DUF1232"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22106"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9F8"
FT                   /protein_id="ABO22106.1"
FT                   /translation="MSDSHRGQNGEAGVDGYSDEGFWHKVKQFAKLAGREVIDNALCLY
FT                   YAAQRPDTPKWAKTVIFGALAYFITPLDAIPDLTPVVGFSDDLGALAAALAMVCMYIDD
FT                   SVKRQAAEKRSAWFD"
FT   gene            complement(250449..251399)
FT                   /locus_tag="Shew_0235"
FT   CDS_pept        complement(250449..251399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0235"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: cps:CPS_0771
FT                   isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22107"
FT                   /db_xref="GOA:A3Q9F9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9F9"
FT                   /protein_id="ABO22107.1"
FT                   /translation="MSQSIRQAVMQASQAWIADFNRQAFADCIARYLPEAQMQVSPFGR
FT                   FDGVEAISQFWLGFAQQNPGELVYRNVEIKVLSDSQAILSANWRMNIASGFISKELWTL
FT                   ADDGHWYLEEDDFSVLTQLSEPLAPRMRSALVLVDLQNDYFKGGRFALDNCEAAAANAA
FT                   KLLHHFRSNQLPVIHVQHIFKDPEASFFQAGTQGVEIADMVAPKGNEPVIIKHYVDSFI
FT                   DTALSQTLIEMGIDKLVVVGAMAQACVQTLCRSAVKAGFECEVISDAIAAPSLSWESQD
FT                   LSGEQLVAANLISLSFGGAKALSLDDWLILERLAG"
FT   gene            251517..252434
FT                   /locus_tag="Shew_0236"
FT   CDS_pept        251517..252434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0236"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: cps:CPS_0770 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22108"
FT                   /db_xref="GOA:A3Q9G0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9G0"
FT                   /protein_id="ABO22108.1"
FT                   /translation="MIRMFRKNEQKRLAYQMLVFDEVVNQGSFTAAAEALGHTKSAVSQ
FT                   YVSQLEQDLGVKLLTRSTRQLHLTTQGEAMAQRSRQLWRLLTETLEAAHDQQAVPGGRM
FT                   AITAPLAFEAPLLTPIIAELCGEFPQLLPEMHYDDARLDILQHNLDMAISVGPQKDSGY
FT                   HAIPIGRLDSVLVAAPSYINRSAAITAESLRGHSLIVLPWQRPLVLQGPSGLAFEAAKE
FT                   IKVNTSISAINSAIAGVGIALVPSIFIETELAEGKLQRVLPEHSGPSREVFAIHAYQQQ
FT                   LPLALRLVVERLKEAFRQKAPVSG"
FT   gene            complement(252445..254343)
FT                   /locus_tag="Shew_0237"
FT   CDS_pept        complement(252445..254343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0237"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: cps:CPS_3839
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22109"
FT                   /db_xref="GOA:A3Q9G1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9G1"
FT                   /protein_id="ABO22109.1"
FT                   /translation="MGFKKSLVASMVTLVALCLLISNWLSYVQIKEATIARVNDKLTGV
FT                   TRNESAKVATWFGAKAQAMDELARHYRLGSYQDNYVNTARLATDLSGVARIYFGFDDGS
FT                   AYSTETGDKWLNGKAIPGKYDPRTRPWYQQGKATTQLDVTDIYIDDGSGHKVISILKNL
FT                   GDGVVLGDIELTYLHDVVSAIDYPGAVALITDQTGKVLASESPTLVSGSRFSDFGLPQV
FT                   QQKIIGSDEVMQEYRIDGVDKLGFSKAIPLVNGKQWFLFIGLDKSNAYAVVDQALTSAL
FT                   VSSAIMLLCAISILLGVLYLLYRPILSLKAMVTELSKGNGDLTKRLEIHCEDDLGQISM
FT                   GINQFIANLQAMMREVLQASAHISGSVERLNGETETNRHILSAHTKETEQIVAAVEEMS
FT                   ATANDVAQNGSETASFTQLTNEQALASKQVVAQATETVNRLVREVEHTADKIGQIDRDT
FT                   INITQVLKVIGDIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAARTQDSTAEI
FT                   EETLSNLRDASNSAIHSMEVTKQTCLETASTTERVATDLDAIGSSVNQINDLNTQIATA
FT                   AEEQSSVSAEITRNMSAICDMANELARSGESSRNETVNLATANQQLEQIVGQFKLD"
FT   sig_peptide     complement(254257..254343)
FT                   /locus_tag="Shew_0237"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.848) with cleavage site probability 0.701 at
FT                   residue 29"
FT   gene            complement(254419..255507)
FT                   /locus_tag="Shew_0238"
FT   CDS_pept        complement(254419..255507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0238"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   she:Shewmr4_3663 porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22110"
FT                   /db_xref="GOA:A3Q9G2"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9G2"
FT                   /protein_id="ABO22110.1"
FT                   /translation="MKNHKIIFRTSMIAAAMALASTQGYAAEQPLSEQVEALNQRIAQL
FT                   EAQAAPSQFKNSEVSLYGSIRPTLSYLDDSTDETWDVRDALSRVGIKASTEFADGWRAI
FT                   AQGEWSVDIANSGNFGKARQAYVAIASPYGQVGIGKQRPAQYSLIAEYVDIFNHGNSPY
FT                   AYDHESPFFVDNFVTYKLVTGGFTWMAGAQFDGDKGDTGADFVNIGVGYDVGALHLGLG
FT                   YVTQDSLENGQVNGDNQTLGGVVAYTFDNGLYLAASYQDKQYNFDNQVQHGDRSGSTLD
FT                   TALAYPLSNEYKIKLGYFQFKDGIEDISSMDYDGFNTTLEWNPLANVRVHLEYLDKNYD
FT                   NLNDDRAVTVGFRYDFNLNWKG"
FT   sig_peptide     complement(255427..255507)
FT                   /locus_tag="Shew_0238"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            complement(255646..256626)
FT                   /locus_tag="Shew_0239"
FT   CDS_pept        complement(255646..256626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0239"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   shm:Shewmr7_0283 formate dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22111"
FT                   /db_xref="GOA:A3Q9G3"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9G3"
FT                   /protein_id="ABO22111.1"
FT                   /translation="MSKAIRWLSLIVLGLFASSYALAEETATLQPQQWQTIQEHAISGD
FT                   IPEIRGLPTQPELLMPASIPQQADESLLGYLGATDTIAFALFASLFGVTALFILFVVVN
FT                   GVSKLDHGFSGKLIKRWSGLSVSVHWLGAIPCILLILTGLVLGGGRFYFEPGMNAGSWS
FT                   ALVGLSSSLHELMAFPFILGYVLMVLMWAPKQFPASYDLKWFAVLGGYINFGKKQHPDA
FT                   GFANAGEKLWFWVFALFGGVMVVSGLAMMFPETYGVTKNTANLMLVLHIASTVIISAFS
FT                   VVHIFMATVMSEGGMSNMTSGYCDENWAKQHHNLWFADLKKAGKV"
FT   sig_peptide     complement(256555..256626)
FT                   /locus_tag="Shew_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(256691..257305)
FT                   /locus_tag="Shew_0240"
FT   CDS_pept        complement(256691..257305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0240"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein;
FT                   KEGG: shm:Shewmr7_0284 cytoplasmic chaperone TorD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22112"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9G4"
FT                   /protein_id="ABO22112.1"
FT                   /translation="MTAEYGPTAMAYHAFKSMMFAPSDTQALAGLIAYLEQESPDSPLL
FT                   IEARKFSDDASELEFDFNRMCIGPYKLLVAPYESVYLSGNHQIFTEETVRVAEFYQQIG
FT                   LVIDDSFNEPADFIGNELEFLYCLHAMAAEQQALENSEHVEALNELAAEFIQTHLGRWI
FT                   TPFCEGIAKHAKQPFWPLLAHELLQFINQQLQAAPSLDGAE"
FT   gene            complement(257305..257850)
FT                   /locus_tag="Shew_0241"
FT   CDS_pept        complement(257305..257850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0241"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: shm:Shewmr7_0285 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22113"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9G5"
FT                   /protein_id="ABO22113.1"
FT                   /translation="MSLNKKVGFVFRQENCVGCGACTVACQIHNELPENHRFRKVDRYE
FT                   VKRDDGAIDVWLSHSCMHCENPACLMVCPAKAYHVRDDGIVVLDREKCTGCGLCASACP
FT                   YAAVSIREDDGKADKCNMCVELLDRGMKPACVSGCPVECLDVGNLQEVLKRPSASKQGI
FT                   GYGDCITKPNLVIIKERA"
FT   gene            complement(257861..260074)
FT                   /locus_tag="Shew_0242"
FT   CDS_pept        complement(257861..260074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0242"
FT                   /product="molydopterin dinucleotide-binding region"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: shm:Shewmr7_0286
FT                   twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22114"
FT                   /db_xref="GOA:A3Q9G6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9G6"
FT                   /protein_id="ABO22114.1"
FT                   /translation="MKMNRRTFLQGVGASSVVGSLSGLMPGIASAGEKGGAPDKLLKRQ
FT                   GEIKYHTCQRNCADRCLLKFTVQNGRMTYVEGASELKKMGTSPCVKGHAYVQYTYAADR
FT                   ILHPMERAGKKGEGKWRRISWDEAYDKIASRLQQIIKDHGADSILPYSYSGHEGVIGKY
FT                   GGPSRFFNAVGARKLDRKVCVFAAYEGLKSVTGTYQGPDPYDNIYTNCYISWGQNETAT
FT                   NVHGIKFINQARDRGAKLLVVNPVRTPIASQADIWLQPKPSTDTHLATGIMKYLVEHDL
FT                   ADLEFIKANTLGYDQLLERLNTMSYEEIERVTGVPKAKMFEFARVYGESELSVLRLGYG
FT                   MQRNYNGARMSRAIAMMHAVAGQYGKIGNGFIYDNTQADDSLNYSKGRADHIHPNPDTV
FT                   GHVNMTEIAKALDPENPMAYGKPIKPIKAVINYNGNFVSVAPDSNACRRGAMRDDLFLV
FT                   VHDFLMTDTAELADIIVPAATQFEFPDMGTDYNCYHMQTSEKVIEPLGESKDNWIFFKE
FT                   LGARMGLDRFPEMRVDYEQILRDFLDTEEPAFRHNNITYEQIIRDKFVTVYDQRPYFGD
FT                   GKYKTPSGKIEFYSEMMKEAGYHPVIDFGLPEDEMVQEEKTLPFRLLSPAIPQRANSSF
FT                   YNVKYIRNFPAYFAKINAEDAKELGIQNNDRVRLSNQRGEAHFIAQVSTQVVRGTVMAP
FT                   KNNWRRMDPQGKDSCTNNLTTDTLTDMGGCSAYHSTRVAIAKA"
FT   sig_peptide     complement(259979..260074)
FT                   /locus_tag="Shew_0242"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            complement(260264..261229)
FT                   /locus_tag="Shew_0243"
FT   CDS_pept        complement(260264..261229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0243"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   she:Shewmr4_3657 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22115"
FT                   /db_xref="GOA:A3Q9G7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9G7"
FT                   /protein_id="ABO22115.1"
FT                   /translation="MNKIDQLNYNQLKVFIAVYEHGQSHQAANELGITPSGVSRTLKIL
FT                   RDIFKDSLFIRRCSGFVATEKTHQLIPMARELVAHYQKLEMQHSVFTPAESGGQYVIHA
FT                   YDEFIYPVQQVIRNEILTEAPNMKFDVRVLTHDCSSDLANGDVDFVVVYEGFNGKNLNA
FT                   EMFSATDNLYILARTGHPILKQELTLANITQYACLEIDNYDDLSCPLLVNLCREEELCM
FT                   EVDGYTDSVATAMRLLSESDAITLVCNEFTRQFVDMLPAVQWVKLPEELAKRCRIRRRE
FT                   NREIGNYLLYGNVNQSAAFNWVKSKLICGLESAWRRAAER"
FT   gene            261778..262473
FT                   /locus_tag="Shew_0244"
FT   CDS_pept        261778..262473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0244"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: vvy:VV2222 tetrathionate reductase, subunit
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9G8"
FT                   /protein_id="ABO22116.1"
FT                   /translation="MLDRRSILKMAAGGALLSLVPASTLQAKTLGKRYAMVFDVRRCTG
FT                   CLSCTVSCSVENQTDAGRCRTRVNQASLSLGERIATLAVPNQCNQCDNPVCTQVCPVEA
FT                   TYKRKEDGIVVIDHEECIHCQLCVDACPYGARRKDESLDNPPEKCNFCIHRVTQGLLPA
FT                   CVETCIGGARTFGDLNDPDSQVSKLVRDNKVYAMLSEAGTSPNIFYIGLPTSTDDQAIL
FT                   NLNYLDWQR"
FT   sig_peptide     261778..261861
FT                   /locus_tag="Shew_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 28"
FT   gene            262483..265521
FT                   /locus_tag="Shew_0245"
FT   CDS_pept        262483..265521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0245"
FT                   /product="molydopterin dinucleotide-binding region"
FT                   /note="PFAM: molydopterin dinucleotide-binding region;
FT                   KEGG: ppr:PBPRB1372 hypothetical tetrathionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22117"
FT                   /db_xref="GOA:A3Q9G9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9G9"
FT                   /protein_id="ABO22117.1"
FT                   /translation="MDRRKFLTQAGLVSAATITGAACSRVDAESEPKKTQDISRFGHPV
FT                   AAEGGFDAQGKWQKTAGVRTVYSRCFSCYNICGLRVRVDEKTDRVLKVGGNPYCENNSG
FT                   SPLPLSTEVKQSFIALAGEAGLKNRATTCAKGASCVDSVDDERRVTRVLKRAGKRGGGE
FT                   WVTISYEQALAEIIEGGDLFGEGHVDGLRAIRQLDQEVKPGHSEFGSKANQLFATFCAE
FT                   DYLRGSFYSRFMMQSWGTVNLGTKHAYCGAAQATGYSLGMAAGFEEWLNDVDWENVEYG
FT                   LFMGTSPGSSGVSLNRVGRGLANSRVDRGFKYVCVDPLLRTTVAADTNATWLPVKPGQD
FT                   AAFSFGVIRTMLEEQWFNKAHLENPSQKAAEASGELNYTNAGHLVVMDPKHPEYRKFAK
FT                   AKDFGLGGDEALIIKAGTQTLASAESGDKAELFVSKRVTDSRGRKVTLMSSLYLLRAEA
FT                   QRTSMEEYAKRSGIAVKEMRQVAKDLAHYGRKACVAGNGGTNSSDGFVMGWIWATLNTL
FT                   AGSHDAKGGAIYGNGPIGGMEGLYDLANIEGGVSLDGIVNACRDGAYEASTEYRLKVEQ
FT                   GKNPYPASTPWHEVLPAMNAAEQWTSHANGDPYSAKVLFNWRNNFLYSAASISQEVVAS
FT                   IADPKRLPLVVGIDCHMNETNRYADYLIPDRSMLEEYAADRMWGAHKLGVVAASPVVTP
FT                   RTEKNEAGEHICMEQLLIDIALKLDLPGFGKGALASSDGRKVDLLTFEDWHARYLANVA
FT                   AQCEQLPKVTEEDRLWAGLDYAMKPLKPRLTAEEAAKVEALLSRGGYYQEDDRYDGDFI
FT                   KGAGPKCLQIYHQEVAQLRHAYSGEFYPGTPTLQEHKFWNGDTWESHWPQSEYPLLFSS
FT                   YKATVRSNYAVAFKRIGEISPTNFVYIHTDTAKAQGLKDGDQVRIVTANGKPCVGTLQT
FT                   DVGVAKGAICVSHGFGHSEGFGGDDRIINGERLAGIANRAGGTAVNQMIPADPTRNGAA
FT                   SMLNDYWTGANCRHGIPVRVEKA"
FT   sig_peptide     262483..262569
FT                   /locus_tag="Shew_0245"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.951 at
FT                   residue 29"
FT   gene            265675..266292
FT                   /locus_tag="Shew_0246"
FT   CDS_pept        265675..266292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22118"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9H0"
FT                   /protein_id="ABO22118.1"
FT                   /translation="MEHKNKMTKSLSLSLGAKSLGVSAALLLAAPAMATTTEQTQFFDA
FT                   IAAHCGQAFEGKVTAGNSADSAFSGKRLVMHVRECSDSELKVPFHVGEDHSRTWVITKT
FT                   DTGLRLKHDHRHQDGSEDKVTMYGGDTQDGGSAELQSFPVDAYSIDSFKQNGLTQSVTN
FT                   VWHMGITESQFIYRLTRENRDFKVEFDLTKPVALPPTPWGHE"
FT   sig_peptide     265675..265779
FT                   /locus_tag="Shew_0246"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 35"
FT   gene            266599..266994
FT                   /locus_tag="Shew_0247"
FT   CDS_pept        266599..266994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0247"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pae:PA1038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22119"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9H1"
FT                   /protein_id="ABO22119.1"
FT                   /translation="MGLGDNPYLILLRIASIVSHKDIMNTLFTYIKAIHHQASDVAIID
FT                   KLTKTNLYCDDGVQINEEETSYHFDNGVVICHRVERDNAPSELLCEECWISYEVIDSAQ
FT                   HAITPCRKTFHNACQESFWLKMQASIA"
FT   gene            267039..267596
FT                   /locus_tag="Shew_0248"
FT   CDS_pept        267039..267596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0248"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   psp:PSPPH_3302 ribosomal protein alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22120"
FT                   /db_xref="GOA:A3Q9H2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9H2"
FT                   /protein_id="ABO22120.1"
FT                   /translation="MTTELTTDRTRIRLLEGHEAQMLLRYYLENREHLAPWEPERRDDF
FT                   FMLAHAQSVVAENTRLYKAGLAFRFAILNREQTEIIGLCNITNLVMGIFKAANLGYSVA
FT                   ERYQGQGYMSEALRALLDFVFHEVGLNRVMANYMPNNEKSARLLASLGFEREGYAKSYL
FT                   KIAGEWQDHVLTAKLNPNRDKV"
FT   gene            complement(268052..268594)
FT                   /locus_tag="Shew_0249"
FT   CDS_pept        complement(268052..268594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0249"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vvy:VV0134 predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22121"
FT                   /db_xref="GOA:A3Q9H3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9H3"
FT                   /protein_id="ABO22121.1"
FT                   /translation="MKYALYKQEQTQEVITLFKDTFSDSEGKEEGALIAKLVEDFLTLP
FT                   TKDEDLYVFIAQDESERIVGSIIFSRLSFPNGENIFLLAPVAVATDCHGQGVGQGLIKF
FT                   GLATLKEKGVTVAITYGDINFYSKTGFVTISQDVIQAPLDLSYPEGWIAQSLVGEAVPH
FT                   VVCKPTCLKAIDNPSYW"
FT   gene            complement(268605..269783)
FT                   /locus_tag="Shew_0250"
FT   CDS_pept        complement(268605..269783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0250"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: vvy:VV0135
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22122"
FT                   /db_xref="GOA:A3Q9H4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9H4"
FT                   /protein_id="ABO22122.1"
FT                   /translation="MYLISELAAKAGISRTTLLYYEKLGLINGQRLDNGYRYYSENDLQ
FT                   RLLLIQQLQSAGLSLKECEQCLDAKLSRSLLENRLTQLNHEIDKKIHARELLLALLGER
FT                   PQRELHHSLSQSAPNAYLNWLSTQGYSEKEALRLKWLSKDMNEHESYMKDFMTVFATLE
FT                   RWGPGSHKDSLKAISLMSPQTMTDILDIGCGTGTSTLLLADNSIAHITAVDNEPIAIEQ
FT                   LNKKIQNAQLHERISPVCASMTELPFQAKSFDAIWAEGCVYIMGMENALKQWKPLLKDN
FT                   GVLMVSDLVWLTDSPDEETKQFWLADYPDIQSIPKRLTLFKKHGYDVIEHFSLGVDAWQ
FT                   NYWQPLQGRVEELQAVMPASQALLDIKKEISVYERSAAKDFTYQYFILKLAN"
FT   gene            270161..270757
FT                   /locus_tag="Shew_0251"
FT   CDS_pept        270161..270757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0251"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   vvu:VV20655 integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22123"
FT                   /db_xref="GOA:A3Q9H5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9H5"
FT                   /protein_id="ABO22123.1"
FT                   /translation="MRKLSSGKCSGIKRPFKLEEIWRIRTRLELENDLMQLALLNLAID
FT                   SKLRASDLLKLHVYDVSSQGVIYERVQCIQQKTGTDVHYEITPRTQQSISRWIFSASLE
FT                   ASSFLFPSSRRSGQPISYSFYRSIIRNWAAKLGLNADYYGTHSMRRTKATLIYARTKNI
FT                   RAVQILLGHSKVDNTIRYLGVELEDALRLSEKTDC"
FT   gene            complement(270902..271894)
FT                   /locus_tag="Shew_0252"
FT   CDS_pept        complement(270902..271894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VV0136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22124"
FT                   /db_xref="GOA:A3Q9H6"
FT                   /db_xref="InterPro:IPR022604"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9H6"
FT                   /protein_id="ABO22124.1"
FT                   /translation="MYHSAANPIIRVAVFPVLLLFWQYVYGTDLPLLAPAMCAVFLTTT
FT                   HEPPPVIMVFVMGGILFITAWFQALMSELLIDYVHVYYLFLFGIFYWCMERTKKNSQDV
FT                   FAILLIVSTAMIAVFTQQKGISVEQIPMALLKNIFIAGFTAYLAYLLFPRGEPLAINMP
FT                   PVNSTTKYLLDWQTLLKAVIVMTMMVCTIQLDLEQSTIITIIVALMIKDPDPSIGKDYG
FT                   LRRLLTTYASVLYAIPPLIMSLLQVNLVGTVGVAVVSALFMGIHAVTKKASYNSIQLMY
FT                   SSYVVLVFYGITSTSISAISDDLVRFTSVFAAVLIGIMSLIILYPRTRT"
FT   gene            complement(271884..272990)
FT                   /locus_tag="Shew_0253"
FT   CDS_pept        complement(271884..272990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0253"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   vvy:VV0137 multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22125"
FT                   /db_xref="GOA:A3Q9H7"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9H7"
FT                   /protein_id="ABO22125.1"
FT                   /translation="MSDNNVHTSAEQSDKKISQARSFTYYIFALVAALWLYTLWADRMT
FT                   PMTDQARVNGQLIRISPEVSGPISQVLITNNSIVKAGDELVTIDPRPFELAVKAAKFDL
FT                   QQAAQSYEADSAAISVAQANEVAARVKVNNAKKNVERNRVLANKGTISQAVMDNIIAEL
FT                   ETAQAGLAQASSALEKAKQEFGPRGIDNPEIQSVLNRQEQALLNLNHTKLTAPANGVIT
FT                   NMDVAVGDYAAAGQPLLTFINNNNLWLTAMVRENSLAHLKPGDKVKIVFDATPGEVYEG
FT                   KISSIGWGSSGNGSLAQDASNGLMTSPTSSSKAQRFPVNIEFTSLPADLNLRYGGRAVV
FT                   GFYPDESYLGERLQDLWIWAWSYISYVS"
FT   gene            complement(273010..273519)
FT                   /locus_tag="Shew_0254"
FT   CDS_pept        complement(273010..273519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VV0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22126"
FT                   /db_xref="GOA:A3Q9H8"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9H8"
FT                   /protein_id="ABO22126.1"
FT                   /translation="MKVLDVDIKVKDSLIGGVINGVINGYIASHHFKGMDSVPMSLNVI
FT                   TNSEVTVWGQAVSLTFGLGIILSLITSKLFIHQLNKSHPQHISQLQSGFWSHLVPIAVT
FT                   HAAALFGWFVAIAVIWTKYAGEVMVSSSSAVALVGLFAFIITIAVEVRTKKSIIYKKIN
FT                   LLEQPQ"
FT   gene            273651..274331
FT                   /locus_tag="Shew_0255"
FT   CDS_pept        273651..274331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0255"
FT                   /product="ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport protein; Ion transport 2 domain
FT                   protein,; KEGG: vvy:VV0139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22127"
FT                   /db_xref="GOA:A3Q9H9"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9H9"
FT                   /protein_id="ABO22127.1"
FT                   /translation="MNLDKALSNISEKNNFIYLTLALIMLLIAAALVQLLQDNVIEYVI
FT                   QGIMVVIFIVCFVSLRFDRKWTHFLRGLAVVWIAAIAAKHLFHIKEMSILMLSLTFVFF
FT                   YGTFQSLVRKILFSGQIDTNKLIGSVALFLLLGLMWAVAYLLLLELDPFAFRGLEAIPW
FT                   EDNFSNSAYFSFVTLTTLGYGDISPVTPIAKTLVYLESVVGVFYMAVVVSSLVSSNLGR
FT                   NAAR"
FT   sig_peptide     273651..273752
FT                   /locus_tag="Shew_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.459 at
FT                   residue 34"
FT   gene            complement(274860..275438)
FT                   /locus_tag="Shew_0256"
FT   CDS_pept        complement(274860..275438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22128"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9I0"
FT                   /protein_id="ABO22128.1"
FT                   /translation="MHKYLSTLILSCCVALGLLTSPMTLAADSYSEAIANFKKAPDTQK
FT                   FFNSAYGYAIFPTVGKGGIGIGAAYGKGRVYKGGAHTGDSSLTQLSIGFQLGGQAYSEI
FT                   IFFKDAKAYQEFTSGSFEFGATASAVAINVGANAQVGTTGNSAGAGHSGANKAASAAYI
FT                   NGMAIFTAAKGGLMYEAALAGQSFTFEPK"
FT   sig_peptide     complement(275358..275438)
FT                   /locus_tag="Shew_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 27"
FT   gene            complement(275574..277652)
FT                   /locus_tag="Shew_0257"
FT   CDS_pept        complement(275574..277652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0257"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site domain protein; WD40 domain protein beta Propeller;
FT                   KEGG: sdn:Sden_0280 peptidase S9, prolyl oligopeptidase
FT                   active site region"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22129"
FT                   /db_xref="GOA:A3Q9I1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9I1"
FT                   /protein_id="ABO22129.1"
FT                   /translation="MGRGYQLTALAAICAGAMGLSSGVLAAERTHQITTDDFFTIGNMG
FT                   NVQLSPDGKHALWLESRWDKELDKAQKDLWLIDTKSRKTNRLTFTNESESSPQWSPDGS
FT                   AIYYLVKQSREDNKAPYNGKAQVFRINLGSTEAVPVTKEAEGVKQFQLSQDGKSLYFLT
FT                   NKTTTDKDIWAKVRAKHGAPKYGHGKVTTNPLYKLDLDHYQQSLVLDDDKVVWNFSVNQ
FT                   DASQIARITTQDNELVNLEGWSNIEVFNTQSQQNKVLEDSAWREQAPSPYGWLLGLAWH
FT                   EDNQRLAFRIDFDGHPGKLFVVKPKDDKAKLIQVKTEGDVTFNSSDIHWRPGSDELCYR
FT                   GYDHARVKLFCSEIDNQGQGDTRTVLAGDLVMGSYSFTHNGKKLAFSHNGLDHFSDLFI
FT                   ADAASKKAKYKRLTNINPQVDSWILPEISIVKWTAPDGSQVEGILDLPAGYKKSDGPLP
FT                   LIVQIHGGPTSATPYALQHRSYGRSTFTANGWALLSPNYRGSTGYGDKFLTDLVGQEHE
FT                   IEVADIMAGVDHLIKQGIADGDKMAVMGWSNGGYLTNALISTTNRFKAASSGAGVFDQR
FT                   LQWMLEDTPGHVINFMQGLPWEKPEAYTHGSSLTHADKIKTPTLIHIGENDQRVPLGHA
FT                   QGLYRALKHYLNVPVELVVYPGEGHGLSKYQHRQAKMDWDKLWFEHYVLGKQMDEAK"
FT   sig_peptide     complement(277572..277652)
FT                   /locus_tag="Shew_0257"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 27"
FT   gene            complement(277754..278701)
FT                   /locus_tag="Shew_0258"
FT   CDS_pept        complement(277754..278701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22130"
FT                   /db_xref="GOA:A3Q9I2"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9I2"
FT                   /protein_id="ABO22130.1"
FT                   /translation="MAFRGEIPPHACLAGHFASTMSTMDTHSHGLLFEGYWWLSLLGGL
FT                   HCIGLGLYLRYLYRDRNDNHKLLGAIFSLLALYFLTGLLNRDNSPLPLQQLFILLIPAY
FT                   FLLMPMLYLYCYRSLHDIKGSIGLSRHFIPAIALVLVIGLSALLSGEMRQLVSTSRVTQ
FT                   FNHVTLLGTVLPLLLVLQTGLYFYAIWRLLRRFKGRAHRAHQDSLKDIKFRWLLALTLA
FT                   MLTNWLVRMGLVILPYLLGDKVSLAAQASTRLFLLLSLYLLALYGLKQITMSAYLRGRL
FT                   SPDLQTQARPSSSRQLLNAEELNYLQQLLQSDKK"
FT   gene            complement(278814..279215)
FT                   /locus_tag="Shew_0259"
FT   CDS_pept        complement(278814..279215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22131"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9I3"
FT                   /protein_id="ABO22131.1"
FT                   /translation="MSQEILSGKLLREFKTIAAMVHIYCKDHCQAKGDVANCPECSEFL
FT                   EYAHTRLDRCPYGQDKPTCNKCPVHCYKPEPKAKAREIMIYSGPRMLLPHPIMAIRHLW
FT                   AERGPVPGKPPAAASNRHLRLAKEQKPSS"
FT   gene            279538..280386
FT                   /locus_tag="Shew_0260"
FT   CDS_pept        279538..280386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22132"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9I4"
FT                   /protein_id="ABO22132.1"
FT                   /translation="MKYIAIILLVAVGVYLYKRAQRLAQEEQQATQKPVEKVVSGEAVN
FT                   VPSQEADQEAEKVVSTPADEGVTFEPVEPAETEAVEETVVEPVEPAAVEETVVEVAEEK
FT                   KPTEAVLEVEQAPEQLAEEPEPEPEPEPEPEPEPEPEPEPEPEPAFKMLAVTDESWTND
FT                   KLSASLAQYRAEPEAEGKHVALLQAIAECYKQRKQEEYREYGAALSPYYQSLFAALPAP
FT                   TKEKGVGFMHLATLLNDCGDFDGAIAICQAAIGYGLSDGTVTGFEGRITRIEKAKAKAQ
FT                   A"
FT   gene            280637..280948
FT                   /locus_tag="Shew_0261"
FT   CDS_pept        280637..280948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22133"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9I5"
FT                   /protein_id="ABO22133.1"
FT                   /translation="MRSMMAFAALLLTMTACTQVPQWTLFYYPDAAPGESAEVLASQGE
FT                   LDQHISGYYLQLDQCLAKGAGMVKLSQTGSGSYLCGELCQRNEAGALKCQRLETLASQ"
FT   sig_peptide     280637..280693
FT                   /locus_tag="Shew_0261"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.737 at
FT                   residue 19"
FT   gene            280966..282420
FT                   /locus_tag="Shew_0262"
FT   CDS_pept        280966..282420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0262"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061; KEGG:
FT                   she:Shewmr4_3645 protein of unknown function UPF0061"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22134"
FT                   /db_xref="GOA:A3Q9I6"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9I6"
FT                   /protein_id="ABO22134.1"
FT                   /translation="MKFKQDYFDQLSGFYSQVTPQGLPRPQWLAWSEDAAALIGLKQPD
FT                   DELLQGLAGNQAIPGASYYAQVYSGHQFGGYSPQLGDGRSIILGEAEGPQGYWDVALKG
FT                   AGMTPYSRHGDGRAVMRSAVREFLVSEALHHLNIPTTRALAVIGSDLPVWRETQETAAI
FT                   TVRLAKSHIRFGHFEFFCHSEQGSKDKLKQLLDFTLSQHYPELSRDQAGYIAWFNRVVA
FT                   DTAKLIAHWQAVGFAHGVMNTDNMSILGDSFDFGPFAFLDTFEEDFICNHSDPNGRYAF
FT                   GQQPGVGLWNLQRLAQALVPIIASDDLIAALNTYQHHLVQAYLVLMRDKLGIKLVEPAG
FT                   SERDEADLQLIGGFTLLMEANRLDHTNTWRRFAQLDPNSQHSSLRDDFIDLAGFDTWYQ
FT                   AYQERLGQVSDVAGWQAVRAQVNPKYVLRNYLAQEAIIACEEGNTQPLAELHQLLTRPF
FT                   DEQPEKEAYAKRPPEWGQGLIMSCSS"
FT   gene            282491..282796
FT                   /locus_tag="Shew_0263"
FT   CDS_pept        282491..282796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22135"
FT                   /db_xref="InterPro:IPR022080"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9I7"
FT                   /protein_id="ABO22135.1"
FT                   /translation="MNQELKISAIKVEPQAKSLSILADVDFDRFHPFAEALVKALDCRV
FT                   IERHWGADRHQWLLEFEGSLLQLNYEFYGDVCWLSVERDDEVEVLVYLASLLESQL"
FT   gene            282793..283794
FT                   /locus_tag="Shew_0264"
FT   CDS_pept        282793..283794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0264"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   son:SO0332 hypothetical kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22136"
FT                   /db_xref="GOA:A3Q9I8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9I8"
FT                   /protein_id="ABO22136.1"
FT                   /translation="MTESMQGAGFHFQALTPDLILDAIESVGIYPETGLLALNSYENRV
FT                   YQFRCDLGRRYVVKFYRPERWSNEQIQEEHDFCAELVEEEIPVAAPVIIEGRSLQDYQG
FT                   YRFALFPSMGGRAFEVDNLEQLEEVGHFIGRIHQMAKRRPFVHRQTLTPKLLGDESLAW
FT                   LKGSDHVPPSLETAYFTIVEQVLEKAKAIWHQYPTEAIRLHGDLHPSNILWTPDGPGFV
FT                   DLDDAKMGPAVQDIWMMLSGERSHQTLQLEVLLEAYEEFCDFDNRQLHLIESLRAMRML
FT                   HYNAWLSRRWQDPAFPMHFPWYGEEKYWEQQILAFKEQLAKLDEPPITLIPY"
FT   gene            283924..284535
FT                   /locus_tag="Shew_0265"
FT   CDS_pept        283924..284535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0265"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: sdn:Sden_0285 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22137"
FT                   /db_xref="GOA:A3Q9I9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9I9"
FT                   /protein_id="ABO22137.1"
FT                   /translation="MKKALLVALALLVAPMAALAADYKEGVHYTVINDGPATAKPEIAE
FT                   FFSFYCPHCYNFAKTQVPKIKANLPEGVVFKQNHVEFIGREMGPEMSRAFAVANQLKVE
FT                   DKMEHALFAAIHDKKQRFVSRDDIRQLFIANGVDGKDFDAAANSFMVSAQMAQMKRATE
FT                   NAKLSGVPALVVNGKYRVETGAIKSYDELLQIAYYLTSLK"
FT   sig_peptide     283924..283986
FT                   /locus_tag="Shew_0265"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            284873..285085
FT                   /locus_tag="Shew_0266"
FT   CDS_pept        284873..285085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0266"
FT                   /product="protein of unknown function DUF1107"
FT                   /note="PFAM: protein of unknown function DUF1107; KEGG:
FT                   son:SO0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22138"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9J0"
FT                   /protein_id="ABO22138.1"
FT                   /translation="MRVFPVYAPKLIVKHARIFVSGVIWVKDLGRLEFEKGKFLLPRQS
FT                   LPQVKRAIMELNEMIEHQHNEAKTA"
FT   gene            complement(285155..285361)
FT                   /locus_tag="Shew_0267"
FT   CDS_pept        complement(285155..285361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0267"
FT                   /product="protein of unknown function DUF904"
FT                   /note="PFAM: protein of unknown function DUF904; KEGG:
FT                   son:SO0335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22139"
FT                   /db_xref="GOA:A3Q9J1"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9J1"
FT                   /protein_id="ABO22139.1"
FT                   /translation="MSLELLSKLETKIQAALETIELLKMELEEEKQKNHTLNEQNQQLS
FT                   QDLTSWNEKVTGLVGLLNDEVSE"
FT   gene            complement(285548..285829)
FT                   /locus_tag="Shew_0268"
FT   CDS_pept        complement(285548..285829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0268"
FT                   /product="transcriptional antiterminator, Rof"
FT                   /note="PFAM: Modulator of Rho-dependent transcription
FT                   termination; KEGG: shm:Shewmr7_0308 transcriptional
FT                   antiterminator, Rof"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22140"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9J2"
FT                   /protein_id="ABO22140.1"
FT                   /translation="MQPYRIIDCHVHDHLELACIRGYQLLIETSTGEMRATAITLTTQA
FT                   DKSEYLTVRNEAGEQAIRLDHIQAITPLTQGAAFDRVVIAPADKSRED"
FT   gene            285926..286813
FT                   /locus_tag="Shew_0269"
FT   CDS_pept        285926..286813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0269"
FT                   /product="protein of unknown function DUF1223"
FT                   /note="PFAM: protein of unknown function DUF1223; KEGG:
FT                   shm:Shewmr7_0309 protein of unknown function DUF1223"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22141"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9J3"
FT                   /protein_id="ABO22141.1"
FT                   /translation="MSKVALLFMLSLLAHPTFAAQTLTQFHKRSGEQQPLVVELFTSQG
FT                   CSSCPPMERWLSGFKQETGLWHYYFPLAFHVTYWNYLGWKDPFAKRAFSQRQYDYLNHK
FT                   GISQVYTPQLVINGREWRPGGQALLPDESDKRAQVGRLSLTIAGQEFTASFDSRLPSNQ
FT                   GLTLHLALLGSGLATRVGRGENRGKHLVEDFVVLSHGRYSALARQPLNDPALLEQGSAK
FT                   QGSAKQALVGQALAGQALTGKNWDKQTVTFSGNIEPLVKADNAPKRLAWVAWIEQDHIP
FT                   LQAVGDWLLVEEAD"
FT   sig_peptide     285926..285985
FT                   /locus_tag="Shew_0269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(286882..287517)
FT                   /locus_tag="Shew_0270"
FT   CDS_pept        complement(286882..287517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRB1460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22142"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9J4"
FT                   /protein_id="ABO22142.1"
FT                   /translation="MPSTKTTPPFKREHIMTKKTLAVAAVITAALSAPTMAADWFIGGG
FT                   IGSQENNYKAEITEAVDPGFSKGTFKDSDSDMIYELRGGVYLNDNNRVYGTYSYNSDDF
FT                   AKQQSFLMSYDYLVGLDANNKFNWFIGATAGVNHVSPDTDVLESKNRFVWGGQTGFMYK
FT                   INDSLSTEIGYRYLKQDYERSFASDAGDKASFSLDDSQQVYLSVDYRF"
FT   sig_peptide     complement(287404..287517)
FT                   /locus_tag="Shew_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 38"
FT   gene            287658..289007
FT                   /locus_tag="Shew_0271"
FT   CDS_pept        287658..289007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0271"
FT                   /product="phospholipase"
FT                   /note="KEGG: lpp:lpp1568 phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22143"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9J5"
FT                   /protein_id="ABO22143.1"
FT                   /translation="MKLVFVHGWSVTSTQTYGELPQALLKLAPEALALDIQHIYLGRYI
FT                   SFNDAVTLEDLSIAFEAARRAELGDEPFSVITHSTGGPLMRHWLCRYYKETESAPLLHL
FT                   IMLAPANHGSALAQLGKSRVSRLKAWFDGVEPGQRVLDWLELGSDGQHELNLSWQQKDW
FT                   LGAGVYPFVLTGEAIDGALYDYMNSYTGEVGSDGVVRVCAANMNFVYAKLAQQTGIQCE
FT                   SFDGECTETLVLTELTQAVEPCVLGIVPRASHSNRKMGIMNSVTQRNAANKPVVADILD
FT                   CLGVADRENYRQLREQMAVASEASRKPPRYCMLVVRVFDNLGHRVTDFDCYLLAGDEYH
FT                   ASKLPHAMVLDKQRNSVNGNVITFYLDANKLFKIRAGKLGLKLIPRPAEGFCHYKSAEF
FT                   RCEPEQLTHLFGADHTLMLDIQLERYIAPNTFSFTKIGDSEDFKGISPEG"
FT   gene            complement(289060..289803)
FT                   /locus_tag="Shew_0272"
FT   CDS_pept        complement(289060..289803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0272"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: she:Shewmr4_0303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22144"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9J6"
FT                   /protein_id="ABO22144.1"
FT                   /translation="MMKLKMLLGVAALASTTAVAQGPQCNHAQLPFQQMTPVPYDSTPY
FT                   SPQDTMPEQCSNPEVEAYIADWEAGKIDFTTIKANDSIAADQRFCKTLDDDGNISEVKD
FT                   CDRTKSPVGYIWKELSDSPVVIGITDGGKSDHAPHFHGQPECYYVVNGEGQTLADNQFK
FT                   KLGTGQYFYIPGATIHNTPIMSEKGLGVIYWYPNNAHFDGFKYYWRKDVKNLRVAEEAF
FT                   DRVDAIRKRDLNLGPYGTNEAFFKK"
FT   sig_peptide     complement(289741..289803)
FT                   /locus_tag="Shew_0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(289975..291039)
FT                   /locus_tag="Shew_0273"
FT   CDS_pept        complement(289975..291039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO1411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22145"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9J7"
FT                   /protein_id="ABO22145.1"
FT                   /translation="MKTYLSCALICLSFPAITAHATSIELGGFLKANARYVDGNIAFQD
FT                   SWAGGGQVVPSAKRTQFSAQESRFNIRLDHEQILGFAEIDFVGSAQGNPIISNSYAPRL
FT                   RHAFIQYQGITAGQTWSTLVNTSSFAETADLGGPLVGQAMVRQTQFCFSTVHWQFALEN
FT                   PYTYGTTAQHNEDKTQWIDTSNDYLPDTIIRYNQAGDWGNVSVSALIRYLDPADSRQWG
FT                   GGLSMGAKLFTYARDDLRLQLHYGNLGRYVGTDAAKDIFDGEIETSLSGMFAYRHFWTE
FT                   RSRSTLFYGHTTTQVEQTDRHHWGINLFTDLTQALSVGVELGRYEIDDAIRDAAAPRPK
FT                   GASNYAQLSMQFSL"
FT   sig_peptide     complement(290974..291039)
FT                   /locus_tag="Shew_0273"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 22"
FT   gene            complement(291207..292340)
FT                   /locus_tag="Shew_0274"
FT   CDS_pept        complement(291207..292340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22146"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9J8"
FT                   /protein_id="ABO22146.1"
FT                   /translation="MMKKTTQFMLSMVATAIALSASTAYAQEQEDGINVGGAVRVNYGY
FT                   KDYSEASKDKGGDLTFDMAAIKFNGKKGDWGLAAEYRFTSSTDYIKYGYGYYNIDPDWQ
FT                   LQFGINKVPFGNRDFISNSWWFGIPYYLGFEDDHDVGIKAVYEKNGWHTDLAFYKNPEY
FT                   GPTENKRYATDLYTGTINGTEYHNEETNQFNVRQTYTLEHEGGSTTLGGSVQYGQIYNS
FT                   KTGNNGDRYAVALHLDSSYKGWNLQLQAMQYEYDAADAVDPNKIGVSVVSWQYEIASKG
FT                   QAYSANIAKTFDTDWGSVKCYNDFGVMTPDVADNSYDNSMQNVTGCAIAAGPTYTMVDF
FT                   VMGKNMTFSTANNDHVGLPEVGNDWDKRVNINFGYYF"
FT   sig_peptide     complement(292260..292340)
FT                   /locus_tag="Shew_0274"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(292382..292750)
FT                   /locus_tag="Shew_0275"
FT   CDS_pept        complement(292382..292750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0275"
FT                   /product="tetraheme cytochrome c, putative"
FT                   /note="KEGG: son:SO1413 tetraheme cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22147"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9J9"
FT                   /protein_id="ABO22147.1"
FT                   /translation="MNKCIVTLLLGLALSSGVYAGELVKMKGKTQGRTNHEFIYQDGCQ
FT                   GCHQGSGKKNATDSACVECHGEINSIPVDESKLAIPEAHPHKSLHYNQGASCLACHGEH
FT                   EKKAPVCAECHRTWFGEM"
FT   sig_peptide     complement(292688..292750)
FT                   /locus_tag="Shew_0275"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(292756..294273)
FT                   /locus_tag="Shew_0276"
FT   CDS_pept        complement(292756..294273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0276"
FT                   /product="flavocytochrome c"
FT                   /note="TIGRFAM: flavocytochrome c; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   she:Shewmr4_0299 flavocytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22148"
FT                   /db_xref="GOA:A3Q9K0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9K0"
FT                   /protein_id="ABO22148.1"
FT                   /translation="MHNRRNFLKLSAGAAIGGMAAALPSTSLAKECQAIKWDESHDVII
FT                   VGSGFAGLSAALNTKRQGIKSVLVLEKMQVIGGNSAINGGWLAIPKNPIQLAQGIEDDS
FT                   PEELVKDQIISGRGMQNETALRQIANRALDAYELCIGTGVKFRDGFNIQVGGHNKARAI
FT                   RTQHGSGGDITTKLYEAGVREGVEYRLQHYIEDFIMDGQEIVGVKVRKNYRFPDITTGS
FT                   TIYIRANKAVILANGGFARNMKLREMVDPSLDPTLDCTNALGATGEVTLTAMAHGALPV
FT                   HMNLIQTGHWGSPDEGGFGWSNALLSIGWHQGAAISVLNGKRFMDERADRKTCSEAIMK
FT                   NRYPDNSPAYPVVLFNYEKYKDDDRVVRALRDKMAWKLDSLDEIASKFNIPAAELKRSI
FT                   NEYNGHVNARKDPLFNRKMDTAEVLTGPFVVSRIWPKVHYCMGGLKTDLAARVIDGRSM
FT                   SPIKKLYAIGEVTGGIHGEARLSSTSCLECLAMGIVVSETIKSDAQA"
FT   sig_peptide     complement(294184..294273)
FT                   /locus_tag="Shew_0276"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 30"
FT   gene            294605..295390
FT                   /locus_tag="Shew_0277"
FT   CDS_pept        294605..295390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0277"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: son:SO1415
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22149"
FT                   /db_xref="GOA:A3Q9K1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9K1"
FT                   /protein_id="ABO22149.1"
FT                   /translation="MKCPTETLPMMRCNQILDAAERLIESQGIVSFKFSQLAKEVGCST
FT                   GTLYKFFERKEDVLVCLFLRSATSNHLPIFIDKHPELSELEKVLLPVLFTFETISRSKS
FT                   FFTLRSVSVNTMVWQLASDEKVERFKKRINAFWGWFTDSLHAAVEQGELQATPLQIKEL
FT                   VQGLTFYLTGSLTQFESQLIAPEYLSNRRETCYRHLAKLMGQYKWNQALTPELFDSLEA
FT                   RTKAFFDQHYRDHMTCAACSALSGVNLKDRPACVRQAYQ"
FT   gene            295678..296769
FT                   /locus_tag="Shew_0278"
FT   CDS_pept        295678..296769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0278"
FT                   /product="branched chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="KEGG: shm:Shewmr7_0310 branched-chain amino acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22150"
FT                   /db_xref="GOA:A3Q9K2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9K2"
FT                   /protein_id="ABO22150.1"
FT                   /translation="MQINYNLKPASERRTQQFKPETNVGFGNLRTDHMFLMDYRDGEWR
FT                   DPRVVPYGPFEMAPGAMALHYGQSIFEGAKAFMHDDGEIYTFRLNKNAERLNLSGEVVC
FT                   IPPVPEAMQLAGINALIDVDRLWFPMQDGACLYIRPFVFATEDRLSVSPSQQYTFCVML
FT                   SPSGAYYADGFDKAIRLLITERFHRAVSGGTGASKAAGNYAASLRAGKAAAEYGAAQVL
FT                   YLDANNKQIEEVGAMNHFHVLKDGTIIIPKFTDTILKSITSQSIMELGEALGCEVRQET
FT                   VMLDQFIADIESGEIVEAGGFGTAAVVSPVGSYIFEDHRVLTVGDGQVGEHTRRIYQVL
FT                   TDIQKGKRQGPEGWMQKVERVAP"
FT   gene            complement(296813..297241)
FT                   /locus_tag="Shew_0279"
FT   CDS_pept        complement(296813..297241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22151"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9K3"
FT                   /protein_id="ABO22151.1"
FT                   /translation="MHWQRVVAVNPVHFIARHKPSSLFRLLALLTLPLFVSACQSNLIA
FT                   QSERDYLEVTPAQLSKYWVIQNNTLNWQGLIEQKQKLNISFGINPSGQLVDLELDDLSI
FT                   SPEQKEALLARFSEQRFNATVDNKSAQPVRVSAIVMFN"
FT   sig_peptide     complement(297125..297241)
FT                   /locus_tag="Shew_0279"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.793) with cleavage site probability 0.575 at
FT                   residue 39"
FT   gene            complement(297449..298150)
FT                   /locus_tag="Shew_0280"
FT   CDS_pept        complement(297449..298150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0280"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: shm:Shewmr7_0316 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22152"
FT                   /db_xref="GOA:A3Q9K4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9K4"
FT                   /protein_id="ABO22152.1"
FT                   /translation="MSKPMALDALSTLDTETPALTLADKALQAIQTSIIKGELAPGSKI
FT                   NEQMLAQRYGISRGPTREALLTLERRRLVVRIPHVGARVAQLSIDELNDLYRLRSVLEG
FT                   MACELAAKHITPTALMQLQRLMDSQEAALAKGDTYFQQDGDVDFHYRIIRASGSRHLQE
FT                   TLIGNLYHLLRMYRYQCTSESRPTRAIAEHRRIVEAIAAGDGELASLLMRRHIEQGRIN
FT                   TEKRLKALQAE"
FT   gene            complement(298344..299291)
FT                   /locus_tag="Shew_0281"
FT   CDS_pept        complement(298344..299291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0281"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   she:Shewmr4_3626 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22153"
FT                   /db_xref="GOA:A3Q9K5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9K5"
