(data stored in SCRATCH9089 zone)

EMBL: CP000608

ID   CP000608; SV 1; circular; genomic DNA; STD; PRO; 1898476 BP.
XX
AC   CP000608;
XX
PR   Project:PRJNA18459;
XX
DT   24-MAR-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Francisella tularensis subsp. tularensis WY96-3418, complete genome.
XX
KW   .
XX
OS   Francisella tularensis subsp. tularensis WY96-3418
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Thiotrichales;
OC   Francisellaceae; Francisella.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1898476
RX   PUBMED; 17895988.
RA   Beckstrom-Sternberg S.M., Auerbach R.K., Godbole S., Pearson J.V.,
RA   Beckstrom-Sternberg J.S., Deng Z., Munk C., Kubota K., Zhou Y., Bruce D.,
RA   Noronha J., Scheuermann R.H., Wang A., Wei X., Wang J., Hao J.,
RA   Wagner D.M., Brettin T.S., Brown N., Gilna P., Keim P.S.;
RT   "Complete genomic characterization of a pathogenic A.II strain of
RT   Francisella tularensis subspecies tularensis";
RL   PLoS One 2(9):E947-E947(2007).
XX
RN   [2]
RP   1-1898476
RG   BioHealthBase
RA   Godbole S., Auerbach R.K., Beckstrom-Sternberg S.M., Brown N., Bruce D.,
RA   Deng Z., Gilna P., Keim P.S., Kubota K., Munk A.C., Noronha J.,
RA   Peterson J., Wagner D.M., Wei X., Wang A., Wang J., Zhou Y.,
RA   Scheuermann R.H., Brettin T.S.;
RT   ;
RL   Submitted (08-MAR-2007) to the INSDC.
RL   Department of Pathology, UT Southwestern Medical Center, 6000, Harry Hines
RL   Blvd., Dallas, TX 75390, USA
XX
DR   MD5; e093bb5aaa05ed04a4c406ebdce8db1d.
DR   BioSample; SAMN02603036.
DR   EnsemblGenomes-Gn; EBG00001114794.
DR   EnsemblGenomes-Gn; EBG00001114795.
DR   EnsemblGenomes-Gn; EBG00001114796.
DR   EnsemblGenomes-Gn; EBG00001114797.
DR   EnsemblGenomes-Gn; EBG00001114798.
DR   EnsemblGenomes-Gn; EBG00001114799.
DR   EnsemblGenomes-Gn; EBG00001114800.
DR   EnsemblGenomes-Gn; EBG00001114801.
DR   EnsemblGenomes-Gn; EBG00001114802.
DR   EnsemblGenomes-Gn; EBG00001114803.
DR   EnsemblGenomes-Gn; EBG00001114804.
DR   EnsemblGenomes-Gn; EBG00001114805.
DR   EnsemblGenomes-Gn; EBG00001114806.
DR   EnsemblGenomes-Gn; EBG00001114807.
DR   EnsemblGenomes-Gn; EBG00001114808.
DR   EnsemblGenomes-Gn; EBG00001114809.
DR   EnsemblGenomes-Gn; EBG00001114810.
DR   EnsemblGenomes-Gn; EBG00001114811.
DR   EnsemblGenomes-Gn; EBG00001114812.
DR   EnsemblGenomes-Gn; EBG00001114813.
DR   EnsemblGenomes-Gn; EBG00001114814.
DR   EnsemblGenomes-Gn; EBG00001114815.
DR   EnsemblGenomes-Gn; EBG00001114816.
DR   EnsemblGenomes-Gn; EBG00001114817.
DR   EnsemblGenomes-Gn; EBG00001114818.
DR   EnsemblGenomes-Gn; EBG00001114819.
DR   EnsemblGenomes-Gn; EBG00001114820.
DR   EnsemblGenomes-Gn; EBG00001114821.
DR   EnsemblGenomes-Gn; EBG00001114822.
DR   EnsemblGenomes-Gn; EBG00001114823.
DR   EnsemblGenomes-Gn; EBG00001114824.
DR   EnsemblGenomes-Gn; EBG00001114825.
DR   EnsemblGenomes-Gn; EBG00001114826.
DR   EnsemblGenomes-Gn; EBG00001114827.
DR   EnsemblGenomes-Gn; EBG00001114828.
DR   EnsemblGenomes-Gn; EBG00001114829.
DR   EnsemblGenomes-Gn; EBG00001114830.
DR   EnsemblGenomes-Gn; EBG00001114831.
DR   EnsemblGenomes-Gn; EBG00001114832.
DR   EnsemblGenomes-Gn; EBG00001114833.
DR   EnsemblGenomes-Gn; EBG00001114834.
DR   EnsemblGenomes-Gn; EBG00001114835.
DR   EnsemblGenomes-Gn; EBG00001114836.
DR   EnsemblGenomes-Gn; EBG00001114837.
DR   EnsemblGenomes-Gn; EBG00001114838.
DR   EnsemblGenomes-Gn; EBG00001114839.
DR   EnsemblGenomes-Gn; EBG00001114840.
DR   EnsemblGenomes-Gn; EBG00001114841.
DR   EnsemblGenomes-Gn; EBG00001114842.
DR   EnsemblGenomes-Gn; EBG00001114843.
DR   EnsemblGenomes-Gn; EBG00001114844.
DR   EnsemblGenomes-Gn; EBG00001114845.
DR   EnsemblGenomes-Gn; EBG00001114846.
DR   EnsemblGenomes-Gn; EBG00001114847.
DR   EnsemblGenomes-Gn; EBG00001114848.
DR   EnsemblGenomes-Gn; EBG00001114849.
DR   EnsemblGenomes-Gn; EBG00001114850.
DR   EnsemblGenomes-Gn; FTW_2028.
DR   EnsemblGenomes-Gn; FTW_2029.
DR   EnsemblGenomes-Gn; FTW_2030.
DR   EnsemblGenomes-Gn; FTW_2031.
DR   EnsemblGenomes-Gn; FTW_2032.
DR   EnsemblGenomes-Gn; FTW_2033.
DR   EnsemblGenomes-Gn; FTW_2034.
DR   EnsemblGenomes-Gn; FTW_2035.
DR   EnsemblGenomes-Gn; FTW_2036.
DR   EnsemblGenomes-Gn; FTW_2037.
DR   EnsemblGenomes-Gn; FTW_2038.
DR   EnsemblGenomes-Gn; FTW_2039.
DR   EnsemblGenomes-Gn; FTW_2040.
DR   EnsemblGenomes-Gn; FTW_2041.
DR   EnsemblGenomes-Gn; FTW_2042.
DR   EnsemblGenomes-Gn; FTW_2043.
DR   EnsemblGenomes-Gn; FTW_2044.