FT                   /protein_id="ABO22153.1"
FT                   /translation="MLNFLPGPLLFALSLTLLIINTVLWSTLICVGGIIKLLLPIALLR
FT                   TGIAHLMNRCMWSWACINGGILFLIAKIEWDIEGLEGLKKDGWYLLISNHLSGFDIAAL
FT                   TYVLRNNIPMLKFFLKKELLYVPFLGLGCWALDMPFMNRTSAKQLRKNPKLKGKDLETT
FT                   RRSCEKFRTIPTSIINYVEGSRFTPEKKARQRSPYRYLLRPKAGGIAFTISAMGEQFTS
FT                   LLNVTLVYPDSADNTLSEVMHGKVKRIVVRIESMPVPEVDDQQYFNDAECRAQFQRWLN
FT                   GVWQQKDEQIHQILTRYNSDQLVSEETRSLAESR"
FT   gene            complement(299316..300200)
FT                   /locus_tag="Shew_0282"
FT   CDS_pept        complement(299316..300200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0282"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   shm:Shewmr7_0319 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22154"
FT                   /db_xref="GOA:A3Q9K6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9K6"
FT                   /protein_id="ABO22154.1"
FT                   /translation="MGAVLSLIRGSLAFSCYVINTLFWVIPILLVSIIKLIPVTPLRTL
FT                   CSYLLDHCATAWISVNTLIERLFHRVDVQIEGDSNLSPKEWYMVIANHQSWVDILVLQR
FT                   IFNHKIPFLKFFLKQELLYVPVLGLAWWALDFPFMRRYSSAQLRKNPKLRGKDIEITRK
FT                   ACAKFKTKPVSVMNFVEGTRFRPEKHQKQNSEFNHLLKPKAGGMAFALSAMGDQIHKLV
FT                   DVTIYYPGNTPSYWDYICGRVKQVRVHIKVSEIAPEMRGDYLNDRAYKISFQEQLNRIW
FT                   QEKDAMLTKMAQQ"
FT   gene            complement(300316..301836)
FT                   /locus_tag="Shew_0283"
FT   CDS_pept        complement(300316..301836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0283"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: son:SO0349 magnesium chelatase family protein;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase, ChlI subunit; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22155"
FT                   /db_xref="GOA:A3Q9K7"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9K7"
FT                   /protein_id="ABO22155.1"
FT                   /translation="MAIACVTTRASLGVAAPEVTVEVHLSNGLPAFSLVGLPETSVKEA
FT                   KERVRSALINAGFEFPQRRITVNLAPADLPKQGGRYDLPIAIGILAASKQVPDTHLADH
FT                   EFIGELALSGQIRPCSGILPVIIDARKQDKTLVLPLENRGDAELVGYRKCFFAAHLQGL
FT                   AQYLHGQASLPGLTQDLQWLDTQADTDHKCLSDVIGQYQAKRALEIAAAGNHNLLFLGP
FT                   PGTGKTMLASRMMQLLPPLDYDEALEVAAIHSVAGLSIPMQAFYRRPFRCPHHTSSAIS
FT                   LVGGGSHPKPGEISLAHRGVLFLDEVAEFPRKVLDCLREPMETGEVVISRAAAKLTFAS
FT                   RFQLIAAMNPSPCGDSANARATPDQIQRYLARLSGPFIDRFDLTIEVPRLPQGTLTSSQ
FT                   RGETSRDVAQRVHQARERQLSRAGVLNAELSGKLLTQTAGFSQKDLEFLEQSVNQLGLS
FT                   VRSYHRLQRVARTIADLEQSKDVARHHIAQALGYRAMDRLLNSLKTPY"
FT   gene            302166..303491
FT                   /locus_tag="Shew_0284"
FT   CDS_pept        302166..303491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0284"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: son:SO4351 CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22156"
FT                   /db_xref="GOA:A3Q9K8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9K8"
FT                   /protein_id="ABO22156.1"
FT                   /translation="MSLLDNMLIILLLIGTSCFFSMSEIALAAARKIRLRQLADEGDPR
FT                   AERVLQLQAHPGSFFTVVQIGLNAVAIMGGIVGESAFTPYIRAGLESWVADPWLSQLSF
FT                   VLSFIIVTSLFILIADLMPKRAAMAMPERVALVLVGPMTFCIRLLTPLVWVFNGLANAI
FT                   FRLLQIPTARNDQVTSDDIYAVMDAGAEAGVLDKDEQQMIENVFEMQTVPVTAAMTARE
FT                   SLVYFLLQDDEEVIKRKIAEDPHTKFLVCDGQLDTIKGVVDAKELLIRVINGQSITLKD
FT                   STLVHNCLIIPDSLSLSESMEYFKNHRADFAVVMNEYALVVGIVTTNDLQSAVMGAWSL
FT                   HESEEQIIARDKDSWLVDGVTPITDVMRAFGIEAFPQSQNYETIAGFMMFMLRKIPKRT
FT                   DFVNFGGYKFEVVDIDAYKVDQLLVTRIPAEATPPLVAAVEQ"
FT   sig_peptide     302166..302252
FT                   /locus_tag="Shew_0284"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 29"
FT   gene            complement(303520..304401)
FT                   /locus_tag="Shew_0285"
FT   CDS_pept        complement(303520..304401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0285"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: sdn:Sden_0972 GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22157"
FT                   /db_xref="GOA:A3Q9K9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9K9"
FT                   /protein_id="ABO22157.1"
FT                   /translation="MPRNDTLNANAPKGGDMTAFAIFIVLIGLMGLLASLIPTYQICQL
FT                   KPPQTQGWHLLLFMIGMFIFGYLGFLWMLLNRETGPLETVVSLVFSAGGAFVWLVVKMS
FT                   MKTIVKLQDTLEDKHYQAYHDSLTDLPNRHMLYETMERLIKENGSPFGFIMMDLNDFKM
FT                   INDNLGHDAGDKVLEIIAYRIERIMPPQALPVRLGGDEFAVLLPKSELGQAQRLAKQIQ
FT                   KAVIEDIHCEGHLLAVGISIGIALYPQDGDDRKTLMKHADIAMYRSKQNNSDYETFSQV
FT                   TDMPAPLGQFSP"
FT   gene            complement(304599..305408)
FT                   /locus_tag="Shew_0286"
FT   CDS_pept        complement(304599..305408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0286"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; KEGG: she:Shewmr4_0358 ABC-type amino acid
FT                   transport/signal transduction systems periplasmic
FT                   component/domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22158"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9L0"
FT                   /protein_id="ABO22158.1"
FT                   /translation="MVSWGRLVTGLCCGFALLFSALPALATASVTICVENTEFPPFNYF
FT                   DRNQSVEPRSIGYDIDILNLAFGQSVLSHKVIALPWNRCLKEVKQGTVDAAMSASLNSE
FT                   RRRDYLISTPYYYLTPSYYYLKSDFPKGVEVQRLEELNHYGSVCGIKNFNYENFGLKPD
FT                   FHLFQIRSLAHLPEMLTKKRCQFFLARKETLSGTLAINKMEDFYTRLAGITAPNAKPEP
FT                   FYMLISKNSPHKETIKQLFDAKVDSLNKQGKLRPLLEHHLQLLSQTY"
FT   sig_peptide     complement(305328..305408)
FT                   /locus_tag="Shew_0286"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.836 at
FT                   residue 27"
FT   gene            complement(305476..306360)
FT                   /locus_tag="Shew_0287"
FT   CDS_pept        complement(305476..306360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0287"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: she:Shewmr4_0360 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22159"
FT                   /db_xref="GOA:A3Q9L1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9L1"
FT                   /protein_id="ABO22159.1"
FT                   /translation="MDIRTIKLYLHLSNSLHFARTAQQMHVSPSTLSRAMQRLEEEVGA
FT                   KLFERDNRSVTLTNAGVEYRHFAEQTLDNWSKLKHRLDPKQDLLRGRLNIYCSVTAAYS
FT                   HLPALLDRFRNEHPLVEIALTTGDAANAVEMVRQNRADISIAAKPESLPESLHFIKIDN
FT                   VPLVIIAPTFKCAVQELLTEPYIPWDRLPFILPEHGPGRLRIENWFKQLGLSANVYAQV
FT                   SGQEAIASMVALGCGVSITPEVVIQNSPVKDRIQQLSSPVAIPPFELGCCSKKSREDEP
FT                   VIAAFVKELNAVN"
FT   gene            306553..308034
FT                   /locus_tag="Shew_0288"
FT   CDS_pept        306553..308034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0288"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: son:SO4349 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: acetohydroxy
FT                   acid isomeroreductase; Acetohydroxy acid isomeroreductase,
FT                   catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22160"
FT                   /db_xref="GOA:A3Q9L2"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9L2"
FT                   /protein_id="ABO22160.1"
FT                   /translation="MANYFNSLNLRQQLEQLGQCRFMDRSEFSQGCDYIKGWNIVILGC
FT                   GAQGLNQGLNMRDSGLNISFALREQAIAEQRPSYQKATGNGFRVGTFEELIPDADLVLN
FT                   LTPDKQHTDAVNAVMPLMKQGAVLSYSHGFNIVEEGMQVRPDITVIMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGDGLEVAKAYASATGGDRAGVLHSSFIAEVKSDLMGEQ
FT                   TILCGMLQTGAILGYEKMVADGIEPGYAAKLIQQGWETTTEALKHGGITHMMDRLSNPA
FT                   KIKAFEMAEELKAILQPLFEKHMDDIISGEFSKTMMEDWANDDANLLKWRAETNETGFE
FT                   NAPACDEAIDEQTYFDKGIFLVAMIKAGVELAFDTMVSAGIVEESAYYESLHETPLIAN
FT                   TIARKRLYEMNVVISDTAEYGCYLFNHAAVPLLRDYVNQMSPEYLGGGLKDSGNGVDNL
FT                   RLIEVNDAIRHTAVEYIGAELRGYMTEMKRIVEEA"
FT   gene            308543..310216
FT                   /locus_tag="Shew_0289"
FT   CDS_pept        308543..310216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0289"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate enzyme
FT                   domain protein TPP-binding; thiamine pyrophosphate enzyme,
FT                   central region; thiamine pyrophosphate enzyme TPP binding
FT                   domain protein; KEGG: she:Shewmr4_0362 acetolactate
FT                   synthase, large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22161"
FT                   /db_xref="GOA:A3Q9L3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9L3"
FT                   /protein_id="ABO22161.1"
FT                   /translation="MEQGQKIRGADAVIKALAAHGVTTVFGYPGGAIMPIYDALVGAPV
FT                   EHLLSRHEQGAAFAAVGYARASGKTGVCFATSGPGATNLVTVLADALLDSVPLVAITGQ
FT                   VSTAVIGTDAFQEIDVLGMSLSCTKHSFMVTDVEELVPTLYRAFEIAASGRPGPVLVDI
FT                   PKDIQIALLDYKAPLQAIQPEPQVDPSLLESAKNLIAQAQRPMLYVGGGVGMAGAVEQL
FT                   RDFINQSGMPSVATLKGLGSIAHDHPGYLGMLGMHGGKAANLAVQECDLLLVVGARFDD
FT                   RVTGRLASFAEHAKVVHLDIDIAELGKLRRPDVAIAGDLREILPALAQPLEIAPWLAEV
FT                   ARLKAQHAWSYDRPGELIFAPKLLNRLAAKLPEDSVVACDVGQHQMWVAQHMWFRRPED
FT                   HLSSAGLGTMGFGLPAAIGAKVARPDACVVAVSGDGSFMMNVQELTTIKRRQIPLKILL
FT                   IDNQKLGMVKQWQQLFFEERFSETDLSDNPDFVTMASAFDIPGRTITQAGEVESALDEM
FT                   LDAKGPFLLHVRIDEAHNVWPLVPPGASNRDMMDEMEKQT"
FT   gene            310213..310482
FT                   /locus_tag="Shew_0290"
FT   CDS_pept        310213..310482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0290"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="KEGG: shm:Shewmr7_3663 acetolactate synthase small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22162"
FT                   /db_xref="GOA:A3Q9L4"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9L4"
FT                   /protein_id="ABO22162.1"
FT                   /translation="MIYNLALTLAQQPEVIERVLRVTRHRGFKVTEMDMHLGDNGTTRL
FT                   GMVVESERALELLSHQLNKLIDVTECEVLSAKPAATRYPQHASA"
FT   gene            310509..311432
FT                   /locus_tag="Shew_0291"
FT   CDS_pept        310509..311432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0291"
FT                   /product="branched chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase, class IV; KEGG: vvy:VV3242
FT                   branched-chain amino acid amiotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22163"
FT                   /db_xref="GOA:A3Q9L5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9L5"
FT                   /protein_id="ABO22163.1"
FT                   /translation="MAAKTAELIWFNGEIMPWGDAKVHVMSHALHYGTSVFEGIRVYDT
FT                   PQGPAGFRLTDHVQRLYDSAKIYRMPVPYSFDETMQACRDIVKSNKLDAAYIRPLVFFG
FT                   DVGMGITPPKDAKCDLMVAAFPWGAYLGEGSMERGVDVAVTSWNRLAPNTIPTGAKAGG
FT                   NYLSSLQISTEAKRNGFDEGIALDVNGLVSEGAGANLFVVKKNKLYTPPATAAILLGIT
FT                   RDTIITLARDLGYEVVEEPMSREFLYLADEIFMTGTAAEIVPVRSVDRIEVGAGGRGPV
FT                   TQALQASFFGLFNGETQDKWGWLELL"
FT   gene            311545..313395
FT                   /locus_tag="Shew_0292"
FT   CDS_pept        311545..313395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0292"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: shm:Shewmr7_3662 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22164"
FT                   /db_xref="GOA:A3Q9L6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9L6"
FT                   /protein_id="ABO22164.1"
FT                   /translation="MAKLRSATSTQGRNMAGARALWRATGVKDSDFGKPIVAIANSFTQ
FT                   FVPGHVHLKDMGSLVAGAIEEAGGIAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADALVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTKLSDKLIKLD
FT                   LVDAMVAAADDRVSDEDSEKIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSLL
FT                   ATHSDRRELFLEAGRRVMALANRYYRDDDESALPRNIASFKAFENAMALDIAMGGSSNT
FT                   VLHLLAAAQEAKVDFTMADIDRLSRQVPHLCKVAPSTPKYHMEDVHRAGGVMGILGELD
FT                   RAGLLHTDVSHVAGENLKAVLVQYDLVQTQDEAVQQFYAAGPAGIPTTKAFSQSCRWPS
FT                   LDVDRQEGCIRTREFAFSQEGGLAVLSGNIAADGCIVKTAGVDEANHTFVGHARVYESQ
FT                   DDAVAGILGGEVVAGDVVVIRYEGPKGGPGMQEMLYPTSYLKSKGLGTSCALITDGRFS
FT                   GGTSGLSIGHVSPEAAAGGTIALVETGDRIEIDIPARSITLAVSDEVLETRRQAMQARG
FT                   KQAWKPVNRERSVSLALKAYAMLATSADKGAVRDVSKLED"
FT   gene            313397..314947
FT                   /locus_tag="Shew_0293"
FT   CDS_pept        313397..314947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0293"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   KEGG: sfr:Sfri_0425 threonine dehydratase, biosynthetic"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22165"
FT                   /db_xref="GOA:A3Q9L7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9L7"
FT                   /protein_id="ABO22165.1"
FT                   /translation="MLALASQSQLDLAHYYLQKILLSSVYDVAKVTPLSSLNKLSARLG
FT                   CQVFLKREDMQPVHSFKLRGAYNRIAELSQEECQRGVVCASAGNHAQGVAMSASARGVS
FT                   AVIVMPQTTPDIKVDAVRRLGGTVVLYGQSFDMANEHAQQLARDEGRIYVAPFDDEAVI
FT                   AGQGTVAQEMLQQQRDLEVVFVPVGGGGLIAGIAAYYKAVMPQVKIIGVEPEDSACLKA
FT                   ALEADERVVLSQVGLFADGVAVKQIGAEPFRLAREYVDQVVTVTSDEICAAVKDIFEDT
FT                   RAIAEPAGALSLAGLKKYIGDEGKGQKVAAILSGANVNFHSLRYVSERCELGEQKEAIL
FT                   AVKVPEHPGIFLRFCELLEKRAMTEFNYRFSSREKAVVFAGIRLSHGQAELDEIVARLE
FT                   GDGFEVQDLSHDETAKLHVRYMVGGLPPEPLQERLFSFEFPEHPGALFKFLTTLRSKWN
FT                   ISLFHYRNHGAAYGRVLAGFEVPESDSVAFQQFLTELGFVYQEETQSPAYKLFLDNRD"
FT   gene            315341..316483
FT                   /locus_tag="Shew_0294"
FT   CDS_pept        315341..316483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0294"
FT                   /product="alanine-glyoxylate aminotransferase"
FT                   /EC_number="2.6.1.44"
FT                   /note="PFAM: aminotransferase, class V; KEGG: son:SO4343
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22166"
FT                   /db_xref="GOA:A3Q9L8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9L8"
FT                   /protein_id="ABO22166.1"
FT                   /translation="MLAAPKVTPFNPPRRVLMGPGPSDVYPEVLAAQARPTIGHLDPLF
FT                   VGMMDELKSLIQYAFQTENAMTLAVSAPGSAGMETCFVNLVEPGEKVIVCRNGVFGERM
FT                   RQNVERVGATAVVVDNEWGTPVSLSDVEAALKAHPDAKFLAFVHAETSTGALSDAKGLC
FT                   QLAKAHDCLSIVDAVTSLGGVELRVDEWGIDAIYSGSQKCLSCVPGLSPVSFSPAAVEK
FT                   LKARKTPVQSWFLDQSLVMGYWSGDQGAGGKRSYHHTAPVNALYALHESLRLLAEEGLE
FT                   NAWARHHSMHALLRDGLENLGLKFVVEEGSRLPQLNAVYIPEGVDDGAVRKQLLENYNL
FT                   EIGAGLGALAGKAWRIGLMGFGARRENVALCLRALEEVLR"
FT   gene            complement(316564..316989)
FT                   /locus_tag="Shew_0295"
FT   CDS_pept        complement(316564..316989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22167"
FT                   /db_xref="GOA:A3Q9L9"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9L9"
FT                   /protein_id="ABO22167.1"
FT                   /translation="MDTASIDSAPAPTPTTQAPAQASPQEPTQPTIQPEFKHSGLGIAA
FT                   FTLSIIATLLIFGIVTVAGVMEATTPGGIDETSPEAIVVGMLIFAFIGLALVALGLGIG
FT                   GLVQKQRKKIFAILGTIFSSVAILATLALIAYGTTID"
FT   gene            317368..317838
FT                   /locus_tag="Shew_0296"
FT   CDS_pept        317368..317838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0296"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: bja:blr7961
FT                   probable HspC2 heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22168"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9M0"
FT                   /protein_id="ABO22168.1"
FT                   /translation="MRSFFPSIFHKDDPRTALHSRLDNVFDDFAKDWLTTWPNTRAELG
FT                   VMPAIDVKECAEYVEIKAELPDMEEKDIDVDIRGNYLTISGEKRHEQEKDEKGYHLRER
FT                   SFGSFQRQIPLGFNIDADQITAKYKKGVLAIHVPKPAELQQDAKKVKVDFHE"
FT   gene            complement(317928..319835)
FT                   /locus_tag="Shew_0297"
FT   CDS_pept        complement(317928..319835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22169"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9M1"
FT                   /protein_id="ABO22169.1"
FT                   /translation="MKKFFVAIILFVAFILYWQTRDSSLTVPIQAADTPNAPTDKSANV
FT                   APDTASHSQALNGLNYADCRNTLQSAKDLKQKWAGEQDWDQRLEQGYSIDDITLAMGHF
FT                   LNANFVGSWRAKQLKHNSQLSQVNRSLGEQVKALIPDLPSFVRVEKAVPQPQLTNIAEL
FT                   TQDEALALLESTEISIDDLNWLLKQESLPQTLLLQALNQIEDVNALLGYGITQNETLHL
FT                   IDTAAFHGRNQVVSALLNKGSQLTNDPYLGTTMEYALAGLDYRFRMNKLSDDEVFKHQI
FT                   EIIRLLQSQGSPANFISNTEQSVKGFFPRHFYSFDAQQIAFLQQTHDLVLAQILPKQGL
FT                   RFDKQSALMQALEKELAEQLTTIASKSERNQCKKIVARVDQEWQPRDLDFFTTKLTNEG
FT                   KTVTRETLNEIDPILADCSSKFAPKALGVSYLHDRELKDKVYGFARENKISEAISVLEE
FT                   AQLNEAEYRHFFYQLLGYDSTYFVPLQTSRLHQERLSYSLLYDATKSKIVDVIAQGIDI
FT                   DELDYSGKSLLDIAITKEDLQLLNYLISQHILYPERVVGRDPLYLLLDTSDHRFNPDQL
FT                   MTYLPLIMSLEPPIQPAHIRLMALLRLKYTKFYADMTELYPQLIAPEDAQLPPAICLYY
FT                   "
FT   gene            complement(319961..321049)
FT                   /locus_tag="Shew_0298"
FT   CDS_pept        complement(319961..321049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0298"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold"
FT                   /note="KEGG: pat:Patl_0737 Zn-dependent hydrolase of the
FT                   beta-lactamase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22170"
FT                   /db_xref="GOA:A3Q9M2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9M2"
FT                   /protein_id="ABO22170.1"
FT                   /translation="MLTSNLINSSSAPQALASGDQLASREPAAHHRSDGGFQNTATNLT
FT                   ENSGMGAILMRYLTETRIDASPSKAIPLMPLTRDGIAALPDSQDSVIRLGHSSILLKIA
FT                   GQTWLIDPVFSDRASPFSFIGPKRFHQPPIALEQLPEIDGVLISHDHYDHLDEESIKQL
FT                   HHKVKRFIVPLGVEQHLLRWGVANDKVQPLDWWQSVTLGKLSITATPTQHFSGRGLWDK
FT                   NQTLWASYVIQSDRSKLYFSGDSGYFDGFKAIGERFGPFDLTMIETGAYDKDWPSIHMT
FT                   PEQSLQAHLDLGGRQMMPIHNGTFDLAFHSWYEPLERIAALAADANTQLITPIVGQVLD
FT                   IHNTPESVAWWREEQLNLALNE"
FT   gene            321214..321822
FT                   /locus_tag="Shew_0299"
FT   CDS_pept        321214..321822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0299"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: hch:HCH_03535
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22171"
FT                   /db_xref="GOA:A3Q9M3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9M3"
FT                   /protein_id="ABO22171.1"
FT                   /translation="MIEKKLTRSELKRAAIVEAASVEFQNKGFSLASMDDIAKRADVSK
FT                   RTVYNHFPSKEALFSAIMLEMMEMLCAFESLPFSAEESLASQLTQLVQHEIKLLSAKGF
FT                   IDTARVIIAEAIHKPELIQDAMSEFSKQESPLANWFNQAIAAGALKAKDSEILVVQFTA
FT                   VIKAYCFWPQLIQGEPLPSQAKLDEITQTVVEMIIKQYT"
FT   gene            complement(321953..323311)
FT                   /locus_tag="Shew_0300"
FT   CDS_pept        complement(321953..323311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0300"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   son:SO4339 sodium-dependent transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22172"
FT                   /db_xref="GOA:A3Q9M4"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9M4"
FT                   /protein_id="ABO22172.1"
FT                   /translation="MSAKDLGHFSSRIGFIMAAAGSAVGVGNIWGFPTQAATHGGGAFL
FT                   LVYLVLIFLLGYPMLVAELMIGRHGQTNPADAMAKLGSSKLSRNLGKTIGFASIITATL
FT                   ICTFYSILSGWFVSFTLAPIARLVGMQDIALWLTSFSLERNLLFTLIFILMVVLVIRQG
FT                   VQQGIEAWSKRLMPLLLAILILGVAYILTQPGASQGLNALLVPDFGRIWEPQVLIGALG
FT                   QTFFSLTVGTGAMMVYGAYLNRQENLAKLTAYVTLTDTSVAFLAALMIIPAMYVAQHNG
FT                   VQIFAADGSLLNADTLVFTVLPALFDSLGGLAGQLIAIVFFILMTIAGLTSAISIVEVP
FT                   TSYMVEKTEIQRHSATYLVGGGIALLATIMVFNFDALFALVITLTTERAQPFIALGIAL
FT                   YTGWVWHRNSLLKAIAAQEGAKLDGLFWRIWPVYVKYVCPVLILAIILQLLTA"
FT   sig_peptide     complement(323201..323311)
FT                   /locus_tag="Shew_0300"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.615) with cleavage site probability 0.379 at
FT                   residue 37"
FT   gene            complement(323549..324049)
FT                   /locus_tag="Shew_0301"
FT   CDS_pept        complement(323549..324049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0301"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   son:SO4337 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22173"
FT                   /db_xref="GOA:A3Q9M5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9M5"
FT                   /protein_id="ABO22173.1"
FT                   /translation="MTRLQLDKTDIQILKLLQAQGRMANQDLAASVGLSPSPCSRRVKA
FT                   MEEAGIIAGYAALVDAPYFQLTLTAYVQVRLEKHTQAILDAFEQAIDGYDEVLECALLT
FT                   GSDADYQLKVLVRDMDAFKHFLLEKLTSNPHIAGIRSSFVLKQVKSRTAIPLPELGTQD
FT                   DKA"
FT   gene            complement(324124..324891)
FT                   /locus_tag="Shew_0302"
FT   CDS_pept        complement(324124..324891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0302"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /EC_number="3.1.3.27"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   shm:Shewmr7_3657 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22174"
FT                   /db_xref="GOA:A3Q9M6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9M6"
FT                   /protein_id="ABO22174.1"
FT                   /translation="MRSNPPSNLYFSVVLLWSGLTLIPAAIYLGGLSLFPWLELSSLKA
FT                   QILFGLTSSGTAPYGVLTVLALLLACYLLLPRKQLVPLLFSVCLAMGLSLGLNHFLKPY
FT                   FGHPRPNVQFLAENQGLSLSGFYQASQPTRRILMAQEVAKLSQEIKLPQETKLSLSPKI
FT                   AQHWQDEVGYSFPSGHTLFAVTLTLVVSYFLLAAQRFLFAALLCLWALAMGFSRMLLGM
FT                   HWPQDVLAASLLGGLIALLALLITEKWRAIGQG"
FT   gene            complement(324998..326350)
FT                   /locus_tag="Shew_0303"
FT   CDS_pept        complement(324998..326350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0303"
FT                   /product="Inner membrane CreD family protein"
FT                   /note="PFAM: Inner membrane CreD family protein; KEGG:
FT                   shm:Shewmr7_3656 inner membrane CreD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22175"
FT                   /db_xref="GOA:A3Q9M7"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9M7"
FT                   /protein_id="ABO22175.1"
FT                   /translation="MLSRLPLANSPLSKKLIFIAILTLVAMIPLGLIESLTSDRQHLYH
FT                   GMVNEIGRSWGEQQTIAGPALVIPYTYEVVQESISDTGKMTKARHTYDSELVVLPEQLN
FT                   LAVSLKHSFLSRGIFRSLVYQSQVTGSAQFRLEAYSLPNLVNLHPDQARLVFGISANQA
FT                   IDKLNRFAAKADQQAAAPQRLMPGTGLEQLRGLDRGFHQPIALSPDSEQLTVNFDISLR
FT                   GSQGISVLPIGQQTEVTLSADWPHPSFHGLLPTERQITAQGFSAQWDVSHLTRNYPQVF
FT                   TKTQEVNLQEIAAQATLFEPVTHYGKIERAVKYGLLFIMLTSTMLLIFELGQQQVLSSI
FT                   QYLLVASAMALFYLLLLSLSEHISFGYAYLLAASVPLLSVSAYIASVTASNRRGAFMAI
FT                   MLLALYSVLYSILKLEDYALLMGSGLLMMVLLLLMYLTRHQIEAPSTPSQE"
FT   gene            complement(326573..326833)
FT                   /locus_tag="Shew_0304"
FT   CDS_pept        complement(326573..326833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0304"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   shm:Shewmr7_3651 protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22176"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9M8"
FT                   /protein_id="ABO22176.1"
FT                   /translation="MINPKKIEEVAKQLSDNLPSGLKQFAGEFEEKSKQVLQNQLMKLD
FT                   LVSREEFDVQQHVLLKTREKLEALQAQVDALEAKLRQQDEA"
FT   gene            327074..329086
FT                   /locus_tag="Shew_0305"
FT   CDS_pept        327074..329086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0305"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase Rep; PFAM:
FT                   UvrD/REP helicase; KEGG: son:SO4325 ATP-dependent DNA
FT                   helicase Rep"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22177"
FT                   /db_xref="GOA:A3Q9M9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9M9"
FT                   /protein_id="ABO22177.1"
FT                   /translation="MKLNPGQNDAVHYVSGPCLVLAGAGSGKTRVIINKIAYLVQKCGY
FT                   QARNIAAVTFTNKAAREMKERVAQSMGRKEARGLWISTFHTLGLEIIKREYKVVGLKPG
FT                   FSLFDDQDTLALLKELTEKEFDGDKDLLRMLMTAISNWKGDLMTPDGAIKTARDEQSQL
FT                   FALLYQRYAQHMKAYNALDFDDLILLPTLLLRHKQEVRERWQKRIQYLLVDEYQDTNTS
FT                   QYELVKLLVGERARFTVVGDDDQSIYSWRGAKPQNLVLLGKDFPNLKLIKLEQNYRSSQ
FT                   RILRAANILIANNPHVYDKSLFSELAYGEPLRVLIAANEEQEAERVVAEMIRHKFVGKT
FT                   QFGDYAILYRGNHQSRLLERALMTNRIPYKLSGGTSFFGRAEIKDIMAYLRLVVNPDDD
FT                   NAFLRVVNLPKRGIGPATLERLGNYANEQHISMFEAIFHSELNHHLPPAAMSALYQFGK
FT                   FIVDTGEAATRGEPVEAVKQLIRHINYEDYLYETSTSAKAAEMRMKNISELYRWVTEML
FT                   EGDELDEGMTLPEVVTRLTLRDMMERNSEDEAGDQVQLMTLHASKGLEFPYVFMVGVEE
FT                   RILPHQTSIDEDNVEEERRLAYVGITRAQRELWFMICRERRQFGEVMRCEPSRFLMELP
FT                   QDDLIWENRKPPQSEQQRVQSGRANIANIRDMLKK"
FT   gene            complement(329116..331764)
FT                   /locus_tag="Shew_0306"
FT   CDS_pept        complement(329116..331764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0306"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   KEGG: she:Shewmr4_0377 diguanylate
FT                   cyclase/phosphodiesterase with GAF sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22178"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9N0"
FT                   /protein_id="ABO22178.1"
FT                   /translation="MFRDKTDQHSPREVGRLYKRISRLKSLARKYKRSEIVQNTLLDIS
FT                   NLAARVERAEDFYAGIQTNLNRLLPADNFFIAILNRETNKLGVPFFVDEKDQHPSQLYP
FT                   SEELSTTLNSGLTGYVLRSQQPLLCDDDKFEQLLASGEIVSRGSSCHQWLGLPIFSSDQ
FT                   TIGVIAVQSYDANITYGEIEVELMTFISQHISGVIERVQYQHNLEAAIEHRTKELSVAY
FT                   DKLKQEVTERRRAENLQKSLFEIAELSNATIDHQSFYRELHRVISHLLPANNCYIALLE
FT                   DNGRELHFPFYVSQLNVGAPQRRPLADGLTEFILKHKRPLLLDGSDIKALIKAGQLYAK
FT                   APQLNYAETIHQWIGVPLFIQGIVKGALTIYSFTPSQTYQEKDLDLLTFVSQHIAAAIE
FT                   RKLSAESLKQSYEQLEEKVAQRTRALAMLNQDLEKEIAQRRKVEQQLVHDASHDTLTGL
FT                   PNRAMFMERLAQAVKHVRRHARDRFALLFIDLDRFKLINDTLGHLQGDRFLIETARRLN
FT                   LCIRSNDTLGRIGGDEFVILLDSINTNSDAIEVAERILGELSEPYQLSNQSFTSGASIG
FT                   IAFSGHSSGDTSESLLKDADAAMYQAKSNGKGCFVIFDHNTSHQQSHDITLEIELREAI
FT                   AKQELALQYFPVLALATQEVLALEPRLYWQHEQLGKIKQDQLSNIAEHCNLTKELDLYL
FT                   FDQLNSDYDKVMQQVDGQVQLHIKLASQHLKHKHAVRKLKNRIKQSYYKADDIWVFFNE
FT                   KAFVADSDSHIQAFDLLAKQAINLGLCAYGSAHTALSSLSFLPLSGLKLDPSYISHLNN
FT                   PQQKRLLKAHQLTASALELTLFVEGVKTDLHRQQLVSLGFDQGQGQALGESIDPSKLPE
FT                   PRKRPSGCISA"
FT   gene            331983..332059
FT                   /locus_tag="Shew_R0014"
FT                   /note="tRNA-Arg1"
FT   tRNA            331983..332059
FT                   /locus_tag="Shew_R0014"
FT                   /product="tRNA-Arg"
FT   gene            332103..332178
FT                   /locus_tag="Shew_R0015"
FT                   /note="tRNA-His1"
FT   tRNA            332103..332178
FT                   /locus_tag="Shew_R0015"
FT                   /product="tRNA-His"
FT   gene            332263..332339
FT                   /locus_tag="Shew_R0016"
FT                   /note="tRNA-Pro1"
FT   tRNA            332263..332339
FT                   /locus_tag="Shew_R0016"
FT                   /product="tRNA-Pro"
FT   gene            332392..332468
FT                   /locus_tag="Shew_R0017"
FT                   /note="tRNA-Pro2"
FT   tRNA            332392..332468
FT                   /locus_tag="Shew_R0017"
FT                   /product="tRNA-Pro"
FT   gene            complement(332601..334523)
FT                   /locus_tag="Shew_0307"
FT   CDS_pept        complement(332601..334523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0307"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; histidine kinase, HAMP region domain protein;
FT                   KEGG: son:SO4323 GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22179"
FT                   /db_xref="GOA:A3Q9N1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032244"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9N1"
FT                   /protein_id="ABO22179.1"
FT                   /translation="MTLFRQIYSLLFGLFLVVVISLAYVQFTETQSFLTKQMESDLNNT
FT                   SHSLGIMLVPDLEAGDIVGAETLINVIFEGGYYQQVKLTWLVDGKQQVWENDVKIEGVP
FT                   QWFIDLGFFETIKRESTITSGWIQLANLEITAHPGFGYNELWRTLTNAIIVISILFLLA
FT                   IMLARFGLTWILRPLHEIAEHAAEIAQRKFGPDMAIPKTSELKSVVEAFNSMSHQLKQI
FT                   FSSLDEEVTELRKKNLVDQVSKLPNRQYMMGRLNSWLSEPNNGSLMMAKFDWLEEVHSK
FT                   YGYQVRDETIRLLSEKMQEQLDEIAPSVIARIAAYEFAFLITSAEQEQSSKYLHTLIRT
FT                   VNQEISKAGCKPNEQFAIGIAQRTDNMTVSDILAQTDNALQKAIADNKVFHWFESNEKQ
FT                   LYTREQWREHLSAAISSKQFQFKWQPVYHTNKDEVVQRELYCQLTIGDKEIHAGQFMPY
FT                   VELLSLGSMLDRCLIETIVDNGLLERNYEPIAINLTFNSLSDTTFHQWLNKFLRNTPLA
FT                   QRIVFDIPEAGVYSDPDACQALCNIIRDNGAHFGIDHFGRQFGSMSYLQNLRPSYVKLD
FT                   QSFAYYDENEHNSELCRALVNVARGLDIQIIVTGIQEQPQLARFEPLKANAYMGYIYPP
FT                   TRVEL"
FT   sig_peptide     complement(334452..334523)
FT                   /locus_tag="Shew_0307"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.731 at
FT                   residue 24"
FT   gene            complement(334532..335239)
FT                   /locus_tag="Shew_0308"
FT   CDS_pept        complement(334532..335239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22180"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9N2"
FT                   /protein_id="ABO22180.1"
FT                   /translation="MKAKIGRQKRFQRVCQLCVVATALGFSCLYASPTQTLDANYIKST
FT                   LEARYGERAGMRVAAWFKVLDESQGLSEQEKITKVNNFFNLFRFVDDIKLWGVSNYWAT
FT                   PMEFIGVNGGDCEDFSIAKYFTLLQLGVPDDKLRITMVKATSVNQYHMVLAYYDTPGSI
FT                   PLVLDNLDRQIKPATQRQDLIPVYSFNGRQLWLNKEKGRGVLAGSSERLEKWNDLKNRL
FT                   GVERLKMPKLRLE"
FT   sig_peptide     complement(335144..335239)
FT                   /locus_tag="Shew_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.867 at
FT                   residue 32"
FT   gene            complement(335256..335861)
FT                   /locus_tag="Shew_0309"
FT   CDS_pept        complement(335256..335861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0309"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: sdn:Sden_0380
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22181"
FT                   /db_xref="GOA:A3Q9N3"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9N3"
FT                   /protein_id="ABO22181.1"
FT                   /translation="MKALLIILSVALLGGCASRDIVTMDTPTNQVFDLNDKDKDGVIVA
FT                   RERCNDTVLGATIDNYGCGKIKPINERQELKILFANDSYYIDPQYYDQVEVVATFMRQY
FT                   PNTKVTIEGHCSKTGSYEHNLALSQNRADAVTSLLSERFGIASDRLTAIGYSYDRPVDP
FT                   THTKMAHTRNRRVIAEVTGEDTKADMKWTIYTVDEQVK"
FT   gene            complement(335861..337273)
FT                   /locus_tag="Shew_0310"
FT   CDS_pept        complement(335861..337273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0310"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   sdn:Sden_0381 type I secretion outer membrane protein,
FT                   TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22182"
FT                   /db_xref="GOA:A3Q9N4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9N4"
FT                   /protein_id="ABO22182.1"
FT                   /translation="MSKQTMHQLKRSAMALAISAMLIPGAASSQTLEQAVAHTLDTNPD
FT                   IRIAFNRFKAREEQVNQAIAGYMPTVDISGGYGWEQTNSPSTRRRAGQGDVDKDGVIEL
FT                   MRGEVGFSIKQMLFDGFYTSSEVDRFSFEASADQWALFAAAEDIALDVAKVYVNYIRSE
FT                   QVLTLAEKNLQSHKDIYDQIKQRTDSGLGSVADLSQITGRLARANANVIAAKNNFFDAK
FT                   AQFIRIVEKEPENLIVPVPDDDMLPTNLTDGLKVAQENHPILKSAASDISAAENERSSA
FT                   QSNYYPKLSLELGGNWNDNLDGEDGYSAFASQNVGGHNNDLIAMVRVKYNLFAGGKDLA
FT                   REKEAAYKIGEAKEIRQRAYRQVVEGVNLAWNAYEMLEPQKLYIRDHVIAAKDTQVAYS
FT                   QQFNLGQRTLLDLLDTENELFEARKDYLDAEYDEIISEYRILNATGRLLESLRVTRPEV
FT                   WKGEREYEGGVK"
FT   sig_peptide     complement(337184..337273)
FT                   /locus_tag="Shew_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 30"
FT   gene            complement(337305..338687)
FT                   /locus_tag="Shew_0311"
FT   CDS_pept        complement(337305..338687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0311"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: shm:Shewmr7_3644 type I secretion membrane fusion
FT                   protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22183"
FT                   /db_xref="GOA:A3Q9N5"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9N5"
FT                   /protein_id="ABO22183.1"
FT                   /translation="MSKHLTTQDLEMVDDVYGAMMTDAPTSHRLIIWALAALAFSFLVW
FT                   AYFAELDRVTTGTGKVIPSSQVQVIQSLDGGIMKELYVREGMTVTKGQPLVRIDDTRFR
FT                   SDFAQQEQEVYSLQANVIRLRAELNSITISDVAADWREQVKIAKQPLQFPPELTESEHD
FT                   LIERQRDEYSGRLDNLSNQLEILARQIQQKQQETEELASKINTLTTSFQLVTRELELTR
FT                   PLADKGIVPEVELLKLERNVNDIRGELSSLRLLRPKLKASQDEAILKRREAVFVYAAEA
FT                   RTQLNEMQTRLSRINEAQVGARDKVSKAEIVSPVNGTIKTVHINTLGGVVQPGIDIIEI
FT                   VPSEDQLLIETKIIPKDIAFLHPGLPAVVKVTAYDFTRYGGLNGVVEHISADTTQDEEG
FT                   NSFYLVRVRTELSSLTKDDGTLMPIIPGMLTTVDVITGQRSVLEYILNPILRARDTALR
FT                   ER"
FT   gene            complement(338680..340860)
FT                   /locus_tag="Shew_0312"
FT   CDS_pept        complement(338680..340860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0312"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter-related protein; SMART: AAA
FT                   ATPase; KEGG: son:SO4318 toxin secretion ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22184"
FT                   /db_xref="GOA:A3Q9N6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9N6"
FT                   /protein_id="ABO22184.1"
FT                   /translation="MQASASPKTEQWTVSASQRVTVDPLLDSLVLLTEYFGSPCSSESL
FT                   AAGLPLSGSILTPELVPQAAGRAGLAAKLTRKGLDQISPILLPCILLLKDKNACLLREI
FT                   DIDKDRAVIQLPETGGEEELSIEALEAMYVGYLFLVKQQYRGDMGLDLHLHDSRTHWLI
FT                   QTLKDSAPIYRDALIASVLVNLFALVSPLFIMNVYDKVVPNLAFESLWVLAIGAGIAYI
FT                   FDLIMRQLRAYLIDVAGKKVDIIVSSRLFAKAIGIPLEKRSPSIGGMARQLGEFDSIRE
FT                   ILTSATITTLVDLPFALFFMLIIYIVAGDLAIIPVIGGCIIIGYTLLMQPRLKAAIEES
FT                   NKFSSLKHGHLIESLASIESIKSSGAEGLVQKSWQQMIGHTANWQLKVKKISTSVTNVA
FT                   NFTVQLSVVCVVILGVYRVADNDISMGGIIAAVILSSRAISPMAQLAGLMTRGNHTASA
FT                   LRQLDQIMTQEDEFENKGHLVSKHRLKGQINADHVSFNYPGSERPVLHPMSLSIAPGER
FT                   IAIIGRNGSGKSTLAKLLVGLYQPTKGSLRYDGLDSAQIHPTDLRRNFGYLPQDITLFH
FT                   GTIRDNILFGTRQVTEHQLIRAVQLSGVNQFTDIETEGLDQQVGEGGQSLSRGQRQTIA
FT                   LARATLNDPPVLLMDEPTASLDARAEKQFIRAMRNVSKERTLLLITHKMHLLNLVDRIL
FT                   VLDRGHLVADGPKEQVLNQLAKGLLSGGPKSE"
FT   gene            complement(340995..355505)
FT                   /locus_tag="Shew_0313"
FT   CDS_pept        complement(340995..355505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0313"
FT                   /product="putative outer membrane adhesin like protein"
FT                   /note="TIGRFAM: putative outer membrane adhesin like
FT                   protein; PFAM: Hemolysin-type calcium-binding region; von
FT                   Willebrand factor, type A; KEGG: shm:Shewmr7_3642 putative
FT                   outer membrane adhesin like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22185"
FT                   /db_xref="GOA:A3Q9N7"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR014749"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR040853"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9N7"
FT                   /protein_id="ABO22185.1"
FT                   /translation="MCVKKLTTVQTIDNIRYLAKKRANSCNIKNQVVSFNSAGAGMKSL
FT                   VTTKNGQVIDVKGKVSLVTETEQKEVTIGEMIPEGSTILIAEQADLELAFADGTSFTSQ
FT                   SLNETSAAEADALNEIEQLQALIASGEDPTAELPETAAGNTAASEGDSGFISVSRTGAQ
FT                   TLAGAGYTTSGFSVEQPTVQAFTVSSDDAPTITANDTNTIAEDGVATGNVLDNDVDFDT
FT                   ELSVVTFTVDGQTVTAGATVEVEGGSLVINADGSYTFTPNDNWNGSVPVITYTTNTGES
FT                   ATLTINVTPVDDPSILANDSNTIAEDTVATGNVLDNDSDIDSELSVVSFSVDGQTVTAG
FT                   TTVEVEGGSLVINADGSYTFTPNDNWNGSVPVITYTTNTGESATLTINVTPVDDPSILA
FT                   NDSNTVAEDTVATGNVLDNDSDIDSELSVVSFSVDGQTVTAGTAVEVEGGSLVINADGS
FT                   YTFTPNDNWNGSVPVITYTTNTGESATLTINVTPVDDTTNAVNDFNTVAEDTIASGNVL
FT                   DNDSDVDDTLSVVSFEIDGNSYIAGNVATLDGGIFFLNADGSYSFVPNENWNGNVPVVT
FT                   YITNTGATATLTIVVTPVDDATSAVDDYINVPEDTVASGNVLDNDSDVDDELSVVSFEV
FT                   NGNSYTAGSSVVLDGGTLVLNADGSYSFTPNADWNGYVPEVTYTTNTGATAILTIYVDP
FT                   VDDATNAVNDFNTVAEDTIASGNVLDNDSDVDDTLSVVSFEIDGNSYIAGNVATLDGGI
FT                   FFLNADGSYSFVPNENWNGNVPVVTYITNTGATATLTIVVTPVDDATSAVDDYINVPED
FT                   TVASGNVLDNDSDVDDELSVVSFEVNGNSYTAGSSVVLDGGTLVLNADGSYSFTPNADW
FT                   NGYVPEVTYTTNTGATAILTIYVDPVDDATNAVNDFNTVAEDTIASGNVLDNDSDVDDT
FT                   LSVVSFEIDGNSYIAGNVATLDGGIFFLNADGSYSFVPNENWNGNVPVVTYITNTGATA
FT                   TLTIVVTPVDDTTNAVNDFNTIAEDTVASGNVLDNDSDIDNELSVATFTVDGEDTVYNA
FT                   GESVELEGGILVLNADGSYTFTPNDNWNGSVPVVTYTTNTGDSATLTINVTPVNDDFTD
FT                   DNEVINVNEDSGATTGNVIDGTSVDGELSVQSFSIDGVTGPFTLGQAVNINGVGSFTLN
FT                   ADGSYSFTPAANYNGPVPVITYVLTDGSSTDTSTLTITVDPVNDDFTDDNEAINVNEDS
FT                   GATTGNVIDGTSVDGELSVQSFSIDGVDGPFTLGQAVNINGVGSFTLNADGSYSFTPAA
FT                   NYNGPVPVITYVLTDGSSTDTSTLTITVDPVNDDFTDDNEAINVNEDSGATTGNVIDGT
FT                   SVDGELSVQSFSIDGVTGPFTLGQAVNINGVGSFTLNADGSYSFTPAANYNGPVPVITY
FT                   VLTDGSSTDTSTLTITVDPVNDDFTDDNEVINVNEDSGATTGNVIDGTSVDGELSVQSF
FT                   SIDGVDGPFTLGQAVNINGVGSFTLNADGSYSFTPAANYNGPVPVITYVLTDGSSTDTS
FT                   TLTITVDPVNDDFTDDNEVINVNEDSGATTGNVIDGTSVDGELSVQSFSIDGVTGPFTL
FT                   GQAVNINGVGSFTLNADGSYSFTPAANYNGPVPVITYVLTDGSSTDTSTLTITVDPVND
FT                   DFTDDNEVINVNEDSGATTGNVIDGTSVDGELSVQSFSIDGVTGPFTLGQAVNINGVGS
FT                   FTLNADGSYSFTPAANYNGPVPVITYVLTDGSSTDTSTLTITVDPVNDDFTDDNEVINV
FT                   NEDSGATTGNVIDGTSVDGELSVQSFSIDGVTGPFTLGQAVNINGVGSFTLNADGSYSF
FT                   TPAANYNGPVPVITYVLTDGSSTDTSTLTITVDPVNDDFTDNNEVINVNEDSGATTGNV
FT                   IDGTSVDGELSVQSFSIDGVTGPFTLGQAVNINGVGSFTLNADGSYSFTPAANYNGPVP
FT                   VITYVLTDGSSTDTSTLTITVDPVNDDFTDDNEVINVNEDSGATTGNVIDGTSVDGELS
FT                   VQSFSIDGVTGPFTLGQAVNINGVGSFTLNADGSYSFTPAANYNGPVPVITYVLTDGSS
FT                   TDTSTLTITVDPVNDDFTDDNEVINVNEDSGATTGNVIDDTSVDGELSVQSFSIDGVTG
FT                   PFTLGQAVNINGVGSFTLNADGSYSFTPAANYNGPVPVITYVLTDGSSTDTSTLTITVD
FT                   PVNDDFTDDNEVINVNEDSGATTGNVIDGTSVDGELSVQSFSIDGVDGPFTLGQAVNIN
FT                   GVGSFTLNADGSYSFTPAANYNGPVPVITYVLTDGSSTDTSTLTITVDPVNDDFTDDNE
FT                   VINVNEDSGATTGNVIDGTSVDGELSVQSFSIDGVTGPFTLGQAVNINGVGSFTLNADG
FT                   SYSFTPAANYNGPVPVITYVLTDGSSTDTSTLTITVDPVNDDFTDDNEVINVNEDSGAT
FT                   TGNVIDGTSVDGELSVQSFSIDGVTGPFTLGQAVNINGVGSFTLNADGSYSFTPAANYN
FT                   GPVPVITYVLTDGSSTDTSTLTITVDPVNDDFTDDNEAINVNEDSGATTGNVIDGTSVD
FT                   GELSVQSFSIDGVTGPFTLGQAVNINGVGSFTLNADGSYSFTPAANYNGPVPVITYVLT
FT                   DGSSTDTSTLTITVDPVNDDFTDDNEVINVNEDSGATTGNVIDGTSVDGELSVQSFSID
FT                   GVTGPFTLGQAVNINGVGSFTLNADGSYSFTPAANYNGPVPVITYVLTDGSSTDTSTLT
FT                   ITVDPVNDDFTDDNEVINVNEDSGATTGNVIDGTSVDGELSVQSFSIDGVTGPFTLGQA
FT                   VNINGVGSFTLNADGSYSFTPAANYNGPVPVITYVLTDGSSTDTSTLTITVDPVNDDFT
FT                   DNNEVINVNEDSGATTGNVIDGTSVDGELSVQSFSIDGVTGPFTLGQAVNINGVGSFTL
FT                   NADGSYSFTPAANYNGPVPVITYVLTDGSSTDTSTLTITVDPVNDDFTDNNEVINVNED
FT                   SGATTGNVIDGTSVDGELSVQSFSIDGVTGPFTLGQAVNINGVGSFTLNADGSYSFTPA
FT                   ANYNGPVPVITYVLTDGSSTDTSTLTITVDPVNDDFTDDNEVINVNEDSGATTGNVIDD
FT                   TSVDGELSVQSFSIDGVTGPFTLGQAVNINGVGSFTLNADGSYSFTPAANYNGPVPVIT
FT                   YVLTDGSSTDTSTLTITVTPDNTDVANDAITVAEDTVASGNVLSNDEAGNTSVVSFTLD
FT                   TDGNGSQESFTAGDSVTLAGGVLVVNSNGSYSFTPNQDWNGSVPVVTYTTNTGETATLT
FT                   ITVTPDNTDVANDAITVAEDTVASGNVLSNDEAGNTSVVSFTLDTDGNGSQESFIAGDS
FT                   VTLAGGVLVVNSNGSYSFTPNQDWNGSVPVVTYTTNTGETATLTITVTPDNTDVANDAI
FT                   TVAEDTVASGNVLSNDEAGNTSVVSFTLDTDGNGSQESFIAGDSVTLAGGVLVVNSNGS
FT                   YSFTPNQDWNGSVPVVTYTTNTGETATLTITVTPGVDGGNNVDLIVDDANTQGTATDSD
FT                   SAGLSFTAGAYDVTGFAFGNIGDINVSGLDANISWSLDSSGNLIGKIDGNAVLQLSLSG
FT                   SNISAGATGTVTVSVTLLDNLPHGTSVDELVINGITVVATDAANDTATGTVSVKVIDDG
FT                   VTVNPLDLAGDNAAGIYDGVINVDGADQGFSADLSGNISGAGTFSDSGITAGGLTVFYY
FT                   VDPANPSMLIAYSDTSGTPSAYDSGNSAQSVIFTLSIDPNGGTYQLDLKHAIDELSTVT
FT                   VANMSGGKGGNTPAVYVTFDGTNYIIDNDINDVDPNNAMVFSLTSTVGNISSTVNGNTN
FT                   GFGVANAFVDQGENLIIDYANDVASASVSFDGATYIHFKAYDADGNLLGEGDITNGQTI
FT                   GNLGEISYIEISTSSLDNHSNFQFTGTSAENIVSSTVDVDLDFVVDVTDSDGDTSTGSI
FT                   HVDLDAPGSTTTAPTALTSNAVSMLSEADLYKDGTESDSQSLRFKSGSESITAFQFGDT
FT                   DNIHVSGVNAKISWSFNDEGQLIGTFMGKEAIRLTLNGDRIESGEEGSVSVTAELLASF
FT                   PHNVSTENLVISGINIVGVDALGQKAVSTITVSVSDYAEAVNDSVRGTEDHDLSGNLLT
FT                   NDIDPDDELSIVSFKLSGNTYQADGSTINLAEGKLSIHADGRFTFEPNLHWSGTLPQIE
FT                   YLTNTGDTAILDLNVVAVADAPILSASTGDVVQGEVALDINVALVDRDGSESLTDVTIQ
FT                   GVPSGVSLSAGTLNADGSWTVAVNQLGNLSIKADDSYNGDLEFTLTIKASSVEQSNSDS
FT                   ASSQTTLDVSLRNYHYDNGTDGDNVINGGEDNDVIVSDTTGIQVVQGENYNVAFILDSS
FT                   GSMGSNRIESAKDQLLQVFNTLKASVGGATSGTVNVLLVDFNSGTKAHVAVNLADSDAI
FT                   SKLESVLNEISSDNGRTNYEAAFETVIDWFSHGSAASNTGTNLTYFITDGETNNYNVDA
FT                   DPEDVWVYYTDNYRSGDDRTLSDLLNDYIPGKELTYRGKVIIDEYGNINYWSGYSRYDM
FT                   DGRQIGSIRVDENGDYYVAKIASGYSNGNGTDVTAESEALAAFQVLNTLSNVEAIGIGS
FT                   GISLNKLTPYDSDGNVATNINVSDLASIILGSKEMLLQGDDTVNAGEGNDIVFGDLVQF
FT                   DGIDGQGYAALQKYVALQLGEDASTVTIQDVHEFVAANPALFDTSRDHDGDDIIAGNQG
FT                   DDILFGQGGDDELHGGSGDDMLLGGHGSDMLIGGAGEDILIGGLGDDTLTGGTGKADGE
FT                   ADTFVWQQGDTGTDHITDFDINQDKLDLSDLLQGENGGNLEDYLHFTVDNGSTTIEIDA
FT                   NNDGHVDQTIVLDGVDLSHLGTTDGQIINGLLGSEGNGALIVDNANVNQAASSFAVPTT
FT                   QDDDSQIQHLVP"
FT   gene            complement(355622..360283)
FT                   /locus_tag="Shew_0314"
FT   CDS_pept        complement(355622..360283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0314"
FT                   /product="putative outer membrane adhesin like protein"
FT                   /note="KEGG: sdn:Sden_0384 hypothetical protein; TIGRFAM:
FT                   putative outer membrane adhesin like protein; PFAM:
FT                   Hemolysin-type calcium-binding region; SMART: Cadherin"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22186"
FT                   /db_xref="GOA:A3Q9N8"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR040853"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9N8"
FT                   /protein_id="ABO22186.1"
FT                   /translation="MIMGASITTQDAVVVNLVGELKVKDEQGNIREVKIGDLIHAGEQL
FT                   IFSPNAKFNLEYEDGSSTTQANLMQDTLNQDTTVSQDTGQEQQSDAAPQTNTPVALDPE
FT                   IAALQAQILAGEDPTQGLPETAAGAGTPTNQGDAYFVSVGRTGDETLADAGWDTAGFPL
FT                   TPDTTVEEVIIPELQPSAPTVSSATFSLFEANLAQGSSPSALLTNFANNIQTAADAGIS
FT                   SLTINGINIISGGQFAGPIVINTPNGVLTITGFDSASGQFTYDYAFNSSADHSAGDQLQ
FT                   FLFNIELVDNQGDIATGTITVNIIDDQPEGFADSNAVTEDTATVATGNVLGNDIQGADS
FT                   AEVTAVTNSQGTSISLGETNSIQGQFGVLTLFADGSYSYQLNNGSSAVQSLALGQQITE
FT                   TFNYLLTDSDGDSVLVPLTITITGTNDTPIITSNIEAATGSVLEAGVMDGGNVPEPGSL
FT                   VTGGTLTAADVDNGASWTWSGVPQVSDYGTFSINASTGEWSYTLADNALVDALAQGETH
FT                   EETFLVTVTDEHGAYSTQLVTVTVTGTNDIPVITSNIEAATGSVLEAGVMDGGNVPEPG
FT                   SLVTGGTLTAADVDNGASWTWSGVPQVSDYGTFSINASTGEWSYTLADNALVDALAQGE
FT                   THEETFLVTVTDEHGAYSTQLVTVTVTGTNDIPVITSNIEAATGSVLEAGVMDGGNVPE
FT                   PGSLVTGGTLTAADVDNGASWTWSGVPQVSDYGTFSINASTGEWSYTLADNALVDSLAQ
FT                   GETHEETFLVTVTDEHGAYSTQLVTVTVTGTNDIPVITSNIEAATGSVLEAGVMDGGNV
FT                   PEPGSLVTGGTLTAADVDNGASWTWSGVPQVSDYGTFSINASTGEWSYTLADNALVDAL
FT                   AQGETHEETFLVTVTDEHGAYSTQLVTVTVTGTNDIPVLTIDKTSGLVTEDDSDPMLTD
FT                   TGTLSFTDVDDEYLPEYVGHDLSASYVANSLMWSGGDITDVLSADQIQALIDGFSVYQD
FT                   HWDYSILNSLVQFLAANETITLSFDVTVADKHGAYDTQTVTITINGNNDPIEGEFAKEI
FT                   WVPASLAEIAIPYLDGYPLGIDVPTDQDYNDVITITGLSLSFVDPDETADIGEIWYVDD
FT                   NTGVLTLYDFDNPVVLSASELGSLVYVPGDNAGIEDQLDINLTFTVNSGSDSVDGNFVI
FT                   HTVPANSLGGNTVLIGDGSSPLTSGNDQDAYLTVSSAFASAINLDPSSGALDLFTDFQK
FT                   SPFDIPIPNGEIGGQTGIEREEEVSVRLTINGITFIVIAAANGVTDWFYDANSGLMSAH
FT                   ISYTNILMESDNSITLADYLGANPVDPGDIWTITYLDNDGGSYQARFVQATFTHELLPD
FT                   TAVTVTGTDNVDNLIFGTTEGDSLTGANLDDEIYGREGNDSIFGLEGDDQLIGGSGDDL
FT                   IEGGSGNDIILGGLGNDTIDGGIGADILIGGAGSDTIDAGIDSDIDTFVWDVGSDDNSI
FT                   DTVLNFDISMDKLDLSAILVDEESGVYALDQYLAFNFSGGNTEISVDANHDGVVDLTIV
FT                   LNNVDLTNNNTLSDAQIINNLLGNENLVIDTIP"
FT   gene            complement(360568..361734)
FT                   /locus_tag="Shew_0315"
FT   CDS_pept        complement(360568..361734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0315"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein; KEGG: she:Shewmr4_0385
FT                   HemY domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22187"
FT                   /db_xref="GOA:A3Q9N9"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9N9"
FT                   /protein_id="ABO22187.1"
FT                   /translation="MIRALIYLVIVIIGLIASPYLSWLKGYIYIAIGDYELETSLVFAI
FT                   FAAVMFYVGLVLLEMLVVWTINLVLNSRLLPEKWRRKAARKHTLTGALALAEEDWSTAE
FT                   KAMARGADKGEIPALNLLAAARAAQHRNDHDARDHYLNEAAKDPAAYKAVLTTRVRYLL
FT                   QQGELTRARALLDELNPTSKSKPPVLALALDLYRAQQDWSALKLLLPIVKKRGIIDESE
FT                   HQALNAEVNLELLKQAAGQNEQALEKAWHWLSRAERKQTEFIAQYALGLAKFERRDEAI
FT                   KLLMKQAKQQPTQAIFDALPQVLTPADLDARKQLFELEKKLGEQTEYQACIAALYDQSK
FT                   EFRESQKWWAKVCQQSPTKQRWLALAEACEHLGEQNQALQNYRKAAIF"
FT   gene            complement(361731..362873)
FT                   /locus_tag="Shew_0316"
FT   CDS_pept        complement(361731..362873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0316"
FT                   /product="protein of unknown function DUF513, hemX"
FT                   /note="PFAM: protein of unknown function DUF513, hemX;
FT                   KEGG: she:Shewmr4_0386 protein of unknown function DUF513,
FT                   HemX"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22188"
FT                   /db_xref="GOA:A3Q9P0"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9P0"
FT                   /protein_id="ABO22188.1"
FT                   /translation="MDKNTQESKAVATTEHDESIDATFTDTPQAKSTASQETKPAQSGG
FT                   GVSWGFLFNLVFILLLLFATATGGFYLYQELTQQKEKTAVLAKQLQQGLDDPRTRITHL
FT                   EQQQRTAENQFDQKLAQLQAKQGEVQDQVNKLAQRNPNHWMAEEAKYLVRMAGNKLWLE
FT                   KDPQTALSLLEAADDRIETMKDPSLTPIRKALARDMNDVAAIKSTDVAGTVLSLDTIIE
FT                   RLPKLKVNRSESKINAKDDSLQVTESIDDWQSNLAKSWQALIEEFVIIRKRTTDPAPLL
FT                   APDQQWYLVENIRNKLLQAQLALFRQDQVNYRQSVTLARKWIFQYFDLDDNKTEQTLAA
FT                   LDALATLEIQSPTIEQFAATPLLQQLVTNGSLIKDRETSL"
FT   gene            complement(362929..363660)
FT                   /locus_tag="Shew_0317"
FT   CDS_pept        complement(362929..363660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0317"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   son:SO4314 uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22189"
FT                   /db_xref="GOA:A3Q9P1"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9P1"
FT                   /protein_id="ABO22189.1"
FT                   /translation="MKLLLTRPEGRNQSMAEALSQRDVPFTIAPLLAVVANNEADHEHK
FT                   KKLFYQSDIIIFISTNAVEYADIALSSAWPKDKQYFAVGQATYCALKDKGIVAFEAPES
FT                   CQQTEGLLTLAQLQAITGQQITIVRGVGGRETLASELADRGAKVDYWEVYRRACPQLDP
FT                   HTPYEWREQAIDTIVITSGEILANLITLVPKELFAWLHACHIIVPSARVYDQAIAAGFT
FT                   RVTNAKAANRDAVLTALGLQD"
FT   gene            complement(363663..364616)
FT                   /locus_tag="Shew_0318"
FT   CDS_pept        complement(363663..364616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0318"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: sfr:Sfri_0440 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22190"
FT                   /db_xref="GOA:A3Q9P2"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9P2"
FT                   /protein_id="ABO22190.1"
FT                   /translation="MASDGISSMSQNVIRIATRKSPLAMWQAEFVKAELEKAHEGLVVE
FT                   LLPMSTKGDVILDTPLAKVGGKGLFVKELEVAMLEGKADIAVHSMKDVPVDFPEGLGLQ
FT                   VICEREDPRDAFVSNTYKNIEELPQGAIVGTSSLRRQCQIRAARPDLEIRDLRGNVGTR
FT                   LAKLDAGNYDAIILAAAGLKRLKLEDRIASFISAEDSLPANGQGAVGIECRTDDERVKA
FT                   LLAPLEHIETRYRVIAERAMNTRLEGGCQVPIGAYAEIDGDTLSLRGLVGNPDGSQVIR
FT                   GTTSGAKQDAEQLGIALADELLSKGAKAILDAVYAK"
FT   gene            364802..367222
FT                   /locus_tag="Shew_0319"
FT   CDS_pept        364802..367222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0319"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase, class-I; KEGG:
FT                   shm:Shewmr7_3637 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22191"
FT                   /db_xref="GOA:A3Q9P3"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9P3"
FT                   /protein_id="ABO22191.1"
FT                   /translation="MKEQEHFIATAERLNKVRLARALAMLTPLQRHLMQLIPVLFHYHR
FT                   SDFPGYNGPMTPSGVFEYFPSDDALEACRTLGLSEPQVIHQQQSALYGVYTMGSTASFG
FT                   QNPKSDIDVWLVYDPTLADDEIASLQDKSQLLTAWFGQHDLEVNIYLVHPKQFISSSRD
FT                   GVVQTASLGCENSGSVQHWLLLEEFYRSQICLGGKRVAWWPGAEAIESHLFLGDVSNLP
FT                   ASEYFGASLWQLYKGLDKPHKALLKVMLLEAYASDYPNSNLVTTQVWQRTLAGDFSAFN
FT                   DAYFLLYQSIEHYLEYKNDKRRLEIVRRCFYLKCGIRLTVAEHPKDWRYYKLQSLVTRW
FT                   GWSDNLLRTLDQCASWHCGQLQWFNEQLNELMLGCYQTLLQFASANKLSDSLKISELGL
FT                   LTRKLHTYFSEDDKQIISLNRLWTRSVAEAHLTVIYSHNTKEYYLYRCTPESKNFMGNR
FT                   AVFHSHSKAKLLIWASLNGVSTAQTQWYAYGEGKGQDKALTKAAKRLPTIMTERRWRAS
FT                   KLDLCQPWHFRQLLFLINFNRDETQLWRGQEIIFDYMNANIFSMGRHHRNMVQSLDVIC
FT                   QNSWGEWHCHHFEGNEAILDALVYITPGMQRAPQQVKVDVVSCSSRLSTQIERSISQLV
FT                   HRANRMCTKAKTSSTMVHPLQVGGIKYGLFFNSKGMVYQDLSESTAFYQRLSKQRMLEL
FT                   PRPDLGNEPFSKIPEVIQDFAAIGAIQYFLRPGKEGIDVFVLDEKNELNHYVQPGNNLE
FT                   ELVSQVSHHHAFADSYLDNERFNLPQFFRLVRVDGRLQAQPFGVNVDEAAIEF"
FT   gene            complement(367230..367604)
FT                   /locus_tag="Shew_0320"
FT   CDS_pept        complement(367230..367604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0320"
FT                   /product="Frataxin family protein"
FT                   /note="PFAM: Frataxin family protein; KEGG:
FT                   shm:Shewmr7_3636 frataxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22192"
FT                   /db_xref="GOA:A3Q9P4"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9P4"
FT                   /protein_id="ABO22192.1"
FT                   /translation="MWALQQPTPLKDAQMAMTDSEYHQLADEMFTALEDAIENAIDEQD
FT                   ADIDIDASGNVLQLEFQDKSKIVINKQEPLHQIWVATQFGGYHFSYVEGKWLDERSDAG
FT                   EFMPFVLASILRQGGIALSL"
FT   gene            368094..368261
FT                   /locus_tag="Shew_0321"
FT   CDS_pept        368094..368261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22193"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9P5"
FT                   /protein_id="ABO22193.1"
FT                   /translation="MLNKMKPILLMVLASAALSGCGQKGPLYKSPAQEDNQKPQVEQPT
FT                   PATEQNNNKD"
FT   sig_peptide     368094..368168
FT                   /locus_tag="Shew_0321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.573 at
FT                   residue 25"
FT   gene            368267..369511
FT                   /locus_tag="Shew_0322"
FT   CDS_pept        368267..369511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0322"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: shm:Shewmr7_3634
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22194"
FT                   /db_xref="GOA:A3Q9P6"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9P6"
FT                   /protein_id="ABO22194.1"
FT                   /translation="MDHFLYQQDELYAEQCTVASLAETYGTPLYVYSRATLERHWHAFD
FT                   NAVADHPHMICYAVKANSNLAVLNVLARLGSGFDIVSGGELARVLEAGGEASKVVFSGV
FT                   GKTVAEMEMALEAGIYCFNVESAAELEQLNLVALRLGKVAPVSLRVNPDVDAGTHPYIS
FT                   TGLKENKFGIAMEEAEAIFLRANELPGLAVKGADCHIGSQLTELQPFLDAMDRMLALID
FT                   RLAEQGVKIAHLDVGGGLGVTYDGEQPPEPSAYASALLGKLAGRDLKLIFEPGRAIAAN
FT                   AGIFVTQVLYLKENAEKNFALVDGAMNDLIRPSLYSAWQKIIPVVPRPGETRQYDVVGP
FT                   VCETGDFLGKDRALNIRANDLLAVRSSGAYGFTMASNYNSRPRAAEVMVDGERHYLVRE
FT                   REKVAQLWQGEQLLP"
FT   gene            369549..370388
FT                   /locus_tag="Shew_0323"
FT   CDS_pept        369549..370388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0323"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: son:SO4308
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22195"
FT                   /db_xref="GOA:A3Q9P7"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9P7"
FT                   /protein_id="ABO22195.1"
FT                   /translation="MIHFTKMHGLGNDFMVVDGVTQNVYFSPEQIKRLADRNFGIGFDQ
FT                   LLLVEPPYDPDLDFHYRIFNADGSEVEQCGNGARCFARFVKSKGLINKQKIKVSTSSGK
FT                   MTLRLERDGSVTVNMGIPVLEPSRIPFNAKKAEKTYLLQADMPEGMQTFLCGAVSMGNP
FT                   HCVLEVDDVANADVERIGSLLTKHERFPKGVNVGFMQVVDANHIKLRVYERGAAETLAC
FT                   GSGACAAVAVGQLQGKLARRVRVDLPGGSLTINWEGEGKPLWMTGPAEHVYDGQIQQ"
FT   gene            370397..371023
FT                   /locus_tag="Shew_0324"
FT   CDS_pept        370397..371023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0324"
FT                   /product="protein of unknown function DUF484"
FT                   /note="PFAM: protein of unknown function DUF484; KEGG:
FT                   sfr:Sfri_0446 protein of unknown function DUF484"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22196"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9P8"
FT                   /protein_id="ABO22196.1"
FT                   /translation="MNKKAELPFDEVLIREYLLDNPDFFARYPELLLAMRIPHEQRGAV
FT                   SLVERRQEMLRSRVTQLEEEITSLLAMASRNEQIYMFNTALSLKLLQAEDLGDLRQILS
FT                   SELQKQFQFTHVRLITVHDIDSELSNIWSERLKQGYYFGRLTQNESKRLFGCEVGSVAL
FT                   SRLSQQCGQVIFAIASQDPMHFHPEMDNLLLDQLKQLLDHLLPKL"
FT   gene            371031..371924
FT                   /locus_tag="Shew_0325"
FT   CDS_pept        371031..371924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0325"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: phage
FT                   integrase family protein; phage integrase domain protein
FT                   SAM domain protein; KEGG: shm:Shewmr7_3631 tyrosine
FT                   recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22197"
FT                   /db_xref="GOA:A3Q9P9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9P9"
FT                   /protein_id="ABO22197.1"
FT                   /translation="MSDDWVQEFVSYLVSERQLSPHTVRNYRFELERVGELLPENFIWA
FT                   EVSDEQLQAVLNKLHRKGLGPRSIALTLSALKQFCHYLLQEGYIKKDPCLNLSAPKQQK
FT                   PLPKNMDLDSVTHLLSIEGDDALALRDKAIMELFYSSGLRLAELAALDTRDIASGEHQV
FT                   KVMGKGSKERIVPIGRMALSAIDDWLKVRSLLPCEDDALFVTAKGKRLAHRSIQARLNK
FT                   WGQLQGLNARVHPHKLRHSFATHMLESSADLRAVQELLGHANLSTTQVYTSLDFQHLAK
FT                   VYDGAHPRAKKRGGNG"
FT   gene            371917..372639
FT                   /locus_tag="Shew_0326"
FT   CDS_pept        371917..372639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0326"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: shm:Shewmr7_3630 HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22198"
FT                   /db_xref="GOA:A3Q9Q0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Q0"
FT                   /protein_id="ABO22198.1"
FT                   /translation="MVSVAIGLRPFKAISFDLDDTLYDNRPIIMAAEQRLLSFLAQRHP
FT                   LTQAWSLDDWQVLKRSLIRQSPSLAHDTSAARLVTLEQGLITLGYAKTQAGEAAQQALA
FT                   YFVEQRSDFTVAPEVIAKLTRLARHYPLIGITNGNVDAQRIGLGEVLEFVLHPGNGTRM
FT                   KPYPDMFYQACQRLDIGCHELLHLGDSFKADVQGARRAGCQAAWLNPAVGREPQLISEG
FT                   QLPHMTCSDLDDLLALID"
FT   gene            372741..373316
FT                   /locus_tag="Shew_0327"
FT   CDS_pept        372741..373316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0327"
FT                   /product="HupE/UreJ protein"
FT                   /note="PFAM: HupE/UreJ protein; KEGG: she:Shewmr4_0396
FT                   HupE/UreJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22199"
FT                   /db_xref="GOA:A3Q9Q1"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Q1"
FT                   /protein_id="ABO22199.1"
FT                   /translation="MRTRLLPLLLLAWTTPVFAHGITHGAGFMTGFNHPVLGFDHLLAM
FT                   LSVGLLSTQLGGRAIWTVPLAFMAFMLVGGILGLYGVALPWVELGIALSVLLLGLAIAL
FT                   GRHIPLLLAMGFVGLFAIFHGHAHGAEMPALASPVLYALGFLTGTAVIHLLGVALGIIM
FT                   QQLSHKLPLLRLSGGVIALVGGYLIVGA"
FT   sig_peptide     372741..372800
FT                   /locus_tag="Shew_0327"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(373429..374145)
FT                   /locus_tag="Shew_0328"
FT   CDS_pept        complement(373429..374145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0328"
FT                   /product="protein of unknown function DUF542, ScdA domain
FT                   protein"
FT                   /note="PFAM: protein of unknown function DUF542, ScdA
FT                   domain protein; Hemerythrin HHE cation binding domain
FT                   protein; KEGG: she:Shewmr4_0398 hemerythrin HHE cation
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22200"
FT                   /db_xref="GOA:A3Q9Q2"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Q2"
FT                   /protein_id="ABO22200.1"
FT                   /translation="MSLSTHSPLASEFAEETVGSLVAGDFRRAHVFSQFGIDFCCGGKR
FT                   TLVKACDRAGIALVEVEAALQAVKAEGMQEDSLNQLPLSELIDYIEATHHDYVREKAPL
FT                   LIEYSQKMVRAHGEHYDEIKPFAGWVRALIEDLMPHLMKEEQILFPAIRAMAAGEQVSG
FT                   CFGHIGNPINAMEHEHDEASEIVERLRALTNDFTPPPHACTTWRICYATLKEFVADLQQ
FT                   HIHIENNILFPKTLAI"
FT   gene            complement(374408..374713)
FT                   /locus_tag="Shew_0329"
FT   CDS_pept        complement(374408..374713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0329"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix, Fis-type; KEGG:
FT                   sfr:Sfri_0453 helix-turn-helix, fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22201"
FT                   /db_xref="GOA:A3Q9Q3"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9Q3"
FT                   /protein_id="ABO22201.1"
FT                   /translation="MFDQTTQPEAHQLTVGKIETANGTIKPQLLRDAVKRAVTNFFAQM
FT                   DGQEAEEVYEMVLCEVEAPLLDIIMQHTRGNQTRAANMLGINRGTLRKKLKKYGMN"
FT   gene            complement(374731..375699)
FT                   /locus_tag="Shew_0330"
FT   CDS_pept        complement(374731..375699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0330"
FT                   /product="putative TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: putative TIM-barrel protein, nifR3 family;
FT                   PFAM: dihydrouridine synthase, DuS; dihydroorotate
FT                   dehydrogenase; KEGG: son:SO0394 tRNA-dihydrouridine
FT                   synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22202"
FT                   /db_xref="GOA:A3Q9Q4"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Q4"
FT                   /protein_id="ABO22202.1"
FT                   /translation="MQIGPYQLKNQLIVAPMAGVTDQPFRNLCLRYGAALAVSEMLSSN
FT                   PEVWDTDKSRQRMAHAGEDGIRSVQIAGADPDMMAHAALVNVQQGAQIIDINMGCPAKK
FT                   VNKKLAGSALLQQPELVKAILQAVVAAVDVPVTLKIRTGWAPEHRNGVHIAQIAQDCGI
FT                   ASLAVHGRTRQCMYKGDAEYDTIRAIKQNVSIPVVANGDICTPEKARSVLDYTGADAVM
FT                   IGRGAQGRPWLFREIQHYLETGNKLAPIEVDEKRQVMLEHLKNLYALYGEYKGLRIARK
FT                   HVGWYLDQEAQRSFRADFNRLETVEEQRSMLERYFDELVKN"
FT   gene            complement(375851..376732)
FT                   /locus_tag="Shew_0331"
FT   CDS_pept        complement(375851..376732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0331"
FT                   /product="LSU ribosomal protein L11P methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: methyltransferase small; ribosomal L11
FT                   methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: shm:Shewmr7_3624 ribosomal
FT                   protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22203"
FT                   /db_xref="GOA:A3Q9Q5"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9Q5"
FT                   /protein_id="ABO22203.1"
FT                   /translation="MAWIQLKIDTDNQHAEQLSDMLMELGSLSITYEDGKDTPIYEPNL
FT                   GETPLWSHTVITALFEADYDLAPVVEMLKLQPYLGADFSHKIEQVEDKDWEREWMDNFH
FT                   PIQFGRRLWICPSWREVPDPEAVNVMLDPGLAFGTGTHPTTALCLEWLDGLDLQGKEAI
FT                   DFGCGSGILAVAALKLGAAKVTGIDIDYQAIDASKANAERNQVADKLDLYLPEDQPADL
FT                   KAEVLVANILAGPLRELAPLIAEKVQPGGLLALSGLLKEQADEISQHYAQWFDMDAPVH
FT                   KEDWSRLTGRRK"
FT   gene            377079..377801
FT                   /locus_tag="Shew_0332"
FT   CDS_pept        377079..377801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0332"
FT                   /product="fumarate reductase respiratory complex,
FT                   transmembrane subunit"
FT                   /note="PFAM: fumarate reductase respiratory complex,
FT                   transmembrane subunit; KEGG: shm:Shewmr7_3623 fumarate
FT                   reductase respiratory complex, transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22204"
FT                   /db_xref="GOA:A3Q9Q6"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR004224"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Q6"
FT                   /protein_id="ABO22204.1"
FT                   /translation="MKVNSLQYQHTHYAALGSPWSAKADRIQSATGILLGCFLLAHLHF
FT                   ESSILFGKETFYHVVQFLEGGMFSSTGHGMPIVTKVFSIFIMLVVMLHAAVALRRFPAQ
FT                   LGQWRALRNHMQGIKHKDSHAWFWQLVTGFILFFLAPVHIFTMITNPEIGPHLSAERVY
FT                   HANAWLLYALLLPAVVVHAMIGLYRVAVKWGLIRHRKGLRKAIKVLIIYLMTLGILSLI
FT                   SYIMIGRSLVLPITPFVP"
FT   gene            377946..378617
FT                   /locus_tag="Shew_0333"
FT   CDS_pept        377946..378617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0333"
FT                   /product="fumarate reductase respiratory complex,
FT                   transmembrane subunit"
FT                   /note="PFAM: fumarate reductase respiratory complex,
FT                   transmembrane subunit; KEGG: she:Shewmr4_0403 fumarate
FT                   reductase respiratory complex, transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22205"
FT                   /db_xref="GOA:A3Q9Q7"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR004224"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Q7"
FT                   /protein_id="ABO22205.1"
FT                   /translation="MSLAKKNNNVSGWLDMSQSVSGVILALFLWTHLVLVSSILLGADA
FT                   MTFVARTMELSFLSADGHGYPWVVSGIAILVALLALIHVLVAVHKMPLNLQQQRALRQQ
FT                   MSVIHHDDTKLWVWQAITGVGIFLLLPVHLWLIGSAPETIGPVGSADRIWNQGVWMVYL
FT                   PLLLCVELHAAIGIYRVAIKWGAKRAIDARARIKKIKTIVSVVFVVIGLASLLAFLPYA
FT                   S"
FT   gene            378664..380670
FT                   /locus_tag="Shew_0334"
FT   CDS_pept        378664..380670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0334"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: shm:Shewmr7_3621 succinate dehydrogenase or
FT                   fumarate reductase, flavoprotein subunit; TIGRFAM:
FT                   succinate dehydrogenase or fumarate reductase, flavoprotein
FT                   subunit; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22206"
FT                   /db_xref="GOA:A3Q9Q8"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Q8"
FT                   /protein_id="ABO22206.1"
FT                   /translation="MKLIYTDSLVVGAGLAGLRVAIASKERGLDTLVLSLIPAKRSHSA
FT                   AAQGGMQASLGNTVKGMGDDEDVHFQDTVKGSDWGCDQEVARMFAHCAPKAVRELANWG
FT                   VPWTRVTKGPRQVVVNAEKVTIEEAEEAHGLINARDFGGTKKWRTCYTADGTGHSLLYA
FT                   VDNKAISLDIPVHERVEALALIHDGKRCHGVVARCLITGELRAYVAKSTTIATGGYGRI
FT                   YEVSTNAIICEGIGQALALETGVATLGNMEAVQFHPTAIVPVGILTTEGCRGDGGLLRD
FT                   KDGHRFMPDYEPEKKELASRDVVSRRMTEHMRKGKGVDSPYGPHLWLDITLLGRKHVET
FT                   NLREVKEICENFLGIDPAEDWIPVRPTQHYSMGGIRTDAKGQSPQLKGLFSVGEAACWD
FT                   MHGFNRLGGNSLAETVVGGMIIGKYVADFCEENTLEIDTSLAERFVAQVRDEIDGLVEG
FT                   QGSESAYELKREMQRIMMDYVGIFRNGPELSKAVEELEALLIRSRNLGLKCKKRHANPE
FT                   LVEALRVKRMLKVALTVACGAEARTESRGAHAREDYPQRNDKEWLNRTLSSWPSVDATR
FT                   PQLDYEQLDVMKMELPPGYRGYGINNAIAHPDTEKREKQIVEILSNLGEDADRHERQHA
FT                   LMPFEVPESLREKNERLHDKPLGNRQQLGEESK"
FT   gene            380667..381398
FT                   /locus_tag="Shew_0335"
FT   CDS_pept        380667..381398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0335"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: shm:Shewmr7_3620 succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22207"
FT                   /db_xref="GOA:A3Q9Q9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Q9"
FT                   /protein_id="ABO22207.1"
FT                   /translation="MSQGRTLTFNIFRYDPQMPDDKPKMVKYQLEEAPGMTVFIALNML
FT                   REQQDPSLQFDFVCRAGICGSCAMVINGYPTLACRTLTSKYPKGDITLMPLPGFELIGD
FT                   LSVNTGKFMRELAERLKLWLHPRNDEADIHRIEAPMDPEEAAKLYELERCVECGVCVSA
FT                   CATKQMRDTFVGAVGMMKIARFELDSRDARSVEDFYHVIGNQDGVFGCMTLLGCQDNCP
FT                   KDLPHMQQIAYLRRKMATALV"
FT   gene            381590..382513
FT                   /locus_tag="Shew_0336"
FT   CDS_pept        381590..382513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0336"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO0402 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22208"
FT                   /db_xref="GOA:A3Q9R0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9R0"
FT                   /protein_id="ABO22208.1"
FT                   /translation="MQVNDLLLFVRVADCGSLSGAAVELEISAAVASASLKRLEKELDT
FT                   VLFIRSTRSLRLTDAGERYLSYCRRALEDLRLGEQALACAKSQIAGKLSVALPSDAGRN
FT                   YILPWLDHLMDEYPRLQLRLHLADSLTNFYHDKIDVALRSGTPKDSSLVAFKICSAQRI
FT                   LCASPEYIAVHGRPETLSDLEKHNCLFFMLDEKTHDQWCFYRDGQSHRVRVSGNRTCND
FT                   AEVARKWALAGKGIVYKSSLDLADDLASGALVPLLTQYSGESADLYLVCPGRQHVTPLV
FT                   LTLREHLRQRCQQRAKRLAAAFTQQA"
FT   gene            complement(382589..383854)
FT                   /locus_tag="Shew_0337"
FT   CDS_pept        complement(382589..383854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0337"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: shm:Shewmr7_3616 transcription termination
FT                   factor Rho; TIGRFAM: transcription termination factor Rho;
FT                   PFAM: H+-transporting two-sector ATPase, alpha/beta
FT                   subunit, central region; Rho termination factor domain
FT                   protein; Rho termination factor, RNA-binding; Ribonuclease
FT                   B, OB region N-terminal domain; SMART: AAA ATPase; Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22209"
FT                   /db_xref="GOA:A3Q9R1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9R1"
FT                   /protein_id="ABO22209.1"
FT                   /translation="MNLSELKEKSISDLVILAQDMKIENMARARKQDIIFAILKAHAKS
FT                   GEDIFGGGVLEILQDGFGFLRSADGSYLAGPDDIYVSPSQIRRFNMRTGDTIFGKIRPP
FT                   KEGERYFALLKVSEVNFDKPENSRSKILFENLTPLHAEERIRMERGNGSTEDITARILD
FT                   LCSPIGKGQRGLIVAPPKAGKTLLLQNIAQSITYNNPEVVLMVLLIDERPEEVTEMQRL
FT                   VKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDANALHRPKRFFGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   QELHLSRKAAEKRVFPAIDFNRSGTRREEKLTTPDELQKMWILRKILNPMDEVSGMEFL
FT                   IDKLAMTKTNEEFFTAMKRAKS"
FT   gene            complement(384085..384411)
FT                   /locus_tag="Shew_0338"
FT   CDS_pept        complement(384085..384411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0338"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: shm:Shewmr7_3615 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22210"
FT                   /db_xref="GOA:A3Q9R2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9R2"
FT                   /protein_id="ABO22210.1"
FT                   /translation="MSDKIITLSDDSFENDVLKSDLPVLVDFWAEWCGPCKMIAPILDD
FT                   VADEYAGKVTIAKLNVDQNNASPAKYGVRGIPTLLLFKNGELADTKVGALSKTQLKEFI
FT                   DAQL"
FT   gene            384583..385890
FT                   /locus_tag="Shew_0339"
FT   CDS_pept        384583..385890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0339"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like;
FT                   KEGG: shm:Shewmr7_3614 DEAD/DEAH box helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22211"
FT                   /db_xref="GOA:A3Q9R3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9R3"
FT                   /protein_id="ABO22211.1"
FT                   /translation="MSETHLTNQKFADFSLHPEIQQALVESGFEYCTPIQALSLPILLE
FT                   HKDIAGQAQTGTGKTLAFLVATFNHLLTTPIPDGRQLNQPRAIVMAPTRELAIQIAKDG
FT                   ELLAKHTGLKVGIVYGGESYEVQRKVLDKGVDILIGTTGRIIDYVRQGVINLSAIQAVV
FT                   LDEADRMFDLGFIKDIRFLFRRMPDANERLNMLFSATLSMKVQELAYDHMNDPEKVEIA
FT                   PSEKTSKNITEEIFYPSMEDKMRLLLTLIEEDWPEKAIVFSNTKHSCENLWAHLEGDGH
FT                   RVGLLTGDVPQKKRIRILEQFTKGELDILVATDVAARGLHISDVSHVYNYDLPDDCEDY
FT                   VHRIGRTGRAGQKGVSVSFACEEYALNLPAIEHYIQHSIPVTNYDSEALLDDIPPPVRI
FT                   HRKHSPRPTGRSGGGKPQGGRPGARPRRHDRTRRHS"
FT   gene            385890..386822
FT                   /locus_tag="Shew_0340"
FT   CDS_pept        385890..386822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0340"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: shm:Shewmr7_3613
FT                   Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22212"
FT                   /db_xref="GOA:A3Q9R4"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9R4"
FT                   /protein_id="ABO22212.1"
FT                   /translation="MKHSGVSPLYAAITLGSNSFNMLVAQTRAGKPTVVAKYKRKVRLA
FT                   EGIGADGVLCPEVFDRGLDCLQMFSQMLDHEGVSRDNIAVIATATLRSISNADAFCEAA
FT                   LPILGQPIEIISGLREAELIYQGMVATTVGEGRRLVIDIGGASTEFIIGDGNKVLLKTS
FT                   LPMGCVTFKDKFFNSFPFQQLDFDAAQSQVETALGDYRRRLTDYGWHCVVGASGTVQSV
FT                   VELLNDRGVSATITPAVLADLRGEVLAQTDVSLRDIRGLHSERAPTFAAGLAILSALFN
FT                   LLDIQSLNLSGGALREGVLHQLAQRVLAA"
FT   gene            387111..389840
FT                   /locus_tag="Shew_0341"
FT   CDS_pept        387111..389840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0341"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: sdn:Sden_2404 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22213"
FT                   /db_xref="GOA:A3Q9R5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9R5"
FT                   /protein_id="ABO22213.1"
FT                   /translation="MKLNRLAQYVSLACGGLAAIAVPTFAADNSDETVERIEVTGSRIK
FT                   RIDMEGASPITTITADELAKSGFSTVGDALRSSNLNAFGSWGGGSNNGWGSQATVQLKG
FT                   ASAFHTLTLLDGKRMAKSPVMDGGAANINTIPMAAVERIEILTDGASAIYGTDAIAGVV
FT                   NIILKKDFEGIQFDARMDRPTQEGGDSSNMSFTGGLDSEKGHLVFTVEHYESQKIMQKD
FT                   RWYTRPFVKEGGNPEDYQDWVNISPTGRVLTQGDAGGWVYSTPFSNSDKSCADVYGEAF
FT                   IGSLIDSDYPGDTLCAYDYTQAAATSVGQTRNNTLIHYSYELTDSIELTARAYWASNET
FT                   KDISAPVPASISIPEGLPAYTTPEGLELVELVADPSAGMNYRFDTAGDRVAEHHDNIYD
FT                   FLIGLDGSAENFDWDVAVNYNKYDNYTWGTGYQLKGATTDLVGHWDEDTNSFVGWDPRD
FT                   PNSALPPGATANYDKRMSASYLDVNGGLSFNLFELPAGDVGMYIGASYREETLDSKVDA
FT                   LAEAGQIVGGNGGSGGAGERDVKAAYFEVVLPIIDSLELNLAGRYDDYSDFGGTFNPQV
FT                   SIRYNVIDSLLLRGSWGTGFRAPTLSDLYQGTSEGFGYIKNYLNCYKEGEDIDTCDRWD
FT                   YGATRTGGNEALKPEESESYNIGVVWEVTDEINLSVDYWSLETTNLISELDASEIVRTQ
FT                   AKLWELADANGEPRPDVSSVYPGTSISQIGNGKIDYVVSQKLNVGLSEREGIDVKLGAG
FT                   FGSDYGDFKFGLGWSYFLKYKSSYSQAGAQILSDDYAGREDTPAHRINLTADYSFGDHA
FT                   LSYFGNYIGSQKSWDIVEGSWDAEAGETADDGQLYEVDSVFYHNLTYTYTLPWNNSISL
FT                   GVTNLTDEDPKFKYDGTYNGNLYDIRGRTYWAGFRQSF"
FT   sig_peptide     387111..387191
FT                   /locus_tag="Shew_0341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(389891..390427)
FT                   /locus_tag="Shew_0342"
FT   CDS_pept        complement(389891..390427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22214"
FT                   /db_xref="GOA:A3Q9R6"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9R6"
FT                   /protein_id="ABO22214.1"
FT                   /translation="MTNNIKALLATTALFFSTQALANNGCAFDEKQEGFIATCSEEKQE
FT                   VILTGEVQAQTLVTELDDFTQGYKSYQVDEAAIAPIKKLQTPTEIVVIIGTWCPDCHRE
FT                   TPRFIRIMEATNNPNIKVTYIGVDRKKLDPEGLAAKYDFTRIPTFIVKQDGKEIGRIVE
FT                   RPETSLEVNLAKILD"
FT   sig_peptide     complement(390359..390427)
FT                   /locus_tag="Shew_0342"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            complement(390657..391235)
FT                   /locus_tag="Shew_0343"
FT   CDS_pept        complement(390657..391235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22215"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9R7"
FT                   /protein_id="ABO22215.1"
FT                   /translation="MKLTALDQTLYDHLYRDIHQFRSTFDLPIEDETSLDEQADTLHTS
FT                   LAIEELTELAEADSRVEQADAIVDSVYVLMGRLVHLGATQMNDRLEISYVIDLLLHVAK
FT                   NRDIDFVRCWDEVHSSNMSKVCRNEQELEETIAHYAKQGVEIVGSRKGDFIIAKCAKDV
FT                   EMTGKVVRQGKVLKSVYYRPADLAKLVTA"
FT   gene            391653..393173
FT                   /locus_tag="Shew_0344"
FT   CDS_pept        391653..393173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0344"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="PFAM: Na+/H+ antiporter NhaC; KEGG: sdn:Sden_3405
FT                   Na+/H+ antiporter NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22216"
FT                   /db_xref="GOA:A3Q9R8"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9R8"
FT                   /protein_id="ABO22216.1"
FT                   /translation="MTSHQQSPEQPGRDSSPASAKRHKQPTLLDALIPIIALVCMLTAS
FT                   VYLFSSDSSYGANQIALIMAACITLVIGVKNGYSWKEMEAGIVKSVSLATGALLILFSV
FT                   GSLIGTWILAGTVPTMIFYGMKILNPDYFYAASCLLCAVVALSIGSSWTVAGTLGIALI
FT                   GVAGAMGLSVEITAGAIISGAYFGDKMSPMSDTTNLAPAVAGSELFGHIRHMVWTTTPS
FT                   ILLALIGFLFIGLNSDSSSVATDLAATMARIETQYHPGLHLLLPLLVVLVLAYKKLPAF
FT                   PTVILGTLAGAICAALFQFDGVIKFVNDDSLPTMVALVKGIWVAMFDGYTANTGDKTLD
FT                   SLLSRGGMSSMVNTVWLILCAMAFGGVMEKTGLLQRLLQGVLRLVKSSGSLIITTLASC
FT                   IGANLITGDQFIAILLPGRMLKVEYEKHGLAPVNLSRALEDSATITSPLVPWNTCGAYM
FT                   ASTLGVATIAYLPFAFFNLICPFVSAAYAYYDIKIERLAESEAVEAVA"
FT   gene            complement(393299..393934)
FT                   /locus_tag="Shew_0345"
FT   CDS_pept        complement(393299..393934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0345"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: son:SO0476
FT                   thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22217"
FT                   /db_xref="GOA:A3Q9R9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9R9"
FT                   /protein_id="ABO22217.1"
FT                   /translation="MRKRLVALLKLALLSLALSALSLMTPTSNALAVMPSAKVYDTGEN
FT                   LPKPVIMSRFVEMTSARKVDEATFESLSGDQVKLSDYRGKLVLINLWATWCAPCIKEIP
FT                   MMDKIRRDNLDKDLVVLPLSIDEAHDEVGAFLTRHQLAGYPTLIDPQRQVEKMLPANIV
FT                   PATYAFDGEGNLIGFLRGYLDWGDKAVQPYLERLTAKYAKPNKAQHLH"
FT   sig_peptide     complement(393836..393934)
FT                   /locus_tag="Shew_0345"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.782 at
FT                   residue 33"
FT   gene            complement(393931..394377)
FT                   /locus_tag="Shew_0346"
FT   CDS_pept        complement(393931..394377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0346"
FT                   /product="cytochrome C biogenesis protein"
FT                   /note="PFAM: cytochrome C biogenesis protein; KEGG:
FT                   son:SO0477 cytochrome c-type biogenesis protein NrfF
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22218"
FT                   /db_xref="GOA:A3Q9S0"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9S0"
FT                   /protein_id="ABO22218.1"
FT                   /translation="MKGYWILLLLALACFLGPTRAQAQVLAETGGSPQWRTPAQLKHQA
FT                   IAIASGLRCPMSTNQSLQDSQSPIANELKAEIYLQLEQGKTSDEIVDFMVVRYGERIRY
FT                   MPSLSAGTALLFFAPLCLLALAIFWYFRQIAGAASFNTSQEDRS"
FT   sig_peptide     complement(394306..394377)
FT                   /locus_tag="Shew_0346"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 24"
FT   gene            complement(394380..396371)
FT                   /locus_tag="Shew_0347"
FT   CDS_pept        complement(394380..396371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0347"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   she:Shewmr4_0487 cytochrome c-type biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22219"
FT                   /db_xref="GOA:A3Q9S1"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9S1"
FT                   /protein_id="ABO22219.1"
FT                   /translation="MSSLVPLAEGETMTAEIGLLLLIISLTLCLLTAMSPVMPACGVKL
FT                   RLKPYQPLFIRLNSLAQVASLFILAYLFLSNDFSVAYVANNSNTQLASLYKLAAVWGGH
FT                   EGSMLFWIGAMGIWSCVLSLQPNHKDRFFHYLHAVLGAIQAGLIAFLLIGSNPFARLLP
FT                   GIPVEGRDLNPILQDIGLILHPPLLFIGYVGLAVCFAAAIAALLDNSQPLKQHCRLMRP
FT                   WAILAWAMLTGGNAFGSWWAYNELGWGGWWFWDPVENASFIPWLVATALMHSLILGERR
FT                   DRFHGTSLFLAILGFSLCLLGTFLVRSGVVQSVHAFAADPLRGGAMLTLFALVSICGFT
FT                   LLLQRLPSLYRPVNSNMLSRESLMQLGNLLLLVAAISILLGSCYPLLYEVASGQSISVG
FT                   APYFNSLFIPLTWLICLVMGAAPLMRWQVSNPGMLRQLTALAAICLFIGLTLNTLLLKE
FT                   FAAHFLLGSFACLWLLGCTGLYLHKRLAAYTGAGDNRRCYAMSFAHLGVALSILGATCS
FT                   SYFQQEELLRMGPGQGKEVAGYTFIYRATETVSHTSYSALQAKIEVRDRREQHLAYLYP
FT                   QRQTFNSNAMQISAAGIHRSLFADLYISMGNRLSEEEFLIRISYKPLIGWIWIGGLIMM
FT                   FAGLSLLLPRKVRRLSRAPSPQLAVKGA"
FT   gene            396809..398848
FT                   /locus_tag="Shew_0348"
FT   CDS_pept        396809..398848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0348"
FT                   /product="cytochrome c, putative"
FT                   /note="KEGG: shm:Shewmr7_3542 cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22220"
FT                   /db_xref="GOA:A3Q9S2"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR032897"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9S2"
FT                   /protein_id="ABO22220.1"
FT                   /translation="MRRWKHKVALSALFCFGAIANVNAAGGKYNSVPEMGKTAKEAIAN
FT                   YQGTEQVNGVKTLQDYIVQEAELFDFLFENHPMFKYQEAGNLVGDYHISDRGEEYLDTG
FT                   HSPEYSKKAGKPRAVQYRLGAKSILDYPNNFVGPEKCAECHATQYEKWSRSRHAKTIRF
FT                   PGEHPEVDNDLNKTMYGTKDTSILPDGITPDVIYATVGTPRTKYGFIDAWLVRGSYHIE
FT                   GGLLKDGTGKMVAGANQFSRGWAEWLTPEMAKKINAVIPEFPTTLEAYGGSGSHQWGMS
FT                   SYGAKYRKEMLFQPASSYCEVCHTFKFDFKTKQEYFDALGDPKKLQEHTISKGIACEEC
FT                   HGAGGHLDGGTGGMQSNCERCHQRFQYDPAMAETPAAQEKPELAFGVKMKSLCPSCGTE
FT                   GSQMYGSAHYEKGMRCTTCHDPHEVTDGTWMSGITKPKLKTDCKDCHEAQTVIASNTDT
FT                   HANQTCQSCHMPNMGSCENFKAMQFPDQAGFDAVRKSHMWKIDVDPERKTLNPPEGQPR
FT                   IQGPKGAKGWTVAKNEEGRTYLDLMWSCARTSISDHDVVENKGCHSQFQSELETGLHYK
FT                   DQLEIYGEVMKWQKPIKEVFGQVEQALVRIDQLLEVTKLSTEDKTQVLMLAEKAQATVD
FT                   LIKQDGSWGVHGFRYSQKRLDAALTYVTQAQKILDGSGYSAKAH"
FT   sig_peptide     396809..396883
FT                   /locus_tag="Shew_0348"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 25"
FT   gene            398930..399355
FT                   /locus_tag="Shew_0349"
FT   CDS_pept        398930..399355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0349"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: son:SO0480
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22221"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9S3"
FT                   /protein_id="ABO22221.1"
FT                   /translation="MKSKLGLSLALLLGLTPLCSLAGGGAEMAPAHRYEHSLHTISLAE
FT                   AEALLAQKDVYFFDVNTLELWAEGYIPGAVYFNVDNWKTLLPEDKAARMVFYCANRLCN
FT                   ASEIAAHQVMKLGYTNVMQMHDGIYGWRLSGRSIEKP"
FT   sig_peptide     398930..398998
FT                   /locus_tag="Shew_0349"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 23"
FT   gene            399422..400225
FT                   /locus_tag="Shew_0350"
FT   CDS_pept        399422..400225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0350"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="PFAM: FKBP-type peptidyl-prolyl isomerase domain
FT                   protein; peptidylprolyl isomerase, FKBP-type; KEGG:
FT                   she:Shewmr4_0490 FKBP-type peptidyl-prolyl isomerase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22222"
FT                   /db_xref="GOA:A3Q9S4"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9S4"
FT                   /protein_id="ABO22222.1"
FT                   /translation="MIESVNMKANLLKSCRVTTLALACTWSFFAAASESPQEVEDASYA
FT                   LGASVGHYISGKIYNQVDLGAQIKVDTVIQGVIDALKGEGKMSNEEILTHLNARAEWLN
FT                   NAKAAKLEALASKHQAEGQAYLAANQAKPGVKVTESGLQYEVIKQGDGPKPVESDVVTV
FT                   HYVGKLLDGTEFDNSYERDEPNRFALLSVIDGWKEGIALMNVGSTYRLTIPAELAYGKE
FT                   VVGVIPPGSTLIFDVELLKMEAPGENAHGMGLSGMGMGGMMGMGH"
FT   sig_peptide     399422..399520
FT                   /locus_tag="Shew_0350"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 33"
FT   gene            400254..400946
FT                   /locus_tag="Shew_0351"
FT   CDS_pept        400254..400946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0351"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: son:SO0482
FT                   formate-dependent nitrite reductase, NrfG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22223"
FT                   /db_xref="GOA:A3Q9S5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9S5"
FT                   /protein_id="ABO22223.1"
FT                   /translation="MISLVFAMAVTLVCFIAPIWRHYFIQEENALAGDATIPARKQTLT
FT                   PIVVTGMLLLIPLTLYGLLGRFNDWHTGQIDENIDYLIAADINKNARILDDTPLDRLAL
FT                   LNLANAYAEGGRYSEAVETLDKLLAIAPDAELYGMKATALYYRDNRAMSLEVSLVISQA
FT                   LALDPEEVQSLLLMATHAYLNKDFQQAIVHWRQLLDSDNPNINRASINSAIVNAEQKMA
FT                   NRTVTASE"
FT   gene            401064..401711
FT                   /locus_tag="Shew_0352"
FT   CDS_pept        401064..401711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0352"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: she:Shewmr4_0492 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22224"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9S6"
FT                   /protein_id="ABO22224.1"
FT                   /translation="MLAPLGCSVKEQTAQDAAPHYVMVFDQNKCVGCGGCKEACNKANN
FT                   LPEGRSRVLLEQQSSAVAGQACPHCGKTDCDCQRKYVRVSCQQCQNAPCVSVCPTGAAH
FT                   RDPKTGIVTMDASKCAGCKYCIAACPYNARYINSETDVADNCDFCLQSKLAKGELPACV
FT                   QECRYDALVFGDANDPNSYVSRLLAVKDSVRVKAHLGTEPSLRYIPIVKLGV"
FT   gene            401714..402661
FT                   /locus_tag="Shew_0353"
FT   CDS_pept        401714..402661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0353"
FT                   /product="Polysulphide reductase, NrfD"
FT                   /note="PFAM: Polysulphide reductase, NrfD; KEGG:
FT                   she:Shewmr4_0493 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22225"
FT                   /db_xref="GOA:A3Q9S7"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9S7"
FT                   /protein_id="ABO22225.1"
FT                   /translation="MDGTLEFTMGLSEGVAWPWPIAVYLFFAGISGGALSVALFIRFYK
FT                   QQSANTPFLKASALIAFVTIALGMLCLVLDLTNPLFFWRILVYYNLNSVMSVGVIALSA
FT                   YIPLVALIALFALEEEIRRLPMLAPLLPLIDKLRPWRRSSETLVLVLALAVCAYTGFLI
FT                   SALIRFPIINTSVLPALFVASGLSAGAAAAKMLAVGLFKEDRHSSDMQILHGAEWPIMF
FT                   AEALFLFMIIMSLVTGNAGAQSAFEAFHTGSWSMVFWLGVVGVGFGGPLLLNFATGERF
FT                   SHSSQAFYLSGLCAVSGMMCLRMFILYAGQNFAI"
FT   gene            402716..403204
FT                   /locus_tag="Shew_0354"
FT   CDS_pept        402716..403204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0354"
FT                   /product="NosL family protein"
FT                   /note="PFAM: NosL family protein; KEGG: shm:Shewmr7_3536
FT                   NosL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22226"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9S8"
FT                   /protein_id="ABO22226.1"
FT                   /translation="MRAFIFIFISALFISGCGAAESDTHNHDGLVIGNHERCHMCGMMV
FT                   KQYPGPKGSLDLKGNEMQPKFCSTRDMFMFALQPENRRQVEALWVHDMAATDWQHPEDE
FT                   HFIDATKAWYVYGSNRKAVMGVAVAPFSTLAAAEAFAQQYGGAVFEYDEITLELLSAK"
FT   sig_peptide     402716..402775
FT                   /locus_tag="Shew_0354"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.566 at
FT                   residue 20"
FT   gene            403215..404573
FT                   /locus_tag="Shew_0355"
FT   CDS_pept        403215..404573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0355"
FT                   /product="periplasmic copper-binding"
FT                   /note="PFAM: periplasmic copper-binding; SMART: Parallel
FT                   beta-helix repeat; Carbohydrate-binding and sugar
FT                   hydrolysis; KEGG: shm:Shewmr7_3535 periplasmic
FT                   copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22227"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9S9"
FT                   /protein_id="ABO22227.1"
FT                   /translation="MLRPSFRQSFSLWRRQGQCLALVLSLGLCLVPHLALGADQSQIIN
FT                   IADSEALRTALASAPNGTEIRLLPGRYIGRFEVEQPLTLRGEPGAVIDAQGAGSALVVS
FT                   ASGVTLTRLTIRNWGRDLYEKDAAIRLLPGANEVTIVANELSGPGFGIYASEVSDLKLK
FT                   DNQIEGEAEAFLLDRGDGIHLLKVNYPHVSGNRIKTVRDGIYLESGVGSRVYGNHLSEL
FT                   QYGLHYMYTKQDEAMDNLACRVSGGYALMNSEGIRLVFNRVREAKEFGVLLNLTHDAEI