DR   EnsemblGenomes-Gn; FTW_2045.
DR   EnsemblGenomes-Gn; FTW_2046.
DR   EnsemblGenomes-Gn; FTW_2047.
DR   EnsemblGenomes-Gn; FTW_2048.
DR   EnsemblGenomes-Gn; FTW_2049.
DR   EnsemblGenomes-Gn; FTW_2050.
DR   EnsemblGenomes-Gn; FTW_2051.
DR   EnsemblGenomes-Gn; FTW_2052.
DR   EnsemblGenomes-Gn; FTW_2053.
DR   EnsemblGenomes-Gn; FTW_2054.
DR   EnsemblGenomes-Gn; FTW_2055.
DR   EnsemblGenomes-Gn; FTW_2056.
DR   EnsemblGenomes-Gn; FTW_2057.
DR   EnsemblGenomes-Gn; FTW_2058.
DR   EnsemblGenomes-Gn; FTW_2059.
DR   EnsemblGenomes-Gn; FTW_2060.
DR   EnsemblGenomes-Gn; FTW_2061.
DR   EnsemblGenomes-Gn; FTW_2062.
DR   EnsemblGenomes-Gn; FTW_2063.
DR   EnsemblGenomes-Gn; FTW_2064.
DR   EnsemblGenomes-Gn; FTW_2065.
DR   EnsemblGenomes-Gn; FTW_2066.
DR   EnsemblGenomes-Gn; FTW_2067.
DR   EnsemblGenomes-Gn; FTW_2068.
DR   EnsemblGenomes-Gn; FTW_2069.
DR   EnsemblGenomes-Gn; FTW_2070.
DR   EnsemblGenomes-Gn; FTW_2071.
DR   EnsemblGenomes-Gn; FTW_2073.
DR   EnsemblGenomes-Gn; FTW_2074.
DR   EnsemblGenomes-Gn; FTW_2075.
DR   EnsemblGenomes-Gn; FTW_2076.
DR   EnsemblGenomes-Gn; FTW_2078.
DR   EnsemblGenomes-Tr; EBT00001705962.
DR   EnsemblGenomes-Tr; EBT00001705963.
DR   EnsemblGenomes-Tr; EBT00001705964.
DR   EnsemblGenomes-Tr; EBT00001705965.
DR   EnsemblGenomes-Tr; EBT00001705966.
DR   EnsemblGenomes-Tr; EBT00001705967.
DR   EnsemblGenomes-Tr; EBT00001705968.
DR   EnsemblGenomes-Tr; EBT00001705969.
DR   EnsemblGenomes-Tr; EBT00001705970.
DR   EnsemblGenomes-Tr; EBT00001705971.
DR   EnsemblGenomes-Tr; EBT00001705972.
DR   EnsemblGenomes-Tr; EBT00001705973.
DR   EnsemblGenomes-Tr; EBT00001705974.
DR   EnsemblGenomes-Tr; EBT00001705975.
DR   EnsemblGenomes-Tr; EBT00001705976.
DR   EnsemblGenomes-Tr; EBT00001705977.
DR   EnsemblGenomes-Tr; EBT00001705978.
DR   EnsemblGenomes-Tr; EBT00001705979.
DR   EnsemblGenomes-Tr; EBT00001705980.
DR   EnsemblGenomes-Tr; EBT00001705981.
DR   EnsemblGenomes-Tr; EBT00001705982.
DR   EnsemblGenomes-Tr; EBT00001705983.
DR   EnsemblGenomes-Tr; EBT00001705984.
DR   EnsemblGenomes-Tr; EBT00001705985.
DR   EnsemblGenomes-Tr; EBT00001705986.
DR   EnsemblGenomes-Tr; EBT00001705987.
DR   EnsemblGenomes-Tr; EBT00001705988.
DR   EnsemblGenomes-Tr; EBT00001705989.
DR   EnsemblGenomes-Tr; EBT00001705990.
DR   EnsemblGenomes-Tr; EBT00001705991.
DR   EnsemblGenomes-Tr; EBT00001705992.
DR   EnsemblGenomes-Tr; EBT00001705993.
DR   EnsemblGenomes-Tr; EBT00001705994.
DR   EnsemblGenomes-Tr; EBT00001705995.
DR   EnsemblGenomes-Tr; EBT00001705996.
DR   EnsemblGenomes-Tr; EBT00001705997.
DR   EnsemblGenomes-Tr; EBT00001705998.
DR   EnsemblGenomes-Tr; EBT00001705999.
DR   EnsemblGenomes-Tr; EBT00001706000.
DR   EnsemblGenomes-Tr; EBT00001706001.
DR   EnsemblGenomes-Tr; EBT00001706002.
DR   EnsemblGenomes-Tr; EBT00001706003.
DR   EnsemblGenomes-Tr; EBT00001706004.
DR   EnsemblGenomes-Tr; EBT00001706005.
DR   EnsemblGenomes-Tr; EBT00001706006.
DR   EnsemblGenomes-Tr; EBT00001706007.
DR   EnsemblGenomes-Tr; EBT00001706008.
DR   EnsemblGenomes-Tr; EBT00001706009.
DR   EnsemblGenomes-Tr; EBT00001706010.
DR   EnsemblGenomes-Tr; EBT00001706011.
DR   EnsemblGenomes-Tr; EBT00001706012.
DR   EnsemblGenomes-Tr; EBT00001706013.
DR   EnsemblGenomes-Tr; EBT00001706014.
DR   EnsemblGenomes-Tr; EBT00001706015.
DR   EnsemblGenomes-Tr; EBT00001706016.
DR   EnsemblGenomes-Tr; EBT00001706017.
DR   EnsemblGenomes-Tr; EBT00001706018.
DR   EnsemblGenomes-Tr; FTW_2028-1.
DR   EnsemblGenomes-Tr; FTW_2029-1.
DR   EnsemblGenomes-Tr; FTW_2030-1.
DR   EnsemblGenomes-Tr; FTW_2031-1.
DR   EnsemblGenomes-Tr; FTW_2032-1.
DR   EnsemblGenomes-Tr; FTW_2033-1.
DR   EnsemblGenomes-Tr; FTW_2034-1.
DR   EnsemblGenomes-Tr; FTW_2035-1.
DR   EnsemblGenomes-Tr; FTW_2036-1.
DR   EnsemblGenomes-Tr; FTW_2037-1.
DR   EnsemblGenomes-Tr; FTW_2038-1.
DR   EnsemblGenomes-Tr; FTW_2039-1.
DR   EnsemblGenomes-Tr; FTW_2040-1.
DR   EnsemblGenomes-Tr; FTW_2041-1.
DR   EnsemblGenomes-Tr; FTW_2042-1.
DR   EnsemblGenomes-Tr; FTW_2043-1.