FT                   QANQIEATQMPNSVAGDLFSEGKGLFVYGAKRNQISGNYIAGNQIGIAMALGGEDNLVY
FT                   QNQFLANATQVRYVGETRVEWSLQGRGNYWSDYRGWDLDGDGIGDGQHLPNDSLDRLFW
FT                   LYPEAKFLMESPLVKLLKWLDNQLQGEHSVGVVDSHPVMTPPPHLGPAAWEAL"
FT   sig_peptide     403215..403328
FT                   /locus_tag="Shew_0355"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 38"
FT   gene            404570..405499
FT                   /locus_tag="Shew_0356"
FT   CDS_pept        404570..405499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0356"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter-related protein; SMART: AAA
FT                   ATPase; KEGG: she:Shewmr4_0496 ABC transporter-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22228"
FT                   /db_xref="GOA:A3Q9T0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9T0"
FT                   /protein_id="ABO22228.1"
FT                   /translation="MSQMAVSFKQVSHYFDELCALNDLSFSLPGGKLMALLGHNGAGKS
FT                   TLIKMILGLLHPSQGEVSVLGQTQRQASKVASTDIGYLPENISFYDKLTGHEVLSYFAA
FT                   LKGVSARAVAPLLEEFGLGYAQHKAVKGYSKGMKQRLGFAQAILAQPRLLLLDEPTVGL
FT                   DPQASQFIYHKLKQLTAQGCTAIVCTHELQLVEPQLDLALVLGRGRRLAFGTLDELVLS
FT                   CDLGVRMAHPALARLVETHPLLQSFYRDGDLICPVSQREVLMKYLTLECQLFDVKVTLP
FT                   ELAQVYHAKMAQMQVMSELGLSLTSGEL"
FT   gene            405496..406347
FT                   /locus_tag="Shew_0357"
FT   CDS_pept        405496..406347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0357"
FT                   /product="copper ABC transporter, permease protein"
FT                   /note="KEGG: son:SO0488 copper ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22229"
FT                   /db_xref="GOA:A3Q9T1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9T1"
FT                   /protein_id="ABO22229.1"
FT                   /translation="MMSTSVKRPSLQLIRVIATKEMKDSVRNRWVMVVFAIFWLLALCM
FT                   TFAGSAVSGTLSLPSLSSVVASLTTISVFIIPLAAILLSYDAFVGEEEAGTLQLLLTYP
FT                   VSKSQILVGKLLAHGGVIFTAIASSYASSAAMLILFGRGEPWGEILSSFALLIASSCLL
FT                   AVIFILISYLVSLKSAEKARAVGSLLALWFALVLIYDLLLLLLLVADLGYASQWLVNLL
FT                   ILLNPTDLYRATNMLGASAPLGSLGLLAQYEWSLPLLLSAGVAWLLSLLYWTRRVFIHK
FT                   LV"
FT   sig_peptide     405496..405657
FT                   /locus_tag="Shew_0357"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.794 at
FT                   residue 54"
FT   gene            406528..407808
FT                   /locus_tag="Shew_0358"
FT   CDS_pept        406528..407808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0358"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: shm:Shewmr7_3532 transcriptional regulator, CadC"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22230"
FT                   /db_xref="GOA:A3Q9T2"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9T2"
FT                   /protein_id="ABO22230.1"
FT                   /translation="MLKITPYLEFDDEAHQLHDRTCGATIGLSFSESAVLAHLLSQPDA
FT                   ICDKEALIAVGWPDRVVAATSLTQCISTLRKKLEPFPEIQLKTIARRGYQLHVSPKSHV
FT                   TMLAVSDAGSIKDALIDVSLMVKVSGILILLGIVATLWYQSDYHQVMKHAARWASDHEI
FT                   NLDIGGTTRPVTLINPKGVDSLHPSMWQKHIAPESNSIQGFNNFGGFAFTDGNHYSMAL
FT                   CDLDERGECRRDKIVNLTAIDLTPAGLNMVEFVELSKRMEERIRYNRILIPPGEAGGDL
FT                   VEHHYNGDVYFPVADELLVRADIGISLVYEQPLGGKFYSRACITDQDCLTTPIKYQIRG
FT                   EFEQYRQKLGQLDVDVFHVKVRQKDLIMPDVVSASAMHFYREIRKHNIRDEELFYMRVH
FT                   ADNGTAVWVVPLLGSLVAWTKYEKVAL"
FT   gene            complement(407878..408576)
FT                   /locus_tag="Shew_0359"
FT   CDS_pept        complement(407878..408576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0359"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   she:Shewmr4_0505 oxidoreductase FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22231"
FT                   /db_xref="GOA:A3Q9T3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9T3"
FT                   /protein_id="ABO22231.1"
FT                   /translation="MNTIRCKVEHVTAFNDAVYQVTLTPETSFEFKAGQYLCVVMGEKD
FT                   KRPFSIASAPGNEQIELHIGAAVSESYPMQVVERLQQSEYIDIEAPGGEAFLRSDSHRP
FT                   RLLIAGGTGFSYIKSIVEQSIALEQKVETTLYWGCRNQDAMYYESLARQWHQDHPWLHF
FT                   VPVVEESTPDWQGKTANLLAQIKQDYVSLNGYDIYIAGRFDMVGVAREVFREIGVEEEH
FT                   LYGDAFAFIK"
FT   gene            complement(408711..410192)
FT                   /locus_tag="Shew_0360"
FT   CDS_pept        complement(408711..410192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0360"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="TIGRFAM: UbiD family decarboxylases; PFAM:
FT                   Carboxylyase-related protein; KEGG: shm:Shewmr7_3525 UbiD
FT                   family decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22232"
FT                   /db_xref="GOA:A3Q9T4"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9T4"
FT                   /protein_id="ABO22232.1"
FT                   /translation="MSFKDLRSFIDHLEANGELKRIAHPVDPHLEMTEIADRVLRAKGP
FT                   ALLFENPVGKTMPVLANLFGTPKRVAMALGKEDPLALRDVGELLAFLKEPEPPRGFKDA
FT                   ISKIPMFKQALNMPPKTVRNAPCQEVVVSGDEVDLTKLPIQHCWPGDVAPLVTWGLTIT
FT                   KGPRQKRQNLGIYRQQLLGKNKLIMRWLDHRGGALDFKDFKEQHPGERYPVVVALGADP
FT                   VTILGAVTPVPDAMSEYAFAGLLRGERTEVCKALSCDLEVPATSEIILEGYIEPGEMAE
FT                   EGPYGDHTGYYNETDEFPVFTVTHVSHRRDAIYHSTYTGRPPDEPAMLGVALNEVFVPI
FT                   LRKQYPEIVDFYLPPEGCSYRMAVISIRKQYPGHAKRVMMGAWSFLRQFMYTKFIIIVD
FT                   EDVNCRDWNDVIWAITTRMDPKRDTVMIDNTPIDYLDFASPVAGLGSKMGMDATNKWEG
FT                   ETDREWGTPIVMDEAVKQRIDAIWDDLGIDDAPTL"
FT   gene            410360..410836
FT                   /locus_tag="Shew_0361"
FT   CDS_pept        410360..410836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22233"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9T5"
FT                   /protein_id="ABO22233.1"
FT                   /translation="MKPDLKPLLLLAGVLWLGALPPVSNSAWALKIDDEFEVDPDFGVD
FT                   PDWEYRPDWDRDFYDPWRWRIGIGTGFPYWRHGSYGYWRDGWRSPYRYQPRKYRKPKPL
FT                   APPQQVTTSFTQSDAIKSLPANARVRVKEGRTVYEWQGVEYIYDWNSDSYVKLK"
FT   sig_peptide     410360..410440
FT                   /locus_tag="Shew_0361"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.752 at
FT                   residue 27"
FT   gene            complement(410865..411581)
FT                   /locus_tag="Shew_0362"
FT   CDS_pept        complement(410865..411581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0362"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="KEGG: she:Shewmr4_1481 signal peptidase I; TIGRFAM:
FT                   signal peptidase I; PFAM: peptidase S24, S26A and S26B"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22234"
FT                   /db_xref="GOA:A3Q9T6"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9T6"
FT                   /protein_id="ABO22234.1"
FT                   /translation="MRRLMLRHFTFQGVGMLKKVMRQVKHHRQFILFIGLMLVFRSAVA
FT                   DWNHVPSGSMLPTIVQGDRILVNKLAYDLRLPFTHVSLMKLADPERGDIITFDSAKADK
FT                   KLVKRIIGLPGDTLAMRNNRLYFNGAALNYRAEPQALADNAGQAAFSVWQETLPGKPHA
FT                   IRLNDQPSRLANFGPVTVPEGHYLALGDNRDASADSRVIGFVPREEITGKAHRVAFSND
FT                   PEHYYWFRSERWLLPI"
FT   sig_peptide     complement(411444..411581)
FT                   /locus_tag="Shew_0362"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.990 at
FT                   residue 46"
FT   gene            411699..412376
FT                   /locus_tag="Shew_0363"
FT   CDS_pept        411699..412376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0363"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: yps:YPTB2218 haloacid dehalogenase-like
FT                   hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22235"
FT                   /db_xref="GOA:A3Q9T7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9T7"
FT                   /protein_id="ABO22235.1"
FT                   /translation="MKYQWILFDADETLFHFDAFKGLQLMFSRFGVDFTLADFEEYQTV
FT                   NLPLWVDYQDGKISARHLQVTRFERWAEKLSVTAEHLNSAFLTAMADICTLLPGAAELV
FT                   DALYGKVKMGIITNGFTDLQTVRLERTGLLHAFSPVVISEEVGVAKPDVAIFEHALSQM
FT                   AHPPREHVLMVGDNPHSDIQGGLNAGFDTCWLNRASQPVPEGITPHYQVASLTELQHLL
FT                   LKG"
FT   gene            complement(412388..412879)
FT                   /locus_tag="Shew_0364"
FT   CDS_pept        complement(412388..412879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0364"
FT                   /product="MshA, mannose-sensitive haemaglutinin"
FT                   /note="KEGG: vfi:VF0366 MshA, mannose-sensitive
FT                   haemaglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22236"
FT                   /db_xref="GOA:A3Q9T8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9T8"
FT                   /protein_id="ABO22236.1"
FT                   /translation="MKRNGFTLIELVITVIILGILATIALPRFINIQSDARIAALQGLK
FT                   SEMSGTLPLVFTKASLENLQTQASTNISLNGDQVELAYGYPAADSAHAWDLLLEASFAD
FT                   AVFNADDPADWYFHNNKAEPFIRFMHPSKKSSSENCYLKYTQALSTTQGPSFEIVDSGC
FT                   "
FT   gene            413069..413159
FT                   /locus_tag="Shew_R0018"
FT                   /note="tRNA-Ser1"
FT   tRNA            413069..413159
FT                   /locus_tag="Shew_R0018"
FT                   /product="tRNA-Ser"
FT   gene            413659..414147
FT                   /locus_tag="Shew_0365"
FT   CDS_pept        413659..414147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0365"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22237"
FT                   /db_xref="GOA:A3Q9T9"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9T9"
FT                   /protein_id="ABO22237.1"
FT                   /translation="MLCSRGIKIQCKLFAFFQLLSIAFQFWTDLLKPTPSHFLADAQRD
FT                   LARLAISHQKQLAYLLSLLLLCYCLSVVISSYLDSRELMQLLSDWLLWESFDLSMMGPV
FT                   FISPLFIYPYLCLCFIAYQLFCLLASQGPGYPLLTCDLKSVEHDAHGCRAPPSLTLCL"
FT   gene            414288..415238
FT                   /locus_tag="Shew_0366"
FT   CDS_pept        414288..415238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0366"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase, subunit II; COX aromatic rich domain
FT                   protein; KEGG: she:Shewmr4_3823 ubiquinol oxidase, subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22238"
FT                   /db_xref="GOA:A3Q9U0"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9U0"
FT                   /protein_id="ABO22238.1"
FT                   /translation="MLIRNFAKASCAMAALMLAGCEGGVLDPKGQVGIDEKQLIVIATL
FT                   LMLIVVIPVIVMTLYFAWKYRDGRDHEIYAPKWAHSKTIELVVWCVPIVIVGILGVITW
FT                   HSTHKLDPYQPLEHEAEPIIVEVVSLNWKWLFIYPEQGIASVNELAFPANVPVNFKISS
FT                   DTAMNSFFIPQLGSQIYSMAGMTTKLHLIANEPGTYKGISANYSGAGFTGMKFNAIATP
FT                   TRDDFNAWVAKVKREGAALGQESYRELAKESSNNPVSYYASVSDGLFEQIVMQYMHQHQ
FT                   MPAQEGMAMPAATLHGQSHEQVHASESSNTTGGEH"
FT   sig_peptide     414288..414359
FT                   /locus_tag="Shew_0366"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.488 at
FT                   residue 24"
FT   gene            415238..417226
FT                   /locus_tag="Shew_0367"
FT   CDS_pept        415238..417226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0367"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   shm:Shewmr7_3915 cytochrome-c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22239"
FT                   /db_xref="GOA:A3Q9U1"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9U1"
FT                   /protein_id="ABO22239.1"
FT                   /translation="MSSFLGKLTLDAVPFHEPIIMVTLAAVAVIGLVIAALITKHKKWG
FT                   PLWRDWLTSVDHKRLGIMYILLAFVMLIRGFSDAIMMRTQQAMATNGAAGYLPPEHYDQ
FT                   IFTAHGVIMIIFMAMPFMIGLMNLVLPLQIGARDVAFPFLNNLSFWLTASGAVLINISL
FT                   GVGEFAKTGWVAYPPLSELAYSPGVGVDYYIWALQISGIGTTLTGVNFLVTVLKMRAPG
FT                   MKLMQMPIFTWTCTWANILIVASFPILTAVLAMLTLDRYMDFHFFTNEGGGNAMMYINL
FT                   FWAWGHPEVYILILPAFGIFSEVISTFTAKRLFGYKSMVWASGAISILGFIVWLHHFFT
FT                   MGSSANVNAFFGVMTMVIAVPTGVKLFNWLFTIYRGRLKLTVPVLWTLGFMVTFTIGGM
FT                   TGVLLAVPGADYVLHNSLFLIAHFHNTIIGGAVFGYLAGFAFWFPKATGFHLNERLGKA
FT                   AFWCWQAGFYVAFMPLYVLGFLGMTRRLNQTDNPDWNFWIYLAAVGACIIFVGIVLQFV
FT                   QLYVSIRDREQNRDTTGDPWNGHTLEWSTASPPQFYNFARLPKVVDIDAFTHAKEQGQA
FT                   YQMQESYQPIHMPKNTGHGVWMALGITAAGFAAIWHILWLAIAGFLGAFIVFLMRAYDT
FT                   DTDYYVQGDEVKRIETAHLNNLSKGQI"
FT   gene            417223..417849
FT                   /locus_tag="Shew_0368"
FT   CDS_pept        417223..417849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0368"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="PFAM: cytochrome c oxidase, subunit III; KEGG:
FT                   she:Shewmr4_3825 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22240"
FT                   /db_xref="GOA:A3Q9U2"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9U2"
FT                   /protein_id="ABO22240.1"
FT                   /translation="MSIAIPADLSVTQVETLHEEHHDTGENTLLGFWIYLMTDCILFAS
FT                   AFATYAVLYMNTDGGVSGKDVFELDFVLIETAALLLSSITYGLALIFAKRHHKGATLAW
FT                   LAVTFALGCVFIGMEVNEFHHLILEGNGPQRSAFLSAFFALVGMHGLHVSAGLVWMAIM
FT                   MLEVVKRGTGGRTLTRLNCLSLFWHFLDIVWICVFTVVYLMGVLL"
FT   gene            417846..418172
FT                   /locus_tag="Shew_0369"
FT   CDS_pept        417846..418172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0369"
FT                   /product="cytochrome C oxidase subunit IV"
FT                   /note="PFAM: cytochrome C oxidase subunit IV; KEGG:
FT                   shm:Shewmr7_3917 cytochrome c oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22241"
FT                   /db_xref="GOA:A3Q9U3"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9U3"
FT                   /protein_id="ABO22241.1"
FT                   /translation="MSQATTHGQDDLAASIKSYLTGFLLSVVLTGIPFWAVMTHSLETS
FT                   TTLAIVLVLAVVQILVHLKYFLHLDFSKEGKVNTLSFMFTALVIVMVVGLSVWIIYAAN
FT                   DLMM"
FT   gene            418183..419109
FT                   /locus_tag="Shew_0370"
FT   CDS_pept        418183..419109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0370"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: she:Shewmr4_3827 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22242"
FT                   /db_xref="GOA:A3Q9U4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9U4"
FT                   /protein_id="ABO22242.1"
FT                   /translation="MIRHSTSTQVAAPLGAYLQVTKPGIIMGNLIAVVGGFLLAARGEV
FT                   DAVLMLATLVGLSLVVASGCAINNYIDRDIDAKMQRTCRRATVTGAIPLKQVLGLGIAL
FT                   GVLGFGLLAWFTNLAALLFAAFGYLVYVGLYSLYMKRNSVYGTLVGSLSGAVPPVVGYC
FT                   AVTGRMDGAALILLAMFSLWQMPHSYAIAIFRFKDYEAANIPVLPVAQGVEKAKLHIVF
FT                   YIALFALVSTLLPLAGYTGVGFMAVSCVTSFWWLLMALKGYRSDVNLLRWSRQVFGFSI
FT                   LTIAILSLTMALDFQVAGQAPLLAMLG"
FT   gene            complement(419234..420100)
FT                   /locus_tag="Shew_0371"
FT   CDS_pept        complement(419234..420100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0371"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; transcription activator, effector binding; KEGG:
FT                   stt:t3096 possible AraC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22243"
FT                   /db_xref="GOA:A3Q9U5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9U5"
FT                   /protein_id="ABO22243.1"
FT                   /translation="MNRAAHQAYSQRIQTVCDYIAKHLEQPLTLEQLSQKAHFSKYHFH
FT                   RQFQVYTGITLGKYISLLRLKRASYRLVFHPELKITDIALDAGFENGESFSRAFKQVFA
FT                   QTPTQFRLTPKWEQWSQQYAKVNYTRRETVQIKLTQRDDIKVAVLEHQGSPAALNDSIQ
FT                   QFINWRKQSGESPVASSLTLGVPFNDPNTVAPEAFRFDICGSVTAEVKANDFGVITKTI
FT                   PGGRCAVIRHLGPHDQMDDKIYQFYRDWLPQSGEELRDFPLYFEYHNFFPEVAEHELVT
FT                   KIYFSLK"
FT   gene            complement(420195..420629)
FT                   /locus_tag="Shew_0372"
FT   CDS_pept        complement(420195..420629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22244"
FT                   /db_xref="InterPro:IPR024331"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9U6"
FT                   /protein_id="ABO22244.1"
FT                   /translation="MSKLKADVTILQAGLFSRWDEESPDLPKFLKATVHVPAEIDIEFG
FT                   FIARIRKAKNQRLSYCIYHPHIPDQQGNVRPPFEGELFVESNDWKFYLGDTIWAPEHDK
FT                   VGRWRMTLSLGDKVVAEKTFHVHLNDEESQVANFWKRRGF"
FT   gene            complement(420651..421046)
FT                   /locus_tag="Shew_0373"
FT   CDS_pept        complement(420651..421046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0373"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   she:Shewmr4_3523 protein of unknown function DUF971"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22245"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="PDB:2L6N"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9U7"
FT                   /protein_id="ABO22245.1"
FT                   /translation="MTPQSDTPKVTGLKLKRKSRQLEISFDNGQQFTLSCELLRVYSPS
FT                   AEVHGHGNPVLVTHKKNVNINAITPVGNYAVKLVFDDGHDTGLYSWKVLYDLASNQVDL
FT                   WENYLARLRAAKASREPLIDMAVKYHT"
FT   gene            complement(421123..422448)
FT                   /locus_tag="Shew_0374"
FT   CDS_pept        complement(421123..422448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0374"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: shm:Shewmr7_0433 heat shock protein HslVU,
FT                   ATPase subunit HslU; TIGRFAM: heat shock protein HslVU,
FT                   ATPase subunit HslU; PFAM: ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22246"
FT                   /db_xref="GOA:A3Q9U8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9U8"
FT                   /protein_id="ABO22246.1"
FT                   /translation="MSEMTPREIVHELDSHIIGQQNAKRSVAIALRNRWRRMQLDAALR
FT                   QEVTPKNILMIGPTGVGKTEIARRLAKLAKAPFIKVEATKFTEVGYVGKEVEQIIRDLT
FT                   DAAVKLTREEQMAKCKFRAEEAAEERILDALLPKPKEDWDTEKKDDTGTRQVFRKKLRE
FT                   GQLDDKEIEIDIAAPQVGIEIMSPPGMEEMTSQLQSMFQNMGPGASKRRKMTIKEAYKL
FT                   LIEEEAAKLVNPDDLKEQAIELVEQHGIVFLDEIDKICKRGDTSGPDVSREGVQRDLLP
FT                   LVEGCTVNTKHGMVKTDHILFIASGAFQMSKPSDLIPELQGRLPIRVELEALSANDFKR
FT                   ILTEPHASLTEQYVALMATEGVKVEFSESGIERIAQAAWQVNERTENIGARRLHTVMER
FT                   LMEDLSFEASDKSGSTTVIDADYVNAHLENLVQDEDLSRFIL"
FT   gene            complement(422504..423028)
FT                   /locus_tag="Shew_0375"
FT   CDS_pept        complement(422504..423028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0375"
FT                   /product="HslV component of HslUV peptidase. Threonine
FT                   peptidase. MEROPS family T01B"
FT                   /note="PFAM: 20S proteasome, A and B subunits; KEGG:
FT                   shm:Shewmr7_0434 20S proteasome, A and B subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22247"
FT                   /db_xref="GOA:A3Q9U9"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9U9"
FT                   /protein_id="ABO22247.1"
FT                   /translation="MTTIVSVRRNNQVVIAGDGQVSLGNTVMKGNARKVRRLYHNKVLA
FT                   GFAGGTADAFTLFERFESKLEMHQGHLMRAAVEMAKDWRSDRVLRKLEALLAVADTECS
FT                   LIITGNGDVVQPENDLIAIGSGGNFAQAAATALLENTDLSAKEIAEKSLTIAGDICVFT
FT                   NQFKTIEELNY"
FT   gene            423623..425317
FT                   /locus_tag="Shew_0376"
FT   CDS_pept        423623..425317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0376"
FT                   /product="Curlin associated repeat protein"
FT                   /note="PFAM: Curlin associated repeat protein; KEGG:
FT                   sfr:Sfri_1514 curlin associated repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22248"
FT                   /db_xref="GOA:A3Q9V0"
FT                   /db_xref="InterPro:IPR009742"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9V0"
FT                   /protein_id="ABO22248.1"
FT                   /translation="MTKLLPLAAAIAMTIGTAHAADSTATTSQNGSGNIASTVQTGTNH
FT                   TATINTALGFDSSATIDQAGDAQTATINQIGGVANSSAMVTQSVSSNNATVNQEHMDNT
FT                   HATVTQAGESNNADVNQLHVNDSQAIVVQQGNTNNANIRQYGFGIHNPAGSTILQTGNN
FT                   NSANTDQDTSTDALSTVVQTGAENIANVNQMNNAERSVVAINQITNSSVATATQDGSAD
FT                   SSITINQINGSIGTADVTQSNGSENLASVTQDDNSLNATASVSQTGSFNQVNTLQQHAI
FT                   NTSLSVMQNGESNIASVNQEHVNDSVATVNVTGDTNTTTVRQYGFGYHEPASATVTTVG
FT                   NFNNVNINQDTSFMAEASVNQVGNGNIALVSQLNESDNSKVFIDQIDASENGNVVVAQD
FT                   QAADSTATVMQSGVNGSAVFVAQGPGSQLNANVNQTASVGGIVNINQDGLDQGAMVSQS
FT                   GTDNMADIDQTASLNRVTVAQMGDFGAADIDQTGNNNEGWLNQTGGEYNDAVLLQQGDD
FT                   NYAMIEQSGLGLDGAHNLATINQLGMNDSASIMQAGGFGNTATITQN"
FT   sig_peptide     423623..423685
FT                   /locus_tag="Shew_0376"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(425417..425995)
FT                   /locus_tag="Shew_0377"
FT   CDS_pept        complement(425417..425995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0377"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   sfr:Sfri_3763 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22249"
FT                   /db_xref="GOA:A3Q9V1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9V1"
FT                   /protein_id="ABO22249.1"
FT                   /translation="MSNRDYANRRPASKGRKKSTGGRRQPAPAPRRFPFVLSLVTLGLV
FT                   GGFGYFLWSINDSADKVETQPEVQAAKPKVVKKDPNALPPKPKEEWTYQEELENKQVEV
FT                   DIPENTTPTRPYQMQCGSFRQESQANEMKAVIAFQGLEAQVRKVSGSNGTWYKVVLGPY
FT                   ERKRLAEKHRHILQRGGLNGCQIWFWEGS"
FT   gene            complement(426010..427755)
FT                   /locus_tag="Shew_0378"
FT   CDS_pept        complement(426010..427755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0378"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: shm:Shewmr7_0456 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22250"
FT                   /db_xref="GOA:A3Q9V2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9V2"
FT                   /protein_id="ABO22250.1"
FT                   /translation="MKSHIQSLLEQAIQTLKQQAIIPADFEARIQVDRTKDKTHGDFAT
FT                   NLAMMLTKVARKNPREVAQLIIDSLPQNSQVAKVEIAGPGFINFFIDENALTNQLMAAL
FT                   SDDHLGVTLPTPQTVVVDYSSPNLAKEMHVGHLRSTIIGDAVVRALEFQGHKVIRQNHV
FT                   GDWGTQFGMLLAYMEELRAQQGEQAQVELADLESFYRAAKVRFDESEEFATRARQLVVE
FT                   LQSGDEYCNKLWREFNDISLSHCHEVYERLGVSLTRADVRGESAYNDDLEQVVRDLDAQ
FT                   GLLSESNGAKVVFQDEFQTKEGEPLPVIIQKADGGFLYATSDLAAMRYRSNVLKADRAL
FT                   YFVDLRQALHFQQVFSLARTANFVRPELSLEHMGFGTMNGEDGRPFKTRSGGVVKLVDL
FT                   LSEAETRALELVRSKNPDMDEEELAKIAKVVGIASVKYADLSKNRASDYIFSFEQMLSF
FT                   EGNTAPYLLYAYTRVAGIFKRAAEIDLTGASIKLEHDKEKELGNKLAQFAEVLGRMVAK
FT                   GQPHALCGYLFELAGAFSSFYEACPVLAADSEDEKKSRLLLAQLTAKTLKQGLDLLGIE
FT                   TLERM"
FT   gene            complement(427878..430073)
FT                   /locus_tag="Shew_0379"
FT   CDS_pept        complement(427878..430073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0379"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: son:SO4122 primosomal protein N'; TIGRFAM:
FT                   primosomal protein N'; PFAM: helicase domain protein; type
FT                   III restriction enzyme, res subunit; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22251"
FT                   /db_xref="GOA:A3Q9V3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9V3"
FT                   /protein_id="ABO22251.1"
FT                   /translation="MSLFVEVALPVPMRQAFSYRVKEADLDKAQVGVRVRVPFGRQQLI
FT                   GLVTGLSQSCDLAPNQIKSVITFLDHEGVLPPSLYKLTQWAARYYFCSLGQMLSQALPV
FT                   ALRKGAEVEAQQLQVWRVTAAGQEADIDLLKRAPAQRKLLLALLETELSQDELNALEQS
FT                   KTALKALVERGWIECIERRIESNLSWRDGLELDETPHQLNPEQAIAVAMLNQQQGYHCT
FT                   LLEGITGSGKTEVYLALLETVLKQGKQALILVPEIGLTPQTISRFKRRFKVQVAVIHSG
FT                   LTDNQRLSAWRLARSGEAAIIIGTRSALFTPMRYPGIIILDEEHDASFKQQEGIGYHAR
FT                   DLAVMRGHLESIPVLLGSATPSLETLQNALSGRYQHLSLGSRAGAAEKVRQGIIDIRNQ
FT                   PLKNGLSHGLLNEMRIHLDAGNQVLLFLNRRGFAPALLCHECGHLHECDRCDAFFTVHQ
FT                   SLGEIRCHHCGNQYAIPRQCHQCGSTMLMGQGVGTEQLADALAKEFPNYPVVRIDRDTT
FT                   SRKGALETHLNAIHKGEYKILVGTQMLAKGHHFPDVTLVGLLDVDGALFSADFRAPERF
FT                   GQLYTQVSGRAGRARKPGTVLLQTHQCDNPILRELMHKGYGEFARGQLEERKQALLPPA
FT                   WHMLLLRAEAHKAEDADAFLAQVAQLLPQDEQCEIIGPMPAPMDRKAGKFRRQLMFQTK
FT                   TRGLLQQAFEQALPQIEALPLAKRCRWSLDRDPQDLL"
FT   gene            430339..431115
FT                   /locus_tag="Shew_0380"
FT   CDS_pept        430339..431115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22252"
FT                   /db_xref="InterPro:IPR020012"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9V4"
FT                   /protein_id="ABO22252.1"
FT                   /translation="MKRVQYLVMLCLVLLGQAGLMSLPAWAKLTHVSINQRLSDLGQRP
FT                   TLRVNIVTQSVNLDKVQFIVEQRSGSERLMVKPMNSYMLLLSGVEEVEDGEAQLVVKEY
FT                   LVNNWQEVKRMPLFDAATAYQQSKPVKPKPVKSNTPVKTAKTNKQPSQPLAAAQQSLAS
FT                   LPPVDVGDRVQQGCQLDYAPPQTLWRLGSTYAKQWQLSTYGAMLAIFEANPNAFNDRKI
FT                   NGLRADVTLKCPSAALKQRYQSADAARAAFEALTAE"
FT   sig_peptide     430339..430422
FT                   /locus_tag="Shew_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            431296..431508
FT                   /locus_tag="Shew_0381"
FT   CDS_pept        431296..431508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0381"
FT                   /product="LSU ribosomal protein L31P"
FT                   /note="PFAM: ribosomal protein L31; KEGG: son:SO4120
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22253"
FT                   /db_xref="GOA:A3Q9V5"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3Q9V5"
FT                   /protein_id="ABO22253.1"
FT                   /translation="MKPGIHPEYAEITATCTCGNVIKVNSTAGKPLHLDVCGACHPFYT
FT                   GTQKVMDTGGRIDKFNKRFGMLGKK"
FT   gene            431735..432505
FT                   /locus_tag="Shew_0382"
FT   CDS_pept        431735..432505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0382"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   noc:Noc_1218 micrococcal nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22254"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9V6"
FT                   /protein_id="ABO22254.1"
FT                   /translation="MDKILALSLSLCSFLATAAGSLCAPTHYDETVTFASVIDGDTLML
FT                   EDGRQLRLIGIDSPEIDRHYPELSEPFANRARNFLASRLLPGQKLKLAFDRKRLDPKGK
FT                   TLAYAYTQEGEHLQEIMLSQGYAKARVYQNDYFWQCLVNIERQARQERRGLWSHKSYQA
FT                   KSPDELNRDDRNRWREVRGVVTGFERKGQQLWLIIDEIFYVGIPREESGKFSNILTLNL
FT                   LESPVIVRGELYYSYKKWQMIAHHPSQISLQNKP"
FT   sig_peptide     431735..431791
FT                   /locus_tag="Shew_0382"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 19"
FT   gene            432685..433932
FT                   /locus_tag="Shew_0383"
FT   CDS_pept        432685..433932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0383"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /EC_number="1.1.1.40"
FT                   /note="PFAM: malic enzyme domain protein; malic enzyme,
FT                   NAD-binding; KEGG: sfr:Sfri_3757 malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22255"
FT                   /db_xref="GOA:A3Q9V7"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9V7"
FT                   /protein_id="ABO22255.1"
FT                   /translation="MADFRQQALDYHEFPVPGKTAVSLTKPAETSMDLALAYSPGVAEP
FT                   VREIAANPDDAYRYTAKGNTVAVISNGTAILGLGNLGPLASKPVMEGKALLFKHFANID
FT                   ATDIEVKHRTAEEFINTVEAIADTFGGINLEDIKAPECFEIEKALIERCNVPVFHDDQH
FT                   GTAIVTAAGMINALEIQGKKLEEAVFVCMGAGAAAIACMTMLVKCGVQRENVYMLDRKG
FT                   VIHTRREDINEYKALFANNTDKRTLQDVIKGADAFLGLSGPDVLSAEDVALMADKPVIF
FT                   ACSNPDPEIKPELAHDVRKDLIMGTGRSDYPNQVNNVLCFPFIFRGALDVRAAKINDEM
FT                   KIAAVHAIAALAKEPVPAEVLAAYPDVTELKFGPDYVIPKPMDPRLLSNVAKAVAQAAI
FT                   DSGVAALPTLPEHYMA"
FT   gene            434107..436017
FT                   /locus_tag="Shew_0384"
FT   CDS_pept        434107..436017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0384"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; KEGG: shm:Shewmr7_0461 diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22256"
FT                   /db_xref="GOA:A3Q9V8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9V8"
FT                   /protein_id="ABO22256.1"
FT                   /translation="MKLTQLLTKKLTGFWLLSLAAVAFIFLLTALVSFIQLTYKFQQQQ
FT                   MTELEEMLLQHQVRHELQHLDIWLPQILAAYDAQKFTLIRGDETLYRFDRGNHDQSVVN
FT                   YDRVLNETLDLHFHISLPQPFLLHNISWHGGLVFLVGCIAVGLLVRRGYLWLALQLQGI
FT                   EDLAKRSHLILSGDYDKALAETGHGRPRLINRALTQMLLELDDAQKQRARFDQFIRSNT
FT                   FLDPESGIGNRLFLKNRLDALSNKDGMMAPGVLLLLEMEDLDLLQQEADEFSIQELLTQ
FT                   TIGGISHLLDSQANSIFSRRSYNQFAIVVPQISLADAEKLAARLLKVCLSQPLEGVNNR
FT                   DDFFHIGVAYFKVGESKEQLIEEAEMALRAAQFQGNSGWFMYDKGAVDEEFARGSVRWR
FT                   SFLEYALVNKRVVPFTQAILDSDGKEHHSEVSCRLRDSSDNLVRATLFLPMAIKCGLIP
FT                   QIERQVIEAVLFDLLPKSPKDQRKYSINLSLDTLTSRAFIRWLQTTLLEYRHLTPRLIF
FT                   EINEDILVNNLAKLKAPLDMIAKMGASLCVDRVGQQVVSTQYLQSCRVDLIKLHRSIVR
FT                   QIHLRQENQLFVRSLIGGLYRTEVQVFAEGVESLEEWQTLKILGVSAGQGSFFSDPLEA
FT                   A"
FT   sig_peptide     434107..434199
FT                   /locus_tag="Shew_0384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.448 at
FT                   residue 31"
FT   gene            436254..437132
FT                   /locus_tag="Shew_0385"
FT   CDS_pept        436254..437132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0385"
FT                   /product="conserved hypothetical biogenesis protein MshI"
FT                   /note="KEGG: sdn:Sden_3351 conserved hypothetical
FT                   biogenesis protein MshI"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22257"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9V9"
FT                   /protein_id="ABO22257.1"
FT                   /translation="MENSLLSKFAFWQTKHDRVDLGVYLNAAAVTFYNRDGDPSFSLPL
FT                   SGDDWSGVFQALTDKIPAPNLQLVLSEDFYQLLVVDKPMVQPEEMHQALIWSIKDMVSE
FT                   PVESLHLDYFESPESTNNKVTVVAVNKAMLQALVKAADKHQVTIAGISIEEMAISNYGA
FT                   GDKLAHMVLCHKPGSELLLTVVKQGQLYMQRRIRGFSQLDRVSSEDLQLNVADNLSLEL
FT                   QRSMDYFESQLRQAPVASIALLMGGERQMLAQLLSRNFDQAVEVIACEQVQDKLAQWAL
FT                   AELERQTEEPA"
FT   gene            437133..437738
FT                   /locus_tag="Shew_0386"
FT   CDS_pept        437133..437738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0386"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   she:Shewmr4_3489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22258"
FT                   /db_xref="GOA:A3Q9W0"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9W0"
FT                   /protein_id="ABO22258.1"
FT                   /translation="MNPKLRVNLFTASLLPPRLRLSFRRLLQLGFGLFVLLLAANLLAY
FT                   LHLGSLEADKHQLLSDKAAFDQQKAQLEQAIAKRSASQALVQQVDLLSQQVELKRLLLG
FT                   ELSHVETLTSKGYSPLLTGLARVTDDQLWLSRIQVQEDQFVFEGFSAAPNAVPLWLARL
FT                   QGVEPLKGQTFSTLTMNRGEKQPLGFVLRSKRDEEQAK"
FT   sig_peptide     437133..437267
FT                   /locus_tag="Shew_0386"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.672 at
FT                   residue 45"
FT   gene            437735..438391
FT                   /locus_tag="Shew_0387"
FT   CDS_pept        437735..438391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0387"
FT                   /product="MSHA biogenesis protein MshJ"
FT                   /note="KEGG: son:SO4114 MSHA biogenesis protein MshJ"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22259"
FT                   /db_xref="GOA:A3Q9W1"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9W1"
FT                   /protein_id="ABO22259.1"
FT                   /translation="MKQQIVRWGEAFDQLSQRERIMITVAVVVVIGMLLYLPLESLLTQ
FT                   SSRVQSNIKALTAENRISEQQIDLYQQTLASDPDQEYRQRLAGLQQQAKDLDQQLSFQM
FT                   VDMVPADKMPTMLGELLGRVQGIRLQSFESLAPKPLLALGDENKLNLYSHGIKLAFEGD
FT                   YFATLKFIEAVEAMPNKLYWRQLDYVVGDYPKAEVTLEVYTLSINKDFISVANQD"
FT   gene            438372..438698
FT                   /locus_tag="Shew_0388"
FT   CDS_pept        438372..438698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0388"
FT                   /product="MSHA biogenesis protein MshK"
FT                   /note="KEGG: she:Shewmr4_3487 MSHA biogenesis protein MshK"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22260"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9W2"
FT                   /protein_id="ABO22260.1"
FT                   /translation="MLRIKISVCLLALLSLGLTQASAQTLRDPTRPGVGAPGSAQHQGG
FT                   QKLVLNSLMITDNSATAIINNKTFTTGDRVQGVRITRITAQGVWLADGRQIKLYPEVTA
FT                   TKGQ"
FT   sig_peptide     438372..438443
FT                   /locus_tag="Shew_0388"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 24"
FT   gene            438699..440390
FT                   /locus_tag="Shew_0389"
FT   CDS_pept        438699..440390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0389"
FT                   /product="pilus (MSHA type) biogenesis protein MshL"
FT                   /note="TIGRFAM: pilus (MSHA type) biogenesis protein MshL;
FT                   PFAM: type II and III secretion system protein; Secretin
FT                   domain protein; Secretin/TonB, short N-terminal domain;
FT                   KEGG: she:Shewmr4_3486 pilus (MSHA type) biogenesis protein
FT                   MshL"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22261"
FT                   /db_xref="GOA:A3Q9W3"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013358"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9W3"
FT                   /protein_id="ABO22261.1"
FT                   /translation="MTAMKTITPLLVLMLAACQTTDRPQPVESKSAIDSSIAAAQNKPQ
FT                   MPPPAAVMPDSVQRELQSSALLGSLTPSQPSERRFDVSAKDVDAKVFFPSLVQGTPLSV
FT                   AVHPNVTGTVSLSLKGVTLSEALQVVEDIYGYEVSREGRILRVFPAGMRTETFPLNYLY
FT                   MERQGLSLTSVNSGRISDNNNNRNNNGNNGNNSNNYNNNNSNNNGGDSNSNNSNETTNG
FT                   TFIRSKTKTDFWGELKETLESIIGNTGDGRQVVVSPQAGLVTIRAYPNELRQVKTFLKT
FT                   AESHLQRQVILEAKVLEVTLSDGYQQGIHWESVLGQSGNNSIEFGTSPAPDGLGDVITS
FT                   AIGGITSLQIKGKDFSTMINLLDTQGDVDVLSSPRVTASNNQKAVIKVGRDEYFVTDVS
FT                   STTVAGTTPVTTPEVELTPFFSGIALDVTPQIDEEGSVLLHIHPSVIDIKEQNKSIKVS
FT                   DSTLELPLAQSEIRESDTVIKANTGDVVVIGGLMKSENIELISKVPLLGDIPFLGEAFT
FT                   NRSNSLRKTELVILLKPTVVGAETWQTELQRSKALLDRWYPEEKQE"
FT   gene            440395..441300
FT                   /locus_tag="Shew_0390"
FT   CDS_pept        440395..441300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0390"
FT                   /product="MSHA biogenesis protein MshM"
FT                   /note="KEGG: she:Shewmr4_3485 MSHA biogenesis protein MshM"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22262"
FT                   /db_xref="GOA:A3Q9W4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9W4"
FT                   /protein_id="ABO22262.1"
FT                   /translation="MYLQHFHLAQPPFSLTPNTGFFFGLAPHVEALQVLQTALQTGEGF
FT                   IKVTGEVGTGKTLICRKLLNDIPERFHCAYLPNPYLSPSELRWALALELGLKYSADLDQ
FT                   QRLTSLIQQQLIALSAHGHSIVLVLDEAQALPDESLEALRLFTNLETESRKLLQVVLFG
FT                   QPELDTRLQQPQFRQLRQRITFSYQLRPMTADETRAYQAHRLEVAGYRGEGLFGARESR
FT                   RIARAARGIPRLINILSHKALLLAYGEGADKVSLRHVKGAIADTQDADRGLFPSWWLGT
FT                   VGAVSLCAGALWFWLTRGLA"
FT   gene            441297..442457
FT                   /locus_tag="Shew_0391"
FT   CDS_pept        441297..442457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0391"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: shm:Shewmr7_0468
FT                   tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22263"
FT                   /db_xref="GOA:A3Q9W5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9W5"
FT                   /protein_id="ABO22263.1"
FT                   /translation="MSVINTMLKDLDKRQQSHGLDELPVPPLQYRQAPQSRLPWLLLAL
FT                   LALLLLAMGYLAWDRYAALERTNLALQQDNQILAQEIASGDLKQPSVEKVASNETALAA
FT                   DEAPAEESKTEASLAADAQVTAKIESSAEASAELMTTSNTDPVAEPKVESKPAVESKPS
FT                   AKSQRVRVEQTADANTAKTTGSMAVTEVKLSPEALAEKRFSQGKSAQEGGQLSQAVDDF
FT                   SEAIRLDPTLHGARQHLAALYYGQGQLGEAKTVLQQGLARYPQELDYALMLAKVLEAQG
FT                   DSQGALAALGTIPDDHLLAKQKWVQQSHLAQQASQFALAEESYRRLARVEPTQAKWWMG
FT                   LAYALDSQQKYTSAKQAYGQALGLSGLSQQASDFIQQRLAQLGDIE"
FT   gene            442454..444214
FT                   /locus_tag="Shew_0392"
FT   CDS_pept        442454..444214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0392"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II, protein E domain protein; KEGG:
FT                   shm:Shewmr7_0469 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22264"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9W6"
FT                   /protein_id="ABO22264.1"
FT                   /translation="MKPKLKMRLGDLLVQEAIISEAQLGQALAEQRNTGKKLGRTLIDL
FT                   SCITEEQLLKFLSQQLNIPFLDISRRAIPPQVVNLLPEVQARRYRALAVEDNGDHVLVA
FT                   MSDPADLQAMDNIEVLLAPKAIKIAVVTETQLLEAFDNLYRRTGEIAQIAGKLEEEYAA
FT                   DDQFDLASLTDADSDNETTVVKLLQSIFEDAVQMRASDIHIEPGDKVLRIRQRIDGQLQ
FT                   ENTLQEVNIASALVLRLKLMAGLDISEKRLPQDGRFHMEIKGHKIDVRMSTMPIYHGES
FT                   VVMRLLDQSAGLLTLDETGMPAEMLARVRRQIKRPHGMLLVTGPTGSGKTTTLYGVLSE
FT                   LNTADRKIITVEDPVEYQLPRINQVQVNHKIGLDFSNVLRTTLRQDPDIIMVGEMRDQE
FT                   TVEIGLRGALTGHFVLSTLHTNDAVTSALRLLDMGAASYLVASALRVIIAQRLVRRVCH
FT                   KCAQPYDASAADHAWLSSISGRDFSQAKFRIGTGCQSCNGSGYRGRIGVFEILELDEKM
FT                   IDAMRSGNPQAFAQAAYQSPNFTPLAESALNYLAEGMTTMEEVAKLIEDASDAQVPISQ
FT                   EMIHQHEIEG"
FT   gene            444217..445434
FT                   /locus_tag="Shew_0393"
FT   CDS_pept        444217..445434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0393"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   son:SO4108 MSHA biogenesis protein MshG"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22265"
FT                   /db_xref="GOA:A3Q9W7"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9W7"
FT                   /protein_id="ABO22265.1"
FT                   /translation="MPIYQYKGRDAQGNAVSGRLDATTQSAAADQLLSRAVIPLELVEA
FT                   KVAREFHLGSLFKSKVGLDELQIFTRQMYSLTRSGIPILRAIAGLSESSHSKRMKDALN
FT                   DISEQLISGRPLSSAMNHHPDVFDALFVSMIHVGENTGKLEDAFIQLSGYIEREQETRR
FT                   RIKAAMRYPIFVLMAVALAMVVLNIMVIPKFADLFARFGADLPWATKLLIGTSNFFVNY
FT                   WYLLLIALVGCFVGIRYWHNTEKGEQQWDRWKLKIPAVGSIIERSTLSRYCRSFSMMLS
FT                   AGVPMTQALSLVADAVDNAYMHDRIVAMRRGIESGESMLRVSNQSQLFTPLVLQMVAVG
FT                   EETGQIDQLLNDAADFYEGEVDYDLKNLTAKLEPILIGIVAVIVLILALGIYLPMWDML
FT                   NVVKGG"
FT   gene            445467..445958
FT                   /locus_tag="Shew_0394"
FT   CDS_pept        445467..445958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22266"
FT                   /db_xref="GOA:A3Q9W8"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9W8"
FT                   /protein_id="ABO22266.1"
FT                   /translation="MENQTRVDSELMQAYGKMIAIVVLLLILGVLGYGYFAKVDQVSSQ
FT                   GLKLEHSRLLNVLAMVRSQWLVQGRPAEMHLDWSTAMELRDGEQPLIKMSDQGWPTLAQ
FT                   ITEENCKTLWWQLLGGRDDLAKIVTQADQAGEVCSYIANNGDRLSYQLTSGRVIFLTDR
FT                   "
FT   gene            446032..446667
FT                   /locus_tag="Shew_0395"
FT   CDS_pept        446032..446667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0395"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: shm:Shewmr7_0472 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22267"
FT                   /db_xref="GOA:A3Q9W9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9W9"
FT                   /protein_id="ABO22267.1"
FT                   /translation="MKMRAQNMPTKQSGFSLIELVIVIVILGILAATAIPRFLNVTDDA
FT                   EDASVDGVAGGLATAVSFVRSQWEVDGRNNANVVLDGTQISLDTRFGFPTGLTSGSGIV
FT                   SATGMTDAACQEVFQNILQGAPRNVLFNQDARNQRFTARVLDGAGGNGVAIDGTQVTNL
FT                   DLCVYHQVTSLALNPTTGVPTPTPDLDTANAKGILYNPGTGQVLSFTN"
FT   gene            446757..447266
FT                   /locus_tag="Shew_0396"
FT   CDS_pept        446757..447266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0396"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: she:Shewmr4_3296 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22268"
FT                   /db_xref="GOA:A3Q9X0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9X0"
FT                   /protein_id="ABO22268.1"
FT                   /translation="MKKQNGFTLIELVVVIIILGILAVTAAPKFINLQSDARASTVEGV
FT                   KAALQGANSLVYSKAAIAGKEKDQGASITIATGVAVTTDYGYLDSATDTATVKTNLEKA
FT                   MDMTFEALSAADSVTAQDWGVLYSSETKFIIVPKGKKSTDACRIDYTTAGNASTPAVVT
FT                   AVTTDC"
FT   sig_peptide     446757..446837
FT                   /locus_tag="Shew_0396"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.872) with cleavage site probability 0.867 at
FT                   residue 27"
FT   gene            447281..447772
FT                   /locus_tag="Shew_0397"
FT   CDS_pept        447281..447772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0397"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: she:Shewmr4_3479 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22269"
FT                   /db_xref="GOA:A3Q9X1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9X1"
FT                   /protein_id="ABO22269.1"
FT                   /translation="MNKQKGFTLIELVVVIIILGILAVTAAPKFINLQSDARKSTVEGM
FT                   KGALQGANTLLYSKAAIQGKEKDANSNDANNVDTTGDGTADTKAVYGYVKADATELAKV
FT                   LEVDSADWTIAAPAAGVSTADIIIHPADFTPAADKKCFLEYTDATSSSLPVYKTVLDNC
FT                   "
FT   sig_peptide     447281..447361
FT                   /locus_tag="Shew_0397"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.872) with cleavage site probability 0.867 at
FT                   residue 27"
FT   gene            447919..448368
FT                   /locus_tag="Shew_0398"
FT   CDS_pept        447919..448368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0398"
FT                   /product="MSHA pilin protein MshC"
FT                   /note="KEGG: son:SO4104 MSHA pilin protein MshC"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22270"
FT                   /db_xref="GOA:A3Q9X2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9X2"
FT                   /protein_id="ABO22270.1"
FT                   /translation="MNKQQGFTLVELVTSIILIAILSVVVLPRFFTASSYSAYTLRDEL
FT                   ISELRRVQLMALNNLDRCYKVSVTATSYRADIFGADCNSLTVTGNAQSLPRQTSLSLGG
FT                   LNSFTLTFDRDGRVTGSCATGCTIKVAADETLDLSIESQGYIHGR"
FT   gene            448358..448909
FT                   /locus_tag="Shew_0399"
FT   CDS_pept        448358..448909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0399"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: she:Shewmr4_3476 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22271"
FT                   /db_xref="GOA:A3Q9X3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9X3"
FT                   /protein_id="ABO22271.1"
FT                   /translation="MDASRAILPRRASGFTLIELVVGMIVLGIALVMLTSMLFPQADRA
FT                   AETLHRVRSAELAHSLLNEIWGKRYDQNSNPNGGVPACGAAARPDLGLPAGLPCTDQAN
FT                   FGPGGLDRNAYRDVDDYHGLTQASKMLNSDRTYAQEYINYQLSVSVTYPGSDKNSKLVA
FT                   INVTTPSGEVITYNALRSNY"