DR   EnsemblGenomes-Tr; FTW_2044-1.
DR   EnsemblGenomes-Tr; FTW_2045-1.
DR   EnsemblGenomes-Tr; FTW_2046-1.
DR   EnsemblGenomes-Tr; FTW_2047-1.
DR   EnsemblGenomes-Tr; FTW_2048-1.
DR   EnsemblGenomes-Tr; FTW_2049-1.
DR   EnsemblGenomes-Tr; FTW_2050-1.
DR   EnsemblGenomes-Tr; FTW_2051-1.
DR   EnsemblGenomes-Tr; FTW_2052-1.
DR   EnsemblGenomes-Tr; FTW_2053-1.
DR   EnsemblGenomes-Tr; FTW_2054-1.
DR   EnsemblGenomes-Tr; FTW_2055-1.
DR   EnsemblGenomes-Tr; FTW_2056-1.
DR   EnsemblGenomes-Tr; FTW_2057-1.
DR   EnsemblGenomes-Tr; FTW_2058-1.
DR   EnsemblGenomes-Tr; FTW_2059-1.
DR   EnsemblGenomes-Tr; FTW_2060-1.
DR   EnsemblGenomes-Tr; FTW_2061-1.
DR   EnsemblGenomes-Tr; FTW_2062-1.
DR   EnsemblGenomes-Tr; FTW_2063-1.
DR   EnsemblGenomes-Tr; FTW_2064-1.
DR   EnsemblGenomes-Tr; FTW_2065-1.
DR   EnsemblGenomes-Tr; FTW_2066-1.
DR   EnsemblGenomes-Tr; FTW_2067-1.
DR   EnsemblGenomes-Tr; FTW_2068-1.
DR   EnsemblGenomes-Tr; FTW_2069-1.
DR   EnsemblGenomes-Tr; FTW_2070-1.
DR   EnsemblGenomes-Tr; FTW_2071-1.
DR   EnsemblGenomes-Tr; FTW_2073-1.
DR   EnsemblGenomes-Tr; FTW_2074-1.
DR   EnsemblGenomes-Tr; FTW_2075-1.
DR   EnsemblGenomes-Tr; FTW_2076-1.
DR   EnsemblGenomes-Tr; FTW_2078-1.
DR   EuropePMC; PMC2175352; 18006572.
DR   EuropePMC; PMC2634620; 19046526.
DR   EuropePMC; PMC2688086; 19521508.
DR   EuropePMC; PMC2793073; 20027310.
DR   EuropePMC; PMC2946586; 20885922.
DR   EuropePMC; PMC3133279; 21531796.
DR   EuropePMC; PMC3147756; 21613430.
DR   EuropePMC; PMC3321753; 21529386.
DR   EuropePMC; PMC4412822; 25918839.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01374; CRISPR-DR61.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000608.
DR   SILVA-SSU; CP000608.
XX
CC   The sequencing of Francisella tularensis subspecies tularensis
CC   WY96-3418 genome was performed at the JGI production genomics
CC   facility in Walnut Creek, CA. Genome finishing was performed by the
CC   JGI at Los Alamos National Laboratory, Los Alamos, NM. Annotation
CC   was performed at BioHealthBase, a Bioinformatics Resource Center
CC   supported by the NIH/NIAID. The sequencing was supported by
CC   Intelligence Technology Innovation Center.
CC   For further information about the source of the DNA, contact Tom
CC   Brettin (brettin@lanl.gov) or David Bruce (dbruce@lanl.gov)
CC   Details of F. tularensis WY96-3418 annotation are available on the
CC   World Wide Web. (URL, http://www.biohealthbase.org).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1898476
FT                   /organism="Francisella tularensis subsp. tularensis
FT                   WY96-3418"
FT                   /strain="WY96-3418"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:418136"
FT   gene            46..1521
FT                   /gene="dnaA"
FT                   /locus_tag="FTW_0001"
FT   CDS_pept        46..1521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="FTW_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="GO_function: GO:0003688 - DNA replication origin
FT                   binding; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006260 - DNA replication; GO_process: GO:0006270 - DNA
FT                   replication initiation; GO_process: GO:0006275 - regulation
FT                   of DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46018"
FT                   /db_xref="GOA:A4IVR6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IVR6"
FT                   /protein_id="ABO46018.1"
FT                   /translation="MTTWDKCLKKIKKNLSTFEYKTWIKPIHVEQNSNLFTVYCNNEYF
FT                   KKHIKSKYGNLILSTIQECHGNDLIIEYSNKKFSGEKITEVITAGPQANFFSTTSVEIK
FT                   DESEDTKVVQEPKISKKSNSKDFSSSQELFGFDEAMLITAKEDEEYSFGLPLKEKYVFD
FT                   SFVVGDANKIARAAAMQVSINPGKLHNPLFIYGGSGLGKTHLMQAIGNHAREVNPNAKI
FT                   IYTNSEQFIKDYVNSIRLQDQDEFQRVYRSADILLIDDIQFIAGKEGTAQEFFHTFNAL
FT                   YENGKQIILTSDKYPNEIEGLEERLVSRFGYGLTVSVDMPDLETRIAILLKKAHDLGQK
FT                   LPNETAAFIAENVRTNVRELEGALNRVLTTSKFNHKDPTIEVAQACLRDVIKIQEKKVK
FT                   IDNIQKVVADFYRIRVKDLTSNQRSRNIARPRQIAMSLARELTSHSLPEIGNAFGGRDH
FT                   TTVMHAVKAITKLRQSNTSISDDYELLLNKISR"
FT   gene            1558..2661
FT                   /gene="dnaN"
FT                   /locus_tag="FTW_0002"
FT   CDS_pept        1558..2661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="FTW_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="GO_component: GO:0009360 - DNA polymerase III
FT                   complex; GO_function: GO:0003887 - DNA-directed DNA
FT                   polymerase activity; GO_process: GO:0006261 - DNA-dependent
FT                   DNA replication; GO_process: GO:0006260 - DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46019"
FT                   /protein_id="ABO46019.1"
FT                   /translation="MNFVLNRDDLLKPLQSMLSVANSKSTMPLLSCILFDIDNNNLKIT
FT                   ASDLDTEISCNIAVSCNTTIKLALNADKIYNIVRSLNENSMIDFRINENKVTIVSNNST
FT                   FNLISLNADNYPLIDSNINEQASFDLSQQDFHHIISKVDFSMANDDTRYFLNGMFWEIN
FT                   ANLLRAVSTDGHRMSITEAIIDSKVLDSASQSIIPKKAILELKKIVGKTEENIKICLGK
FT                   NYLKAIFGNYAFISKLIDGRYPDYQKVIPKNNTKLLAVDKQFFKNSLLRTSILANDKYK
FT                   GVRLNISQNQLLLSANNPDNEKAEDKIEVQYNDQPMEICFNYKYLLDIINVLSEETMSI
FT                   YLDNPNMSALVKDEKDNSLFIIMPMKI"
FT   gene            complement(2692..3096)
FT                   /locus_tag="FTW_0003"