FT   gene            448909..449706
FT                   /locus_tag="Shew_0400"
FT   CDS_pept        448909..449706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0400"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: sfr:Sfri_3741 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22272"
FT                   /db_xref="GOA:A3Q9X4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9X4"
FT                   /protein_id="ABO22272.1"
FT                   /translation="MRLQTNKGFTLVEMVTVIIILGILVVGVSSFVILGTRIFVESSSV
FT                   DQVLSQSRFVIERMTRELRNALPNSIRVASSSDAQCIEFMPITASASYISLPIAPDSAT
FT                   DSGSVMLPAQGINLAHKMVIYPLSPAQLYQDSPSTTQGRIFDVKQLSGNQIEFNNALRF
FT                   DEASPQKRYFIVNGAVSYCFLSRGDIRRYDGYGVQTTQPTPAQMGTGALMGQHVVNNLG
FT                   SEEPIHYTPGTLVNNAVVQLSPRFEVNGQTFQYQHQVQVINVP"
FT   gene            449696..450133
FT                   /locus_tag="Shew_0401"
FT   CDS_pept        449696..450133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0401"
FT                   /product="MSHA biogenesis protein MshP"
FT                   /note="KEGG: sfr:Sfri_3740 MSHA biogenesis protein MshP"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22273"
FT                   /db_xref="GOA:A3Q9X5"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9X5"
FT                   /protein_id="ABO22273.1"
FT                   /translation="MFPNRASQRGSALVIGIFIITVMFLMAAALVNIVSDADEGVNLEV
FT                   LATRAFAAANSGADVALAQLFPLSGAVVGCSSVSASWTPPNVVGFHGCSVVLSCNQTTV
FT                   ATGSDSVTQYLIGSEATCAVGNCDGDACLRVNRKVEVEARE"
FT   sig_peptide     449696..449779
FT                   /locus_tag="Shew_0401"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.763 at
FT                   residue 28"
FT   gene            450126..452828
FT                   /locus_tag="Shew_0402"
FT   CDS_pept        450126..452828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0402"
FT                   /product="MSHA biogenesis protein MshQ"
FT                   /note="KEGG: she:Shewmr4_3473 MSHA biogenesis protein MshQ"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22274"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9X6"
FT                   /protein_id="ABO22274.1"
FT                   /translation="MNRLLLTLLAGLFYLVFSTGVFAVPQCDAIFTDPPTGNHNPGLVP
FT                   PDDIGPRLGNLTCTKWGCSGHSSRFAPGDYDFATGDFQNKSYMSTTGKTARLYFDNLSM
FT                   NNASINASGNAENLIIYVRGDLSVAGQNYLNGILYVAGTVTFTGNAWIDGAIASGGSLS
FT                   FGGNGGADVDLGAVDDADFGGMCDKGGVSVDHYRLEFTSDALSCAAKDILLRACVNADC
FT                   STQASVSSSVELTKNGVKYADVGFTGSAQTQVWHPDGGSVLLGLGTTAPSAPYRCYIDG
FT                   ALVANAQCLLDFADTGFYFDVPDSTACKTGNSFNLFAVTKDTQTQQCKPLFANQTKTIS
FT                   FGFDYLRPATVNNPAQLTLNSLLSPSDSIAIDGGGTQTMQVHFNGEGVASLSANYPEAG
FT                   VVTLSAENNHTVSRPAGGSETLVLTHSDSFTSAPAGFHFANVSANGRCDASDPYDADCK
FT                   VLAAAGEPFSMQVTAACWQSDDDKDFGNNKALQNFEHGGLSVVSQVVQPDTGVNGVLGS
FT                   DSLAFSLSSGVSAQIIDDQSWSEVGTMKVALGADVSFEGVTIPASQSSSEVFGRFTPAY
FT                   LEITGNDPEAAQSCGPFTYLDQPFGFKTGTEPNIQVAGLNAQDKVTSNYQIGDWWRYKH
FT                   RDEADRNQWPERSYQDSTGLAVIGDSQAPALSGQVNYRGSPNIAELIGAQPSYRRTQTP
FT                   QEPFDAKFDLILSALDVSDEDGICYRDSASAACRGFTFSDIGDGKAFELRYGRLVLENG
FT                   YGPQSEGLRLPLRSEYVSSVTAGVTTWTLNGDDNCSVFNTQTSLDAGESATSGLYRILP
FT                   SGFPDLQAYSDSGLSLRSGALVNGVGNLYFAIPNQAGEVPLKLHVEPWLKGYWNYPGNA
FT                   ADTLFDPRANAYFGTYRGHDKIIYWREVK"
FT   sig_peptide     450126..450197
FT                   /locus_tag="Shew_0402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            452994..454043
FT                   /locus_tag="Shew_0403"
FT   CDS_pept        452994..454043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0403"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: shm:Shewmr7_0479 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22275"
FT                   /db_xref="GOA:A3Q9X7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9X7"
FT                   /protein_id="ABO22275.1"
FT                   /translation="MFKKLRGIFSNDLSIDLGTANTLIYVREEGIVLNEPSVVAIRGER
FT                   GSGGQKSVAAVGTEAKQMLGRTPGNIQAIRPMKDGVIADFYVTEKMLQHFIKQVHNNSV
FT                   FRPSPRVLVCVPVGATQVERRAIRESAMGAGAREVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVAIISLNGVVYSSSVRIGGDKFDDAIINYVRRNYGSLIGEATAERIKHT
FT                   IGTAYPGDEVLEIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQSPP
FT                   ELASDISERGMVLTGGGALLRDLDRLLMQETGIPVMVADDPLTCVARGGGKALEMIDMH
FT                   GGDLFSDEN"
FT   gene            454178..455059
FT                   /locus_tag="Shew_0404"
FT   CDS_pept        454178..455059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0404"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: shm:Shewmr7_0480
FT                   rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22276"
FT                   /db_xref="GOA:A3Q9X8"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9X8"
FT                   /protein_id="ABO22276.1"
FT                   /translation="MKPIFARGISNQFRLTLAIVLSVILLVANDRLEPVRQSISSVLSP
FT                   LQYVANIPGAILDWSAESIATRNMLAKQNKQLLRQQLLMSERLQRFEHLRQENDRLRAL
FT                   LGSPVHMDSKKMVAEVMEVASDPFRHYVVLNHGARSGVFVGQPVVDAHGVVGQVVEISE
FT                   LTSRVLLISDVTHAIPVRVTRNDVRLVAQGIGELDELELRHVAKSTDLRVGDLLVSSGL
FT                   GKRFPEGYPVARIMTVERDDGQSYATVTAQPLAALDRIRYLLLIWPDGNQSEQAEPIEA
FT                   GADAQPQAEETP"
FT   gene            455056..455544
FT                   /locus_tag="Shew_0405"
FT   CDS_pept        455056..455544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0405"
FT                   /product="Rod shape-determining protein MreD"
FT                   /note="PFAM: Rod shape-determining protein MreD; KEGG:
FT                   sfr:Sfri_3736 rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22277"
FT                   /db_xref="GOA:A3Q9X9"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9X9"
FT                   /protein_id="ABO22277.1"
FT                   /translation="MSMHIPHGRWVVWLSFLLAMLFQIMPLPGLVEGWRPDWLLLVMIY
FT                   WAMALPHRYNILSAWVLGVLLDILLGAHLGIRALSMSLVIYVVVLHFQRLRNFPMWQQA
FT                   LMVASLVCLHHLLVFWVQFVVNVASFDVSLFLPALSSLIIWPWVFWMLRRIRRIYKVR"
FT   gene            455544..456134
FT                   /locus_tag="Shew_0406"
FT   CDS_pept        455544..456134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0406"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: sdn:Sden_3331 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22278"
FT                   /db_xref="GOA:A3Q9Y0"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Y0"
FT                   /protein_id="ABO22278.1"
FT                   /translation="MMQLVLASSSPRRRELLAQVGLGDSEFAFEALSADIDESHRAGES
FT                   ADEFVVRLAIEKAQAGLALWGQAGAVVLGSDTIVVLDGEILGKPKDEQDARQMLSALSG
FT                   KRHSVMTAVAVTDGQRTLSRLVETKVQFCGLTEQAILAYIATGEPMDKAGAYGIQGLGG
FT                   CFVEAIDGSYSAVVGLPLVETRALLAEMKLLAV"
FT   gene            456232..457734
FT                   /locus_tag="Shew_0407"
FT   CDS_pept        456232..457734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0407"
FT                   /product="RNAse G"
FT                   /EC_number="3.1.4.-"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: she:Shewmr4_3468
FT                   ribonuclease, Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22279"
FT                   /db_xref="GOA:A3Q9Y1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Y1"
FT                   /protein_id="ABO22279.1"
FT                   /translation="MSHIVKNRVQKKIGSELLINVTPTEARVALVEYGILQEVHIERRM
FT                   KRGLVGNIYKGKVSRVLPGMQAAFVDIGLDKAAFLHASDIVPHTECVADVEKGNFVVRD
FT                   IAELVRQGQDIMVQVVKDPLGTKGARLTTDITLPSRYLVFMPGSSHVGVSQRIESEEVR
FT                   ARLKGLTEPFVDEDGGFIIRTAAENAGEQELIQDAAFLRRVWAKVCERRKRPGVSLLYQ
FT                   DLALPVRIVRDFVGTELDQIQVDSGQTYEELLQFTQEFMPEIADKIEHYSGRVPIFDLY
FT                   DVENEVQRALGRKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLEETIFNTNLEATH
FT                   AIARQLRLRNLGGIIIIDFIDMLNEDHKKRVLSTLEAALANDRVKTNVSGFSGLGLVEM
FT                   TRKRTRESLEHVLCGECPACFGTGSLKTVETVSYEIFREIIRLNRGYDADEFLVYCAPT
FT                   VYNSLTGEESHLVAELGAYIGKHVRLQNEPMYAQNKFDVVIM"
FT   gene            457734..462044
FT                   /locus_tag="Shew_0408"
FT   CDS_pept        457734..462044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22280"
FT                   /db_xref="GOA:A3Q9Y2"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Y2"
FT                   /protein_id="ABO22280.1"
FT                   /translation="MSRPFCPRTFGRLCWQMIAIIVVLFALSVSLFRGLLPKLDQVRQE
FT                   LVSYIYEQYQVKVEVSELTAEWQAFGPAVTIKNLVLPVQENLPVTFIIDNVHLKLDFWD
FT                   SLVSASPQIENVIFEGVKIALDLDRISQAGNGQQSSDAPVAEQNTDWLYALMLEQFDRF
FT                   AITDVTMQLISSTHKYRPIHIRDLRWRNLAGRHRAEGALFLDEQASEVERLSLAVDIRG
FT                   DGHNPESLTGQLYLAANSLDLGEWASRQENPYASGKKLPLEGVVNLQAWAEFSNRAFTA
FT                   ATVAFEPSWLQWQLKGEQQKFEIKAGQLNWQPQVSGWQLTSSDLAFVTNGQAWPALHIG
FT                   ARKRDDRLMASINQLDAEVLLPLLPLVPGMDLDGLYLWQSMDPKGSIEQLKLGYGEQQG
FT                   FALSAQLKQFAWQGSGAIPGAEPIDLMLGMQGSDLYLSAPAQQYHLDFNGGFEEALSLA
FT                   GDAFTVKYALGEAELIAPKLHFYNADLDLDAAMKLDFAGEASLNLLADVQVKNAARAKY
FT                   YFPKHAMSESLVDYLSGAIKAGQSQDAKVVWNGPLKHFPYDDNSGVFQAGFSLNQARYR
FT                   FQPDWPEVTELSLNALFENAAMDIWVNKGMLMQVPADGAHVAIPRMSHQTLLTVKADLR
FT                   TQGEAAKQVLQRSPLADTVGATLEVVQVQGEVSGKLDLSIPLYHGGKEAILGQVKFDNT
FT                   PVYISEPGVQLDGVTGEVYFANEVVTGEKIQARLFEQPVSFTFDTGKTNKHYGLNLDMQ
FT                   GQWALASLPAMLDNPLKDYYSGELDWQGAMTLIFDELGYRIQAQVKSDMQGVELSLPGK
FT                   FAKTADSPRALSFELIGDNKQASLGAKLGDQMEFWGGFDEESGDHLAHFDLLLGRLFKP
FT                   GDQLKRQAGHLQLDMPATEFAPWLPIIKGFMGDAALESSLDLAMREALAEQAPESPLVQ
FT                   AETEPKKSSFFPPLIAVDGQVRQLNLYGQPLTELNLEAHPTEHGWRFEGNANEFSGRVD
FT                   FYPDWSTQGLKLVASRFNFAPESKEGEASEVASDEVLSILPPLAVDVDQFSVYGKPLGH
FT                   LVLQATPKNGDYQIQTIAITTPGITLKGKGAWSNSEGQNLTEFQVDLKAKQFDEVSERL
FT                   GIDPGLKEAPLDLQAELSWQGAPYAFSLETLNGQISYKLGKGHLSEVSDKGARIFSLFS
FT                   LDSLLRKLSLDFSDVFGKGLYFNAFTGTLKLDNGVVKTTDSEMDAVAGNMRVRGYTDLT
FT                   TESLNYDIRFVPQLASSVPTVVLLSTGGWTLGLGAFALTKVLEPVIEVISEIRFRLTGT
FT                   MSEPKLEELERKSKEIEIPESVLPRQRAPGAEAKPESVLPESKQPAQLKQEQQEQNPVK
FT                   QPVLDAKPEGASADQQVMPSGVEIPKPAVVAMPEFKEMPTGQQAPVEQKTETPQQQESQ
FT                   EKPVSKESSDAGQPITMSEWSRRRGEPQLYSRAA"
FT   gene            461968..462798
FT                   /locus_tag="Shew_0409"
FT   CDS_pept        461968..462798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0409"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: son:SO4092 hydrolase,
FT                   carbon-nitrogen family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22281"
FT                   /db_xref="GOA:A3Q9Y3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Y3"
FT                   /protein_id="ABO22281.1"
FT                   /translation="MQVSLLQCQSGRDVEENLSFIREQLDALAGGERPHLVVLPECCLL
FT                   FGGHERQQLAYAGDDAGSELKQTLAALAKQYGIYLVAGTIPILADEGRVFSRSYLFDDS
FT                   GETLGHYDKLHLFDVDVDDGTKSYRESDTFCPGEGVTVVDTPFGKVGMAICYDLRFADL
FT                   FRAMRLQGAEIIVLPAAFTRVTGRTHWLPLLQARAIETQCFLLAAAQWGEHNQGKRETW
FT                   GHSCVISPWGEVQAIKPEGCGWLSAEIDLKAIEGIRRNIPVVAHNRFEPPKLKR"
FT   gene            462840..464288
FT                   /locus_tag="Shew_0410"
FT   CDS_pept        462840..464288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0410"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   shm:Shewmr7_0486 peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22282"
FT                   /db_xref="GOA:A3Q9Y4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Y4"
FT                   /protein_id="ABO22282.1"
FT                   /translation="MPFLTQVEQSLLQDGLSLDQLQGYINSIHQHQVDFSDLYFQGSRH
FT                   ESWVLEDGIVKEGSFHIERGVGVRAISGEKTGFAYADEITPAALSAAVEAARGISAAGN
FT                   SGRVQAWKQHKVTPLYQSADPIAAMEEVKKIALLKQADAYVRSLDPRIIQVVISLSGVH
FT                   EEILVAASDGTLAADIRPLVRFNCSVVLEQEGKRERGASGGGGRHDYQVFFESGDDGLP
FT                   SCFAFAREAVRQASVNLTAIDAPAGEMPVVLGAGWPGVLLHEAVGHGLEGDFNRKGSSA
FT                   FSGLVGQQVASSLVTVVDDGTLENRRGSLSIDDEGVPTQKTVLIQDGILKGYMQDKLNG
FT                   RLMGQASTGNGRRESYAHLPMPRMTNTYMEAGDSSPEDIIKSVDKGIYAPNFGGGQVDI
FT                   TSGKFVFSASEAYLIEKGEITQAIKGATLIGNGPEAMGQLSMVGNDLALDKGVGVCGKD
FT                   GQSVPVGVGQPSLKLDRLTVGGTA"
FT   gene            464481..465884
FT                   /locus_tag="Shew_0411"
FT   CDS_pept        464481..465884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0411"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   shm:Shewmr7_0487 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22283"
FT                   /db_xref="GOA:A3Q9Y5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Y5"
FT                   /protein_id="ABO22283.1"
FT                   /translation="MRYSHIVWLSLLALAGNAAQAKELAFGDAWQQLLQVSDKLQASQQ
FT                   EVNRAQAEKAAGEDLNLPSLSINGSYTRLEKPLELDLRDLNPLASLDPATLPPALGGAL
FT                   GAIPGSLFITPFTEQDVFRSSLQAMWPIYTGGRISAAQGIHEAQVAEKEQQHQLSTRDL
FT                   FVQLVDRYYGVAVSHALMATRGQLVDALTEHAEHAVKLEQQGQIAKVERLNAQVALENA
FT                   RVDYASAKRQLEMSQIALSRMLHQSDVDTASKLFLLDNPPSLGLLSQLTLTSHPALKLL
FT                   EAKETQANGLIDVEKGSYYPSVFLYGNYTLYEDDSLLAKMEPDWMVGVGVKIPLISRDG
FT                   RSGKVEAARSALLQARYTKAQTQQDLSLLLDQSYRQLQQAREETESLDLSLSLAKENKR
FT                   LRDLAFSQGLSTSIEKVDAELKLSGVQTQQLAAQYRYVQAYARLMAISGQLDEFIGRSR
FT                   TAQERADAH"
FT   sig_peptide     464481..464546
FT                   /locus_tag="Shew_0411"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            465874..466845
FT                   /locus_tag="Shew_0412"
FT   CDS_pept        465874..466845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0412"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   son:SO4089 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22284"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Y6"
FT                   /protein_id="ABO22284.1"
FT                   /translation="MRTNRILAIVALIALVAILAYGLMLAHTPKAERLQGQIEAREYNI
FT                   SSKVPGRVAQVMVRRGDQVAEGDLLFAIDSPELNAKLMQAQGGRDAAKALQQEADNGAR
FT                   KQQVAASKEQWLKAKAAATLAETTYKRVEALFSEGVLARQKRDEAFTQWQAAKYTQQAA
FT                   YAMYQMAEEGAREETKAAAEGNARMAEGAVKEVSAILADSQMRSPKSGEVSEVLLHPGE
FT                   LAPSGFPVVSVIDMQDAWAVFQVREDQLKGFKVGDTLEVEIPALGERYPFKVAHISVMG
FT                   HFATWRSTESGHDFDMRTFEMELRPVTPIADLRVGMTSLLVQ"
FT   sig_peptide     465874..465942
FT                   /locus_tag="Shew_0412"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.400 at
FT                   residue 23"
FT   gene            466858..468030
FT                   /locus_tag="Shew_0413"
FT   CDS_pept        466858..468030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0413"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: she:Shewmr4_3462
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22285"
FT                   /db_xref="GOA:A3Q9Y7"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Y7"
FT                   /protein_id="ABO22285.1"
FT                   /translation="MGQLITRELRRLWQSPWQLALVSYLPLLGTLALWWLFSAGLPRAL
FT                   PVAVVDQDQSQLSRMLVRQLSANSVISPVSYQDIGQAQAAMERAEAYAMVVLPFKLNQD
FT                   LMIGHQPSIDIRYNAQFLLVGKLLSSQIQLSLADGLKQKARLKQLASGVPPVQAEINLN
FT                   LIKTQSSALYNANNNYVAFLVPPILIALVQIVAMLVFANALTEELRRETLAEWFSLGTY
FT                   RVLLSKVLVYTPLLMLQLGLVYAWLYGYLGLPMRGGLGQLLIAQLVMLLAVWLIVLTIF
FT                   ALLQDSARVISFCTALFAPSFAFMGVTFPTHEMPLLAQWWRQIMPSSHYVNTHIGVIAY
FT                   GQETQALVSQLSSYWGFLLLLPVIALMLAKMRREQTGEQLDQAQIVEGQG"
FT   gene            468027..469172
FT                   /locus_tag="Shew_0414"
FT   CDS_pept        468027..469172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0414"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: she:Shewmr4_3461
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22286"
FT                   /db_xref="GOA:A3Q9Y8"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Y8"
FT                   /protein_id="ABO22286.1"
FT                   /translation="MNLFALMFEELKAIVTDKAIAITLFGGVIFYSVLYPLPYLNEVPT
FT                   RQQIVVVDGDHSSLSRLVIRHAQASPKLEVVAQVDDLTQAQAAVNSGQAHGYLVIPEGF
FT                   RRDLLRQRGVTLAYGGDANYFLVYSAILEGLVSVGIDAGKYIQFQGLLARGEAAKQVQR
FT                   ELEPIHLNSVPAFNPSLGYTSYVVPGVLLLVLHQTLLIGTGILGAGQWRRQGYWHSVGL
FT                   GQLLSARVATFGLIYSLFTAYYIGYCHYWYQVGVQGNLGQVCLFLLPFLLATSLAGIAF
FT                   SSLFVRRDLPTQVLLLISMPILFVSGFVWPVELIPAPLQAVSQLIPGVVTIKGMLQLNQ
FT                   MGADWQSVAPLWWQLWGLVLFYLLLAYLGLRLRLETRKSPH"
FT   gene            complement(469209..469751)
FT                   /locus_tag="Shew_0415"
FT   CDS_pept        complement(469209..469751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0415"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   sdn:Sden_3068 protein of unknown function DUF615"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22287"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Y9"
FT                   /protein_id="ABO22287.1"
FT                   /translation="MMNIVGDSEHFKQPFDHDDDYVSRADIKREIAIYQELGKKLVSLS
FT                   KSQLKKLELDELLHDNILKAKTIRINSEAHRRQLHYVGKLMRSVDIDELQENLKNVLNQ
FT                   NRNESSKQNVAEKQKDHLLTGGDEAIQTLLEQHPGLERQKLRQLVRQANKELAKQPETA
FT                   SKSAAELVKYLRAETGE"
FT   gene            469898..471238
FT                   /locus_tag="Shew_0416"
FT   CDS_pept        469898..471238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0416"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   sfr:Sfri_3721 peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22288"
FT                   /db_xref="GOA:A3Q9Z0"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Z0"
FT                   /protein_id="ABO22288.1"
FT                   /translation="MASPSIETELNSLKDAVSMALEYAAKLGTSGAEVAISKQQGLSVS
FT                   TRLKEVETVEFNKDGALGITLFRDGCKGSSSTSDLSPEAIRRAVKAADDIARFTSEDPF
FT                   NGLADAELMAKQIEDLELYYPHETTPAELEALAARAETAALDADARIKNSDGASANAHT
FT                   GAKVYGNSHGFLNGYVSSRYSLSCVVIGEQDGHMQRDYDYTVARRFDDLWTPEAVGQQA
FT                   AKKTLSRLGARKIATTKLPILFAPDVATGLMGHLVGAISGSSLYRKSSFLLDAIDTQIF
FT                   PEWFTIAEQPHLKGALASAWYDSEGVATIDRNIIDSGVLSTYLLTSYSARKLGLTNTGH
FT                   AGGIYNWTLSHTGQTFDELVKQMGTGLIVTEVMGQGVNGVTGDYSRGAAGFYVENGEIL
FT                   YPVEEITIAGNLKEMYRNMVAVGKEQDLRSSIRTGAILLDEMKIAGN"
FT   gene            471407..471754
FT                   /locus_tag="Shew_0417"
FT   CDS_pept        471407..471754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0417"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG:
FT                   she:Shewmr4_0532 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22289"
FT                   /db_xref="GOA:A3Q9Z1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Z1"
FT                   /protein_id="ABO22289.1"
FT                   /translation="MAVAIFKALSDETRLLSLLLIQAEGELCVCELMVALDESQPKVSR
FT                   HLAQLRKAELLSDRRQGQWVFYRINPELPDWAGEVIQKTLAGNPQLLSQAQARLAKMGQ
FT                   RPERVQVCCKG"
FT   gene            471758..472792
FT                   /locus_tag="Shew_0418"
FT   CDS_pept        471758..472792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0418"
FT                   /product="arsenical-resistance protein"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: sde:Sde_3779 arsenical pump
FT                   membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22290"
FT                   /db_xref="GOA:A3Q9Z2"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Z2"
FT                   /protein_id="ABO22290.1"
FT                   /translation="MGLFERYLSVWVGLAIVAGVGLGYLLPQQFALIASFEYASVNLLI
FT                   AVLIWVMIYPMMVQIDFSAVKDVGKRPKGLLLTLVVNWLIKPFTMALLGWVFFRVLFAS
FT                   WVDPQTASEYIAGMILLGVAPCTAMVFVWSQLTKGNPNYTLVQVSVNDIIMVFAFAPIC
FT                   AFLLGVSDIQVPWQTLLISVVLYVVLPLVAGIATRKVLNKKGHILSVEAFVARLKPWSI
FT                   LGLLATVVLLFGLQANTILAQPQNILLIAIPLLLQTYGIFFIAYLAAKRMRLEQDVAAP
FT                   ACMIATSNFFELAVAVAISLFGLHSGAALATVVGVLVEVPVMLSLVAFVNRDKTNYLRG
FT                   LGKA"
FT   gene            472828..473838
FT                   /locus_tag="Shew_0419"
FT   CDS_pept        472828..473838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0419"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: son:SO0538 glyceraldehyde 3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22291"
FT                   /db_xref="GOA:A3Q9Z3"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Z3"
FT                   /protein_id="ABO22291.1"
FT                   /translation="MTIKVGINGFGRMGRLALRAAWEWDDIEFVQINDPAGDAATLAHL
FT                   LTFDSIHGRWNHDAVAEGEQIIIGDKRINTSANRAIGDTDWSGCDLVIEASGVMKTKAL
FT                   LQAYLDQGVKRVVVTAPVKEEGVLNIVMGVNHQLYDKDKYPIVTAASCTTNCLAPVVKV
FT                   LHEQIGIKHGSMTTIHDITNTQTILDAPHKDLRRARACGQSLIPTTTGSATAITHIFPE
FT                   LKGKLNGHAVRVPLANASITDCVFEMQRPVTEQEVNALFKAAAEGELKDILGYEERPLV
FT                   SVDYKTDPRSSIVDALSTMVINGTQLKLYVWYDNEWGYANRTAELARMVGRMDKA"
FT   gene            473839..475071
FT                   /locus_tag="Shew_0420"
FT   CDS_pept        473839..475071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0420"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   son:SO0539 transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22292"
FT                   /db_xref="GOA:A3Q9Z4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Z4"
FT                   /protein_id="ABO22292.1"
FT                   /translation="MMLASLRALPSEMRQYLLVTGNYWAFTLTDGALRMLVVLHFHQLG
FT                   YSPLSIAMLFLFYEIFGVVTNLVGGYLGARLGLNRTMNIGLGLQVAALAMLLVPSSWLV
FT                   VPWVMAAQALSGIAKDLNKMSAKSSVKMLVAKGEEDRLYKYIAVLTGSKNALKGAGFFL
FT                   GGALLALLGFKGAIGLMAALLAIVWLVSIIKLKQDLGKAKNKPKFTELFSKSRAINILS
FT                   AARMCLFAARDVWFVVALPVYLASQFGWDHYQVGGFLALWIIGYGAVQSLAPRVTGKAS
FT                   GQVPDGRSAMWWASALTIIPALIAYLMSGELAALAPGFNLGVLLLGLMLFGAVFAVNSS
FT                   LHSYLIVSYASDDGVSLDVGFYYMANAMGRLLGTILSGWVYQAYGLGACLWISTGLLGL
FT                   TVVISVGLPRR"
FT   gene            475257..475505
FT                   /locus_tag="Shew_0421"
FT   CDS_pept        475257..475505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0421"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: nfa:nfa8710
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22293"
FT                   /db_xref="GOA:A3Q9Z5"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Z5"
FT                   /protein_id="ABO22293.1"
FT                   /translation="MADLEKIKILTRGEKGVIAGVCSGLADYFGWRVNGLRVAFVLSSL
FT                   FFFLPVLVYLVCWLVLPKYPTTQAMRRQLQRKANQAR"
FT   gene            complement(475572..476057)
FT                   /locus_tag="Shew_0422"
FT   CDS_pept        complement(475572..476057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ilo:IL0802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22294"
FT                   /db_xref="GOA:A3Q9Z6"
FT                   /db_xref="InterPro:IPR021329"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Z6"
FT                   /protein_id="ABO22294.1"
FT                   /translation="MSPLIDCLLIGLGATLIMDLWGLVRHPLLGMPLPSYYLVGRWLGH
FT                   MPKGQFRHQAIAKASPVPGETLIGWLAHYLIGVSFAALLLLITGSKWLTSPSLTPALAV
FT                   GLVTVLAPFLLMQPGMGAGIAASRLPNPGQARLHSLITHGVFGLGLYLSALGLRLFN"
FT   gene            476135..476557
FT                   /locus_tag="Shew_0423"
FT   CDS_pept        476135..476557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0423"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: ilo:IL0801
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22295"
FT                   /db_xref="GOA:A3Q9Z7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Z7"
FT                   /protein_id="ABO22295.1"
FT                   /translation="MDISQVAKRSGVPASTLRYYEERGLIRSLGRHGIRRQFGAEVLER
FT                   LALIALGRSAGLSLDEIGSMLATGGDPLIDRELLLRRADELERTILRMQAMRDGLRHAA
FT                   NCTAPSHMECPKFRRLMKAAAAGAFDPQDKPSLPRR"
FT   gene            476762..478135
FT                   /locus_tag="Shew_0424"
FT   CDS_pept        476762..478135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0424"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: sdn:Sden_0649 amino acid
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22296"
FT                   /db_xref="GOA:A3Q9Z8"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Z8"
FT                   /protein_id="ABO22296.1"
FT                   /translation="MEGITEFVSTINGFVWGTPMLVMILGVGLFLSFGLRLMPILKLGT
FT                   GFKLLWSGRIPDKDKQMKGEISPFNALMTSLSATIGTGNIAGVATAIFIGGPGALFWMW
FT                   CTALVGMATKFSEAVLAVKYREVDDNGNHIGGPMYYIKNGLGSKWAWLGTAFALFGSFA
FT                   GFGIGNTVQANSVADALNSNFGVPTWVTGLVLMVLVGAVLMGGIKRIADVAGKLVPLMT
FT                   VFYIAAGLSVIVVNAAAIPDAIALIVHSAFNPVAAQGGFAGAAVWAAVRFGVARGVFSN
FT                   EAGLGSAPIAHAAAQTNNPVAQGLVAMLGTFIDTLVVCTITGLAIVVSGAWTSGENGAA
FT                   LTSYAFSHALPMGNYIVAIALSIFAFTTILGWSVYSEKCVQYLFGVRAVKPFRAIWVIV
FT                   VPLGAVSSLDFIWLLADTLNAMMAIPNLIALSLLSPVVFGLTREYFIKKRQQEAEASS"
FT   gene            complement(478213..479313)
FT                   /locus_tag="Shew_0425"
FT   CDS_pept        complement(478213..479313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0425"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sfr:Sfri_3539
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22297"
FT                   /db_xref="GOA:A3Q9Z9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:A3Q9Z9"
FT                   /protein_id="ABO22297.1"
FT                   /translation="MLLASLRRIKSITTKEIRQLKRDRITFGMVVMIPLIQLLLFGYAI
FT                   NTDVRNVPVVVVDQSHSAAGRWIVEAVKVTQVVSIEKHYASAEEAEAAITRGEVRAALI
FT                   LPPNLTEKLANGETLGQWVVDGSDTMVASAISQLRNMPLDQITGQDTQRLPTFEVALFY
FT                   NPEQRSAVNIVPGLIAVILTMTMILFTSAAIVRERERGNLELLITTPIKPLELMLGKIV
FT                   PYILVGLVQMTIILGLGHLIFDVPINGAIAQLLMGTLLFIAASLTLGLIISTIAKTQLQ
FT                   AMQMTIFIILPTILLSGFMFPFEAMPKPAQWIAELLPATHFMRIIRAIVLRGGALSDMQ
FT                   FDALWLIGFTLVGILVASLRFNKRLD"
FT   gene            complement(479300..480322)
FT                   /locus_tag="Shew_0426"
FT   CDS_pept        complement(479300..480322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0426"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter-related protein; SMART: AAA
FT                   ATPase; KEGG: sfr:Sfri_3538 ABC transporter-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22298"
FT                   /db_xref="GOA:A3QA00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA00"
FT                   /protein_id="ABO22298.1"
FT                   /translation="MPLNADLAIDARGVDKRFGDLLAVAELDLQVQKGHIYGFLGPNGC
FT                   GKSTTIRMLTGLLTPTRGEISVLGMAIPQQAEALRRRIGYMTQKFSLYEDLSVRENLQF
FT                   IADIYGLGARESKRKIDELIDTYHLDAQRQQLAGTLSGGQKQRLGLACACINEPELLFL
FT                   DEPTSAVDPQNRRDFWEQLFDLSERGTSILVTTHYMDEAQRCHQLAIMESGHIRAKGNP
FT                   QALLEAMPLHVIEIAGHRLRQLKSHLSQFSEIPSAAQLGDRLRVLVDKQIADPIPWLLE
FT                   KSRTMTGQLTPEPLSPNQFNASQLKPNQLSLVSPNLEDLFVSVTGKGLKTSREAADVTR
FT                   "
FT   gene            complement(480322..481275)
FT                   /locus_tag="Shew_0427"
FT   CDS_pept        complement(480322..481275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22299"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA01"
FT                   /protein_id="ABO22299.1"
FT                   /translation="MTLSKSLRLIAPLILLLSGCQGAEPPQALGTLERDRVLLRATTSE
FT                   IITGLPKREGSLVTQGELLLQFDTRKQLARVANAQAQWQKAQAYLLRLTNGERPEDIAS
FT                   AQANLERATAAMVQAEKTYRRIDKLKRQNLVSQQELDQAVASRDQTIAEHNAANEALSK
FT                   LIVGVRQEDIQQAQAALDAAAAELDLARQLLEDLSITATRSGRLDSLPFNLGERVPANA
FT                   VVVAIQADKAAYARVYIPAPAMAKLTIGMQLKVHVDGQAQPFTGTLRWLSKEPAFTPYY
FT                   ALNQQDRSRLVYLAEFDLDDRAQSLPTGIPAQVELP"
FT   sig_peptide     complement(481204..481275)
FT                   /locus_tag="Shew_0427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.646 at
FT                   residue 24"
FT   gene            complement(481506..481679)
FT                   /locus_tag="Shew_0428"
FT   CDS_pept        complement(481506..481679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22300"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA02"
FT                   /protein_id="ABO22300.1"
FT                   /translation="MAQLLDVIPNDAEIEAITAPKNPKAACELQHRREVKRRLEELLEE
FT                   AALKRAMGGDFY"
FT   gene            complement(482008..482700)
FT                   /locus_tag="Shew_0429"
FT   CDS_pept        complement(482008..482700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22301"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA03"
FT                   /protein_id="ABO22301.1"
FT                   /translation="MKQALRTLSLLAGTLMVALPASASVTGNIGATSNYLWRGATQTGD
FT                   APAVQGGIDFEHDSGLYLGTWASNVDFGDDTSYEIDFYGGYAGSIGEDFGYDISYLYYA
FT                   YPDSDSSIDFGEVTLALSWKWFSIGYSKVVNAGSDVASAPFDEKDLSYINAGVSFPLSE
FT                   TLSISAHYGYSSGDVVNAWFDTDNYADYSLSLDKETDFGTISFLVSDTDLEDDDPKVVV
FT                   GYSYSFDL"
FT   sig_peptide     complement(482629..482700)
FT                   /locus_tag="Shew_0429"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 24"
FT   gene            complement(482940..483212)
FT                   /locus_tag="Shew_0430"
FT   CDS_pept        complement(482940..483212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0430"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: sfr:Sfri_3532 histone family protein DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22302"
FT                   /db_xref="GOA:A3QA04"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA04"
FT                   /protein_id="ABO22302.1"
FT                   /translation="MNKTELVAKIAESAELTKAEAARALKSFEETVAEAMKNGEKISIV
FT                   GFGSFETTSRAARTGRNPQTGKEIQIPAAVVPKFKAGKTLKDSVN"
FT   gene            complement(483467..483877)
FT                   /locus_tag="Shew_0431"
FT   CDS_pept        complement(483467..483877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22303"
FT                   /db_xref="GOA:A3QA05"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA05"
FT                   /protein_id="ABO22303.1"
FT                   /translation="MNRPSPSILLLIALYIVIAILAGWRALDSQTLDLFTLGVIPVLIG
FT                   LIARTSWASLVLKIYIGIQTLGFTALGATAVIAYQITPEDVKVVVRGQELPIWAIALVV
FT                   TALLSFQWYMAFSKGLKQYLPQAAQTSDQTKA"
FT   sig_peptide     complement(483809..483877)
FT                   /locus_tag="Shew_0431"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.738) with cleavage site probability 0.452 at
FT                   residue 23"
FT   gene            484163..484672
FT                   /locus_tag="Shew_0432"
FT   CDS_pept        484163..484672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22304"
FT                   /db_xref="InterPro:IPR025334"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA06"
FT                   /protein_id="ABO22304.1"
FT                   /translation="MNENEFWQLVTRSKPEQDQESLAAELKAKLNELDNQDLAAFDKFF
FT                   SQQMRRSYLWSLWGAAYIVTGCDSEYGFAEFRAFLISLGQEWFERILLDPDALAELPAW
FT                   PEKDGYAYPFVEDYDLIAGQIYEDRTGEELPFVPSGQATPQGKKFSPKKKQLKATYPQL
FT                   FQLFPF"
FT   gene            complement(484694..485083)
FT                   /locus_tag="Shew_0433"
FT   CDS_pept        complement(484694..485083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22305"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA07"
FT                   /protein_id="ABO22305.1"
FT                   /translation="MKRQQHSGGSKHSPRCRQQIEFKTPTGAMTMSKLTHKRFSGRFAL
FT                   LASLILGFAFISGANANELSDSERAAVEQHFQILDQQQEASDNQTLDGFQADLDSQLEQ
FT                   AEEEFMEGACAEHELTFDSDSQVCY"
FT   sig_peptide     complement(484898..485083)
FT                   /locus_tag="Shew_0433"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.991 at
FT                   residue 62"
FT   gene            complement(485176..485487)
FT                   /locus_tag="Shew_0434"
FT   CDS_pept        complement(485176..485487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22306"
FT                   /db_xref="GOA:A3QA08"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA08"
FT                   /protein_id="ABO22306.1"
FT                   /translation="MQNRSSLLFVVILFSLLAGALYWITIEEETQQAPETWSAFVYAHG
FT                   YNSGRYKKTDDFEDYQSCKAFATEQAKELGDVLWECGLRCRFDNSRQGFQCETMQNQE"
FT   sig_peptide     complement(485425..485487)
FT                   /locus_tag="Shew_0434"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.627 at
FT                   residue 21"
FT   gene            485735..486256
FT                   /locus_tag="Shew_0435"
FT   CDS_pept        485735..486256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22307"
FT                   /db_xref="InterPro:IPR021557"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA09"
FT                   /protein_id="ABO22307.1"
FT                   /translation="MKFQSLLLVGALVSLNLAAEEAKENPVTEAGVVKITWQDTDNYRD
FT                   VKAVGDIQFRYELRVFDTLTKNLNKAAEKTLKPNQKLELVVTDVDLAGDVRPTFGATPN
FT                   DIRLIEDIYPPRMTFSYQVLDGDNVVIAGDEKLRDMSFMHTTGVMNDKPLRHESKMLSD
FT                   WLKKTVQPKL"
FT   sig_peptide     485735..485794
FT                   /locus_tag="Shew_0435"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 20"
FT   gene            complement(486271..488043)
FT                   /locus_tag="Shew_0436"
FT   CDS_pept        complement(486271..488043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0436"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="PFAM: GGDEF domain containing protein; CBS domain
FT                   containing protein; EAL domain protein; KEGG:
FT                   shm:Shewmr7_3475 diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22308"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA10"
FT                   /protein_id="ABO22308.1"
FT                   /translation="MTAIDLSSELDKIIENEKIHVLFQPIFNINSQRLHGFEALSRGPE
FT                   HSALFSPVPLFQTAAHEGRLSELEEICRRHSIRQFDARELPGKLFINISPKALLEPSHA
FT                   KGLTLSLVQELGLSPDQIVIELSEQYPADDIDLLKECLNHYRSQGFLTAIDDLGTGYSG
FT                   LRLWSELAPDYVKIDRHFIHQIDQSPVKQEFVRSIIDLCQSLSCKVIAEGIETPAELAL
FT                   LTQLGIVYCQGYLLGRPQTQPTQTLKAVAPQETKQRQTRYAESAESLSTRTICVTPETK
FT                   LKALSARFVRSPHLQVVAIVDAKQKPLGVVDRAQLMELFSTPYGRALHENSPVIEVMND
FT                   KVLKVPACMPISEVSQCLTAEHGTVAQHFMVMREQQLLGIGHTKDLLQQITEQRIKMAR
FT                   HANPLSGLPGNIPIQEELQRLRQQGRAFYLAYFDLCHFKPYNDIYGFCRGDEVIQSLAL
FT                   RLQQQLGSEHFVGHVGGDDFVVIGTSQAIVDECRRLLLSFNQDREAFYSPDDWLAQCVM
FT                   AEDRQGQRVAHPLISLCVGLLPPEVTRFCDEQGLSAYSAAAKKQAKAALNGFSLFTPAP
FT                   NDAAIAMYRPLKFA"
FT   gene            complement(488177..488488)
FT                   /locus_tag="Shew_0437"
FT   CDS_pept        complement(488177..488488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22309"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA11"
FT                   /protein_id="ABO22309.1"
FT                   /translation="MPHSHLIEQLKENLQLAYRQAIDADAKLDELKKAGHGKFTTIFTQ
FT                   DEGFTSRSNRFGPYVQELADEMTKLPRQGDGLAPALESFVRKLGVLLQTLQAFKSQAK"
FT   gene            488537..489421
FT                   /locus_tag="Shew_0438"
FT   CDS_pept        488537..489421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0438"
FT                   /product="GumN family protein"
FT                   /note="PFAM: GumN family protein; KEGG: son:SO0557
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22310"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA12"
FT                   /protein_id="ABO22310.1"
FT                   /translation="MATSRPRLLTIGILLLTGIMSLSAMAAGDDKPPFYKISYQGKQTF
FT                   LLGSIHIGQAGFYPMAEQIEVAFAKAGALAVEADTNKADIMGLIRKYGLAQVAADAKTQ
FT                   ARLEEYCRTRSEICTPMQPYAPWMQAMQFSVMRFASLGYQAQWGVDQMLLSKNGQRPVI
FT                   ELESTEYQFKLMASFSPQMQWEMVLEAIDAPDEEMVQLIKAWRSGDEAGLDALMQGQML
FT                   HDGDKELIDKMLWQRNEQMTAKIRSLMMQQDGPSPLFVVVGAGHVVGDKGIPAKFAGVE
FT                   GAKVQNCWQTACN"
FT   sig_peptide     488537..488617
FT                   /locus_tag="Shew_0438"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            489529..490161
FT                   /locus_tag="Shew_0439"
FT   CDS_pept        489529..490161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0439"
FT                   /product="CheD, stimulates methylation of MCP proteins"
FT                   /note="PFAM: CheD family protein; KEGG: sde:Sde_3103 CheD,
FT                   stimulates methylation of MCP proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22311"
FT                   /db_xref="GOA:A3QA13"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA13"
FT                   /protein_id="ABO22311.1"
FT                   /translation="MQAEATLFPVRPEFEAIPRQWDSRHDAVVARVDPGNFYVTAHDEL
FT                   IFTRLGSCVAACIWDPLLGIGGLNHFLLPERQLHEDWHQLTSYTCRYGNWAMEQLINSI
FT                   LSLGGMRNRLKAKVFGGAQMTATSVLNVGESNISFVKNYLKTEGIEIVSEDLGGPWPRK
FT                   VLFHPNSGKVKLMRLSPERISKMMSEEQRYLKQIVTAQGESQVELFD"
FT   gene            complement(490170..491024)
FT                   /locus_tag="Shew_0440"
FT   CDS_pept        complement(490170..491024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0440"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: shm:Shewmr7_3472 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22312"
FT                   /db_xref="GOA:A3QA14"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR033664"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA14"
FT                   /protein_id="ABO22312.1"
FT                   /translation="MRVAPAYGKIALLISVSFSHGRHSVQDKNFDALAGKFAKNIYGTP
FT                   KGEVRAAVLWRDISQAMTQLPEGPLRILDAGGGFGFFSQKLAKLGHSVTLCDISSEMLA
FT                   LGQAQITEYENNSGEKLDITLLHAPIQSLTREELGQFDLILCHAVAEWLSDAKQTLAGL
FT                   TQLLKPQGLFSLMFYNKEAMRFHSLISGNFDYVAADFKVKKKVGLTPSYPLYIDDVRGW
FT                   VSDWQMELVTASGVRVIHDYLKTHQPPNSDFSQLLEMELQYSTHPAYIGLGRYVHFITR
FT                   WQR"
FT   gene            491155..491994
FT                   /locus_tag="Shew_0441"
FT   CDS_pept        491155..491994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0441"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   shm:Shewmr7_3471 MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22313"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA15"
FT                   /protein_id="ABO22313.1"
FT                   /translation="MPSLLSLYRKIFFGRKPGWDEQPLPHVKVTCPQVAVRGDKVAQYA
FT                   KVCGFEFDGQQLPLTYLYVMVFRLHASIFTLDAITFPLLGMIHLKNSITRYRTTSVDER
FT                   YDLECELTSSQMTDSGLEFELVSRAFVGGEQVWESLSTYLYRIEQSGKRARPPKASPMS
FT                   WSNPVSWELSEDLGRRYAKASGDYNLIHLHPVLSKRFGFDRVLAHGMWSKARSVAQLMP
FT                   EIGDKPCTVEVAFKLPLLMPAQVSFDFDTESAEGLMFELRDVKGRRPHLTGQVKFHD"
FT   gene            complement(492128..493018)
FT                   /locus_tag="Shew_0442"
FT   CDS_pept        complement(492128..493018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0442"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: she:Shewmr4_0560
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22314"
FT                   /db_xref="GOA:A3QA16"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA16"
FT                   /protein_id="ABO22314.1"
FT                   /translation="MSQQSFTFSPFIAGFWRLDSWQQTPQQTLALIEHYLSLGVTCMDH
FT                   ADIYGEYCCEALFGRALALKPELRQQMQIVTKCGIKPAFASTPERYVNHYDTGYQHILT
FT                   SVDNSLKALRVDEIDLLLIHRPDPLMNADEVAQAFEQLYQTGKVRHFGVSNFTPAQFDL
FT                   LQSRLERPLVTNQLEISPLAMHTLSDGSLDQAQQHRCPPMAWSCLGGGEIFSSQSEQAK
FT                   RLRQTLTKIAADHGTDDISQIIYAWVMALPSQPRPIIGSGNPERISAAVAAGEIKLDRQ
FT                   DWFSIWQASTGHSVP"
FT   gene            493192..494886
FT                   /locus_tag="Shew_0443"
FT   CDS_pept        493192..494886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0443"
FT                   /product="Formate-tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="PFAM: formate-tetrahydrofolate ligase, FTHFS; KEGG:
FT                   son:SO0560 formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22315"
FT                   /db_xref="GOA:A3QA17"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3QA17"
FT                   /protein_id="ABO22315.1"
FT                   /translation="MLTDIEISRQASLQPIESIATAFGILPHELSPYGRTKAKVDLAIT
FT                   NRIKDNKHGKLVIVTAVTPTPFGEGKTVTSIGLTQGLQAIGKKSCACIRQPSMGPVFGI
FT                   KGGAAGGGLAQVVPMEDLNLHLTGDIHAVTSAHNLAAAAIDARLYHEQRLGCEAFREQS
FT                   GLAPLDIDPEKILWRRVVDQNERSLRTITVGLGEVNGPVHQGGFDISAASELMAILALS
FT                   RDLKDLRARIGRIVLAQNKQGDYISAEDLGVAGAMTAIMSQAISPTLMQTLSGAPCLIH
FT                   AGPFANIAHGNSSIIADDIALRLADIVVTEGGFGSDMGFEKFCNIKTRQSGNAPDAAVL
FT                   VVTVKALKSHNPDAGSEMDKLAAGYANLSWHISNVAKYGLPLVVAINRFAEDTQEELEW
FT                   LKARVLQEGVFACEVCEAFTQGAEGAMALARAVVRATEQPSQFRYLYETKQSIEAKLLT
FT                   IAEAGYGANGISLSDTAKAQLAQLQRQGFDKLALCIAKTPMSVSHDPKLKGAPQGFELP
FT                   IAELKLNAGAGFITALVGKVMTMPGLGIRPGYLNIDIDERGEITGLA"
FT   gene            complement(495031..496653)
FT                   /locus_tag="Shew_0444"
FT   CDS_pept        complement(495031..496653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0444"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   shm:Shewmr7_3468 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22316"
FT                   /db_xref="GOA:A3QA18"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA18"
FT                   /protein_id="ABO22316.1"
FT                   /translation="MLRNLALALVTMMALAHLPATADEALQTPQPLTELTQLQQTIDSD
FT                   IAKLGNANGEMKQFIEYRIKEHANQLHDKFKLMMNQQPLDKANLLPLLQKHLAFIDKVA
FT                   DYYAADIDQFKQQLGSDNDTGVMYKLAMRDRQRDEILSAKYETLTWLDALGEDTQAIKT
FT                   QLTAQLLKRSDMLNSLVHFTQDKLKLAVDEAAKAGKDVTAEQTALVTNLNERLSLTSAS
FT                   LSVAIELLDAMSQDTTALKQTLFSISGDITQDVLNVDVASNLLDQWWNQAKNQALDNGP
FT                   GLLFKLFVFLLILFLAHLAGKAVQRIVKKMVSNSKLKFSKLLQDFFVSLSGKTVFALGL
FT                   MIALSQLGFELGPLLAGFGVAGVIIGFALQDTLSNFASGMMILIYRPYDVGDLINAAGV
FT                   TGKVSQMSLVSTTIKTLDNQRLIIPNNKIWGDTINNITVEHQRRVDMTFGIGYGDNIEK
FT                   AEQVLRGIVDEHPKVLKQPEPTVKLHLLGESSVDFVVRPWVKPEDYWDVYWDITRAVKM
FT                   RFDQEDISIPFPQRDVHIYQTGK"
FT   sig_peptide     complement(496585..496653)
FT                   /locus_tag="Shew_0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            496778..497113
FT                   /locus_tag="Shew_0445"
FT   CDS_pept        496778..497113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22317"
FT                   /db_xref="GOA:A3QA19"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA19"
FT                   /protein_id="ABO22317.1"
FT                   /translation="MLCPHCSHPFRAQQVAAQRGKGLDAQIQCPHCEAWLGRSANLMRL
FT                   KMLGFYLGLVMLVVGYFLPEWRNLTTPVAIFAVMILLVTHMMDHLKVNQAPPRQEMDDS
FT                   EHRQKYR"
FT   gene            497660..497920
FT                   /locus_tag="Shew_0446"
FT   CDS_pept        497660..497920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22318"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA20"
FT                   /protein_id="ABO22318.1"
FT                   /translation="MAIWLSAILFCLSVLAPAHSLEHLDEGATTHCTLCIQKLQLNSVL
FT                   PVGEFSFSLPSLTVEVPLREPTVLAAVHVDYFQSRAPPAQS"
FT   sig_peptide     497660..497722
FT                   /locus_tag="Shew_0446"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.760 at