FT                   /note="MFS transporter protein"
FT   misc_feature    complement(2692..3096)
FT                   /locus_tag="FTW_0003"
FT                   /note="disruption due to transposon insertion"
FT   gene            complement(3108..3988)
FT                   /locus_tag="FTW_0004"
FT   CDS_pept        complement(join(3108..3659,3659..3988))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0004"
FT                   /product="transposase ISFtu1"
FT                   /note="ORF00005 has a programmed ribosomal frameshift
FT                   'aaaaaaag' which permits frameshifting to ORF00004 to
FT                   produce a single ORF with high sequence similarity to IS630
FT                   family of insertion elements; programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46020"
FT                   /protein_id="ABO46020.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            complement(4092..4616)
FT                   /locus_tag="FTW_0006"
FT                   /note="putative nicotinamide mononucleotide uptake protein"
FT   misc_feature    complement(4092..4616)
FT                   /locus_tag="FTW_0006"
FT                   /note="disruption due to transposon insertion"
FT   gene            4789..5181
FT                   /locus_tag="FTW_0007"
FT   CDS_pept        4789..5181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0007"
FT                   /product="hypothetical membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46021"
FT                   /protein_id="ABO46021.1"
FT                   /translation="MKLRKVLIATLLGASALSLSSCWLLVGAAVGGGTAAYISGEYSMN
FT                   MSGSVKDIYNATLKAVQSNDDFVITKKSITSVDAVVDGSTKVDSTSFYVKIEKLTDNAS
FT                   KVTIKFGTFGDQAMSATLMDQIQKNL"
FT   gene            5202..5612
FT                   /locus_tag="FTW_0008"
FT   CDS_pept        5202..5612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0008"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46022"
FT                   /protein_id="ABO46022.1"
FT                   /translation="MTFLKKAFIATIVSISALVLNSCIVAAIAVGGGTVAYIDGNYFMN
FT                   IEGNYKAVYKATLKAINDNNDFVLVSKDLDQTKQNADIEGATKIDSTSFSVKIERLTDQ
FT                   ATKVTIKFGTFGDQAMSSTLMDQIQAAVHKAS"
FT   gene            5615..6013
FT                   /locus_tag="FTW_0009"
FT   CDS_pept        5615..6013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0009"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46023"
FT                   /protein_id="ABO46023.1"
FT                   /translation="MYKKLYLIILSTIIAISLNSCVVAAVLIGTAVVAGGTVYYINGNY
FT                   IIEVPKDIRSVYNATIKTIQMDSQNKLISQTYNTKSAIIKALQKGEKISIDLSNIDSRS
FT                   TEIKIRIGVLGDEKKSADLANSITKNIT"
FT   gene            6084..7502
FT                   /gene="clcA"
FT                   /locus_tag="FTW_0010"
FT   CDS_pept        6084..7502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clcA"
FT                   /locus_tag="FTW_0010"
FT                   /product="voltage-gated ClC-type chloride channel ClcA"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46024"
FT                   /protein_id="ABO46024.1"
FT                   /translation="MQTTLISIMSNKVLDTYYKNNRHIWVLVLSGAVIGTMIGLLATAF
FT                   QLLLDFIFKIKLALFSFSGGNLFIEIAMSISLSIVMVLISIFIVKKFAKEAGGSGIQEV
FT                   EGALKGCRKIRKRVMPVKFISGLFSLGSGLSLGKEGPSIHMAAALAQFFVDKFKLTTKY
FT                   ANAVISAGAGAGLAAAFNTPLSGIIFVIEEMNRKFRFSVSAIKCVLVACIMSTVISRAI
FT                   MGNPPAIRVETFSSVPQNTLWLFMVLGIIFGYFGLLFNKSLIKVANFFSEGSKKRYWTL
FT                   VIIVCIIFGIGVVLSPNAVGGGYIVIANTLDYNLSIKMLLVLFVLRFAGVIFSYGTGVT
FT                   GGIFAPMIALGTVFGLAYGLSVAQLFPQYNIEPGVFAVAGMSALFTATVGAPLTGIVLV
FT                   MEMTWNFHLLLPLMITCFSASMLTYIHHQKPIYDTLLRRTISNERKQQAKEKNERNQKP
FT                   TPNTSGQTISKEEI"
FT   gene            7519..8943
FT                   /locus_tag="FTW_0011"
FT   CDS_pept        7519..8943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0011"
FT                   /product="metallocarboxypeptidase"
FT                   /EC_number="3.4.17.-"
FT                   /note="GO_function: GO:0004181 - metallocarboxypeptidase
FT                   activity; GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46025"
FT                   /protein_id="ABO46025.1"
FT                   /translation="MHWDLETQAPKNSINTTSEVIGFFSEKIYEITNSEEITSSLKYLN
FT                   SNLSSLDEINKRIVYLTTKQKDRLSKIPKDEYVAYNKLLSQAQNIWAKARKDNDFEAFA
FT                   PYLEEIIKYQKKYVERIGYNEHPYDVLLDDYEEGMTVAKLEPFFDSLKERIVPLLEKIK
FT                   NTDQVDTSCIDKPYNIDKQKEYSHKIAKKLGFNFDSGILKESAHPFTLNFNKYDVRMTT
FT                   RYIENLFTSSLFSTIHETGHAMYEQNIGDNIYDTILGTGVSLGIHESQSRFYENLVGKN
FT                   KAFWDRNYSELQDLFAENLADTSIEEFYKAINKVSPSLIRVEADELTYSLHILVRFEIE
FT                   KEIFEKDIDIRELPKLWNDKYQKYLGITPFNFSDGILQDVHWSAGLFGYFPTYALGSAY
FT                   ASQIFYYMNKDFDVNVAIRDNKLELVLGFLTKHIHQFGSLKPADEIIYNMCGEYLNAKF
FT                   YVEYLDDKFTKIYNLK"
FT   gene            9030..10220
FT                   /gene="trpB"
FT                   /locus_tag="FTW_0012"
FT   CDS_pept        9030..10220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="FTW_0012"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="GO_function: GO:0004834 - tryptophan synthase
FT                   activity; GO_process: GO:0000162 - tryptophan biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46026"
FT                   /db_xref="GOA:A4IVS4"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IVS4"
FT                   /protein_id="ABO46026.1"
FT                   /translation="MSKLNAYFGEYGGQFVPQILVPALDQLEQEFIKAQADESFKQEFK
FT                   ELLQEYAGRPTALTKTRNIVKNTRTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKE
FT                   IIAETGAGQHGVATALACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSA
FT                   TLKDACNEALRDWSANYSKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQMLAKEGRL
FT                   PDAVIACVGGGSNAIGMFADFIDEKNVKLIGVEPAGKGIETGEHGAPLKHGKTGIFFGM
FT                   KAPLMQNSDGQIEESYSISAGLDFPSVGPQHAHLLAICRAKYASATDDEALDAFKLLCK
FT                   KEGIIPALESSHALAHALKLAYEDPNKEQLLVVNLSGRGDKDIFTVHDILKEKGEI"
FT   gene            10220..11029
FT                   /gene="trpA"
FT                   /locus_tag="FTW_0013"
FT   CDS_pept        10220..11029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="FTW_0013"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="GO_function: GO:0004834 - tryptophan synthase
FT                   activity; GO_process: GO:0000162 - tryptophan biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46027"
FT                   /db_xref="GOA:A4IVS5"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IVS5"
FT                   /protein_id="ABO46027.1"
FT                   /translation="MTNRYTTLFANLEKRNEGAFIPFVTIGDPNKALSFEIIDTLVSSG
FT                   ADALELGIPFSDPLADGPTIQEANIRALESGITPKDCFDILTKIRAKYPHIPIGLLLYA
FT                   NLVYANGIENFYQKCLDAGVDSILIADVPAHESKEFRDIAKKVSIAQIFIAPPDASEST
FT                   LKQISELGSGYTYLLSRVGVTGTETAANMPVEDVLTKLREYNAPKPVLGFGISKPEQVQ
FT                   QAIKAGAAGAISGSATVKIIQNNISNKQKMLNELTYFVKEMKAATLN"
FT   gene            complement(11084..11437)
FT                   /locus_tag="FTW_0014"
FT   CDS_pept        complement(11084..11437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46028"
FT                   /protein_id="ABO46028.1"
FT                   /translation="MSLINMTKIDKKNKVPVHLELEKSVLDEILEYLKWAEIDDQAHFI
FT                   EEACRYIFDIDEDWKKFKKNHFEATGIKLVDKKETKLDVFNEMVGEDEGMVNLEDDENL
FT                   GNKLAKKLQKSSK"
FT   gene            complement(11526..12235)
FT                   /locus_tag="FTW_0015"
FT                   /note="nicotinamide mononucleotide transport (NMT) family
FT                   protein"
FT   misc_feature    complement(11526..12235)
FT                   /locus_tag="FTW_0015"
FT                   /note="contains frameshift"
FT   gene            12455..15034
FT                   /gene="clpB"
FT                   /locus_tag="FTW_0017"
FT   CDS_pept        12455..15034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="FTW_0017"
FT                   /product="AAA superfamily ATPase clpB"
FT                   /EC_number="3.6.1.-"
FT                   /note="GO_function: GO:0016887 - ATPase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46029"
FT                   /protein_id="ABO46029.1"
FT                   /translation="MDINKFTIKLQEALAEAQSYAFQQKATEFTSAHILKALLEQNDSV
FT                   AISILSVCGVNIQNFIKAVNDMVDSVAVLSGEGNPQVTPSRDLIATLHKMQGLANKNGD
FT                   EFISSEVFLLASLEDKSLTGLYNKFGITKEKLTKAVNDYRGGEKVSSQNQEDMKGALDK
FT                   YTVDLTDLARKGKIDPIIGRDSEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVNDEVPEGVKGKKVLSLDMGALLAGAKFRGDFEERLKSVLKELSKQEGNVILFIDELH
FT                   TMVGAGKAEGSMDAGNMLKPALARGELKCVGATTLDEYREYVEKDPALERRFQKVLVDE
FT                   PTVEDTIAILRGLKERYELHHGVNITDSAIVSAATLSHRYITDRQLPDKAIDLVDEAAS
FT                   QIRMEIDSKPEKMESLYRRIIQLKMQREQLKKEKDDATKKRLEILEQEIKGLDSEYKGL
FT                   EELWKAEKLKMQGTSKLKEELEKAKFELEKYQRVGDLSKMAELQYGKIPELEAQIKQIE
FT                   ETEAEPSENKLVRTSVTENEIADVVSKATGIPVSKMMEGEKDKLLNMESFLHKRVIGQD
FT                   QAIKAVSNAVRRSRSGLSDPNRPIGSFMFLGPTGVGKTELTKALAEFLFDDEDAMLRVD
FT                   MSEFMEKHSVARLIGAPPGYVGYEQGGYLTEHVRRKPYSVILLDEIEKAHADIFNILLQ
FT                   VLDDGRLTDGQGRTVDFKNTVIVMTSNLGSHRIQEMQGQDYETVKSAVMEMVLSHFRPE
FT                   FVNRVDDAIVFEPLNKEMITEIAKIQIKRLEKRLADLSIGLEVTTEAMDKLADAGFDPV
FT                   FGARPLKRAIQNNLENPLALKLLDGEFKAEDKIVVDIDANNNITFSK"
FT   gene            15285..17478
FT                   /locus_tag="FTW_0018"
FT                   /note="putative chitinase"
FT   misc_feature    15285..17478
FT                   /locus_tag="FTW_0018"
FT                   /note="contains frameshift"
FT   gene            17532..18692
FT                   /gene="purT"
FT                   /locus_tag="FTW_0020"
FT   CDS_pept        17532..18692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="FTW_0020"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /EC_number="2.1.2.-"
FT                   /note="GO_function: GO:0004644 - phosphoribosylglycinamide
FT                   formyltransferase activity; GO_process: GO:0009152 - purine
FT                   ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46030"
FT                   /db_xref="GOA:A4IVS8"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IVS8"
FT                   /protein_id="ABO46030.1"
FT                   /translation="MNISNIKIMLLGSGELGKEFIIAAQRLGIHTIVVDRYKNAPAMQV
FT                   AHESYVIDMLNSDALEQLILAKNPTYIVPEIEAINTDSLVKLEAHNFNIIPCAKATKLT
FT                   MDRQGIRALAAQQLNLQTSKFAFANSEQEYLDVIQSIGLPFVIKPVMSSSGKGQSIVKE