FT                   residue 21"
FT   gene            497998..499203
FT                   /locus_tag="Shew_0447"
FT   CDS_pept        497998..499203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22319"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA21"
FT                   /protein_id="ABO22319.1"
FT                   /translation="MMNFNARLSAVALACACLPSLMPSLSFAADPSLTNPAISAVLDGY
FT                   YQNAERPMAERVEGFGLGHTELALSANIDDMFYGKLTTVIEVADGETKVGLEEAFIQTL
FT                   AMPYGLSMRGGRFLSDVGYLNNQHVHSDAFSDRPAAYRAFLGGHYFDDGVRLDYVAPTD
FT                   LYWSMGVEAFKGDNMRAEDEHGEREFKSVGVYTAYTKLGGDIGVSSSWQLGLSYLRNEN
FT                   GRLSAHEEHEEAVVAEDGHDHSHGVSYTGENTYMADFVYKWAPQGNYKYQHLTLSGEYF
FT                   RVSDYAPLDDHDHEAVDDHDTAKPDAHTGWYLSSVYQFSPNWSAGLRYGQVDTHLMHDE
FT                   HFDAQKLKETEVSLAWHHSHFSTVRLQYTNQQGTNFDGITDDNVITLQYVMTLGAHGAH
FT                   QF"
FT   sig_peptide     497998..498084
FT                   /locus_tag="Shew_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            499187..500098
FT                   /locus_tag="Shew_0448"
FT   CDS_pept        499187..500098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0448"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   shm:Shewmr7_3463 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22320"
FT                   /db_xref="GOA:A3QA22"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA22"
FT                   /protein_id="ABO22320.1"
FT                   /translation="MRINSNYLKAGVAALALSFACGAQAKLNIFACEPEYAALAKELAP
FT                   DAKIYAATTAMQDPHQVQARPSLIAKMRQADLAVCAGADLEVGWLPMLQMKSANAQVRS
FT                   TDKGLFYAAEHTQTLDKLAQVDRSMGDVHAQGNPHLHFDPERLLEVAKALSAKMVSLDP
FT                   DNRAAYESALADFSQRWQAAIAGWQSQAAPLKGKKVIAYHTSFRYLFNWLGMEQVGDLE
FT                   PKPGLPPSTGHLASLQGRAGQGDVMAIIVASYQDERGANWLGERTGLPVVNLPMSVGGN
FT                   DDAQNLFGLYDSVIHLLLGVNR"
FT   sig_peptide     499187..499264
FT                   /locus_tag="Shew_0448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 26"
FT   gene            500159..500950
FT                   /locus_tag="Shew_0449"
FT   CDS_pept        500159..500950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0449"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: shm:Shewmr7_3462 ABC-3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22321"
FT                   /db_xref="GOA:A3QA23"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA23"
FT                   /protein_id="ABO22321.1"
FT                   /translation="MFDLDLLSILLPAFAAGILVLSTHVLLGSQVLKRGIIFIDLAIAQ
FT                   VAALGAIIAHTNHELEHLPYATVWMPALFALLGAGFIAWLAKRMADELEAIIGCFYVLS
FT                   AVAAMLLLSNDPHGAEMLKQLMSGQILWVNWSQLVLPAVVSGLVLAIIALRPTILNGAG
FT                   FYLLFALVITLSVELVGVYLVFSSLILPALAVNKLRGKGKWPLAYLVGLLGYGIGLLLS
FT                   ASFDLPSGAAIVATLAVSTIAFRLLQPRLLRESSITKVEAN"
FT   gene            501186..501920
FT                   /locus_tag="Shew_0450"
FT   CDS_pept        501186..501920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0450"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="KEGG: son:SO0567 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferases; PFAM: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22322"
FT                   /db_xref="GOA:A3QA24"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA24"
FT                   /protein_id="ABO22322.1"
FT                   /translation="MLLIFRSLILAIMLLLAFVFGGLYCLLRPRHRDNVHLFAKIFSWA
FT                   APVLGVKVVVRKPKVERSEPCIFLANHQNNFDMFTHTAAVPKGTVSLGKKSLAWIPFFG
FT                   QIYWLSGNILIDRKNRNRAFETMAQTAKKIKDKCLSIWIFPEGTRSRGKGLLPFKAGAF
FT                   HTAIEAGVAMVPVLASNQEHIKLNRWNNGVVIIEVMDPIETKGLAKSQVKELSTRIHAM
FT                   MAEKLAQLNQEASALMAKKAIN"
FT   sig_peptide     501186..501251
FT                   /locus_tag="Shew_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.597 at
FT                   residue 22"
FT   gene            501945..502352
FT                   /locus_tag="Shew_0451"
FT   CDS_pept        501945..502352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0451"
FT                   /product="protein of unknown function DUF1260"
FT                   /note="PFAM: protein of unknown function DUF1260; KEGG:
FT                   sfr:Sfri_3513 protein of unknown function DUF1260"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22323"
FT                   /db_xref="GOA:A3QA25"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA25"
FT                   /protein_id="ABO22323.1"
FT                   /translation="MSTERQLQEQKQENQEIVDAILADGSEPDAEYTIEHHFSASNFDR
FT                   LEKAAVEAFKLGFEVNDAEEMELEDGSVLFCFDAIAYHKLDVALLDKACEDLIQLAAKL
FT                   KVDYDGWGTYFIGDEMEDDDEEYEEEDSRFH"
FT   gene            complement(502430..503401)
FT                   /locus_tag="Shew_0452"
FT   CDS_pept        complement(502430..503401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0452"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: sfr:Sfri_3512 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22324"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA26"
FT                   /protein_id="ABO22324.1"
FT                   /translation="MPYDQSAMNELHWLIDMVQTIEVGLVVLDRDYNIQLWNGFMENHS
FT                   GISPNSIKGKNIFDQFDYLPANWLKQKMESVFLLKNRAFISWEQRPYVFKFGNYRPITG
FT                   RADFMYQNVTLLPLSSLTGQITHISMIIYDVTDVAINKLQLKAANERLEHLSQTDGLTQ
FT                   LHNRRHWQLCMQKEFDRHARYGEPTTLVMFDIDHFKRINDTYGHIAGDRVIQHVSHILR
FT                   QSLRDTDCAGRYGGEEFSVVLSNTNAEAALHFADRLREKIEASELRFESAILKVTVSIG
FT                   ICGIDEHLSNSAQWLGQADSALYQAKQKGRNCCVIFNPDEAE"
FT   gene            complement(503415..504410)
FT                   /locus_tag="Shew_0453"
FT   CDS_pept        complement(503415..504410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0453"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   shm:Shewmr7_3458 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22325"
FT                   /db_xref="GOA:A3QA27"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA27"
FT                   /protein_id="ABO22325.1"
FT                   /translation="MSIPVLICDDSALARKQMARTLPKEWDVEITFANNGAEGIEAIRA
FT                   GKGEVVFLDLNMPVMDGYEVLETIQKEDLPALVIVVSGDIQIKAHEKVKALGALDFIQK
FT                   PVSADAISNILQEYGILTIALGEQDNDNPMIEVDLRDACQEVANVAMGRAADLLAKLLD
FT                   VFVLLPIPNVNVLEVSELTMTLKATERYSTVSALCQGFIGAGVAGEALLLFHDSSFQDM
FT                   AKLMGLANPEDANTEIEVMIDTGNVLIGAFLSGISEQLHMKFSQSHPVVLGRHCTVNDL
FT                   IHDNSEKWSRTLAMEINYRIEGHDIQCDLLLLFTEDSLPTLNYKLGYLLD"
FT   gene            504816..505625
FT                   /locus_tag="Shew_0454"
FT   CDS_pept        504816..505625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0454"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   sfr:Sfri_3510 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22326"
FT                   /db_xref="GOA:A3QA28"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA28"
FT                   /protein_id="ABO22326.1"
FT                   /translation="MQHPHVTLTIAEGIAWVELSRPEKYNALNYALFDSIVKVQKVIAG
FT                   RRDVRAVILSGSGGNFCSGLDVASVMKSPMQAFKLLFKWLPGNANLAQRVSIGWRRLPV
FT                   PVICVLEGICYGGGTQIALGADMRIAAPDCRLSIMEAKWGLVPDMAGLVGLRELVGKDV
FT                   AMQLTMTAEVIDAEQAKDYGLVTQVSEAPREAAEALALRLAKTSPDANAAIKFSINKSW
FT                   RAGERSLLARESLSQVRLLLGKNRVIAALRQTKDPERRYRPRQPWWR"
FT   gene            505791..506294
FT                   /locus_tag="Shew_0455"
FT   CDS_pept        505791..506294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0455"
FT                   /product="uncharacterized protein UPF0114"
FT                   /note="PFAM: uncharacterized protein UPF0114; KEGG:
FT                   cps:CPS_1797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22327"
FT                   /db_xref="GOA:A3QA29"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA29"
FT                   /protein_id="ABO22327.1"
FT                   /translation="MIMRQGFERFLWSSRLSVMIGVFACVLAAFVVFVMGVKDVVHMVA
FT                   LLWDYVLTGSYEVRNDLVMVVVEILDTFLLGSVLLIFAFGLYELFISNLQAAEDSVAGG
FT                   KILVISSIDSLKSKLGKVILMMLIIKVFSYFTEMKPTSMLELLYMGVIVVLIALALMLS
FT                   KDKK"
FT   sig_peptide     505791..505895
FT                   /locus_tag="Shew_0455"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.881) with cleavage site probability 0.472 at
FT                   residue 35"
FT   gene            complement(506342..507226)
FT                   /locus_tag="Shew_0456"
FT   CDS_pept        complement(506342..507226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22328"
FT                   /db_xref="InterPro:IPR022529"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA30"
FT                   /protein_id="ABO22328.1"
FT                   /translation="MPMILRSTQLSLALLALMSQALIPAMAIAQRSTTPDYDYLPPAEV
FT                   AKITLGDAEQAVLVRPWQGRNQYGAAVLLGDLGEDADPEGLLAFLRRELTPKGWATLSI
FT                   GAPQGAAQPNHITDAGEIPKPGEQQLSQKSNQSLPKYSQEDWAALREQQKTVMSQTLGQ
FT                   LDSLGKSYPGKRILIVTGQSAGLVIEMLTTSALPSPDLLVVINPYLEQDEENRDLPGKL
FT                   AKLELPVLDIQSPDGLPASLATQKARKALSPMGEPLRYEQQQLALNLDQPSAWQDVLTL
FT                   VQGFAQRILRAYP"
FT   sig_peptide     complement(507137..507226)
FT                   /locus_tag="Shew_0456"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.725 at
FT                   residue 30"
FT   gene            complement(507362..510268)
FT                   /locus_tag="Shew_0457"
FT   CDS_pept        complement(507362..510268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0457"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: shm:Shewmr7_3455
FT                   SNF2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22329"
FT                   /db_xref="GOA:A3QA31"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3QA31"
FT                   /protein_id="ABO22329.1"
FT                   /translation="MPFSLGQRWISDTESELGLGTVIGLEGRMVTLMFPATDENRMFAR
FT                   DDAPLTRVIYNPGDIIESHEGWSLKVSEIEEKNQLVIYHGIHTETGEEVSLRETLLNHN
FT                   IRFNKPQDRLFAGQIDRLDRFGVRYQSQLLRHKLATSDLLGLQGPRVGLIPHQQWIAHE
FT                   VGQRFAPRVLLADEVGLGKTIEAGLIIHQQLLTGRAERILIIVPDTLRHQWLVEMLRRF
FT                   NLRFSVFDEDRCVEAYADHDNPFYTEQLVICSLELLRKKKRLDQALDADWDLMVVDEAH
FT                   HLEWTEEEPSRAYRVVEALSEVVPGVLLLTATPDQLGHQSHFARLRLLDPDRFYDYQAF
FT                   LKEEESYKEVASAADALASGKRLPDEAVASLTELLNEKDITPALRLIEDESVDNEQRDQ
FT                   ARSELLQELLDRHGTGRVLYRNSRASVKGFPTRIFNAHPQTMPAQYKTAARVSDMMGGQ
FT                   TDLTAKVKQALSPEKLYQAFESDSASWWKFDPRVDWLIDFLKNHRSKKVLIIASQAETA
FT                   LSLEEALRTREGIQATVFHEGMSIIERDKAGAYFAQESGGAQALICSEIGSEGRNFQFA
FT                   SHLVLFDLPLNPDLLEQRIGRLDRIGQANDVEIHLPYLANTAQENLMNWYHKGLNAFEQ
FT                   TCPTGHILFNEFSEELLTQLVYRDEDKFTQLLNHTQSRYKALKKAMEQGRDKLLEINSH
FT                   GGDKAQKLVENLAARDQDTQLIGSVIRLWDIIGVEQEDSGENAIVLHPSEHMMFPTYPG
FT                   LPEDGITVTFDREMALSRDDIALITQEHPLVQTGLDLITSSETGTTSVAVLKNKALPAG
FT                   TIFLELIYMADASAPRSSQLYRYMPPTPVRVLLDKNGNNLSQNVSYESFDKQLSAVNRH
FT                   IASKLVNASQTLLHPLFAKGEEFAQAAMKQLTEEASNKMTQQLTAELERLEALKAVNPN
FT                   IRDEELEHLRNQMVELGNYLDACQLQLDAVRLVLVSHA"
FT   gene            510634..512028
FT                   /locus_tag="Shew_0458"
FT   CDS_pept        510634..512028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0458"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; SMART: AAA ATPase;
FT                   Nucleotide binding protein, PINc; KEGG: son:SO0576 PhoH
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22330"
FT                   /db_xref="GOA:A3QA32"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA32"
FT                   /protein_id="ABO22330.1"
FT                   /translation="MEQDDKKLFVLDTNVLLHEPLAIYSFKEHDVVVPMTVLEELDQIK
FT                   DRKRDVSRDARVAIRALEDILGGQTTPEEIVSGVPLPKREGHGDAVGSLSIFPDHQLEF
FT                   TQASLPGDNNDNRIINTALHLQNQFAPRHVVLVTKDINMRLKAKGAGINLVEDYRTDQL
FT                   IDDIRFLTKGFHQFEGDFWARKEHVNTETQGRHTVHRVPVKEVGEENFYTNQYLIDEDS
FT                   NFCGRVLSNNDEELEILDLGRDRLLNLDAWGIKPKNVYQGMAMQALLDPDIDLVILTGP
FT                   AGCGKTLLAMAAALEMVVERGLYDKVIVTRNTPEIAESIGFLPGTEEEKMAPWLAAITD
FT                   TLEVLHKHDVNPSGSMNYIMDKANIQFKSINFMRGRSIQNSVVLLDECQNLTASQIKTM
FT                   ITRMGEGTKLICSGNLAQIDSNYLTAVTSGLTYIVERFKNFDGSANIYLNGVVRSRLAE
FT                   FAEENL"
FT   gene            512269..515961
FT                   /locus_tag="Shew_0459"
FT   CDS_pept        512269..515961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0459"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="KEGG: she:Shewmr4_0577 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22331"
FT                   /db_xref="GOA:A3QA33"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA33"
FT                   /protein_id="ABO22331.1"
FT                   /translation="MKSTEPDLQLKSPIQKNYNRAVFYTYIGVIIMALLTAWIFFERQK
FT                   TQMMDQREELVERHVLQIDLLLESSIRAVKSLRNVAVDHLRLGELVRTDRLPQYEKFNE
FT                   SGQFFTLEPSYAQSGKPFTNMGRITGAGSLNGRSDKFYQELEMLFELSLSFPVARQAAP
FT                   KASSIYYISKHRMMSYYPWPSDEQRFRDELLKKQQFQLVTPAMNPQRSVAWSPAYVEPN
FT                   GKGLLTTVGVPIYLEDEFIGSINLDMTLSSLDKQIRLYFKMPGTVILLDQQNNILSHSD
FT                   IDAADINRVFHISQKIPSALHSVPESELFDAHEGIMRNGYYIHSVALQNAPWRLLYLQD
FT                   ENELFKDSWEKLELTFLLVVIALSVLVTIVHWQTRRSFVNPASRLLSHLEGCSQEPRKP
FT                   PAKITQGWEPWFQLVSRIFEENQQYTRHLAEQNRRLDNLVARRTERLKETTERREREYA
FT                   LLRSLLDSIPEAIIFKDKEGKYLGCNKSAERMLGYTESEMIGQDSQTMTSNEQSMRIRA
FT                   EDERVLSERTPLRYQEKVELAGKPVLLDTLKLPFYNRRGELLGLIAVWRDVTREYESAE
FT                   QLRLSEERYHLAMDAVEDGLWDWYLDSEQIICNPAYYSMLGYKSNEFPALVSTIDELVH
FT                   PDDRIRVQEYREQYLADPIGAYDVEFRMRGKSGMYHWVLSRGRVVEFTSDNQPKRMVGT
FT                   HKDITRHKSNEVALLEAKQDAESANLYKSEFLANMSHEIRTPMNAIIGMLQLASRTQLT
FT                   PQQADYLDKAGFSAQSLLRIINDILDFSKIEAGKLELERVAFPLDKVLDHALDLNALKA
FT                   QEKGVELLLYAPVTAGLILEGDPLRLGQVLINMLSNAVKFTQSGEIELGCEDVGERDHR
FT                   ITLKFWVRDTGIGISKEQQESLFDAFAQADGSTTRKYGGTGLGLSISKHLVSMMGGTMQ
FT                   VQSELGVGSTFSFTISFEIAEEAEVKPLIVPEVIGNLKTLVVDDNPTALQIYSTAMRDF
FT                   HFDVDTASNGAEALYKLEHRPVDLLLLDWMMPEMDGVEVIKALDAMVADGRLEKRPVII
FT                   MMTAYASEPLKEDLDDLDIYAMLQKPFKASALFDEIIAAFIDKPKINPAAALPVEGNAT
FT                   GTGQILLVEDNFINQQVATELLKSAGYEVDVAENGQVALDMVDAKQYDAVLMDIQMPVM
FT                   DGLTATKELRKRYTKEELPVIAMTAHAMSGDREKSLAAGMNAHITKPIVLNELFDTLAQ
FT                   WIVRH"
FT   gene            516184..518583
FT                   /locus_tag="Shew_0460"
FT   CDS_pept        516184..518583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22332"
FT                   /db_xref="GOA:A3QA34"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR032534"
FT                   /db_xref="InterPro:IPR033413"
FT                   /db_xref="InterPro:IPR034032"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA34"
FT                   /protein_id="ABO22332.1"
FT                   /translation="MRPSTLALALALILVPTGPLLAVENSAKVIKSSQAANGFINLFYQ
FT                   QGSGDLYLEATRLNQPFLLVTSLPHGVGSNDIGLDRGQLGMTRLVQFERHGPYLILKQL
FT                   NTRYRATTDNGAEQRAVKEAFAESVLWRGKLLEGKQALVSINDLVLRDLHGIADTLEQT
FT                   KQGHYQLDKETSLILPQGVKSFERNSDVDVLLTFKGAKAGPQVAEVTPDGKQMSLRMRY
FT                   SFVELPDDNYQPRSYHPNSGYLSDEYLDYGAPIDKDIVQRHLLRHRLQKVTPGDAPSEV
FT                   VKPIIYYLDPGVPEPIRSALLEGARWWETAFNEAGFINGFKVELLPEDADPQDIRYNVI
FT                   QWVHRATRGWSYGSAIADPRTGEIIKGHVTLGSQRVRQDHLIARGLTAGWQDREAAAQA
FT                   VTELSLARIRQLSAHEVGHTLGLDHNFAASSNDNASVMDYPHPKATLKGDKIDISAPYD
FT                   EGVGAWDKFTVAYGYGQFSQEDQQAKLTELMQAVERQGLRYIGEADSRRAGASHAYASL
FT                   WDNGQDPVAELSRLAKVREVAIDGFSDAALLKGQPYGELRDAFVPIYLLTRYQIEAAAK
FT                   FIGGTDYTYSTQEGGRSWHYMAPELQKNALEGLLQGLSVDALALPTKVTDALVPKSGNY
FT                   GATRESFDSATGVVIDPIGMAEVLSRHTCGQLLQPMRLNRVNQGYFADKEQLSVVTLVN
FT                   KLLAKTVFADAPNGPSQGVWMRVNAVVLDALLASYHDGASSPEVKAQLAGRLAFAQKQL
FT                   SRLVKRSSDYEAAHYQWLLDGLEKGLKDSKYKLIHKPLAMPPGSPI"
FT   sig_peptide     516184..516252
FT                   /locus_tag="Shew_0460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(518656..519195)
FT                   /locus_tag="Shew_0461"
FT   CDS_pept        complement(518656..519195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22333"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA35"
FT                   /protein_id="ABO22333.1"
FT                   /translation="MSHLIKLAALVAALYFGYQHWFAPYPLQTYRLTSVPVSLKLLPDP
FT                   KVLHKQNTQVEFESLNTQKKADDKLTMFVMTFKSSMERFEPEDLEFLPYEMDKYTSMAG
FT                   PEVAAILEELILSKGYINTNGMRGYEVEMRLPKDDTRMLQHIYIIDDHLLLLMASYQSS
FT                   REEQTARNFLDSVQRL"
FT   gene            519508..519813
FT                   /locus_tag="Shew_0462"
FT   CDS_pept        519508..519813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22334"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA36"
FT                   /protein_id="ABO22334.1"
FT                   /translation="MKLLASTTLALASLLLTTQAFAERPDFSKTAAARADYLFANNPSA
FT                   QLDQVQRSSSRHDFSKTTAANSEYRFADNPPADETELEPRTTQHDFSRTEAARKQS"
FT   sig_peptide     519508..519576
FT                   /locus_tag="Shew_0462"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(519932..520315)
FT                   /locus_tag="Shew_0463"
FT   CDS_pept        complement(519932..520315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22335"
FT                   /db_xref="GOA:A3QA37"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA37"
FT                   /protein_id="ABO22335.1"
FT                   /translation="MNKAIISTLLSAFVCPGSGHFYLKRYNAGTLISCISLSGLAYLLY
FT                   QAVNRAVTVSDQILSGELPLDYGAIYAAISQAPQGGEAFWVEAATWAFILGWLIGIIDA
FT                   YRQGRKLMRLEARQGETHAEANR"
FT   gene            complement(520368..520751)
FT                   /locus_tag="Shew_0464"
FT   CDS_pept        complement(520368..520751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22336"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA38"
FT                   /protein_id="ABO22336.1"
FT                   /translation="MARLFLFTLFAASLLITGILSGCANGHGQAQDPSQTQSQSSHQAE
FT                   QQELGAMVQALQQAIATPSPEQLEVIARYGTDSRYYVMVRGWLVQELSGIESQLAAQGD
FT                   GAPETMRAKAEHLRAAIRRIDLE"
FT   sig_peptide     complement(520671..520751)
FT                   /locus_tag="Shew_0464"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.729 at
FT                   residue 27"
FT   gene            complement(520912..521322)
FT                   /locus_tag="Shew_0465"
FT   CDS_pept        complement(520912..521322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rba:RB544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22337"
FT                   /db_xref="GOA:A3QA39"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA39"
FT                   /protein_id="ABO22337.1"
FT                   /translation="MYAHHSIDRRLLLVAALAATALLGCERPVSFSSEVQPILNASCIS
FT                   CHSGAGEGMAKTHLALDSYQGVMRGTQLGPVVVPGSSASSTLYLAIDHKVDSKIQMPPH
FT                   HSDKFAQGEGKPLSSEQIALIKRWIDEGAKQN"
FT   sig_peptide     complement(521248..521322)
FT                   /locus_tag="Shew_0465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.505 at
FT                   residue 25"
FT   gene            complement(521519..524593)
FT                   /locus_tag="Shew_0466"
FT   CDS_pept        complement(521519..524593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0466"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   shm:Shewmr7_0550 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22338"
FT                   /db_xref="GOA:A3QA40"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA40"
FT                   /protein_id="ABO22338.1"
FT                   /translation="MNFAEYSITHKVVSWMFALLLLIGGSLSFMSLGQLEFPEFTIKEA
FT                   LVVTAYPGASPEQVEEEVTLPLEDALQQLDGVKHITSINSAGLSQIQIEMEDKYDAEKL
FT                   PQIWDLVRRKVSDTQGSLPSGAMTPQVIDDFGDVYGILLNLSGDGYSERELENYADFLR
FT                   RELVLVDGIKRVNIAGIVDQQVVVEISTQKINALGLNQDYIYGLINSQNVVSNAGSIRV
FT                   GDNRIRIHPTGEFDSVEALSRLVVSAPGSAKLIYLGDIANIYKAMDETPSNLYHSGGDM
FT                   ALSVGIAFSSGVNVVKVGEAVNQKMMALSDELPVGMMLTTVYDQSKMVDQTINGFLVNL
FT                   AESIAIVIGVLLIFMGLRSGLLMGLVLLLTILGTFIMMKVLNIELQIISLGALIIALGM
FT                   LVDNAIVVTEGIIIGLKRGQSRLETAKQVITQTQWPLLGATVIAIIAFAPIGLSDNATG
FT                   EFCISLFLVLLISLFISWITAMTLTPFFCDLLFKDGEIPDEADSDPYKGWLFQLYRGSL
FT                   SLAMRFRGLTLLVVLLALVGSVMGFGQVKNVFFPASNTPIFFVDVWMPEGSDIKATEAL
FT                   LGRIEQDLMAEQEKQDLGLVNITSVVGQGAQRFVLPYVPEKGYAAYGQLLIEMSNLETL
FT                   NAYMRRLEQDLVQHYPEAEYRFKYMENGPSPAAKIEARFYGEDPEVLRQLAQQASEIFL
FT                   AEPSATSVRHNWRNQVTLVRPQLALAQARETGISKQDLDNALLTNFSGKHVGLYRENSH
FT                   LLPIIARAPADERLNADSISALQVWSTENNVFVPISQVVSDFTTEWEDPLIMRRDRKRV
FT                   ISVLADPLNGGNETADSVFRKLRPKVEAISLPAGYELEWGGEYETSSEAQQSVFSSIPL
FT                   GYLAMFLITVLLFNSVRQPLVIWFTVPLALIGVVSGLLLFDAPFSFMALLGLLSLTGMI
FT                   IKNGIVLVDQINLELSQGKDAYRAVFDSSVSRVRPVLMAAITTMLGMIPLLPDAFFGSM
FT                   AITIIFGLGFASVLTLVVLPVAYTLVFGIKVPKTA"
FT   sig_peptide     complement(524492..524593)
FT                   /locus_tag="Shew_0466"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.896 at
FT                   residue 34"
FT   gene            complement(524597..525679)
FT                   /locus_tag="Shew_0467"
FT   CDS_pept        complement(524597..525679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0467"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   she:Shewmr4_3401 efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22339"
FT                   /db_xref="GOA:A3QA41"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA41"
FT                   /protein_id="ABO22339.1"
FT                   /translation="MKPLTTSLSLLVLTLVLAGCSTESAEIAPESVRPVKLLEITELGS
FT                   GTLRSFPAKVAATKQAELSFRLSGQLIEFSLVDGQRVTKGEVLARLDDRDARNQLLNRE
FT                   ADHELAQADFNRKGELLRQALISQAEYDLAKAQLKSSAANLASAQDQLSYTVIKAPFSG
FT                   TVAKTKIENFQIVQANQPVLVLQKDRFIDVVIQVPESLASRVTSFNPHSPSLPMVTFSN
FT                   HPEQQYAARLKEFATQVTPGTQSYEVVFTLPTPTEFSVLPGMSAQLILDIAGPDAKKKS
FT                   AIVPPSAVLKRDQDGEPIVWTYDLGTGQVSARKVSLGKVTSQGIEITQGLTVGDRVVVA
FT                   GVAQLHESQQVKPLRWQRGV"
FT   sig_peptide     complement(525602..525679)
FT                   /locus_tag="Shew_0467"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.764 at
FT                   residue 26"
FT   gene            525876..526820
FT                   /locus_tag="Shew_0468"
FT   CDS_pept        525876..526820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0468"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: sfr:Sfri_1434 transcriptional
FT                   regulator, LysR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22340"
FT                   /db_xref="GOA:A3QA42"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA42"
FT                   /protein_id="ABO22340.1"
FT                   /translation="MKTEDIALFHRIVETGSLVEAADILNVPKSTLSRRLQTLEDELNV
FT                   KLFHRQSRAMTLTASGSHFYNKTTPLLATLEQTFSELSGKEAAVTGHLRILIFPIPELL
FT                   YITQAIFEFMDLNPALTVEIIVSSEPKDMIRNNIDLAFMLEDAFNENEMVARHIISEFV
FT                   HFFASPEYLERAGKPTKPEELPEHNSILFRYPNGRIFNEVPFGKDRILSVTGNLCVNSL
FT                   STCLEAALMGRGIAMMPLPIAREYVENGKLVMLFEDIEPYEGKCFLVYPSRRFISLASQ
FT                   RFIDHVLRALDECLQNGACDREARTKGAIKPLI"
FT   gene            complement(526823..527494)
FT                   /locus_tag="Shew_0469"
FT   CDS_pept        complement(526823..527494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0469"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   ppr:PBPRB0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22341"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA43"
FT                   /protein_id="ABO22341.1"
FT                   /translation="MDDLQHETLERDYFEHDFSGKDLQGLLFRRCRFVRCSFNRADLTD
FT                   CHFKQCQFVEPGDLLGCDFSYATLINAKFSDCRLNLARFTGARCFGAEFRASNLQGADF
FT                   YRASFANQIGINHYFCSAVFSGCNLAYGNLSQVILEECELTDNRWRGANLTGASLKGSD
FT                   LSGGEFSPELWGEFDLRGANLTRVDLEGLDPREVALEGVMIDAWQQSQLLAPFGLIVCG
FT                   E"
FT   gene            complement(527511..528878)
FT                   /locus_tag="Shew_0470"
FT   CDS_pept        complement(527511..528878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0470"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG:
FT                   she:Shewmr4_3399 MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22342"
FT                   /db_xref="GOA:A3QA44"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA44"
FT                   /protein_id="ABO22342.1"
FT                   /translation="MRDRHGLLSQPIGRVLLNMSLPNLIGILTILGFSLVDTFFISQLG
FT                   TEALAAISFTFPVTLIVSSIAIGIGAGVSTNLGRLIGSGNSPKAKVFLHDALLITFWLI
FT                   AALSLLGSLFIGPLFTLLGANDDSLPLIRDYMFLWYLGAPLLVLLMVGNQGLRATGDTK
FT                   SPAKIMALAAVINLVLDPLLIFGLGPFPRLEIQGAAIATLISWVVALSLSGYLLIIKRN
FT                   LVDFAEFNLERIHCNWRQLAHIAQPAALMNLLNPVANAIIMAMLARIDHSAVAAFGAGT
FT                   RLESVLLIAVMALSSSLVPFIAQNLGAGQTERARDALMLSLRFVLVFQTLIYLPLALMA
FT                   TPIAQLFSKDPQVIEWLSFYIIALPAAYGPLGMVILTATSLNAYHRPMSSLVLNVCRLF
FT                   LLLLPLAALGSYLGGVKGLLLALPITNAVMGIACYILASRITEPDTTPKHVEIYKR"
FT   gene            529106..529396
FT                   /locus_tag="Shew_0471"
FT   CDS_pept        529106..529396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0471"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: sdn:Sden_0421
FT                   chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22343"
FT                   /db_xref="GOA:A3QA45"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3QA45"
FT                   /protein_id="ABO22343.1"
FT                   /translation="MNIRPLHDRVIVKRSEVESKSAGGIVLTGSAAEQSTRGEVLAVGN
FT                   GRILENGTVQPLDVKVGDIVIFNEGYGVKKEKIDGQEVLILSESDLMAVVE"
FT   gene            529453..531102
FT                   /locus_tag="Shew_0472"
FT   CDS_pept        529453..531102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0472"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: son:SO0704 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22344"
FT                   /db_xref="GOA:A3QA46"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3QA46"
FT                   /protein_id="ABO22344.1"
FT                   /translation="MAAKEVLFGNDARVKMLAGVNVLANAVKVTLGPKGRNVVLDKSFG
FT                   APLITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVTEGL
FT                   KAVAAGMNPMDLKRGIDKAVVAAVAELKTLSQECSDTKAIAQVGTISANSDESIGEIIA
FT                   TAMEKVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSVELENPYILL
FT                   VDKKISNIRELLPILEGLAKTGKPLMIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIAILTGGTVIAEEIGLELEKATLEDLGTAKRVVITKDDTTIIDGTGEQE
FT                   QISARVAQIKIQAEESTSDYDREKLQERMAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALIRVASKIGELDVANEDQKHGVTIALRAMEAPLRQIATNA
FT                   GEEASVVANNVKNGSGNYGYNAGSDVYGDMLEMGILDPTKVTRSALQFASSIAGLMITT
FT                   EAMVGDVPQEAGAGDMGGMGGGMGGMGGMGMM"
FT   gene            complement(531629..532156)
FT                   /locus_tag="Shew_0473"
FT   CDS_pept        complement(531629..532156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22345"
FT                   /db_xref="GOA:A3QA47"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA47"
FT                   /protein_id="ABO22345.1"
FT                   /translation="MTGWIKFEWIFISWILSLFIHHHSVKRGAISAQKDALIDLIASLS
FT                   EFKWSEEKSEKLYEQERYNAKVSRVNWKLRQLNKLSSCKFISEDKLTPLYNFDIECYLD
FT                   KKTSVEDRERLKFELQECCEDLIDGIENTHFDKIVSSKSYMFWSYRHTLFGMFFGTAIV
FT                   YLFIEIMKFLFK"
FT   gene            complement(532153..532500)
FT                   /locus_tag="Shew_0474"
FT   CDS_pept        complement(532153..532500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vfi:VF2040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22346"
FT                   /db_xref="InterPro:IPR025474"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA48"
FT                   /protein_id="ABO22346.1"
FT                   /translation="MNSVKTIVVTNEFHPRPKGRYKDDAPGCEFTAGEVFRDTILVDAL
FT                   KANDKVIVDLTGYNRYGRSFLDEAFGGLISRRGFTKEELDEKLTIKHDTVENFVTTAND
FT                   RIIAAEQKRPK"
FT   gene            complement(532487..533653)
FT                   /locus_tag="Shew_0475"
FT   CDS_pept        complement(532487..533653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vfi:VF2039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22347"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA49"
FT                   /protein_id="ABO22347.1"
FT                   /translation="MKKKLQVHDRELAKKASFYANRIGKNHNIFKGHAIHSFNGKKLET
FT                   IFNIPILPVPKIFDIVRTGYDQAFVDFLQDFKILLSEKKHIYLSFVNTTVTNLPVFLLL
FT                   YEIQDKYNCKISVIWSKKSPFVNKLIKDSGAFSPKAERNQAMFNPKIKRIPVISGSNQE
FT                   YQTFPDALVDAIRDKFYDGDIPDNIESRISQAVIETLENVGRHAYPDQPLDKDKKWWLV
FT                   CSIGHNGNEKEEYMYLAIFDSGRGIPLSFEDSKVFQNRVKKHYPEEFSKLLHGEIEDNS
FT                   KLGQLTKLVRTAKSMIAPLRNTIGDSGLIHASMMHDMTSLDDDSHGQGSVSIKDIVTTD
FT                   ADSKLIILSNSGCYQYNKGGKEEHTRIELQNELSGTLLQWSIKLDELC"
FT   gene            complement(533870..534667)
FT                   /locus_tag="Shew_0476"
FT   CDS_pept        complement(533870..534667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0476"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   sfr:Sfri_3658 protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22348"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA50"
FT                   /protein_id="ABO22348.1"
FT                   /translation="MQDVAKIAVFIDADNAPARKFDVILAELAKHGVVSIRKAYGNWKS
FT                   PGLKHWEDILHEYAIQPIQQFDLTKGKNATDIALVIDAMDILYTKDIDIMCLISSDCDF
FT                   TPLVTRVLSDGKKVFGFGERKAPTAFVNSCSRFLYLDAEPEVETEVEVPIEKVTESATD
FT                   KEAKTTTPTTKASVPRKQNLKGDTKLIHLLRQAIEATEEDDGWSRLGPIGSHISNHSSF
FT                   DQRNYGFKKLSDLFAAIDLFEMRKTNGSVMWIRESKRAKKNGK"
FT   gene            complement(534699..535280)
FT                   /locus_tag="Shew_0477"
FT   CDS_pept        complement(534699..535280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22349"
FT                   /db_xref="GOA:A3QA51"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA51"
FT                   /protein_id="ABO22349.1"
FT                   /translation="MPSYAWRKSWCSTPHRGKGDRFDRQLRPCKSASSPSMVRAHKRST
FT                   SNRPYPIPQRSNAPLEGIFKGMSLMHEIKVNLYDCQHCSGTGTCTNGKDNCSCEACAKK
FT                   NELPFWRRQNQHGLMCGSCGGIGKAEPLTERMNKRIAPLLAIAIVVILLIIIAEAAIFE
FT                   NKYFSEILAFSGAIIGSVCGFYFSSVKNQN"
FT   gene            535900..536136
FT                   /locus_tag="Shew_0478"
FT   CDS_pept        535900..536136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0478"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   shm:Shewmr7_0557 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22350"
FT                   /db_xref="GOA:A3QA52"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA52"
FT                   /protein_id="ABO22350.1"
FT                   /translation="MSSSLNQDSLGLLIKTRRKEAALTQEVAAMLCGVTKKTLIRVEKG
FT                   EDVYISTVFKILDGLGIRLAVESKSDAGSSEWY"
FT   gene            536139..537440
FT                   /locus_tag="Shew_0479"
FT   CDS_pept        536139..537440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0479"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: she:Shewmr4_3395
FT                   HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22351"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA53"
FT                   /protein_id="ABO22351.1"
FT                   /translation="MAESPILVLDMLLGDQLIGALSFDPSDERFAVSYTQAWQQSGFPL
FT                   SPTIPLDGSGSSTQIAMFLVNLLPENKGLDYLVESLGVAKGNTFALIRAIGLDTAGAIA
FT                   FSSKGSAFPPTTLRTISDDEIVQRLEDPEFWPMEIWDGRPRLSVAGVQSKLNLFFNGEE
FT                   FGFGEGALSSTHILKFEQHPHLVINEFLTMRLAKALALKVANVEIRCFGQYKSLCVERF
FT                   DRRYLDDENRVQRRHIIDSCQALGFSVNKKYERNFGSGRDVRDIREGVSLPRLFGLANQ
FT                   CINPAAAKQDMLRWTLFNLLSGNADAHGKNYSFFMTPNGMLPTPWYDLVCVALYEDFEQ
FT                   ELAMAIDDEFDPNKIYAYQLAAFSEEVGLPRALIVNSLDKMVAKIRLEINGVIAMLKDL
FT                   DEDEQAFVEAYKAQLLARCERYSAIAPEIKAIEL"
FT   gene            537510..538568
FT                   /locus_tag="Shew_0480"
FT   CDS_pept        537510..538568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0480"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: lpp:lpp1174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22352"
FT                   /db_xref="GOA:A3QA54"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA54"
FT                   /protein_id="ABO22352.1"
FT                   /translation="MVWIHNMYEDLMPVLVIAVTLALLVAVMLFIEGRRKPTIMPGWLD
FT                   LQGFERLFIYWDAPSAKEYGEKHPRRYQRLLEAWQDLPPEEAWFHYNLSCIGVTPVGSS
FT                   VRSAKRWCQKAWLKKQDVEAAYHLGMMQLMGLGGAPEYRSALTLFEAAEQGGIIRATTA
FT                   RGLMLLRDPGFMNTGFVNTGDGNSCIGDSGLAEDWPIEVPKAQRHGEALACFTGAFEQG
FT                   DMLAALNLGYMLEHGLGLDAGAEAESAANLDRAIESYLLAAEAGLPAAQYRLSMLFEDR
FT                   GELVDAYRWAYIAAACSESDIPMARSQRLATLLDRRTLQQAQESARVTAHRIMTPRVLA
FT                   MLHNLKHLRSAA"
FT   gene            538703..539107
FT                   /locus_tag="Shew_0481"
FT   CDS_pept        538703..539107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22353"
FT                   /db_xref="GOA:A3QA55"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA55"
FT                   /protein_id="ABO22353.1"
FT                   /translation="MGNQHLNGTKRGPWMAIGVSLAVVGLIALLLMMMPKGFKATHEEI
FT                   GKGTPALVFVYDPNLAVSHTQTEQMNEARGHLGDNVLFLLARVGTPEGEQLIAKYRAGA
FT                   AELLLFDGSGKLVKRQLAVQDANQLMRWVR"
FT   gene            539397..540563
FT                   /locus_tag="Shew_0482"
FT   CDS_pept        539397..540563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_2138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22354"
FT                   /db_xref="GOA:A3QA56"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA56"
FT                   /protein_id="ABO22354.1"
FT                   /translation="MKRILCLSLLAFSQMAAAVEPLIETPKDMQPTWVDEILDVFGADG
FT                   EFDESKTIDMSYLPTAYYTPEKKFGVGLLMVGLYKTDGAAPEEQPSSLVLNSFVSMNNS
FT                   YGVEVENMTFFNGGKQRLLLGLELHNEASVYYGRGIADGNIDSNHHEFDEQLYSFTPRW
FT                   MTQVADNYFVGVGVDFTYASADKFTRVEGDIPLPSDGILPSNFSSGLVVTSIYDSRDYR
FT                   LNATKGWLFQLDAGLYQNSEYDSFAKYDLELANYIDLSTTSWLSQMPGLIAWQVQGHFT
FT                   SGDVPWNMLPDLGGSSAMRGYIKGRYRDKQMMMGQVEYRLPIFQRYGMVFWGGVGSVAD
FT                   KVSDLNDELLTSYGTGFRFKIKDNINLRLDVGVGENETNFYLNVNEVF"
FT   sig_peptide     539397..539453
FT                   /locus_tag="Shew_0482"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 19"
FT   gene            540566..541378
FT                   /locus_tag="Shew_0483"
FT   CDS_pept        540566..541378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_2137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22355"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA57"
FT                   /protein_id="ABO22355.1"
FT                   /translation="MTVLPVRLCVNAKPMLVASAVVAALALSQCAKADETQIRDAQDKA
FT                   VIDAAPKQKPQCTRRSDYDIYLSGIHTGTMSRTEQWQGKRAVVTSNSEASILGIGTRYR
FT                   QRAELSWSETTEEWITQAFHQQVSGFRARDMQVRFSQNGRAARVDLDGEVTDYHSKDNA
FT                   LRDVDTLAIEMRRLLMQGRHQFALVRQASDAMEPYQFYVKAPQAAEVAPWGQLMLVPVE
FT                   QTGAEEVTYYFAPELDYQLIKARYHGILLQGLIELNHYSSSCDLAPSA"
FT   sig_peptide     540566..540667
FT                   /locus_tag="Shew_0483"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.993 at
FT                   residue 34"
FT   gene            complement(541500..542771)
FT                   /locus_tag="Shew_0484"
FT   CDS_pept        complement(541500..542771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22356"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA58"
FT                   /protein_id="ABO22356.1"
FT                   /translation="MKQGCLIIGLGLGAMTINANAQQCNLSITGTVPEGINLDKLVVST
FT                   YNKELPVTSRDFSLCASKQDLQVVGRHSPRNTIYLMDKSGAIPRGIYTAEVFVQSKAIN
FT                   LGATSTLTKQACDLRCGYYASQRIQASHGLQQLAAQYRQVPATDSKAIAAFYAKHKTAL
FT                   TDLYFDGITPKTMAPIDSSAFWVDPYSGAGLYFESPASLLSGTYSEYVGTKIRQARQQD
FT                   KAVAEVVKQHKASLQGLMKGFDSWQARGDAIAAVTDELKASQDPAATEVAQIFIDGYQA
FT                   AEATLKAYLANDNKTPIASLTQADKAFELLLADWTVAAYTHSKDKQAFSALFSEQFKLK
FT                   LPIKDRELDKALSRLIDLPSHLSKMSLEQGYQNIQVEFKDALPKSSERYDFKDALHSVS
FT                   FVYEKGAWRLDSVSQLPIAHYETN"
FT   sig_peptide     complement(542706..542771)
FT                   /locus_tag="Shew_0484"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.870 at
FT                   residue 22"
FT   gene            complement(542808..543425)
FT                   /locus_tag="Shew_0485"
FT   CDS_pept        complement(542808..543425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0485"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; Excalibur
FT                   domain protein; SMART: Cold shock protein; KEGG:
FT                   sfr:Sfri_3647 cold-shock DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22357"
FT                   /db_xref="GOA:A3QA59"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA59"
FT                   /protein_id="ABO22357.1"
FT                   /translation="MERGTLVRWNDDKGFGFIKPNTPNAQDVFIHISALKQMARKPVVG
FT                   DEIIYQSQQQSDGKIKAVKASIEGVAVVSGIASGRASGLANKPTRPQHRDHTQSSHYSH
FT                   RRSGSRLQRMIFIIILVSIGSFAIKQYQALNATPVASFEELPAVEAQEWQPATPKFRCE
FT                   AGKIHCSQMSSCQEAKFYLRNCPGTEMDGDHDGIPCERQFCG"
FT   gene            complement(543518..544534)
FT                   /locus_tag="Shew_0486"
FT   CDS_pept        complement(543518..544534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0486"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: sfr:Sfri_1725 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22358"
FT                   /db_xref="GOA:A3QA60"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA60"
FT                   /protein_id="ABO22358.1"
FT                   /translation="MLAWFTQLADLLVYDLLGLSSQSAAGQALHFFVEDTSKIFALLVV
FT                   MIYLIGWLRAALNVERVRDYLAGKPKLLGYGLGAGFGAITPFCSCSSIPVFLGFTTAGI
FT                   PVGITMAFLLTSPLINEVAILLLFSLLGAKITLLYALTGITIGMLGGALLDLLHAERWL
FT                   QPLAANAYRRGATQTQTTASASDTYTPDESTPGISWRQRHQFAKQETLTIFGRVWKWVI
FT                   IGVGIGAALHGFVPAGYLEANLGDGQWWSVPIAVLMGIPLYANATGVIPVLESLLIQGV
FT                   PLGTTLAFCMSTVAASFPEFVMLKQVMQWRLLALLFALLLVAFTLMGWVLNLVTISG"
FT   gene            complement(544562..544810)
FT                   /locus_tag="Shew_0487"
FT   CDS_pept        complement(544562..544810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0487"
FT                   /product="redox-active disulfide protein 2"
FT                   /note="TIGRFAM: redox-active disulfide protein 2; KEGG:
FT                   mbu:Mbur_0943 redox-active disulfide protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22359"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA61"
FT                   /protein_id="ABO22359.1"
FT                   /translation="MKIEVLGSGCKRCTNLASDIARIADELNLNIELTKVTDMAQIAAY
FT                   GVMSTPAIVIDGEVLAAGRLPSEEELAQLLTKINKVQ"
FT   gene            complement(544821..545225)
FT                   /locus_tag="Shew_0488"
FT   CDS_pept        complement(544821..545225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0488"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: dps:DP0944
FT                   similar to ArsR-family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22360"
FT                   /db_xref="GOA:A3QA62"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA62"
FT                   /protein_id="ABO22360.1"
FT                   /translation="MKATTAQIQTQAQAQTHTQSQQRLNNRAALLKALAHPTRLWLVEQ
FT                   LEHQERCVCELTDGVDADISTVSKHLALLRQAGIVASRRVGKQIYYRLETPCLLGMLSC
FT                   IETALAQSPGCCAKSLAAKTDKAKAIQSVR"
FT   gene            545503..545931
FT                   /locus_tag="Shew_0489"
FT   CDS_pept        545503..545931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22361"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA63"
FT                   /protein_id="ABO22361.1"
FT                   /translation="MKALKLSQGLTLGPALLLPALLIGLGLYSAQASASNGFNSEASHA
FT                   AGGAAMAGALVWASDAWTPQYDRAWVGFSVSAAIGILVQYHEYDKGTNTASEALLDAAS
FT                   HTLGAAIGAYVTDGYLLSPVVKPEPGGSYVGVDLSFRF"
FT   sig_peptide     545503..545607
FT                   /locus_tag="Shew_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.900 at
FT                   residue 35"
FT   gene            546050..548077
FT                   /locus_tag="Shew_0490"
FT   CDS_pept        546050..548077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0490"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site domain protein; WD40 domain protein beta Propeller;
FT                   KEGG: shm:Shewmr7_3813 peptidase S9, prolyl oligopeptidase
FT                   active site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22362"
FT                   /db_xref="GOA:A3QA64"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA64"
FT                   /protein_id="ABO22362.1"
FT                   /translation="MKKIAILLLCILMPVTTVFAQTGKPLSVEVLWQLSRIGNPSISPN
FT                   GDYIIAPVTEYDVPEDKGNTQLWLFSQDGKQQRALTAKGMRVSEPVFSPDSKTLAFISK
FT                   RDKDEAGQIYLLPMDGPGEAQRLTDVPSGVYGLKWVGEHLYFISSVYPGKNWKEIGEQL
FT                   KADKDNKVSAHQWNALPYSSFDHWIDEGRQAHVFRIAAKGGEVEAITQPLNIELPRSSQ
FT                   GAGSYDISPDEAWIAFNANGSDNQVNPKLDLFLAAIGSGKAENITPDNLAPDASPQFSP
FT                   NGKTLAFTRQHIQGFYADTAKLMLFDLKKRSTKMLAKEWDRSVARFVWTPDSKGFYAAI
FT                   DDAATRRLYHIDAKSGKVKAITKATNFGQPAIANNGTLVATNDSFLYPARLVKVNGKNG
FT                   KTSRLDSFNDEILADVDLGSYESVTYKGYNDQEIQMWVHYPPGFDRSKKYPLMMLVHGG
FT                   PHNAISDGFHYRWNAQTFASWGYVTAWPNFHGSNSFGQAFADSINPDWKNKSLEDVLKA
FT                   ADWFKQQSWIDDKRMVAGGASYGGYLTSIILGQKHPFNALLIHAAVYNMYSQMAADFSV
FT                   HSPRFGNYWDNPEIYQSISPHYGAGNFNTPTLVIHGQLDYRVPVGQGFELFRTLQTRGV
FT                   ESRMIYFPDENHWIMKPNNSIYWYHQVKDWMTRFAEPGGK"
FT   sig_peptide     546050..546112
FT                   /locus_tag="Shew_0490"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            complement(548159..548413)
FT                   /locus_tag="Shew_0491"
FT   CDS_pept        complement(548159..548413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22363"
FT                   /db_xref="InterPro:IPR021376"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA65"
FT                   /protein_id="ABO22363.1"
FT                   /translation="MNPIIAILKEHNVSDAQIQELFQALTENPLMAMGTIGQLGIAPEK
FT                   LQQLMALVMQNPALIKEAVTELGLDFAKVEAAKAQLQKS"
FT   gene            complement(548543..550135)
FT                   /locus_tag="Shew_0492"
FT   CDS_pept        complement(548543..550135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0492"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: chemotaxis sensory transducer; Hemerythrin HHE cation
FT                   binding domain protein; KEGG: son:SO3890 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22364"
FT                   /db_xref="GOA:A3QA66"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA66"
FT                   /protein_id="ABO22364.1"
FT                   /translation="MIDKIAKRIASLSALQWSLLTGLPLVPIAYLLIRQGAWGWLALLV
FT                   IDYLFILSVLLALNSMFGRLRSAAIHLSEGDLRVRLDTQEALGGPLFKAFNQIGEDVSR
FT                   TVFSLSKSAQQLVRVADTVQADSQVSKTGALRQKDDVEEAKQIVSKLFETTAEVSSFCE
FT                   STSQLASESKRQADRGKQEMRSLETALEDVGEQFAASDQNFEQLKQESLQIGQVVETIK
FT                   GIAEQTNLLALNAAIESARAGELGRGFAVVADEVRSLALRTQVATEDINNKIVNLQTQI
FT                   NDAIAAMQKNRQSVLHSQSVANEAESHFEELVSQIDAIDALGQEIAVASQHQVEQTQML
FT                   ETCLVEVDKVSDENVKATQETLLASITVRNLAGEIDSLLHRFATDSEQIGREDTRRDKL
FT                   IEWSDALDLNLAEINRQHKTLVHLINELYYLLNNNYGLASIKRVVQGLIDYTANHFKYE
FT                   ETLFEQFGYPQDKQHTDSHHQLVGKVLAFQRRVEQGEDIGDELMAFLKSWLSQHIQKED
FT                   KAYVDCFKHNGMN"
FT   gene            complement(550297..550803)
FT                   /locus_tag="Shew_0493"
FT   CDS_pept        complement(550297..550803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22365"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA67"
FT                   /protein_id="ABO22365.1"
FT                   /translation="MGVITKLSLPLLAALTLSACNQEEQSAPAQPPAAKQSAEETVAMK
FT                   ADEAKATQVETSKAQPKAEDLKIVADGLSKETSDSLQKAITMTQGTVRYFNLEGGFWGI
FT                   VADDGRHILPQNLPQEYRKDGLRLSFKAQEVKDMMTIQQWGILSKLSDIEVIGKVDSKS
FT                   GDPRL"
FT   sig_peptide     complement(550738..550803)
FT                   /locus_tag="Shew_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.633 at
FT                   residue 22"
FT   gene            551047..551799
FT                   /locus_tag="Shew_0494"
FT   CDS_pept        551047..551799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22366"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA68"
FT                   /protein_id="ABO22366.1"
FT                   /translation="MKKLLLVPALISGALVAATPASAATIIGGIGFESARTVQPTEKKE
FT                   KQQVEAILQAVNVEFLGLNWSNTTAAKINRNGDMTVARNWAYGFWNDNFGVSVDLIKGD
FT                   WLGAGPNIAAVGLAYQDCWDKFCLRVNPTLAAIDMKGADGQVFKDNGAQLNLKADYQFN
FT                   DTFSATFHPQYASWNDDELGQTLKLEFNLTANLTDNKRHKLMLVNEHFLVNNASTDHRT
FT                   RYIGENSPFGGYVVGTESTLKLRYFYVF"
FT   sig_peptide     551047..551118
FT                   /locus_tag="Shew_0494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            551984..552685
FT                   /locus_tag="Shew_0495"
FT   CDS_pept        551984..552685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3378 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22367"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA69"
FT                   /protein_id="ABO22367.1"
FT                   /translation="MLANKLLARKRGPMTAMRRQRGFSGMQIFLIVLLTMVLTALASFF
FT                   IIKTYIFPSPFTPVTLNAKEEQRLDNKLSQLGWQVERKDDRHGGAGKLEPEPYRERDAD
FT                   RRVTFSEKEVNAMIGRNPDFAERVAIDFSDNLASAKILIPIPQDFPIMAGEILRVNAGL
FT                   DIHLDASRRPVVALVGVSLMGVPIPNAWLGNMKNVNLVGEFGDRGFWTAFADGVEDLQI
FT                   RDGELYLKLRR"
FT   sig_peptide     551984..552112
FT                   /locus_tag="Shew_0495"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.835 at
FT                   residue 43"
FT   gene            complement(553040..554413)
FT                   /locus_tag="Shew_0496"
FT   CDS_pept        complement(553040..554413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0496"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: shm:Shewmr7_3308 amino acid
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22368"
FT                   /db_xref="GOA:A3QA70"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA70"
FT                   /protein_id="ABO22368.1"
FT                   /translation="MNFHALLSEINAIVWGPITLCLLVGTGLYLTLRLRLIQVFKLPLA
FT                   LRLLFKPASGQGDLSSFAALCTALSATIGTGNIVGVATAIKVGGPGALFWMWLAAFFGM
FT                   ATKYGECMLALKYRTTDARGNIAGGPMYYIERGLGLGWLAKLFALFGVGVAFFGIGTFA
FT                   QVNAISDAMTIAFHVPAWVTALVLTLLVAAVTLGGVKRIAKVAQKLVPSMALGYVLACL
FT                   WILVTFSEQIIPALQLVIHSAFSPISAAGGFLGATVAQAIQIGIARGVFSNESGLGSAP
FT                   IAAAAAKTKEPVEQGLVSMTGTFFDTLLICTITGLVLIITGVWSGDAAGAAMTSAAFAT
FT                   GGSAVIGQYLVTIALVCFAFTTILGWHYYGERCWYYLTGHKLGERGIKIYQFIFLSLIA
FT                   VGAFIQLDLIWLLADTVNGLMAIPNLIALIGLRKVIIADTLSYFAARDSQGAQQELTA"
FT   misc_binding    complement(554656..554770)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   64.85"
FT   misc_binding    complement(554771..554892)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   50.96"
FT   gene            555306..557003
FT                   /locus_tag="Shew_0497"
FT   CDS_pept        555306..557003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0497"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: ppr:PBPRA2914 hypothetical
FT                   sulfate permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22369"
FT                   /db_xref="GOA:A3QA71"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA71"
FT                   /protein_id="ABO22369.1"
FT                   /translation="MFSAVKKSISAKPSFQEIQTNILAGLTVGVIALPLSMALAIASGV
FT                   PPQHGLYTAMIAGIVIALCGGSKVNISGPTAAFVVILLPIVQQFGLGGLLLSGLMAGVI
FT                   LLLMGLGKLGKLIEIVPYPVTVGFTAGIGVVIATFQIKDFFGLEVAAGGEHYLEKLSYI
FT                   LQALTSISWQETLIGALTLAVLLAWPKLKSKVPAHLAALLVGALIAWVMTQMIGGFSVA
FT                   TIGSRFHYELDGLLGSGIPPIMPSFEWPWNLPGADGQPIGMSFELVRELLPSAITIAIL
FT                   GALESLLCAVVADGMSGKKHNPNDELIGQGLGNILVPLFGGIPATAAIARTAANVKAGG
FT                   SMPLASVVHGLFILAGILLLAPLLSYIPMASMAALLLVVAWNMSEAKHFVRTLKVAPRD
FT                   DVLILVLCFALTVLFDMTIAVAVGMGLAAMLFIRRSISLTDARAVETNHQAYEVPESVV
FT                   VYDINGPLFFGSAHKALKTIALVRPDVRVVILDMSEVTLLDMSAIVAMESIAQDLSGKQ
FT                   VALIINNLQPRMLLKLRRAGIRKRRGQVEYARTMDDSFALAQRMTAQA"
FT   sig_peptide     555306..555434
FT                   /locus_tag="Shew_0497"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.689 at
FT                   residue 43"
FT   gene            complement(557009..557638)
FT                   /locus_tag="Shew_0498"
FT   CDS_pept        complement(557009..557638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0498"
FT                   /product="conserved hypothetical flavoprotein oxygenase"
FT                   /note="KEGG: son:SO0492 hypothetical flavoprotein
FT                   oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22370"
FT                   /db_xref="GOA:A3QA72"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA72"
FT                   /protein_id="ABO22370.1"
FT                   /translation="MDTQARYYYEPSKGHGLAHDPLNAIVGPRPIGWIASRSPEGHRNL
FT                   APYSFFNCFNYHPPIIGFASVGYKDSLANILATGEFVWNLATRPLAEKMNLTSAALPAG
FT                   SDEFDFAGLTPVAGSVVGVDRVAESPVNFECRLTQSLQLQSAAGDKIETWLVLGEVVAV
FT                   HIDPSLIEDGSYQTAKAKPILRAGGPSAYYGISEALRFDMQRPQVP"
FT   gene            557784..559136
FT                   /locus_tag="Shew_0499"
FT   CDS_pept        557784..559136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0499"
FT                   /product="Xaa-Pro aminopeptidase family enzyme"
FT                   /note="KEGG: ilo:IL1431 Xaa-Pro aminopeptidase family
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22371"
FT                   /db_xref="GOA:A3QA73"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA73"
FT                   /protein_id="ABO22371.1"
FT                   /translation="MLANKNNNLSLFAIVISLVCLLAPQLGQAAATDEILPLRERAAMI
FT                   DSLIQKRVQQLLPDLMRETNIDMWLLISREYNEDPVLQTLLPATWLSARRTTILVFARD
FT                   KQGEVTAYAIAPYSVGNLFTKAWDKEAHPSQWQALNALVERYQPKRIGVNRSGSWAHAD
FT                   GLVAGDEQWLLSHLPERYRQALVSAEPLAVGWLERRIPEEIELYPSLVKMAHEIIAQGF
FT                   SNRVIKVGQTTSEDLVWWFRERVRELKLDTWFHPSVTIQRAKQQDLSGDSVILPGDLLH
FT                   VDFGITYLRLNTDTQQLAYVLRDGETQAPDYLVKAFNSGNQLQDILTAQFAVGKTGNEV
FT                   LKAAREHAIAAGLKPTIYSHPIGYHGHGAGTSLGMWDAQQGIAGSGDHPLHLNTAYSIE
FT                   LNNAVFIPEWEREIRIMLEEDAMFDASGVWYLDGRQTALILIEPELSMGGK"
FT   sig_peptide     557784..557873
FT                   /locus_tag="Shew_0499"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.925 at
FT                   residue 30"
FT   gene            559225..560241
FT                   /locus_tag="Shew_0500"
FT   CDS_pept        559225..560241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP1291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22372"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA74"
FT                   /protein_id="ABO22372.1"
FT                   /translation="MTNYKIQKHFSLILGVVLLGLTTGCATSYKVDPELVSQFKPEATP
FT                   TQEQTFVYVIRGANFQGGARGAWVAANKDVVADLSNGSHTLLKLATGLNSVHLVQGLVG
FT                   FGYSRVDNRPGETVYLTIDYTTGKMKEVERDLGVSMIMQTKKAKDIGAPRKNDAYDNLL
FT                   ANPALLGFPVMKTGVEPIKPDEHSAVINFYRMETLIGEVPFDIWSETGYVGSTKAGTYF
FT                   QVRVTPGKHTFVSLSERYSVLEAEVEAGKEYVVEYDVDMGWNQAHVQILPIDPVKSAKT
FT                   IRKWQEKARLMVLDETVVQQPEFAQRVQMAKEYLTPKFKSIDAGEMSTRALTKQHAL"
FT   sig_peptide     559225..559317
FT                   /locus_tag="Shew_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.570 at
FT                   residue 31"
FT   gene            560444..560728
FT                   /locus_tag="Shew_0501"
FT   CDS_pept        560444..560728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0501"
FT                   /product="protein of unknown function DUF134"
FT                   /note="PFAM: protein of unknown function DUF134; KEGG:
FT                   son:SO0727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22373"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA75"
FT                   /protein_id="ABO22373.1"
FT                   /translation="MPRPKKCRRLQCRPPCSLFKPNGIPSVELEKIQLEADEFEALALG
FT                   DVQRLSQLEAAASMGISRQTFGNLLASARQKVATAITQGQAIVLPKSNQ"
FT   gene            560738..561265
FT                   /locus_tag="Shew_0502"
FT   CDS_pept        560738..561265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22374"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA76"
FT                   /protein_id="ABO22374.1"
FT                   /translation="MIIAMPMSRGRLAAHFTKAQRIGFFNEYHQLITSFDNPAIGGGGC
FT                   CAKSELLSLIKAQKTDIVIVQHIGERMLGKLLAAGISVSQGDNAESIEVLLSQTQLMER
FT                   RLLDASQGRASLNHAKKGGCCASGGDCGSAEGGCGCGGHKPMSEVSSLLQKPESAQGEL
FT                   ASVSYSGFRPLS"
FT   gene            complement(561271..561612)
FT                   /locus_tag="Shew_0503"
FT   CDS_pept        complement(561271..561612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0503"
FT                   /product="thioredoxin domain protein"
FT                   /note="KEGG: shm:Shewmr7_0578 thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22375"
FT                   /db_xref="GOA:A3QA77"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA77"
FT                   /protein_id="ABO22375.1"
FT                   /translation="MPQLTADNIESSDALDDYLAAHEAVLLLFGGAHCGVCQSIKPRLL
FT                   QMLAEEFPKMRLCYIDCEQQGDIAAAHRVFTLPVVELYFQGQAFARFVKVFAMVEVREA
FT                   IARPYQLLD"
FT   gene            561877..563088
FT                   /locus_tag="Shew_0504"
FT   CDS_pept        561877..563088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0504"
FT                   /product="NnrS family protein"
FT                   /note="PFAM: NnrS family protein; KEGG: sfr:Sfri_3037 NnrS
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22376"
FT                   /db_xref="GOA:A3QA78"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA78"
FT                   /protein_id="ABO22376.1"
FT                   /translation="MLNIDDPSVVDKTPAIWRLGFRPFFLGGALLATLYVPLWLISWYL
FT                   PEMSLLRSQFWVKVVPLWWHPHELLFGFAVAIVSGFLLTSVQTWTNQPSLKGWPLALVF
FT                   ACWLLARVLLLSPFELPVWLPGLFDSLFLLLTAAKLWSCIYRVKQWRNIGFPIMLLVAT
FT                   GINLLSYYALSQRDFVLSHHIWQGMLWWLGLLITIVGGRVIPFFTAVRVKQAKPEPIKA
FT                   LDLSLIALMILLIAQGITKYLTPGAEQALLAVTALAHLLRWSRWLPHKTLGEPMLWSLQ
FT                   LAYLCLPLTLAALAWNIDDENAYRHLLHLFAIGTMAGLCLSMISRVSLGHTSRNIYQGP
FT                   KMSLAFLGITLAALCRAVMPLWFPEYSELWLWIAGSCWSLAFGWFVWCYAPILTRPRVD
FT                   GRPG"
FT   gene            563145..564503
FT                   /locus_tag="Shew_0505"
FT   CDS_pept        563145..564503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0505"
FT                   /product="Nitrite reductase (cytochrome; ammonia-forming)"
FT                   /EC_number="1.7.2.2"
FT                   /note="PFAM: cytochrome c552; KEGG: sfr:Sfri_3036 nitrite
FT                   reductase (cytochrome; ammonia-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22377"
FT                   /db_xref="GOA:A3QA79"
FT                   /db_xref="InterPro:IPR003321"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA79"
FT                   /protein_id="ABO22377.1"
FT                   /translation="MKKLTAIALSLLGWCTLSQALAADVSPEKMKAKYPNQYASWQATS
FT                   TQAARSDMLASYPAAIILWAGSAYAKEYHSPRGHQFAVADVTHTLRTGVPPGEGKKGLS
FT                   ASCWTCKSPDVPRLIDELGVEGFSAKNFTDLGTEMNSVVYCSDCHEQGKAELSLPRPHA
FT                   RDAMAKVHLPFDKQDEAMQGAQVCGQCHVTYYFQPERSNKVNIPWIFGSSADLIEKYYD
FT                   TRRFYEWIHPVSKTPILKARHPEFEHWSRSEHAKVGVTCVTCHMPAATDGEGKAYTNHQ
FT                   VGKALPNYDVVCQGCHENKQALMKQLNSAKSQIAEKARRVEQLLVKAHYEAGAAWDAGA
FT                   SWAIMNDAIMAIRHAQWRWDFAMSSHGSYAHNPQEANALLDTAILQAEHARRALSEILS
FT                   MLSVTQVNYPDISTKEAAQQAVGIELDKLTEAKQAFIKQEVDKHWPAVSRTGY"
FT   sig_peptide     563145..563213
FT                   /locus_tag="Shew_0505"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 23"
FT   gene            complement(564571..565488)
FT                   /locus_tag="Shew_0506"
FT   CDS_pept        complement(564571..565488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0506"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO4154 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22378"
FT                   /db_xref="GOA:A3QA80"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA80"
FT                   /protein_id="ABO22378.1"
FT                   /translation="MYHLKDLQLAIRIADLHSISAAARELGMTPASASAALQRLEHKLN
FT                   CQLFARSTRNMQLTEEGQAFIDTGRQALSLLQGASDALADKRGELRGELRIALPSDLGR
FT                   NRVRAWLDELTAEAPELTLRLYFGDQLDDLIAQNVHLALRYGELQDSSLMRRQLARMHR
FT                   VTVASPVYLARHGRPSHPQQLSQHKILLLNRGNTPWHKWRFAYKQQPLEVELTGSKSCN
FT                   DGAVIKEWALAGEGIAYKSWFDVAQEVTEGRLELLLVDYLADPIPLQLTYLQTEYPSHK
FT                   VRTCIEFLKEKCQAFDSQYPLLRR"
FT   gene            565616..566707
FT                   /locus_tag="Shew_0507"
FT   CDS_pept        565616..566707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0507"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   son:SO4153 N-ethylmaleimide reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22379"
FT                   /db_xref="GOA:A3QA81"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA81"
FT                   /protein_id="ABO22379.1"
FT                   /translation="MKLFNSYQMGQHTLANRIVMAPMTRSRTSQPGNLPNQMMATYYAQ
FT                   RASAGLIVTEATQISGDSQGYSFTPGIYTQAQIDGWCQVTDAVHSAGGKIFNQLWHVGR
FT                   VSHPVFQGGEAPMAPSAIKPEGTQVWVVDEAHPEGQMLDCPTPREMTQADIDRVVKDFA
FT                   LAASNAVTAGFNGVEIHGGNGYLIDQFLRTNSNKRRDAYGGSGEKRIRFLLEVVAAVSE
FT                   KVGAGRVGVRLAPFVTFKDMNCPEIVDTILLAADALSKMGVAYIHLSEADWDDAPQIPE
FT                   SFRVQLRNLFDATIIVAGRYDLARASEVLSKGYADLVAFGRPFIANPDLPYRLQQQLPL
FT                   ASFDKGPLFGGGEAGYTDYPAAR"
FT   gene            complement(566781..567938)
FT                   /locus_tag="Shew_0508"
FT   CDS_pept        complement(566781..567938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0508"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   she:Shewmr4_3514 sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22380"
FT                   /db_xref="GOA:A3QA82"
FT                   /db_xref="InterPro:IPR031563"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA82"
FT                   /protein_id="ABO22380.1"
FT                   /translation="MRCNTQDVNQLNKHIGEFSGAFADLGTFLPLVLGLIAINHFSPQG
FT                   IFLGFGLFALFTAYFYRRPIPVQPMKVIAALVIAQGLTPGMLQASGILMGLILLLLAYS
FT                   GAIGWMAKQLSPTVSIGIQLAIGLQLIWMGGQMMSGTWLIGILAFSALFMSRFMPLPYL
FT                   AMPLVLVLGMLWQANQGSAPSFTLSATTDWQLGWPNIDEWQSAALLLVLPQLALTLTNA
FT                   VIATSAMAGEKFPQDALVDDKRFAPRRLATSSGWANLLLAPLGATPMCHGAGGLAVQYH
FT                   FGARSWRAPALFGICCLLVALCWGDTIAQVLSLIPLAILGSLLAIAGLQLAWSKRFLDG
FT                   KPFCIFVILSTAAVCLTINTAAGLAVGVILEMGRRQWHLISDLRH"
FT   gene            568204..568629
FT                   /locus_tag="Shew_0509"
FT   CDS_pept        568204..568629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VPA1145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22381"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA83"
FT                   /protein_id="ABO22381.1"
FT                   /translation="MEEKQLIKLGIVPLLVATTFLLSACASQRDIMIDQGYPVAYADGY
FT                   DDGCHSGNKAGGSLFDQFKKDVAKFDADKQYAQGWSDGFKQCESEQEAIQRQVRLSLEQ
FT                   HKLDEQKKHNAWEEKKAMEREALKGVDTSGLKSLSQS"
FT   sig_peptide     568204..568284
FT                   /locus_tag="Shew_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.703 at
FT                   residue 27"
FT   gene            complement(568682..577120)
FT                   /locus_tag="Shew_0510"
FT   CDS_pept        complement(568682..577120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0510"
FT                   /product="putative outer membrane adhesin like protein"
FT                   /note="TIGRFAM: putative outer membrane adhesin like
FT                   protein; KEGG: son:SO4149 RTX toxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22382"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040853"
FT                   /db_xref="InterPro:IPR041690"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA84"
FT                   /protein_id="ABO22382.1"
FT                   /translation="MSQDKRPNTPPQDESSQARNQAKPQTNSQPASEPEPLTEAQRRER
FT                   EAERLARAQDKAVQKLKAEEYRDGKTTSRFNQDLVADKPWHAAASASAEPQIEHADLAN
FT                   SADQGPMAQGDQTPSSTELDDRIASAAQSQQSQSHQSQSQEVQSQEAQTQETQTPEAQA
FT                   NAAQVQNKLAHRAAQTTGIEEFSGFEKGTAQAPNLTPLAHALTSGGTPPAFQVTLTSSE
FT                   TQAHKPPQPSTGSTQQPSTQQTGTQPPTTERPTTDPQVSLTGTGTGTGTGTGTGTGTGT
FT                   GTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTG
FT                   TGTGTGTGTGTHENPLHIDSQQDFQTIKENSVIDTVSDKLAASGDTKDTVTWSVETSKG
FT                   QYGDLVLNPSTGEWHYHLNNFDAKTNALFEGEHHNETFTITATDNLGNRVSSVICVAVE
FT                   GSNDLPVISGVHHASLNELGSVDKVSGQLIATDPDTGDGVHWAVPHSSGVYGELVIDPD
FT                   TGVWQYRIDNSSPNTLALHAGQVATETFRVTATDSSGQPVSQIVTIEVHGADQRAIIHG
FT                   IASGSVTEDRDLVAGQLQTSGQLTVIDPDGGDAHFIATTLQGQYGTLTINDLGHWTYTA
FT                   DNSQSAIQGLKSGESLTETLFVHSIDGSDQKVTVTINGTDDRAVIGATTGAVTEDKDLY
FT                   QGLLRVDGALTVTDADHGEEQFVATSLQGQYGTLTINNLGHWTYTADNSQAAIQGLKSG
FT                   ESLTETLFVHSVDGTEQKVIVTINGTDDRAVIGGTATGTVTEDKDLYQGQLRVDGALTV
FT                   TDADHGEAQFVATSLQGQYGTLTINDLGHWTYIADNSQAPIQGLKSGESLTETLFVHSI
FT                   DGTEQKVTVTINGTDDKAVIGGASTGAVTEDKDLYQGQLRVDGALSVTDADHGESQFVA
FT                   TSLQGQYGTLTINELGHWTYTADNSHSAIQGLKSGESLTETLFVHSIDGTEQKVTVTIN
FT                   GTDDKAVIGDASTGAVTEDKDLYQGQLRVDGALTVTDADHGEAQFVATSLQGQYGTLTI
FT                   NDLGHWSYTADNSQTAIQGLKSGESLTETLFVHSIDGSEQKVTVTINGTDDKAVIGGTA
FT                   TGIVNEDRDLYQGQLRVDGALTVTDADSGQNQFIATSLQGQYGTLTINDLGHWTYTANN
FT                   SQAAIQGLKAGESLTETLFVHSVDGTEQQVTVTINGTDDKAVIGGAATASVTEDRDLYQ
FT                   GQLRVDGALTVIDADSGQAQFQATSLQGQFGTLSIDSNGHWTYTADNDQPAIQGLKSGE
FT                   SLTETLFVRSVDGTEQRVTVTINGTDDKAVIGGPSTGAVTEDRDLDQGQLRVDGALRVT
FT                   DPDSGQAQFQATSLQGQFGALSIDSNGHWTYTADNSQATIQGLKSGESLTETLFVHSVD
FT                   GSKQKVTVTINGTDDRAVIGGAATGAVTEDRDLYQGQLRVDGALSVTDADHGEAQFIAT
FT                   SLQGQYGTLTINDLGHWTYTADNAQPAIQGLKSGKYLSETLMVHSVDGTEQPITIKISG
FT                   QDDAAVITGEDKGNLKEDYYPAGDAHNTLHYTGSLDVHDPDKGESYFRATHDAQAISDP
FT                   FGGSLDIEKHGVWQYVVSNNALQHLGKGQFEQVVYRVYSADGTSKDITITLEGTNDAPV
FT                   ISATQILPAGQEDTQMRLTPAQLLAHAKDVDDNDAGQLTVANLQADHGTITTNPDGSFS
FT                   FTPEKDYNGAVHFTYDVKDAHGGVTHTGASTTLAAVSDQAQVSGDTRGELVEDQHPDAH
FT                   NQIAISGQLNVQDPDAGQAAFQAGTATQVDDPFGGSLHIGADGSWTYDVDNARLQQLSE
FT                   HQEVLVTHRVYTLDGTAQDIVIKITGTNDAPKLGVVRLSSTTGHLTVQDPDNQDSHSFS
FT                   VAQQTGQFGTLVVDPDTGAYSYHLNQSVAGMHYDKASGQYQGTDTFEVQVSDNHGGSET
FT                   KFISFDARVSLTMPTGTGLQPQLHATVTSPSQLVDTKPQQTPTQTIGNAITLVLSHGSD
FT                   TGVSDSDGITHDSHPVVEGQTDIPFSLVTLYEQGNKLTSLLSDAQGHYSVALSGLSEGA
FT                   HQISASAQAPGSQQTVQATPLALTLDTQTDIAVHSASLNGHGELVVQVYLPKDSELTQL
FT                   VISSSGGGQPLVIDPQHHDAIGGSVSHPDHQYINFEHIDLSSLPDGELTISVRGQDVAG
FT                   NQASASSSQFNGLPLSLNTNIPPLTLALTHDTGQSSSDGITTDASLTIGGQLAGMRVEY
FT                   SVDGGQHWQSQFTPVQGHNQLWVRQTDAFGHASPHTQLDFELDNQAPLPQIRLDAITPD
FT                   NLVNAVEAGRSIAVTGSVNSEVPGGTPITLAIGQQTYQGQVDNQGHFSVQVPGSELAGA
FT                   HEINASLTTTDLAGNQGSATENHQYQVDTQASIDMNPIAGDNMLQAGEQHQALTISGTV
FT                   TNVEEGQRVTVSIGGQQYHANVHNGCWSTQLSAAEVDALPGGSLEIKAMVSDLAGNQAQ
FT                   MSSPLYVVDHANPIPSMSFITPPTPTGTGAIGSHISGDLIAPPLLQQLTPNAPTTGAWA
FT                   IDDGHGHPTLSLRGQYGTLTIDPDTGHVDYVYNQAPTPGDKAAGGTHWAGETTSETHHD
FT                   IFHILYHDSHSSNVDVEVNLDITYVHGHSGHNQLSTQLVDMTVTPVTTSPAPPPPPPEL
FT                   HDTPQWDDNQDASDDAQVIVIQASEGEAEDKHAADLDEKLVHSQPHELAASGAEPSHTE
FT                   ADTRPLAAATLAPVDHYLQMVGLSQQDLAQVESHTKPQPDLETPLMATEHFDADDLTLT
FT                   PADQFDNPLLEEHEKEKPHPSLVDIDDPRDDQHASAHDDDLLHNALNDMHNQF"
FT   gene            complement(577130..578455)
FT                   /locus_tag="Shew_0511"
FT   CDS_pept        complement(577130..578455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0511"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: son:SO4148 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22383"
FT                   /db_xref="GOA:A3QA85"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA85"
FT                   /protein_id="ABO22383.1"
FT                   /translation="MNDSQLTQRSWPEHEFTEAVEAPAEKRAIRRITFFIATAVFILLI
FT                   WSIFTNIEEIAKAKGQVVPLGHRQVIQSQTGGTLASIAVAEGDLVQKGDLIANFVATDS
FT                   QALKEELQSKQANLELKIERYTAFLEEREPDFNAYQLGFPALVAQHINALARMNQEKQA
FT                   IIALSESDVAKSEAELASVEQEITPLKDQIRSVEQTLKMMNSVKEQQAVSKLRMLESQQ
FT                   KLDAYIRELKVLEGRRSVLQRNIDNQEKQLAQKQASLFNEVGEKRTDAQAELLGIVARL
FT                   KSSDSLVQQNRVTSPVDGIIQSIPNNSAGSVIQPGGTVAVIVPTTPTALLEAKLSPRDI
FT                   GFVTVGQKARIKIDAFDYSRYGAIDGLVKKISPSTDADEKGGVFYKVQIAIDKPYFGDQ
FT                   PDKLALIPGMTGEADIVTGDKTVFQYLWKPVFTNVTEAFGER"
FT   gene            complement(578448..580547)
FT                   /locus_tag="Shew_0512"
FT   CDS_pept        complement(578448..580547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0512"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter-related protein; SMART: AAA
FT                   ATPase; KEGG: son:SO4147 ABC transporter,
FT                   ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22384"
FT                   /db_xref="GOA:A3QA86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA86"
FT                   /protein_id="ABO22384.1"
FT                   /translation="MNQHLDPIHLPKSLLIALFHQLGLSVQASNIDKSDLHDRLTHLEA
FT                   YILLKKHHVGIKVQALDANLLVHSVYPFILLPQDGEPMVARRSNHSFQYLSKDNQWLTL
FT                   DKLPGAGHVFLVESLPAQSRSSSVFASHLAKLRPWYRPIFWLSLLSSLSGLAIPLFTMA
FT                   VYDRVIGGQAPQILPSIALGAALALGIFVASRLLRAQALANVSNRFARDLSGITFNRLL
FT                   SMPLSLLSRVGLSSHIARMRNAEKVRSLVAGPGGGGLIDLPFTLIALVAITLLSGVLVL
FT                   VPLGMLLLFYLVMKALDKFTQAAAPTISGEYQNSLNELSTHLLPLKSAGESGAWYEQFM
FT                   RRAREHCRQNFLYSKRAGLNAAVAHAMGLFTALATVFTGIFLVLNQSITPGALIACVML
FT                   IWRITGPAQLAFASRQKFTLLKGAVDQFDRFMGVTTEFNELRLDSPNLNQTPALSFKHV
FT                   TLRYSADSEPALSGVTLDIETGETVAIIGPNGSGKTSLLLTAIGVIEPQAGFVTVNGKN
FT                   LKQFDPEIFRQWAAYSPTNSEILPGTLADNLRLAKPEASDEELKQALTDAGGASLLQAL
FT                   KQNIDANLFSRGTSMFSAVESSYISLARALLKGSPLLVMDEPIANRNPFARQAFIQTLK
FT                   RLKGKTTILFTTHDQALIQQADKVVILDKGTVVYAGPLPNQDGVTTQGATNQDSTPSME
FT                   ASQNE"
FT   gene            complement(580547..582205)
FT                   /locus_tag="Shew_0513"
FT   CDS_pept        complement(580547..582205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0513"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter-related protein; KEGG:
FT                   son:SO4146 toxin secretion ABC transporter protein, HlyB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22385"
FT                   /db_xref="GOA:A3QA87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA87"
FT                   /protein_id="ABO22385.1"
FT                   /translation="MVKTFRLLAQNQSFNELLLTSVFINLLSLALPFTMLQIYDRILPN
FT                   EAHGTATVLVIGVAIAILLELILRYARSWLLGASAANYELHTITRVVKRLLNADYHHIE
FT                   NLGAGKISHGIHSIAAMRDIYSGQAAVALMDFPFVLIFLALVAYIGGPLVFIPLIVWLI
FT                   AGVRVWQLGQKLSLATKELSLSQDERTRLLMLVLSGLTTTKAMALESRMTYAYKKINHQ
FT                   RLAQQEEVDWLSAKLQELIQGTAQATTLCLVMIGCFEVLNGNLTTGGLAACSILAGRAV
FT                   APLSAIGSLRAKYVSAKEAMDQVNALIATPQETFNGQTRYQQKLPLGPISFESVSAEKT
FT                   SARLDNISLTIPAGCIVTVTSNPMTHASLLLSTIGAYHQLDSGQIAIAGVPQQDHDGFE
FT                   YRQSICYVPPWASLFSGSILENMTLFRREREASAMLIADQLGLSATLAQLPAGYQTQVG
FT                   SNENQVLNKGAIKLIALVRALAQSPSILLLDEPMVSLDADSQARLLQVLMERRGQMTVV
FT                   IASYFDEVAALSDMQIALGEHGELAGQAQGQGGVR"
FT   gene            complement(582488..583894)
FT                   /locus_tag="Shew_0514"
FT   CDS_pept        complement(582488..583894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0514"
FT                   /product="cytochrome c, putative"
FT                   /note="KEGG: shm:Shewmr7_0439 cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22386"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR024673"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA88"
FT                   /protein_id="ABO22386.1"
FT                   /translation="MKHTLSLTAMFAAGVFGLASLNAIAENPHKEAIQGPFTQGSQVTE
FT                   QCIECHEDHAKDFMKSSHWTWELEQKLPGRTVKRGKKNAINNFCTSIAGNEPRCTSCHA
FT                   GYGWKDNNFDFSDMTKVDCLVCHDTTGTYVKDPAGAGEALAKVNLERVAQNVGMPVRDN
FT                   CGSCHFYGGGGDAVKHGDLDSSMAYPDKATDVHMDSDGNDFQCQTCHTTQQHQITGNAM
FT                   GVSPGGENDIGCENCHDSAPHANKRLNTHTASVACQTCHIPFFARNEPTKMSWDWSTAG
FT                   SDQEETVDEYGKHTFMKKKGSFVWGKMVKPEYAWYNGKADAYMVGDKMDPSKVTKLTAP
FT                   LGDITDKTAKIYPFKVHRGKQIYDKKQNIFVTAKVYGKGGYWKEFDWDKAAKLGMEANQ
FT                   ALAQQGIKYSGEHGFAETEMWWRINHMVSPKDQALKCNDCHNKGTRLDWQALGYEGDPM
FT                   KNKKGAKHAK"
FT   sig_peptide     complement(583817..583894)
FT                   /locus_tag="Shew_0514"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 26"
FT   gene            complement(583939..585651)
FT                   /locus_tag="Shew_0515"
FT   CDS_pept        complement(583939..585651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22387"
FT                   /db_xref="InterPro:IPR021803"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA89"
FT                   /protein_id="ABO22387.1"
FT                   /translation="MRTLLSILIANALAMSGSVYAADSDAQKIAELKQQLADLTEEIDQ
FT                   INSRVDKNERHTALDRLEITGDFRTKAHSLHYQNVTWNPAIKVDFNDFGAKAMSGAFGM
FT                   PNDPNSPLGQMMAANPELAAAFQSGMLQGVMPYVLAPKTTQDINNDIFYTTRLRLNLKA
FT                   KVWDNVSFAGRLSMYKNWGDSTGVQVFDSWRSFTMDGTNSGNTSGDWLRVERAYFDWKN
FT                   IGGSNTYLSIGRRPSTYGPPTQYRENEKRGGTPSGHLVNFNFDGLTLGYKLGELTGIEG
FT                   QVVRFCYGQGFESQWGNGEMFGDIVTKDTHLGGFNIDAINDGNHFLQFTLFGAKDINDG
FT                   FKGTMAFPTQLAGIFAPTMYQDMQKFSNFNFQTRVQPSGVIGDMYLGGIGYAYESDEDF
FT                   KAFASFGWTRAEGNGNAGMFGGMLSDAVFEAQLNADGSEIIMMPSAADENDTKDGYGIY
FT                   VGIQIPAPYGKFGLEYNYGSKYWTPFTQAQDDPIGSKLATRGHVAEAYYMFDINPRMFI
FT                   KLAGLYYDYEYTGSGTPVGAPQKVDDVIAGSAFSMLPVVDTAYDINASLVVNF"
FT   sig_peptide     complement(585586..585651)
FT                   /locus_tag="Shew_0515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(585716..586045)
FT                   /locus_tag="Shew_0516"
FT   CDS_pept        complement(585716..586045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0516"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: shm:Shewmr7_0441 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22388"
FT                   /db_xref="GOA:A3QA90"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA90"
FT                   /protein_id="ABO22388.1"
FT                   /translation="MMKNVAKIATCLILAFTVGGQVYAVDGGNPKKGKHLYKKECKACH
FT                   SKGDAAGELTPMSKTMSQWDRFFKRDMHGAQPDVFKKLSDKERLDIQQFLYDHAADSDQ
FT                   PQTCG"
FT   sig_peptide     complement(585971..586045)
FT                   /locus_tag="Shew_0516"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            586558..587754
FT                   /locus_tag="Shew_0517"
FT   CDS_pept        586558..587754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0517"
FT                   /product="putative plasmid transfer protein"
FT                   /note="KEGG: eca:ECA0549 putative plasmid transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22389"
FT                   /db_xref="InterPro:IPR032811"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA91"
FT                   /protein_id="ABO22389.1"
FT                   /translation="MKYLSLVIAVLLSGSASLASAASLYNEARSDAMGGTGVAASNREG
FT                   AAFINPALLAIHAPKYSGGAVMLPVLGAEAANIDNLTDKFDALQASYDGLEAAINASDV
FT                   TGITNYRDMLVADLKSLDGENAYGSVGLGFSVVLPTKRMPMSIFYKTYIDAVSVAVIED
FT                   SDIDALTNLDPNNPPAVTDLDSQGAVVAGAISDLGVALSFPLSIVNMPVAVGISPKLQR
FT                   IDTYNYVVSANNFDADDFDDNKYRNDDTVANLDIGVAIQPLERMTIGLSGRNLVSQKLD
FT                   TVEAMGRKFTYRVEALYTLGVAYDWDNFSLTTDVDLNGHKRFDEIGETQYWRLGGEMRA
FT                   TDWLALRVGYRHDMKDTSSNLYTLGTGFTIGRSFNLDLTGLVGTDDAVGGVIQTSYHF"
FT   sig_peptide     586558..586623
FT                   /locus_tag="Shew_0517"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 22"
FT   gene            complement(587818..588558)
FT                   /locus_tag="Shew_0518"
FT   CDS_pept        complement(587818..588558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0518"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   son:SO4058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22390"
FT                   /db_xref="GOA:A3QA92"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA92"
FT                   /protein_id="ABO22390.1"
FT                   /translation="MPALPLDPHILALASLIVFVGALTQSLIGFGMAVVAAPLLYLIEP
FT                   SLVPAPVILMGFSIALLTLIRERGALEFNGLQYALLGRIPGGLIGAGLLMVAPQDVLGM
FT                   TIAIIVAIAVLLSLMRLNLVVNRRSLFIAGVISGIFGNIAAIGGPPLAILLSGKDAKQF
FT                   RAALSAFFIFSSTIAIVILGLTGLLTLHHFYCSALLLPSVLLGYLMANRLVGRIDKNKT
FT                   RIMTLVLCSLSAILLAAKSLSALL"
FT   sig_peptide     complement(588448..588558)
FT                   /locus_tag="Shew_0518"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.854) with cleavage site probability 0.771 at
FT                   residue 37"
FT   gene            complement(588637..588951)
FT                   /locus_tag="Shew_0519"
FT   CDS_pept        complement(588637..588951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0519"
FT                   /product="methionine repressor, MetJ"
FT                   /note="PFAM: Methionine repressor MetJ; KEGG:
FT                   shm:Shewmr7_0511 methionine repressor, MetJ"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22391"
FT                   /db_xref="GOA:A3QA93"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA93"
FT                   /protein_id="ABO22391.1"
FT                   /translation="MTEWNGDYISPYAEHGKKNEQVKKITVSIPLKVLKVLTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAYTGQPLPQDDDLSKDKPDSIPAEVKRLMTEMGIEWEEME
FT                   "
FT   gene            589176..590342
FT                   /locus_tag="Shew_0520"
FT   CDS_pept        589176..590342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0520"
FT                   /product="cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: she:Shewmr4_3439 O-succinylhomoserine
FT                   (thiol)-lyase; TIGRFAM: O-succinylhomoserine (thiol)-lyase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22392"
FT                   /db_xref="GOA:A3QA94"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA94"
FT                   /protein_id="ABO22392.1"
FT                   /translation="MTARKLATAAVRRGIESDTQHGAVVPPIYLSTNYSFEGHQQPRAF
FT                   DYSRSGNPTRSILGDAIAELEQGATGVVTCTGMAAITLVTSLLGPEDLLVVPHDCYGGS
FT                   YRLFTNLAKKGAFKLLVVDQTDERALEQALTQSPKMVWLETPSNPLLRVVDIEAIAQAS
FT                   HKVGAQVVVDNTFLSPVLQQPLQLGADIVVHSTTKYINGHSDVVGGAVVAKDPEVGELL
FT                   HWWSNTLGLTGSAFDSYLTLRGLRTLAVRIREHQANAQKVLALLCDHKAVEKVYYPGLA
FT                   EHPGHEIAARQQKGFGAMLSFELKGGESALVAFLDALQYFSVAESLGGVESLVAVPATM
FT                   THRAMDPDARREAGVKDTLIRLSVGIEDGEDLVADILAGLEAAIAVSS"
FT   gene            590362..592755
FT                   /locus_tag="Shew_0521"
FT   CDS_pept        590362..592755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0521"
FT                   /product="aspartate kinase / homoserine dehydrogenase"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /note="KEGG: she:Shewmr4_3438 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; homoserine dehydrogenase; homoserine dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22393"
FT                   /db_xref="GOA:A3QA95"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA95"
FT                   /protein_id="ABO22393.1"
FT                   /translation="MTRCHLHKFGGSSLADADCYRRVAHILLTHGHSDDLIVVSAAGKS
FT                   TNFLYRLLELCDTDQLWQEELQVLVSYQQNLIEQLLSNEQARSLRERLATDKSQLTSLL
FT                   SLDELNDYQRNQVVSFGERWSSCLLAALLRESGVAATDVDARTLLVADEGAVPQIRLGE
FT                   SRQKVQALLEAHPQERLVITGFICANEQGDTLLLGRNGSDFSATLLASLADIERVTIWT
FT                   DVEGVFNADPNRINDAKLLKSMSLTEANRLAHLGSPVLHNRTLQPLFDTEVSLAVRSSY
FT                   APHTDFTLIAPKSSSASAPVVTSLSSVSLFSLTISVELPQLLACFAQAGLTPLAYWSLA
FT                   HGRAELAFTHENQKQAQAIFEAKRSELGIDELQLRDDLGLVALVSADASLYRRGFSRLL
FT                   SREAHPLCNDGLSLVTLVPKAQVNLLTQKVHRRCAGPRKRIGVLLLGIGNIGEAWIDLF
FT                   KRARPVLNKELEVSVELVGLLSSKKALLSETDIDLSSWQQAFEERGTGWQYTHLFEQLQ
FT                   ALNCDELIALDISASADLTLQYPEFFARGIHIVSANKLAGSGPLAFYQELKQQLGNRRL
FT                   FWRYNASCGAGLPVQHALNDLHNSGDSIEAVGGIFSGTLCWLFEHYDAKKPFSELVLEA
FT                   KGLGITEPDPRDDLSGRDMQRKLLILAREIGYDIELDDIELESLVPTKLAEIPLDDFIK
FT                   RMAELDGEMLQQYQAAAEQNKVLRYVASLDSEQGQLKAKVGIQWVDRSHPYANLTPGDN
FT                   VFVIRSDFYQDNPLIIRGPGAGREVTAAAVQSDLAQICRDLLQE"
FT   gene            593019..593909
FT                   /locus_tag="Shew_0522"
FT   CDS_pept        593019..593909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0522"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="TIGRFAM: 5,10-methylenetetrahydrofolate reductase;
FT                   PFAM: methylenetetrahydrofolate reductase; KEGG:
FT                   shm:Shewmr7_0514 5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22394"
FT                   /db_xref="GOA:A3QA96"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA96"
FT                   /protein_id="ABO22394.1"
FT                   /translation="MAFHHAQHANSLNQSLSELNGDINVSFEFFPPATPEMETILWNSI
FT                   RRLEPLKPKFVSVTYGANSGVRDRTHGVIERIQKETDLVAAPHLTLVDASDEELVELAK
FT                   HYWNSGIRDIVALRGDLPAGSPKPTRFANDLVRLLKSVADFDISVAAYPEVHPDAPNAQ
FT                   ADLINLKKKIDAGANRAITQFFFDVESYLRFRDRCVAAGIDVEIVPGILPVTNFTQLKR
FT                   FAGMTNVSIPSWLHKQFEGLDDDPSTRQMVGANVAIDMVKVLSREGVKDFHFYTLNRAE
FT                   LTYAICHTLGVRPGK"
FT   gene            594034..594633
FT                   /locus_tag="Shew_0523"
FT   CDS_pept        594034..594633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0523"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: shm:Shewmr7_0519 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22395"
FT                   /db_xref="GOA:A3QA97"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA97"
FT                   /protein_id="ABO22395.1"
FT                   /translation="MYRMLIGVTALFLSSQVMAANEMPPAAALCGSCHGPTGMGIEPIA
FT                   PRIAGLSSEYIVKQIHLFQQGDRQNPSMTPMAMTVQGEAINQVADYFAAQPLPAFTPVV
FT                   RGSQTSYQSAAETLVYQGDWQRTLPACVSCHGPSGIGGGQFPRLAGQQASYLKTQLMAW
FT                   QSGTRKGDIDNMMGNIASKLSQDEIAALADYFATLK"
FT   sig_peptide     594034..594093
FT                   /locus_tag="Shew_0523"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            594644..595705
FT                   /locus_tag="Shew_0524"
FT   CDS_pept        594644..595705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0524"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: son:SO4047
FT                   cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22396"
FT                   /db_xref="GOA:A3QA98"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA98"
FT                   /protein_id="ABO22396.1"
FT                   /translation="MNRNLMTLSGLLFFALGNNVQAGDLPDKQAELKLAAPAQDADYLK
FT                   MRSLATIPEGVFGDKVRLGYQLFVNTQQLRGQYVGNELNCVNCHMDAGRRANASPLWAA
FT                   YLAYPAYRKKNDKVNSYQERIQGCFTYSMNGKAPESGSEPLVALSAYSYWLAMGGLMDK
FT                   YGVTGAVPELSDAELLKGGKREDFVLPEAIAKATTLDERAKLPGRGFPAIPKPEQAYSP
FT                   ARGEQVYRAHCQSCHGENGEGLAMGGVYSLPPLWGPNSFNWGAGMHRVNTAANFIYENM
FT                   PLGKSVQLSHQEAWDVAAFVVSHERPQDPRLEGDKVMELSKRYHQHQGYYGKSVGEGAV
FT                   LGTQSYPINPVKQ"
FT   sig_peptide     594644..594712
FT                   /locus_tag="Shew_0524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            595779..596003
FT                   /locus_tag="Shew_0525"
FT   CDS_pept        595779..596003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_0645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22397"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:A3QA99"
FT                   /protein_id="ABO22397.1"
FT                   /translation="MDSMRTNASQCPLCHQPNQCAVVAGRESDTCWCHHQTFAPKAQLP
FT                   QAIAPDVCICQACAEALRLEAELGVKRVD"
FT   gene            596035..596406
FT                   /locus_tag="Shew_0526"
FT   CDS_pept        596035..596406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22398"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAA0"
FT                   /protein_id="ABO22398.1"
FT                   /translation="MKNSAIMLLGLLVLAGCSNLTLTTNISPEEALKTSKVEEYSMAEI
FT                   GRYKADYLGKVSTSMCRTRSTQPKPTESLLVGNLKYKAQKLGANGIVVMECVDHKINND
FT                   CPEFLRCDALAYRVDFDAL"
FT   sig_peptide     596035..596106
FT                   /locus_tag="Shew_0526"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.313 at
FT                   residue 24"
FT   gene            complement(596449..597303)
FT                   /locus_tag="Shew_0527"
FT   CDS_pept        complement(596449..597303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0527"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: sfr:Sfri_3249 Sel1 domain protein repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22399"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAA1"
FT                   /protein_id="ABO22399.1"
FT                   /translation="MKRIIKTLSIGLTFWAITSTSYASGLPECDSAECKEYFKAYTILT
FT                   KRGHSDAMATLGELYYAGYGTKKNPEKALKWFRRAAKFGNTTAQYKAAVMYLQETDYQD
FT                   VDKAISLLERSMKVNFSPSALVLGKVYLNDTLVKQDLTEADKWLSRAYELNNASAKVFA
FT                   ANLKKSELAKTLPLPKLYAMVDADKDAKPGSNAPVGEMETITVTAPDYNRYFDDEIARL
FT                   NNSRPDTESGTGSNIAGRTCAEMWGCSTEGDSERVRDVLLSDWGRETIPFRIEGPNYYP
FT                   SSR"
FT   sig_peptide     complement(597232..597303)
FT                   /locus_tag="Shew_0527"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 24"
FT   gene            complement(597398..598222)
FT                   /locus_tag="Shew_0528"
FT   CDS_pept        complement(597398..598222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0528"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: sfr:Sfri_3249 Sel1 domain protein repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22400"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAA2"
FT                   /protein_id="ABO22400.1"
FT                   /translation="MMKKRLKALSIGLSLLAVTSQGFAAGLPECDTAECQEYFKAYTIL
FT                   TKRGHSDAMATLGELYYAGYGTEKDMEQAFKWFRRAAKFGNTTAQYKAGIMYLQDSKGR
FT                   DIDKGITLLKRSSKVGFSPSAFVLGKIYLGNELVKQDLAEADHWLAKAYELNNQEAQKF
FT                   AKQLKASEQGQTLALPTLYALLDTQASSKPGSNAPVGEMETITVTAPDYTQFFNDEIAR
FT                   LNNSRPDTEKGTGSNIAGRTCAELWACSTEGDSERIRDFLLSDWGRIALSFR"
FT   sig_peptide     complement(598148..598222)
FT                   /locus_tag="Shew_0528"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 25"
FT   gene            complement(598302..599129)
FT                   /locus_tag="Shew_0529"
FT   CDS_pept        complement(598302..599129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0529"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: sfr:Sfri_3249 Sel1 domain protein repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22401"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAA3"
FT                   /protein_id="ABO22401.1"
FT                   /translation="MQRIVNKLLLVAALVAIAPLCNATQLAPCKTAECEAYFDAYTILT
FT                   KRGHSSAMATLGELYYSGYGTEKDLDKAFKWFRRAAKFGHTTAQYKAGIMYLQTSAYQD
FT                   IDKGIALLKRSAKATFSPSALALGKIYLQDTLIPRDLAATDRWLTFAYKLNNLEAMKFA
FT                   KTLRESPDTAKLPLPKLFALVDAEKPVAADSKSSLEEMEIILVEAPDYAAYFDEEIAQL
FT                   NQSRPDTAKGTGSSIAGRTCSDIWACSSEGDSERIRDLQLSDWGNIALALNVR"
FT   sig_peptide     complement(599058..599129)
FT                   /locus_tag="Shew_0529"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 24"
FT   gene            599363..600490
FT                   /locus_tag="Shew_0530"
FT   CDS_pept        599363..600490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0530"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG: pae:PA5145
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22402"
FT                   /db_xref="GOA:A3QAA4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAA4"
FT                   /protein_id="ABO22402.1"
FT                   /translation="MDKLDAIVIGAGVVGLAVAASLSRRFGNVLIIDRAETIGTGISSR
FT                   NSEVIHAGIYYPTGSLKAQLCVEGKRQLYAYCRRRGVAVNSLGKLIVATQVEQEAQLDA
FT                   LFTQARANGVDDLNPLGRRQLQALEPALKASAGLLSPSTGIVDSHGLMLSLLAEAEEYG
FT                   AIFCPHTEFITTQADANGFRVELMQQGERVSLETSFLINCAGLFATEVATRIEGLAESL
FT                   VPQLYWCKGHYFAYQGKSPFAHLIYPVPEPGLKGLGIHATIDLGGQLKFGPDAQYMVPD
FT                   SLEDYRVPEALRQRFHQAIASYYPGIAIERLQTAYAGIRPKLQGPDDTEVADFLIQGEA
FT                   QHGIPGLVNLLGIESPGLTASLAIAEQVSRQLVTP"
FT   gene            complement(600553..602352)
FT                   /locus_tag="Shew_0531"
FT   CDS_pept        complement(600553..602352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0531"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA, RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: shm:Shewmr7_0528
FT                   DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22403"
FT                   /db_xref="GOA:A3QAA5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAA5"
FT                   /protein_id="ABO22403.1"
FT                   /translation="MSSSEKTFRELGLSEPLLRALDELGYEKPTPIQAASIDPLMAGKD
FT                   ILGQAQTGTGKTGAFALPLLNAIDPNRNVPQILVLAPTRELAVQVAEAFGSYSKFMKGL
FT                   HVLPIYGGQSMHQQLNALRRGPQIVVGTPGRVMDHMRRGTLKLETLNALVLDEADEMLK
FT                   MGFIDDIEWILEHTPQERQLALFSATMPEQIKRVANKYLQTPVHISIAASHTTVESIEQ
FT                   RFVQVSQHNKLEALVRVLEVENTEGIIIFVRTRNSCVELAEKLEARGYASSPLHGDMNQ
FT                   QARERAVDQLKRGKLDILIATDVAARGLDVERIGHVINYDIPYDTEAYVHRIGRTGRAG