FT                   HNEIKKAWDYAQNGSRGHAKGVIVEQFIDFDYEITLLTVRHKDGTSFCDPIGHIQKDGD
FT                   YRFSWQPHTMPDTALAKSQEIAKEITDALGGYGVFGVELFIKGDEVFFNEVSPRPHDTG
FT                   MVTLISQNINEFELHLRAIVGLPIPDIQTLQPSASAAILLEGDTANASICGIDKALADA
FT                   NVDIRIFGKKEIHGKRRMGVVLAKAQNTHIALETSKQALAHIHLTK"
FT   gene            complement(18694..19350)
FT                   /locus_tag="FTW_0021"
FT   CDS_pept        complement(18694..19350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0021"
FT                   /product="O-methyltransferase family protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="GO_function: GO:0008171 - O-methyltransferase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46031"
FT                   /protein_id="ABO46031.1"
FT                   /translation="MSIKSLFKSSSLDDYIDTNSVKLDVIAQQLFNKAKNDELSHMLSS
FT                   PNQLQLLSLLLKIINVKRVLEIGVFRGFSTLVMAQALADDATIEACDIGYEYLKPYEHF
FT                   WQQAKVEHKINLNIAPALETLDRFLQQQLKFDFVYIDADKPNYINYYEKALALMDSGGL
FT                   IAIDNVLWSGRVADKSNNEVNTLVIRQLNNLIHDDKRVDACIIPIGDGINLLRKR"
FT   gene            complement(19428..20069)
FT                   /locus_tag="FTW_0022"
FT   CDS_pept        complement(19428..20069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0022"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46032"
FT                   /protein_id="ABO46032.1"
FT                   /translation="MKAELDPRKLIAGTTISVAILFFVTYLVSIADGHNTLCNPFISGC
FT                   SDITHAGFTSYEKYMLKAILIPTATLMAVIFFFIQNLLVQISDYSKAVIKQGKVILFLA
FT                   SVGCIGLIIGTAVIDGQDTLMNLHLKAVAVFFVLMSICQVWYTIIEYRYSSRLNKIPLI
FT                   LRRIAILITIAFSIWSVFMDQTTVNHNIVEWWGVYALIFWFWTFSITKIK"
FT   gene            20301..20624
FT                   /locus_tag="FTW_0023"
FT   CDS_pept        20301..20624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0023"
FT                   /product="4Fe-4S binding domain protein"
FT                   /note="GO_function: GO:0009055 - electron carrier activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46033"
FT                   /protein_id="ABO46033.1"
FT                   /translation="MPFVVTESCIKCKYGDCVEVCPVDCFYEGPNMLVINPDECIDCAL
FT                   CEPECPVNAIKSSDDLSENEEQMLDLNRELAGIWPNIVEKCEPCEDADNWASVPDKLKY
FT                   LEK"
FT   gene            20787..21539
FT                   /locus_tag="FTW_0024"
FT   CDS_pept        20787..21539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0024"
FT                   /product="acetyltransferase protein"
FT                   /EC_number="2.3.1.-"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46034"
FT                   /protein_id="ABO46034.1"
FT                   /translation="MKSFLKKIWNILMWLRMTAFQLYSFAVIGGCSILINIFAFFKLPL
FT                   SWRMAVCYVWTYLYWIGMLVFLQVFIRITGRVNIDKDYPCIYVSKHQSMLETFMFYGLL
FT                   GKCHFIMKQELFDAPIFGPAMKNLGSIAIDRDKPRESLKKVVTDGKQSLADGINVVIFP
FT                   EGTRVSVGEYPEFQRSAMKLAADANVYIIPVAHNFGRFFPRKWGQVIKPGIARMDFGKR
FT                   IDPRDFDSKTLTSYCHKVITEKTKEFNG"
FT   gene            21553..22293
FT                   /locus_tag="FTW_0025"
FT   CDS_pept        21553..22293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0025"
FT                   /product="acetyltransferase protein"
FT                   /EC_number="2.3.1.-"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46035"
FT                   /protein_id="ABO46035.1"
FT                   /translation="MKKIVHLLLVARMQVFKVYAYIVLLLCCILMNLVGVLGASLKVRL
FT                   FVCWIWSCLYRLGVLVLLQIYVKIDGKENIPNYPCIYVSKHQSMLETFVFYGLVRNCCF
FT                   VMKQELLEKPIFGKANTFAEAIGIDRSNGLSAIKKVLEDGKDRVENKNLSIVIFPEGTR
FT                   VPVGEYPKFHRSAMKLATVTNIPIIPVAHNFGVYFGRKKGDFVKPGIARMSFEKAIDPK
FT                   NYSVAELTDMCYDIINDKTKSFGG"
FT   gene            complement(22299..23018)
FT                   /locus_tag="FTW_0026"
FT   CDS_pept        complement(22299..23018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0026"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46036"
FT                   /protein_id="ABO46036.1"
FT                   /translation="MFELNSKDNDSKKFCLMSWNSYKIDHKDSETFSAYIRHVYFNYNI
FT                   DIFCLQEAVHHHGSKFPIDKFDINFASNIVLRSHNYGVATVSHYPVIKNVKILTTHRES
FT                   VINTHKASLITHLNINNTKVIVVNIHAINFKSNKVYEYEFEKIKEFIAPEKYKHPIIIA
FT                   GDFNTWNRKRVKLIKDFCREFCFKVAFIDEPQLVKSFQNNHLDFVLYRGLSLEKAAVLD
FT                   CKKISDHNPIIAEFCIK"
FT   gene            complement(23083..24234)
FT                   /gene="nhaA"
FT                   /locus_tag="FTW_0027"
FT   CDS_pept        complement(23083..24234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="FTW_0027"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="GO_function: GO:0015385 - sodium:hydrogen antiporter
FT                   activity; GO_process: GO:0006818 - hydrogen transport;
FT                   GO_process: GO:0006814 - sodium ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46037"
FT                   /db_xref="GOA:A4IVT5"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IVT5"
FT                   /protein_id="ABO46037.1"
FT                   /translation="MGASQKNQELIGGLILFSAALLAIVVNNSPLASYYAMLETINVKL
FT                   GIENLVIDKNLMHWINDGLMAIYFLYIGLEIKREIIVGTLSKPSNIITPAIAAFAGLAM
FT                   PSLIYLSINHDIKVINGWAIPSATDIAFTLAILALLGTRVPAKLKLLVITIAIFDDIAA
FT                   IAIIAIFYTKSLSLLSLSLGTLFILAMIICNRIFKINRSSVYVVLGFFAWFCTIKSGVH
FT                   ATLAGFTTALCIPFRENDKDSPANFMEDSLHPWIIYFILPVFAFANAGISFSGISFSIL
FT                   FEPITLGIIWGLFVGKQLGIFSILAVFKKLKWFKLGESFSNLQLYGISLLCGIGFTMSL
FT                   FIGVLAFNDTHLLNAIKIGVVVGSVLSGFFGYIVLRFIVTNPS"
FT   gene            24328..25224
FT                   /locus_tag="FTW_0028"
FT   CDS_pept        24328..25224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0028"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="GO_function: GO:0009055 - electron carrier activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46038"
FT                   /protein_id="ABO46038.1"
FT                   /translation="MKNLPKAWYAIANIKEIKSKPIKLERLGKNLVLWKDAEKIIAMEN
FT                   RCPHRGAELSLGKVCDGAIACPFHGFRFDTQGNCIYTPETQGAIPKLQVKTYPTKVVAD
FT                   MVWINVFDEQLDSSYAFEFAQNLYNEFAGNYSLLADTWNNNIRHCIENQLDYTHLATVH
FT                   KRSIGRGYKIPQDIKLNICDEYIEALKNQRLMLKYIFPNFWLLNNADKLKICVYFVPIN
FT                   EHQTKLYLVNYRKFLTGKIIKPIADIVFSITNKIILNEDKRVVKTQKYDEKYDTDDFLL
FT                   RHDQIIKEFRKIWHTPD"
FT   gene            25290..25799
FT                   /locus_tag="FTW_0029"
FT   CDS_pept        25290..25799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0029"
FT                   /product="putative B-type cytochrome subunit"
FT                   /note="GO_function: GO:0016949 - nickel hydrogenase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46039"
FT                   /protein_id="ABO46039.1"
FT                   /translation="MKYSLPVRVLHSLLAFLIIAQLILGFGYAYDLFDSRWIMTLHKSF
FT                   GLVIFFVIPLLAVAKFFSIKPPYNPPLPLLQLIIAKIVHLGLYISAFSMAFSGVVGSML
FT                   MGYPWKIFFVIPFPEIITPNFELGSKIFSYHYIFASVLLVLVVLHIAAALYHQLIVKDN
FT                   ILARMK"
FT   gene            25829..27087
FT                   /locus_tag="FTW_0030"
FT                   /note="major facilitator superfamily transporter"
FT   misc_feature    25829..27087
FT                   /locus_tag="FTW_0030"
FT                   /note="contains frameshift"
FT   gene            27236..28116
FT                   /locus_tag="FTW_0033"
FT   CDS_pept        join(27236..27565,27565..28116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0033"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46040"
FT                   /protein_id="ABO46040.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            complement(28117..28995)
FT                   /locus_tag="FTW_0035"
FT                   /note="putative membrane transporter"
FT   misc_feature    complement(28117..28995)
FT                   /locus_tag="FTW_0035"
FT                   /note="disruption due to transposon insertion"
FT   gene            29130..30143
FT                   /locus_tag="FTW_0036"
FT                   /note="conserved hypothetical protein"
FT   misc_feature    29130..30143
FT                   /locus_tag="FTW_0036"
FT                   /note="contains premature stop"
FT   gene            30375..33962
FT                   /gene="pdpD1"
FT                   /locus_tag="FTW_0037"
FT   CDS_pept        30375..33962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdpD1"
FT                   /locus_tag="FTW_0037"
FT                   /product="pathogenicity determinant protein D, pdpD"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46041"
FT                   /protein_id="ABO46041.1"
FT                   /translation="MDQDINDLLYDTNDLKKEKVCGGFFDFIKAWFYNDVERHMFFEDE
FT                   IIVAQKLKTMDVMANTYALERKKYFEKFLKDSHKQKGFFTRIKDRDFAFYKDPTRVKLW
FT                   SSITDTDVYSFFIKSSVNQVLGGGNIAQLTSLPKFKFNAIASVNNENISAAANLAATGA
FT                   KSFFGSSCINIWSNLPVFDSERGDVKSFIPLYLRISGKASSALFNYNIDISASTNRLKF
FT                   TESKCMELLNNFKGNVNLRLVAAKSSREAKSFIYTPKFKEDSNKHLNDLGFILNTQQGS
FT                   YRYLVPEIRDGLDLIREYTYPEIEQIYFGRSALSGYSKSNYDKQSLGIEKNGEGLMTLR
FT                   VSSKDYENPLIQVKTSVNVTSFDLLSGQIKGKILADDLIGFSDAKGAINKFRNEVDTII
FT                   KNNISESFKSPFKIPNLSEFSDMEIRVRFGLYSKQSASKLRTIRISIPMTTKMLDFNQT
FT                   SGSYNTKSGMGYSMAQRHQLKEAIPYNEGLLENSAQQDFDLVKPTGNSTLGAVQDNLSN
FT                   IYDKSSTFDSVIGSLRELYKLKGEDLTNIDSHDILNVLSQNSSLSGLSSSIAADLNELN
FT                   SKFKDITSINKKTSEAILSTNYQQYNPSFNKAKIFDNPDSFYVQDTLINYSQTLKKEEF
FT                   RDQMSTINIIEFGSDGDLPILFNLCKMMTSESAKDGAKNFLSQKENVNKTKEFFDALEN
FT                   TTSVISPESNISYTSINVLCSKNAGGVITENNKASSVSLGSTISLADFNRMYSLDSRVS
FT                   VLGVSPLEELSSFSAKKNEYKITFEEYFTKLAIQRYMEVIMIDDEADFIKSFVLPMMEC
FT                   QKKLLDNLVILNKDAKWKSSSSFKRAFSNRGSFSFTGWLKERLPGFDFELSQEYAYFTG
FT                   LVINFAFEEDNSSSETVIKLCKIIKSLDRLVRGFYFLLRRMVKNRNTKVGSHNVSESHI
FT                   NMVKQILTSLCEPYQILTQKVSDNAELLSALVNMLSFMDSLVEVQRLCASICIPTSAFF
FT                   TLVNENKNLLKDICYTVEKSGVTGIVVESTFSYSPELFKENQQDIKLNIKNTSVRVRDG
FT                   KVKRVTSIDRNANTEAILQSIYDNIIAFDEQDLERLFTGFRILKQENSTNTNKAVFNIG
FT                   LTYHPITNNAFVEFNKDQQSLLYSYNNLSKDAYVTKIKSIVDAKVALNLSFEHEEIRSS
FT                   QGFSVLATVPARGYSIDDLNRKYRPMIWV"
FT   gene            34043..34597
FT                   /gene="iglA1"
FT                   /locus_tag="FTW_0038"
FT   CDS_pept        34043..34597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iglA1"
FT                   /locus_tag="FTW_0038"
FT                   /product="intracellular growth locus, igl A"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46042"