FT                   RTGMAILFVTHREMRMLRTIERATKSRISPMNVPSPETVAERRLSRLGEQVSNTIDNES
FT                   LDFMHGAVAQLCQQLEVDTEVLAAALLNMVQQERPLQLPPIQERQRDSRDERNSRDRGD
FT                   RSDRAPRGRRESRPTPANLGQADTLKDHPDVKMCRYVLDVGRDHGVGVGNIVGAVANEA
FT                   NIDSRYIGQIQLFDQITSIDLPEGMPKDVLQHLKKVRVCGKPLNIREAGSEIVNASDDN
FT                   RAPRRRKPVGERKSHRKGNRDNG"
FT   gene            complement(602600..603628)
FT                   /locus_tag="Shew_0532"
FT   CDS_pept        complement(602600..603628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0532"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; KEGG: shm:Shewmr7_0529
FT                   peptidase M28"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22404"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAA6"
FT                   /protein_id="ABO22404.1"
FT                   /translation="MRSPYAPVHKHYLRLAPLLSLLKLGLFTLSLLTLGLAGCAESPND
FT                   RRCGDEYRLTWSDQARLLAHVKTLSSDQFAGRKTGTDGAALARDYITNQMQLAGLTPWQ
FT                   GHFDHDFEYDYQFGTRLGTNIIGILPANEPSDSWRLVVAHYDHLGKQGYKLYHGADDNA
FT                   SGVAGMLEIAFHSARLPRDTNLMFIATDAEEPGLYGSKAFVDGLMAPDAKLKASQIQLM
FT                   VNLDMIGRPARNSRIYLEGRRGFGQFEQIKARLEQTVNLCIRANHPPEAGKTIQKVDWL
FT                   RASDHYPFHQAGIPWLYFGVPPHKDYHQPSDAASKIDVNFLAAVTETAYKLLIIDTYLL
FT                   NN"
FT   sig_peptide     complement(603506..603628)
FT                   /locus_tag="Shew_0532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.688) with cleavage site probability 0.650 at
FT                   residue 41"
FT   gene            complement(603761..606586)
FT                   /locus_tag="Shew_0533"
FT   CDS_pept        complement(603761..606586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0533"
FT                   /product="Excinuclease ABC subunit A"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter-related protein; KEGG: shm:Shewmr7_0531
FT                   excinuclease ABC, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22405"
FT                   /db_xref="GOA:A3QAA7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAA7"
FT                   /protein_id="ABO22405.1"
FT                   /translation="MDKIEVRGARTHNLKNINLTIPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLLFARVGEPRCPTHNQPLAAQTVSQMVDKVLTLPEGSRQMLLAPVINDRKGEHV
FT                   KLLDSLAAQGFIRARIDGEVCDLSDPPALELHVKHTIEVVVDRFKVRDDLQQRLAESFE
FT                   TALELSGGIATVASMDGDSEELLFSANFACTHCGYSMAELEPRIFSFNNPAGACPTCDG
FT                   LGVQQFFDADRVITNTELSLAGGAIRGWDRRNFYYFQMLTSLAEHYKFDVEAPFEKLSA
FT                   KIRNIVLHGSGKESIAFKYINDRGDVVVRNHPFEGILNNMDRRYRETESNAVREELAKY
FT                   INTQACSSCGGSRLREEARHVFIEDLNLPRLTDWSIGEAMEYFEQLSLTGQRAQIAEKI
FT                   LKEVRDRLGFLVNVGLNYLSLSRSADTLSGGEAQRIRLASQIGAGLVGVMYVLDEPSIG
FT                   LHQRDNERLLNTLIHLRDLGNTVIVVEHDEDAIRMADHIIDIGPGAGVHGGQVICDGPL
FT                   KEIVACDESVTGQYISGKKQIHISEKRAQYDASKVIELFGASGNNLKQVDLTIPVGLFT
FT                   CVTGVSGSGKSTLINDTFYKIAHRQLNGATVDEPAPYKKVAGMDHCDKVVDIDQSPIGR
FT                   TPRSNPATYTGIFTPIRELFAATQEARTRGYKPGRFSFNVKGGRCEACQGDGLIKVEMH
FT                   FLPDVYVPCDSCKSKRYNRETLEVRYKGKNIHEVLEMTVEEAREFFDAVPAIARKLQTL
FT                   MEVGLSYIGLGQSATTLSGGEAQRVKLAKELSKRDTGKTLYILDEPTTGLHFADIQLLL
FT                   DVLHRLKAHGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGTILVSGTPEQVAEHPSSH
FT                   TARFLKPLLKG"
FT   gene            606789..608156
FT                   /locus_tag="Shew_0534"
FT   CDS_pept        606789..608156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0534"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   she:Shewmr4_3420 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22406"
FT                   /db_xref="GOA:A3QAA8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAA8"
FT                   /protein_id="ABO22406.1"
FT                   /translation="MANNGLSKTEKKVAFSLASVFGLRMMGLFMIMPVFALYGQHLEGF
FT                   SPLWVGIAIGAYGLTQAILQIPMGILSDRYGRKPIILIGLALFALGSLLAASADSIYGV
FT                   VAGRALQGMGAIAAAVLALAADLTRDEQRTKVMAIIGMCIGFSFALSLLVGPIVAEHLG
FT                   LSGLFAMTAGLALLGMVIVQLLVPNPIGQAPKGDTVAAPAKLKAMLTDPQLFRLDAGIF
FT                   ILHLVLTAVFVALPLDLVDAGLVKEKHWMLYFPAFVGAFFLMVPLIIIGVKKKNTKATF
FT                   QIALLIMIAALAAMALFANSLVVLSVAVVLFFTGFNYLEASLPSLIAKFCPVGDKGSAM
FT                   GVYSTSQFLGAFCGGLLGGGAYQLLGAAGVFAVALGLMCIWLLLTLGMQNPILLKSYTL
FT                   EAEVEGKEQARAMATELSQLPGVAEAIVVLEEKVAYLKVDEHFDLRQARAVLGSSN"
FT   sig_peptide     606789..606899
FT                   /locus_tag="Shew_0534"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.849) with cleavage site probability 0.802 at
FT                   residue 37"
FT   gene            608229..608891
FT                   /locus_tag="Shew_0535"
FT   CDS_pept        608229..608891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0535"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: sfr:Sfri_3710 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22407"
FT                   /db_xref="GOA:A3QAA9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAA9"
FT                   /protein_id="ABO22407.1"
FT                   /translation="MASRGVNKVILVGNLGKDPEVRYMPNGNAVANFTVATSESWKDQQ
FT                   GQMQERTEWHNIVMYRRLAEIAGEYLKKGSKVYLEGKLQTSKWQDQQTGQDRYKTEINV
FT                   NEMQMLDSRGQGQGGQGGQQGYGAPQQQNQYAPQQSAPAARPQQPQHSAPQGGYGAQQQ
FT                   AAPQQQGYGAQPQQAPAYAPKPQAAPQQQAPQQRPAPQPQQNFTPDLDDGWDDDIPF"
FT   gene            609087..610076
FT                   /locus_tag="Shew_0536"
FT   CDS_pept        609087..610076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0536"
FT                   /product="TIM-barrel protein, yjbN family"
FT                   /note="TIGRFAM: TIM-barrel protein, yjbN family; PFAM:
FT                   dihydrouridine synthase, DuS; KEGG: shm:Shewmr7_0746
FT                   TIM-barrel protein, YjbN family"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22408"
FT                   /db_xref="GOA:A3QAB0"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAB0"
FT                   /protein_id="ABO22408.1"
FT                   /translation="MSSATMPTAINRTFSIAPMLDWTDRHYRYFARLMSSELLLYTEMV
FT                   TTGAIIHGKGDYLAYNQEEHPLALQLGGSNPEDLAKCAKLAAERGYDEVNLNVGCPSDR
FT                   VQNGRFGACLMAEPDLVAQCVAAMNEVVDIPVTVKTRIGIDEQDSYEFLTEFVDKVSAA
FT                   GCDTFIIHARKAWLQGLSPKENREIPELDYDRVYRLKQDYPQLSISINGGVKTLEECGE
FT                   HLKQLDGVMVGREAYQNPYLLAQVDQQLCGLDKPVLSRDAVLENMIPYIEKHLVSGGRL
FT                   NHITRHMTGLYQGEAGSRAWRRYLSENAHKPGAGIAVVHEARASMELK"
FT   gene            610364..610642
FT                   /locus_tag="Shew_0537"
FT   CDS_pept        610364..610642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22409"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAB1"
FT                   /protein_id="ABO22409.1"
FT                   /translation="MNKLTKVSLIASLLVGASFSASADDFIPTDITAKLERHLATQMQE
FT                   MMVTAQQELTLSLQAQLSESLFDTNLKLAETATKSEEAPMKSAMVKE"
FT   sig_peptide     610364..610435
FT                   /locus_tag="Shew_0537"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            610824..611030
FT                   /locus_tag="Shew_0538"
FT   CDS_pept        610824..611030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0538"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: she:Shewmr4_3241
FT                   phage shock protein C, PspC"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22410"
FT                   /db_xref="GOA:A3QAB2"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAB2"
FT                   /protein_id="ABO22410.1"
FT                   /translation="MNIDDLVRRLKNPRSMVCGVAAMTADKFAWSCLWTRVVWAVAAFM
FT                   NPAFVLLVYFVLALVLPKWKPGY"
FT   gene            611049..611408
FT                   /locus_tag="Shew_0539"
FT   CDS_pept        611049..611408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22411"
FT                   /db_xref="GOA:A3QAB3"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAB3"
FT                   /protein_id="ABO22411.1"
FT                   /translation="MKGRTNLQKALDILLALGVILIVAAALMMLGHYFEARWFYISLES
FT                   PQWIDIGLWSTALVSALLLILLLWLTLAFSFIALVSSFCVLSAIAMLFAGFSLFWPILL
FT                   LLLAAWGVGQASRVD"
FT   gene            complement(611424..612161)
FT                   /locus_tag="Shew_0540"
FT   CDS_pept        complement(611424..612161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0540"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   shm:Shewmr7_0749 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22412"
FT                   /db_xref="GOA:A3QAB4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAB4"
FT                   /protein_id="ABO22412.1"
FT                   /translation="MSNIQFQDEQGVRIITINRPDKRNALNLEMYARLTEYLIQGESDN
FT                   GINAFLLKGEGDCFTSGNDVADFLKNSDLGQNHPTVRFLFTLLDLTKPLVAAVAGPAVG
FT                   IGTTLLLHCDLVYADNTAKFQLPFVNLALVPEAGASLLLPRLVGQTKASELLLLGEPFD
FT                   AQSALSMGLINDLLPSDELMSHAMSQSIKLAKKPPQALRASRRLIRGDSELIREQMQKE
FT                   LEEFAVRLQSDEAKAQFNAFLSR"
FT   gene            612211..612678
FT                   /locus_tag="Shew_0541"
FT   CDS_pept        612211..612678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0541"
FT                   /product="protein of unknown function DUF461"
FT                   /note="PFAM: protein of unknown function DUF461; KEGG:
FT                   shm:Shewmr7_0750 protein of unknown function DUF461"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22413"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAB5"
FT                   /protein_id="ABO22413.1"
FT                   /translation="MKQIFKHAFNFVLLSCTSFSVLANVMFVDGYVRAMPPSVPNTAAY
FT                   FTLMNHGPEVDLVGVDTEVADEAQLHTLVEEEGVVKMRQLPKFTLASHANLELMPSGKH
FT                   VMLLGLKKPLTEGQEVVLRLKFSDGSEQQLTLPVSKQAIATQDDGEHHHHH"
FT   sig_peptide     612211..612282
FT                   /locus_tag="Shew_0541"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.990 at
FT                   residue 24"
FT   gene            612691..613662
FT                   /locus_tag="Shew_0542"
FT   CDS_pept        612691..613662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO3906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22414"
FT                   /db_xref="GOA:A3QAB6"
FT                   /db_xref="InterPro:IPR016936"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAB6"
FT                   /protein_id="ABO22414.1"
FT                   /translation="MQVTWKRVSLAAAVLFLIGYIISVWWSVEPDSIEPHQLNNETGHK
FT                   IVGYATTTSLILTMETLLDKNGGWLSNDVMPPSLFMDNMPAFEFGAIEQARDLALIMRK
FT                   EFSRSQSQSTADKDLLAAHSKLNIEHTSWLVPSAEGEYRDAIKLLKLYRARIADTNNPD
FT                   AQFYARADNLNEWLKEVQKRLGSMSQRLSASVGQERINTDLAGDTEASQSTPNLASQEI
FT                   KTGWWQIDDVFYETRGATWALLNFMKAIEVDFADVLKKKNAEVSLQQIIRELEETQQPV
FT                   WSPIVLNGSGFGIVANHSLVMANYISRANAAVIDLTNLLTQG"
FT   gene            613667..614425
FT                   /locus_tag="Shew_0543"
FT   CDS_pept        613667..614425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22415"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAB7"
FT                   /protein_id="ABO22415.1"
FT                   /translation="MKKTLLACALLGSLAATSAQAATVVGFKVGGDYWNADTEGTFAQK
FT                   GQAQQEFDYSSSSQGSIWVAVEHPIPLVPNLKIRENRLDADGKATLTGDWTFGDRVFSD
FT                   DVTTASNLSNTDFVLYYELLDNDIVALDLGAAYKKMHGSFRVHQISPSGVVGAYAQKDL
FT                   SDGIVMAYANAEVGIPGLGLYGFADVMQGIDESSVYDYQVGLGWQFDGVALDTKVRVGY
FT                   RDFNFDVNNFDGVTANMQFKGYFAGVELVF"
FT   sig_peptide     613667..613732
FT                   /locus_tag="Shew_0543"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(614493..615839)
FT                   /locus_tag="Shew_0544"
FT   CDS_pept        complement(614493..615839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0544"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   son:SO3904 outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22416"
FT                   /db_xref="GOA:A3QAB8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAB8"
FT                   /protein_id="ABO22416.1"
FT                   /translation="MSKKGQLMKFKIRTLCAALTLAATTSAVHADDLLQIYQQALTNDP
FT                   IALQAQAQRDRLYEQIEENRAPLLPTISASVGYGKSWTNVDDDKYNSGLDAGVSLKQVI
FT                   YDHSAWVGLDLAELAASQADAAYASTLQSLIIRVTGAYFDVLAAKDNYEFKGAEKRAIE
FT                   RQLEQTKQRFAVGLTAITDVHEAQAQYDLARASEILAENQLINSYEALREITGIDHKSI
FT                   DILDTTRFTAVPPTPAMPNDWLKMAETSSVDLLTTRIGKDIAQQTISLYKAGHMPSLSL
FT                   NAGYTTNLNQKNQAGDLSDYDNANVGLTLSVPIFEGFKVSSKVNQAQYQYVEASEKMEQ
FT                   TYRKVVKDVRNNFNNVGASISSIRAYEQSVISSESALKATQAGFEVGTRTIVDVLNRTR
FT                   DLYDSKRQLSNARYGYINSILALKQATGTLSEDDVIAINNGLKAPEVSQ"
FT   sig_peptide     complement(615747..615839)
FT                   /locus_tag="Shew_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            616103..616711
FT                   /locus_tag="Shew_0545"
FT   CDS_pept        616103..616711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0545"
FT                   /product="ADP-ribose diphosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: she:Shewmr4_3235
FT                   nucleoside diphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22417"
FT                   /db_xref="GOA:A3QAB9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAB9"
FT                   /protein_id="ABO22417.1"
FT                   /translation="MSQKFTNEDVQMLGKRTLFQGFFRMEEYRFKHRLFAGGWSQEVVR
FT                   EVFERGHAVVVLPYDPVSDKVVLIEQIRIPVVNAATTPWLLEFVAGMIEEGESAEQVAH
FT                   RELLEESGLVASEMHYISQYFSSPGGTSERFDFYWARVDASQADGLHGLDDEHEDIKVH
FT                   VMPREAAFQLLQDGTINNASTVIGLQWLQLNYQSLRAAK"
FT   gene            616708..617154
FT                   /locus_tag="Shew_0546"
FT   CDS_pept        616708..617154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0546"
FT                   /product="protein of unknown function DUF1249"
FT                   /note="PFAM: protein of unknown function DUF1249; KEGG:
FT                   she:Shewmr4_3234 protein of unknown function DUF1249"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22418"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAC0"
FT                   /protein_id="ABO22418.1"
FT                   /translation="MSLSLNKRKPDYQANVSRFLALCSRNYFNILRWLPAGYEQGQSWQ
FT                   VEGDFGCLEVKLLENTQYTQLIEISRPLKIAQYVDTPKVVVRVYHDAKLAEVLTSRQIY
FT                   RLRPVYDYPNIRMYHRDEKYQVNAFLEELLKIDNHARIICQSES"
FT   gene            617164..618003
FT                   /locus_tag="Shew_0547"
FT   CDS_pept        617164..618003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0547"
FT                   /product="Calcineurin phosphoesterase C-terminal domain
FT                   protein"
FT                   /note="PFAM: metallophosphoesterase; Calcineurin
FT                   phosphoesterase C-terminal domain protein; KEGG:
FT                   she:Shewmr4_3233 calcineurin phosphoesterase C-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22419"
FT                   /db_xref="GOA:A3QAC1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAC1"
FT                   /protein_id="ABO22419.1"
FT                   /translation="MLKEAISYSIDHDESVKLVQVTDPHLFADPEAQLLGVNTAHSLDA
FT                   VLNTIKAVDYPAHLLLATGDISQDYSNQSYHNFVAAIEKLNLPCHYLPGNHDDPRIMHL
FT                   HMQGPSVYGDRRILVGKWQIIMLDSTVRGKPGGHMADSEMELIEAAVAAHPELYTLLVM
FT                   HHNPILVDCKWLDQHCMDNGEAFLDRVTAMPQVKGLLWGHVHQSLDQFYQGKSGPVKLM
FT                   ATPSTCIQFKPKSPYFALDAQQPGYRLLELKPDGSILANVYRVPGNKFSPDHDSSGY"
FT   gene            618198..618776
FT                   /locus_tag="Shew_0548"
FT   CDS_pept        618198..618776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0548"
FT                   /product="protein of unknown function UPF0227"
FT                   /note="PFAM: protein of unknown function UPF0227; KEGG:
FT                   she:Shewmr4_3232 protein of unknown function UPF0227"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22420"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAC2"
FT                   /protein_id="ABO22420.1"
FT                   /translation="MLLYIHGFNSSPHSDKGVVTAQYIAKHFPDINFVQPQLPATPKAA
FT                   MALLTDLVEQALEMGESLSFIGSSLGGYFASYLAERYGGRAVLVNPAVKPFELFDEFLG
FT                   PQYNPYTEEDYQILPEHKLEVAKYDTPAISHPDRFLVLLQSGDEVLDYRQAVNKYQCCQ
FT                   MLIEAGGDHSFVGYQQQMPGICDFLFLDK"
FT   gene            618825..620711
FT                   /locus_tag="Shew_0549"
FT   CDS_pept        618825..620711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0549"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: shm:Shewmr7_0758 DNA topoisomerase IV, B
FT                   subunit; TIGRFAM: DNA topoisomerase IV, B subunit; PFAM:
FT                   DNA gyrase, subunit B domain protein; ATP-binding region,
FT                   ATPase domain protein domain protein; DNA topoisomerase,
FT                   type IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22421"
FT                   /db_xref="GOA:A3QAC3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAC3"
FT                   /protein_id="ABO22421.1"
FT                   /translation="MTNQYTSDAIEVLNGLDPVKRRPGMYTDTTRPNHLGQEVIDNSVD
FT                   EALAGHATRIDVILHKDNSLEVIDDGRGMPVDIHPEEGIPGVELILTKLHAGGKFSNNN
FT                   YQFSGGLHGVGISVVNALSNRVEITVRRSGQVYEMAFEHGDKVEELTVTGTCGRRNTGT
FT                   RVHFWPTASYFDSVNFSIPKLIYLLRAKAVLCPGLRIKFTNKQTGDVEEWCYESGLTDY
FT                   LKSSTQGALTLPEEPFIGSMAGNTEAVDWAITWLPEGGDSLNESYVNLIPTPLGGTHVN
FT                   GFRQGLLEAMREFCEFRNLIPRGIKLSPEDIWDRSSFILSIKMQDPQFAGQTKEKLSSR
FT                   QSAAFVSGIVRDAFSLWLNTHTDQAEALAEMCISNAQKRLKAAKKVARKKVTSGPALPG
FT                   KLTDCSGQDPMRGELFLVEGDSAGGSAKQARDREFQAIMPLRGKILNTWEVEASQVLAS
FT                   QEVHDISVAIGCDPDSNDISELRYGKICILADADSDGLHIATLLCALFMKHYKVLVEKG
FT                   HIYVAMPPLFRVDVGKEVYYALDEAEKQGILDRISAEKKKGKVQVTRFKGLGEMNPLQL
FT                   RETTMDPNTRRLVQLTIDDAEDTLAIMDMLLAKKRSGDRKTWLETKGDLAQL"
FT   gene            620759..621925
FT                   /locus_tag="Shew_0550"
FT   CDS_pept        620759..621925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0550"
FT                   /product="L-sorbosone dehydrogenase, putative"
FT                   /note="KEGG: shm:Shewmr7_0759 L-sorbosone dehydrogenase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22422"
FT                   /db_xref="GOA:A3QAC4"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAC4"
FT                   /protein_id="ABO22422.1"
FT                   /translation="MHNKRVSCYFLCAMFAVMASGVSLTARAEQPIMITVTKGFGLSLY
FT                   ASDLGDAKQMALGDEGTLFVGSYKSGTIQALVDSNADGRVDKRYVVAKGLEYPEAIAFH
FT                   KGDLYVAEEERILRFVDIENRLKRPGRGKEVYDRLPGKTNKSRRAMRFGPDGRLYVAIG
FT                   APCNVCEAHAPFGSIIAIDLDSGSSEQIATGIRNVTGFDWDPKDSKLWFADLGRDWMGD
FT                   RLPPDEINRVDIVGAHYGFPYIHASSVLEPAYEKPKGLKVTTPVFELPAHVAPMGLEFY
FT                   RGEQFPEKYRDQLFVAENGSWNRSSKIGYQVTMLTLEDDSISKRQTVVSFLDGEFPVAR
FT                   PYDLIMAPDGAMYISDDLKGNVYRLFYKENASEEIESSEASEQQDPNQ"
FT   sig_peptide     620759..620845
FT                   /locus_tag="Shew_0550"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 29"
FT   gene            621922..624189
FT                   /locus_tag="Shew_0551"
FT   CDS_pept        621922..624189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0551"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.6.2.3"
FT                   /note="TIGRFAM: DNA topoisomerase IV, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: she:Shewmr4_3229 DNA
FT                   topoisomerase IV, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22423"
FT                   /db_xref="GOA:A3QAC5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAC5"
FT                   /protein_id="ABO22423.1"
FT                   /translation="MSDAIDLSLDGVEQMPLRRFTEEAYLNYSMYVIMDRALPHIGDGL
FT                   KPVQRRIVYAMSELGLSAQSKHKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRY
FT                   PLVDGQGNWGAPDDPKSFAAMRYTEARLSKFSEVLLTELGQGTVDWGVNFDGTLKEPMV
FT                   LPARLPHILLNGITGIAVGMATDVPPHNARELVDACVELIDNPKVDLERLMELVPGPDY
FT                   PTEAEIISPRTEIAKIYETGRGSIKARAVYSVESGEIVITALPHQASGGKILEQIAAQM
FT                   QAKKLPMVADLRDESDHESPVRIVIVPRSNRVDCDQLMAHLFATTDLEKNFRVNLNVLG
FT                   LNGRPQVKGLKQLLTEWLEFRLTTVRRRLEHRLDKVLARLHILEALMIAFLNIDEVIEI
FT                   IRYHDDPKAELMSRFNLTDEQANAILDLKLRHLAKLEEFKIKTEQSELEAEREKLELLL
FT                   SSDRRMKTLIKKELKQDAETYGDERRSPLVERSESRALSEQELVPAEAVTVVLSEKGWV
FT                   RCAKGHDIDPTALSYKAGDGFLCAASGRSNHATVFIGSTGRAFATDTHTLPSARSQGEP
FT                   VTTRFQLSPGESMAHALLGEDGQCFLLASDAGYGFIGDYKDMVSRNKAGKALLSLPANA
FT                   QVLPPKRVDKSRSESILAITNEGRMLLFSVDALPQLAKGKGNKIIGIASDRAKSREELL
FT                   VHLHVVPQDTAVTLWAGKRKLTLKPSDLEHYRGERGRRGAKLPRGLQRVDKVELGEDET
FT                   SL"
FT   gene            complement(624267..624458)
FT                   /locus_tag="Shew_0552"
FT   CDS_pept        complement(624267..624458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0552"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: sdn:Sden_3217 BFD-like (2Fe-2S)-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22424"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAC6"
FT                   /protein_id="ABO22424.1"
FT                   /translation="MYVCLCHAITDKQIKEAVDQGDMSLADVKRRLGVGNQCGKCSKMA
FT                   TEIIQARLDVTPNFYEVA"
FT   gene            complement(624800..625726)
FT                   /locus_tag="Shew_0553"
FT   CDS_pept        complement(624800..625726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0553"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding; KEGG: she:Shewmr4_0584 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22425"
FT                   /db_xref="GOA:A3QAC7"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAC7"
FT                   /protein_id="ABO22425.1"
FT                   /translation="MEHKLLLLTSDNDRYRSLLGSCHLPHLTLLGDDPQSILDADIWLA
FT                   EPPLAAPLVGHAKQIKWMQSTYAGVDLLVKPRLRRDYQLTNVRGIFGPLMSEYLFGYLL
FT                   AHQRQHKQYQSQQAEKIWRPGNFRTLQGQELLLLGTGNIAKHLAQTAKHFGMRVTGINR
FT                   GAKPTIGFDSVDTLANLAHHIDKADAIAAILPSTPQTQGALNQELLAMMKPEAILFNLG
FT                   RGDVLDLDALYAQLLSHPQQNAILDVFNQEPLPQEHPIWSLENVIITPHIAAPSFPEQV
FT                   VEIFANNYHKFIKGEPLSHKVNFERGY"
FT   gene            complement(626221..626928)
FT                   /locus_tag="Shew_0554"
FT   CDS_pept        complement(626221..626928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0554"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: shm:Shewmr7_3444 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22426"
FT                   /db_xref="GOA:A3QAC8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAC8"
FT                   /protein_id="ABO22426.1"
FT                   /translation="MRVYAHRGASGYGAENTLAAIKKSVALGCNAVEIDVHSVEGELYV
FT                   FHDRRLDGKSSGTGLIEAVTQEYLAGVTVDGEPIPKLWELLEYLQPFDALINIELKGLN
FT                   SLGPFMALYPEILEKLNYRPDQLLISSFHHGFLFTLRQAFPEIVLAPLIEGVPEDLAAI
FT                   VTRLEAFSLHLSVNFVTRELVEDAHARGAKVFVYTVDNRDDIHYLSQMGVDGIFSNFPD
FT                   VSADCVHQLLLTR"
FT   gene            complement(626928..630110)
FT                   /locus_tag="Shew_0555"
FT   CDS_pept        complement(626928..630110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0555"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   she:Shewmr4_0587 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22427"
FT                   /db_xref="GOA:A3QAC9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAC9"
FT                   /protein_id="ABO22427.1"
FT                   /translation="MSRILLIILCLISFSGAANSPLNLNKRLGLGQEPQVASKSTAEQL
FT                   SLLEEQLTEQQALQSSFDAIIHQYQSQKQALTQQLKEAATPLEYNPNQDLSQQASLSYL
FT                   RLSELKETEANLATQVNELIKRQQQLPSLISQANLTLAKHKQATSNDNQPLSEMQRRVY
FT                   VQSLSTLESELASSQKQIALTQQQLALVRSQLVQQEALIERLNGAIAEQRHKATAATIA
FT                   ASQIETSITDDAIAIKLNAQNQAYGEQLKQLTHEVTNVMTQQEQAETQYQFQAKQITNI
FT                   QQQIALVKLNSAFGERFLRILYSLPKPPSQDKISNEIANARLARYQIEQDQTLHPLLGA
FT                   VEQLTPLQSKLVGAQKELQRQLLENYDLYLGELAELRVLYEQLGQQYQTLKTTLNEHLF
FT                   WVANANSIDGYWLGDLYQSTQWLLTQAPWHQVQDSLSEQSTLWSWWVILMVLCLVMQDL
FT                   VTPKFTQLMAKNVTYVGNVTQDKFIYSFNTLIGSLLYSCIKPLPLISGGLIFYFSNHNL
FT                   VSSVGMGILAIGMLYQLYRLTYLLALDKGLLIGHFKGDKAIIRAGQQRLRALTVLAMPI
FT                   VGVIGFTEVLETSLVRNSLGRGAFILLALMLFWFYRDMLSLSKQEHHYHQDDKNKRLLQ
FT                   KLLWSILILLPPACAVLAFRGYYFTAYQMLLQLQLSLILSLSFMLLYQLIKRWMLIERR
FT                   RIAFNRAKAKRAEILAQREKEDDPNSNEPPDTYEEPVVDLETISSQSLGLVRSLLTLAF
FT                   LISLIGLWTQTHSAIFSFLDGITLWTSSSTVDGIAQQLPITLKSLLLGLIIVGFSLMIA
FT                   TNLPGLLELMILQRLDLTQGTGFAITTVSRYLVVFFGMLSGFSTLGMEWSKLQWLVAAL
FT                   SVGLGFGLQEIFANFISGLIILFEKPVRIGDTVTIRELTGTVSKIQIRATTIVDWDRKE
FT                   IIVPNKAFITEQLINWSLSDPITRVIVYVSVARDSDPARVEAALYQAVKECDDALTTPE
FT                   PEVWFAGFGQHTQDYEIRAYAKDMNTRWPLRHKLHKQVSKKLRENHLELAYPQLEVHIS
FT                   GQSKETQGIIRS"
FT   sig_peptide     complement(630054..630110)
FT                   /locus_tag="Shew_0555"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.721 at
FT                   residue 19"
FT   gene            complement(630235..631125)
FT                   /locus_tag="Shew_0556"
FT   CDS_pept        complement(630235..631125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0556"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: shm:Shewmr7_3442 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22428"
FT                   /db_xref="GOA:A3QAD0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAD0"
FT                   /protein_id="ABO22428.1"
FT                   /translation="MNTSSSERSGLIELHLAVLLFGGTALFSKLIPLSALDITALRCCI
FT                   AALALALLVKVSGKHLRLNRGKDYGIALGLGIIVSLHWVTYFAAMQLSSVAIGMIAFFT
FT                   YPVMTVLVEPFFTGKRLELADIISGICVLLGVSLLIPEANLGNDVTLGIIIGVLSAALF
FT                   TARNLLHKRYFASYSGAQAMYYQTGVSALFLLPWLEVDPSAIQANVWWLVILLGIVFTA
FT                   APHALFTSALRQLSAKTVSLVSCLQPLYGALLALLILGEGLAMKTLIGGALVVFTAVYE
FT                   TQKSHKANRAQKAKS"
FT   gene            complement(631134..631994)
FT                   /locus_tag="Shew_0557"
FT   CDS_pept        complement(631134..631994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0557"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: shm:Shewmr7_3441 phosphatidylserine
FT                   decarboxylase; TIGRFAM: phosphatidylserine decarboxylase;
FT                   PFAM: phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22429"
FT                   /db_xref="GOA:A3QAD1"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3QAD1"
FT                   /protein_id="ABO22429.1"
FT                   /translation="MDKLKIALQYIMPKHLLSRLVGKLAAAELGAVTTSVIKWFIKQYK
FT                   IDMSEAAQSAPEAYASFNQFFTRALKPGIRPLCDDDDYIVHPVDGAVSQCGPIKEGRIF
FT                   QAKGHEYSSLALLGDQADDAKRFEGGDFATIYLAPKDYHRIHMPIKGTLSKMTYVPGEL
FT                   FSVNPLTAENVPGLFARNERVVAIFETEIGPMAMVLVGATIVASIETVWAGTVTPPTGK
FT                   KVFTWDYPTEGPEAITLDKGEEMGRFKLGSTVVMLFAKDALEHFADGVEPKAVTRMGQA
FT                   FAKID"
FT   gene            complement(632038..633051)
FT                   /locus_tag="Shew_0558"
FT   CDS_pept        complement(632038..633051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0558"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: shm:Shewmr7_3440 ribosome small
FT                   subunit-dependent GTPase A"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22430"
FT                   /db_xref="GOA:A3QAD2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAD2"
FT                   /protein_id="ABO22430.1"
FT                   /translation="MRANHEKRLQRKDAKETTIELQDSSLGPEQLGTVISRFGQHADVE
FT                   TENGELVRCNIRRNIQSLVTGDKVIMRQASETTATIAGVVEAVHPRHSSLSRPDLYDGI
FT                   KIIAANIDQILIVSSVVPSFTTQIIDRYLVAAEDTGIAPVIILNKIDLLSDEEAPAVEA
FT                   ALERYQAIGYQVYRVSSKSGEGVEAIKTLLKDKVSVFVGQSGVGKSSLINALLPEAELI
FT                   TGDVSETSGLGQHTTTTAKLLHFPSGGDLVDSPGVREFALWHLPAERVGWCFVEFRDYL
FT                   GTCKFRDCKHKNDPGCAITQAFEEGKIAQDRYQNYHRIIDSLDEQRHARHFKNDND"
FT   gene            633209..633754
FT                   /locus_tag="Shew_0559"
FT   CDS_pept        633209..633754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0559"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: son:SO0592 oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22431"
FT                   /db_xref="GOA:A3QAD3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3QAD3"
FT                   /protein_id="ABO22431.1"
FT                   /translation="MAADETNLIWVDLEMTGLEPEVDRIIEIATIVTDKELNILAEGPV
FT                   IAIHQSEDVLAAMDDWNQKHHGESGLIDRVRASDFSEQDAIEQTIAFLSEHVPAGVSPM
FT                   CGNSIGQDRRFLNRYMPTLEDYFHYRNIDVSSVKELVRRWRPEVMDGFKKQGTHQALVD
FT                   IQESIAELRYYREKVFKI"
FT   gene            633941..634016
FT                   /locus_tag="Shew_R0019"
FT                   /note="tRNA-Gly2"
FT   tRNA            633941..634016
FT                   /locus_tag="Shew_R0019"
FT                   /product="tRNA-Gly"
FT   gene            634062..634137
FT                   /locus_tag="Shew_R0020"
FT                   /note="tRNA-Gly3"
FT   tRNA            634062..634137
FT                   /locus_tag="Shew_R0020"
FT                   /product="tRNA-Gly"
FT   gene            634145..634220
FT                   /locus_tag="Shew_R0021"
FT                   /note="tRNA-Gly4"
FT   tRNA            634145..634220
FT                   /locus_tag="Shew_R0021"
FT                   /product="tRNA-Gly"
FT   gene            634229..634304
FT                   /locus_tag="Shew_R0022"
FT                   /note="tRNA-Gly5"
FT   tRNA            634229..634304
FT                   /locus_tag="Shew_R0022"
FT                   /product="tRNA-Gly"
FT   gene            635005..635460
FT                   /locus_tag="Shew_0560"
FT   CDS_pept        635005..635460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22432"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAD4"
FT                   /protein_id="ABO22432.1"
FT                   /translation="MRFQQLNEQLAYVSKCRLEMARLYARLHSAVDSSRVKLMLEYLQQ
FT                   HEKEVSQKIDDYIEEAPRRLLELWYNDIVFEDFIKRCQEVIPAANMNEDDLLELHLDLD
FT                   NRLIGLFEKTAESSVPGDVKNALNDLVRVEKIQQQRLVHSSLRMEDI"
FT   gene            635897..637375
FT                   /locus_tag="Shew_0561"
FT   CDS_pept        635897..637375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0561"
FT                   /product="carbohydrate kinase, YjeF-related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF-related protein;
FT                   PFAM: protein of unknown function UPF0031; YjeF-family
FT                   N-terminal domain protein; KEGG: she:Shewmr4_0593
FT                   carbohydrate kinase, YjeF-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22433"
FT                   /db_xref="GOA:A3QAD5"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAD5"
FT                   /protein_id="ABO22433.1"
FT                   /translation="MLFSDGQLPSALYTAQMIRDAEARLIASGEANLCQLIDSAGQSAF
FT                   ELLQREGKLNSKILVLAGYGNNGADAYICATLLLESGCDVALYAVERSEAGEGISYAKA
FT                   AFLAAGGHQLSDYEEALKEAEVVVDGLLGTGVKGELRAPFAEMIVAINRYSPWILSLDV
FT                   PSGIDVDTGAGQLAVKADVTLTFGAPKQGLITGKARDCVGRLWFADIGLQEYLPESKVL
FT                   NIAHRLTDLGLPARAQNSHKGACGKVTVIGGDIGMAGAPRLAAESCLRAGAGLVAVISR
FT                   PEHLTVVNSGRPEIMFWGCELVDMEVYQRLGWADILLIGPGLGKHDWGYNLLKATGLSD
FT                   KSCVMDADALNLLALEPSRQSNWVLTPHSGEAARLLGISIAEVEADRFAAVYALQAKYG
FT                   GVVVLKGAGTLIYDGKVCHVAPVGNPGLASGGSGDVLGGIIAALMAQGMAKMEAASAGV
FT                   VVHGAAADLAAKDGERGMLACDLFAHIRALVDKI"
FT   gene            637476..637949
FT                   /locus_tag="Shew_0562"
FT   CDS_pept        637476..637949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0562"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   she:Shewmr4_0594 protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22434"
FT                   /db_xref="GOA:A3QAD6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAD6"
FT                   /protein_id="ABO22434.1"
FT                   /translation="MTPVKVYLENEAETVSLGQRLASAIKPPLTLYLSGELGAGKTTFS
FT                   RGLIQSLGHKGAVKSPTYTLVEPYELGDIDVYHFDLYRLSDPEELEFMGIRDYFTESSL
FT                   CIVEWPDKGVGLLPEADLAIHIQYHQQGREVMLTAHSRAGEILLDSLHNNDKN"
FT   gene            637936..639255
FT                   /locus_tag="Shew_0563"
FT   CDS_pept        637936..639255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0563"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="PFAM: Peptidoglycan-binding LysM; cell wall
FT                   hydrolase/autolysin; KEGG: she:Shewmr4_0595
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22435"
FT                   /db_xref="GOA:A3QAD7"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAD7"
FT                   /protein_id="ABO22435.1"
FT                   /translation="MIRTESLIKRLLLIVLLCIPSVAYSANKLEGVRIWAAPESTRVVF
FT                   DLREPPKYSHFTLTSPYRLVVDLTTTATGLDLNKIENNSKLVKRVRISKPPKKGTLRLV
FT                   IDLVKPAKANLFALSPTAPYGNRLVVDLEGGNQSPKTVKVEPEQKLRDIIVAIDAGHGG
FT                   DDPGSIGPSGIYEKKVALQIAKKVEAKINATPGMRAIMTRSGDYFVNLNKRSEIARNSK
FT                   ADLLVSIHADAFTSPQPQGASVWVLSMRRANSEIGRWLEQKEKHSELLGGAGEIIQNAD
FT                   NEQYLAMTLLDMSMDRSMAISHNIAGDVLANLGKVTRLHKHKPEAASLAVLKSPDIPSI
FT                   LVETGFISNHKEERLLTQRDHQNNIANAVHKGVVRYFENNPPANTMMASKSGIKHKVTA
FT                   GESLSVIAHRYQVSVDSIKKANKLKSNTLYIGQKLIIPRA"
FT   sig_peptide     637936..638013
FT                   /locus_tag="Shew_0563"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 26"
FT   gene            639265..641160
FT                   /locus_tag="Shew_0564"
FT   CDS_pept        639265..641160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0564"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   DNA mismatch repair protein, C-terminal domain protein;
FT                   KEGG: she:Shewmr4_0596 DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22436"
FT                   /db_xref="GOA:A3QAD8"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3QAD8"
FT                   /protein_id="ABO22436.1"
FT                   /translation="MTIRILPPQLANQIAAGEVVERPASVIKELVENSLDAGATRVDIE
FT                   IDKGGSKLIKITDNGSGIPKEELSLALSRHATSKLASLDDLDAILSFGFRGEALASISS
FT                   VSRLTLTSRTQEQSEAWQAYAEGSEMAVRVIPAAHPVGSTVEAADLFFNTPARRRFLKS
FT                   DKTEFTHIDEWLKRIALVRSEIHFTLKHNGKQVRNYRPAKTEAQYLQRLAQVSGKAFAD
FT                   NALRVDCNHNGLSLSGYIQSPFSEMAVGDTQYFYVNGRLVRDRLVNHAVRQAFAQQLQG
FT                   EQVAFVLMLNLDPHQVDVNVHPAKHEVRFHESRYVHDFILQALESALRQSSELAFEAAL
FT                   DTQVTDQNRSASYIRPLQTQQSDTGSNQIAHGDTEENALWLANERPAYGEREASRQAGG
FT                   QRVQETQMSSYGSGQSGGRGRSYASTELPSQAAVDSYAQLMTTPGVSSQANQADDSHLP
FT                   PMPQVLDGQYWLLVRGSELALLSLSCAAREVTRREIEAKLDAGLIGQPLLMPVSVKVDE
FT                   DWQQTLVERELLVRKLGLELTIRLGQLIIKKVPPYLRQSQLASVIPEFLQWIRFEEPTT
FT                   EALVNWLVNQSGEQFNSASRLWAGLMGLPESQQQEILSLAKVMPWQTWLGEQTSE"
FT   gene            641153..642079
FT                   /locus_tag="Shew_0565"
FT   CDS_pept        641153..642079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0565"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="KEGG: son:SO0602 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   tRNA isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22437"
FT                   /db_xref="GOA:A3QAD9"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3QAD9"
FT                   /protein_id="ABO22437.1"
FT                   /translation="MNSESQPTIITLMGPTASGKTALAMALAEQHNCEIISVDSALIYR
FT                   DMDIGSAKPTQEELSRAPHRLIDIRDPSESYSAADFRSDAIANIEAILAAGKTPLLVGG
FT                   TMLYFKALLEGLSPLPSADEAIRAEIAKEVEAKGWQALHDELRQIDPVSADRIHPNDPQ
FT                   RLSRAIEVYRISGKSLTELTQVKAEALPYKVVQFGIAPKDRKVLHLAIAERFKLMLNQG
FT                   FVEEVQRLKARADLHLDLPSMRCVGYRQVWQYLDGEYDYDTMVEKSIVATRQLAKRQLT
FT                   WLRGWADLNWLESGDESNLARLLEHCR"
FT   gene            642172..642450
FT                   /locus_tag="Shew_0566"
FT   CDS_pept        642172..642450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0566"
FT                   /product="RNA-binding protein Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein, core; KEGG: shm:Shewmr7_3432 RNA
FT                   chaperone Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22438"
FT                   /db_xref="GOA:A3QAE0"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3QAE0"
FT                   /protein_id="ABO22438.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPARPFNVSSHHNTPNQAAGYNASHDDSAE"
FT   gene            642471..643769
FT                   /locus_tag="Shew_0567"
FT   CDS_pept        642471..643769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0567"
FT                   /product="GTP-binding protein, HSR1-related"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; KEGG:
FT                   son:SO0604 GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22439"
FT                   /db_xref="GOA:A3QAE1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAE1"
FT                   /protein_id="ABO22439.1"
FT                   /translation="MFERYEAGEAAVLVHIDFSDEDSREDITELRLLVESAGAETVGVI
FT                   TGSRRSPDRKYFVGTGKAEELAAMVAATDANVVIFNHALSPAQERNLELICQCRVLDRT
FT                   TLILDIFAQRARTYEGKLQVELAQLRHMSTRLIRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRGRIKTINKRLEKVDKQREQSRRARQRSELATVSLVGYTNAGKSTLFNALTVSEV
FT                   YAADQLFATLDPTLRKLDLQDGSVILADTVGFIRHLPHDLVAAFKATLQETREADLLLH
FT                   VVDSADENMGDNFEQVQLVLKEIGAEEIPQLIVCNKIDLLEDVGPKIDYDGDGVPIRVW
FT                   VSAQQSLGLDLLEKAINQLVGRAILELTLRIPATAGHYLGQFYRLDVIQQKEYDDLGNC
FT                   ILSVRLLEADWHRLAKQSQGELETFIVETAAIE"
FT   gene            643813..644955
FT                   /locus_tag="Shew_0568"
FT   CDS_pept        643813..644955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0568"
FT                   /product="HflK protein"
FT                   /note="TIGRFAM: HflK protein; PFAM: band 7 protein; KEGG:
FT                   shm:Shewmr7_3430 HflK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22440"
FT                   /db_xref="GOA:A3QAE2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAE2"
FT                   /protein_id="ABO22440.1"
FT                   /translation="MAWNEPGNKGQDPWGNKNGNDKGPPDLDEVFKNISKRFGGKGNGA
FT                   GGGFSALGFIIVLGIAVVVWGLSGFYTVKEAEKGVALRFGKYIGQVEPGLQWKATFIDE
FT                   VFPVNVSNVRSIPASGSMLTADENVVLVELDVQYIVVDAYRYLFSAVDANSSLREATDS
FT                   ALRYVVGHNKMDDILTTGRDQIRRDTWEEVERIIKPYNLGIEIRDVNFLPARPPEEVKD
FT                   AFDDAIAAQEDEQRFIREAEAYSREVEPKARGTVQRMEQQANAYKEREILEARGKVARF
FT                   EKLLPEYKAAPEVTRARLYIDAMSNVLSGTNKVLVDSKAGNNMMYLPLDKLMEQRPQTK
FT                   TSKPVEADSVNDSVNSIVNSVGMPLDGRPSRSDRTRQGRN"
FT   gene            644958..645836
FT                   /locus_tag="Shew_0569"
FT   CDS_pept        644958..645836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0569"
FT                   /product="HflC protein"
FT                   /note="TIGRFAM: HflC protein; PFAM: band 7 protein; KEGG:
FT                   shm:Shewmr7_3429 HflC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22441"
FT                   /db_xref="GOA:A3QAE3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAE3"
FT                   /protein_id="ABO22441.1"
FT                   /translation="MGRLSVIIAAILVAMGLSSLMVVNEGERAIVSRFGKIIKDEGVTR
FT                   IYKPGLHIKLPVIDKIKYLDSRIQTMDGAADRFVTSEKKDLMVDSYVKWRIKDHEKYYL
FT                   ATNGGNKVQAESLLQRKINNDLRTEFGRRTIKDIVSGSRDELQQDALRNASDSAQDLGI
FT                   EVVDVRVKQINLPANVSSSIYQRMRAERTAVAKEHRAQGKEQSEIIRAKTDASVTIQIA
FT                   EAERKALQVRGEGDAIAAKIYADAYKKDPEFFSFLRSLEAYQASFGNGSNVMVLEPEGD
FT                   FFKYMKSADAK"
FT   sig_peptide     644958..645032
FT                   /locus_tag="Shew_0569"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.523 at
FT                   residue 25"
FT   gene            646171..646761
FT                   /locus_tag="Shew_0570"
FT   CDS_pept        646171..646761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0570"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /note="TIGRFAM: ubiquinol-cytochrome c reductase,
FT                   iron-sulfur subunit; PFAM: Rieske [2Fe-2S] domain protein;
FT                   KEGG: shm:Shewmr7_3428 ubiquinol-cytochrome c reductase,
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22442"
FT                   /db_xref="GOA:A3QAE4"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAE4"
FT                   /protein_id="ABO22442.1"
FT                   /translation="MSNAPVDTGRRRFLTAATAVVGGAGAVAVAVPFIKSWNPSAKAKA
FT                   AGAPVEVNISKLEPGQLIRVEWRGKPVWVVRRTEEILKGLATHDDKLRDPASNEEQQPA
FT                   YAQNAVRSIKPEYFIAVGLCTHLGCSPTYLPDTFGEQVEGVASGFFCPCHGSKFDMAGR
FT                   VFQGVPAPLNLVVPPHQYIDDGNVIIGVDQGAA"
FT   sig_peptide     646171..646263
FT                   /locus_tag="Shew_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.539 at
FT                   residue 31"
FT   gene            646761..647975
FT                   /locus_tag="Shew_0571"
FT   CDS_pept        646761..647975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0571"
FT                   /product="Cytochrome b/b6, N-terminal domain"
FT                   /note="PFAM: Cytochrome b/b6, N-terminal domain; Cytochrome
FT                   b/b6, C-terminal domain; KEGG: shm:Shewmr7_3427 cytochrome
FT                   b/b6, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22443"
FT                   /db_xref="GOA:A3QAE5"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAE5"
FT                   /protein_id="ABO22443.1"
FT                   /translation="MVKNIIDWIDARIPMTATYNRHVGQYATPTNFNFWYFFGSLAMLV
FT                   LVNQLLTGIWLTMNYVPTAEGAFASIEYIMRDVEYGWLLRYMHSTGASAFFVVVYLHMF
FT                   RGLIYGSYQKPRELLWLFGMLIFLVLMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVI
FT                   GDDLTLWIRGDFVVSGATLNRFFALHVIALPLVLVVLVFLHLIALHEVGSNNPDGIEIK
FT                   KNKDENGWPKDGIPFHPYYTVKDIMGVAGFLIVFCYVLFFMPEGGGYFLEKPNFEAANP
FT                   MKTPEHIAPVWYFTPFYAILRAIPDKLLGVVGMGLAIAVLFVLPWLDRCKVKSIRYRSM
FT                   IHKLNIGQFAVSFVILGYLGAVPATPTLTIAARVFTLTYFGFFLALWLYSKNEKTKPVP
FT                   ERLTH"
FT   gene            647975..648676
FT                   /locus_tag="Shew_0572"
FT   CDS_pept        647975..648676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0572"
FT                   /product="cytochrome c1"
FT                   /note="PFAM: cytochrome c1; KEGG: shm:Shewmr7_3426
FT                   cytochrome c1"
FT                   /db_xref="EnsemblGenomes-Gn:Shew_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABO22444"
FT                   /db_xref="GOA:A3QAE6"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A3QAE6"
FT                   /protein_id="ABO22444.1"
FT                   /translation="MKKLLIALVTLVPSLAFAAGGAHVHLESANVDLKDKESLQRGLDT
FT                   FQHYCSGCHSTQYQRYNRVAEDLGISVDDMRNKYMLNGDAKVGDLMENAIPEVDAAKWF
FT                   GAAPPDLTLVARVRGEDWIYTYLKSFYKDETRPFGVNNTVFPSVAMPHVLQELQGLQVK
FT                   QEDGSFVATGGKLTAEEYDQVVRDITGFLVYSGEPVKLERESLGWWVMGFLFIFFIVAY
FT                   LLKKEYWKDVH"
FT   sig_peptide     647975..648031
FT                   /locus_tag="Shew_0572"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 19"
FT   gene            648785..649414
FT                   /locus_tag="Shew_0573"
FT   CDS_pept        648785..649414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Shew_0573"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-