FT                   /protein_id="ABO46042.1"
FT                   /translation="MAKNKIPNSRLMINYETNVDGVLKKKELPYRVLVVGDLSKGRSVD
FT                   AKKEFADREVRRVNNGVDRVLEEMNISFDFEAPNFVSKDRSNLKVNYRIESVKDFRPDA
FT                   VAKKVPEIRALLEMKEILASFAKDIENNRNLKKTIDMIFSDSNELESLKSKIPALTNYT
FT                   IKDSCDAAESQDLSNQQVDGK"
FT   gene            34611..36131
FT                   /gene="iglB1"
FT                   /locus_tag="FTW_0039"
FT   CDS_pept        34611..36131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iglB1"
FT                   /locus_tag="FTW_0039"
FT                   /product="intracellular growth locus B, IglB"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46043"
FT                   /protein_id="ABO46043.1"
FT                   /translation="MTINKLSLTDELLNNFGGSTEVDSVLKNIDFDVSDDASKVLSLST
FT                   DYNARNLMALSLVLANNDNINNYNQKYIQKVITVIDKLIDLQVNSIISNDEFRALEQEW
FT                   LKVQEVCQEDYDNVEVSILDVKKEELQYDFERNLYDISSSDFFKKVYVSEFDQYGGEPY
FT                   GAILGLYNFENTTNDIIWLTGMGMVAKNSHAPFIASIDKSFFGVKDLSEITHIKSFEAL
FT                   LEHPRYKEWNDFRNLDVAAYIGLTVGDFMLRQPYNPENNPVQYKLMEGFNEFVDYDKNE
FT                   SYLWGPASIHLVKNMMRSYDKTRWFQYIRGVESGGYVKNLVACVYDNKGILETKSPLNV
FT                   LFADYMELSLANIGLIPFVSEKGTSNACFFSVNSAKKVEEFVDGFDSANSRLIANLSYT
FT                   MCISRISHYIKCVIRDKIGSIVDVESIQKILSDWISEFVTTVYQPTPLEMARYPFRNVS
FT                   IEVKTIPGKPGWYSCKINVIPHIQFEGMNTTMTIDTRLEPELFGTNNN"
FT   gene            36142..36777
FT                   /gene="iglC1"
FT                   /locus_tag="FTW_0040"
FT   CDS_pept        36142..36777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iglC1"
FT                   /locus_tag="FTW_0040"
FT                   /product="intracellular growth locus iglC"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46044"
FT                   /protein_id="ABO46044.1"
FT                   /translation="MIMSEMITRQQVTSGETIHVRTDPTACIGSHPNCRLFIDSLTIAG
FT                   EKLDKNIVAIEGGEDVTKADSATAAASVIRLSITPGSINPTISITLGVLIKSNVRTKIE
FT                   EKVSSILQASATDMKIKLGNSNKKQEYKTDEAWGIMIDLSNLELYPISAKAFSISIEPT
FT                   ELMGVSKDGMSYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIAAA"
FT   gene            36798..37994
FT                   /gene="iglD1"
FT                   /locus_tag="FTW_0041"
FT   CDS_pept        36798..37994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iglD1"
FT                   /locus_tag="FTW_0041"
FT                   /product="intracellular growth locus iglD"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46045"
FT                   /protein_id="ABO46045.1"
FT                   /translation="MFLERIYWEDGLRLDSDILDKSNLSVLERLSTASYLPANLNKGIV
FT                   SFDLDVESLQTGLILIKDLKLYLDEKNFVFYDKSYPLSLQIMTDKLSDEIPLFLNIREK
FT                   VIEKNGIKYIYNQLSLSLEHSYGFKHSIQIALFRLDRGRLVPEIYDFPLLTLNHYYLGD
FT                   IFVKLNRTVSELKSFNRFVFSASRSYASILLVFLINKLERELKFAESNRANSSPKQIFD
FT                   LIDDIYSLIQLNLDKVEELDSIEFDFQKPLTKLNLLADRLLTLCEYRKINNFIRFELHG
FT                   KKYICESFPEEFFVATRYYLFLKRKATAPANVRFENKNALRITSISRNKNIVALSLSGV
FT                   KLVDVECSMINFTTRFDNIDAIYEIQKGSEWDFILADSSAVFTAFEGSENFDFFIAFS"
FT   gene            complement(38001..38576)
FT                   /locus_tag="FTW_0042"
FT   CDS_pept        complement(38001..38576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46046"
FT                   /protein_id="ABO46046.1"
FT                   /translation="MSKKIFKLLSISIIFSIYQQTFSNTITASTFELKNSSKKNATIFL
FT                   NLNEFCPTNIAACKDENDNNCIYITELVREPLSRIYYYLAVPITSKSVKDLTILYKHDK
FT                   EESPPEAINICLSLFKNNKHETYYSQVIYNWFVSSELYLSFSEGSIFINKDINNSNNYD
FT                   KGNFLSVNLERIADGWAPPHYEKKITII"
FT   gene            complement(38594..42580)
FT                   /gene="pdpC1"
FT                   /locus_tag="FTW_0043"
FT   CDS_pept        complement(38594..42580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdpC1"
FT                   /locus_tag="FTW_0043"
FT                   /product="pathogenicity determinant protein pdpC"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46047"
FT                   /protein_id="ABO46047.1"
FT                   /translation="MNDKYELNIYFEKIELPKTADFNMISKHDIKELRVDANLKKKIHL
FT                   LQFDEDYLAYMRRLRSIHPSKIAMQKIKSIRNKKNSFIIAILSLDKIIHKTKFITFGHK
FT                   TVIFDFKKLWGLVDFVIVHTSNKTWVNHKLTSFMPSITYCNQNIIHLAYHSDFLYIYHT
FT                   PEFMDDINVDRENRRELVAKIPDPYWVRADTKENKINITSEKKNLEKDLKKITKLKNFE
FT                   ISANDIFFSKAIKAAPRLQHKNKSKLFNSLAIENNEKIKRDIIDYAISNAWYKNEGLLE
FT                   NLMTFLDALIVRHLYLIAVYSVYEIEIGIKSVKPEYSKLLKAGLLNKDIQNQLIYDQKK
FT                   ISNIIWLGETFHGLDIEEAQALCEFLDEENINPKINPINSKKLYKTYKENYKSDSEKIL
FT                   SFTKYKEKYNFLNNDKLREEHANKLSSILEDPKFRVLSYINAFLCSTKNYLVPYGYLGS
FT                   NPLTYYNCMLETGKRRTSKEAYFADIRNKLFIVCYLPGFLSSVIADDDFIDWYSNKKEN
FT                   QELLKNSYLNNLYNSKQKYIKDFIDLDIIKLLKQTSSQIKPSYIPVAFRYGAFASTTAL
FT                   IRSNANVSNRMEFELYDSPERLHNQYSEKEEMIMPKSVNNPKDHSIDNGMSLFSLNLTN
FT                   EKEDGLRKVMLKVAQLYNLDFKVGISGNLDQAMTQALILGMATTKKNGDIVIDEDQVLY
FT                   MTYLYCIFMAHSVDHTVDEILMSSNTYMLNSKEEKYPIANIANFFARPVFKLSKDKEFK
FT                   ALVEKYENSIKPNSKVLKENYISRVTTLSEVYEDIYNLNCLYSSLSEGSLYNLLSTHSE
FT                   RNCTLLEQYSRKKKAETGLVQDGEKIKVVNNYNSYAAINQYQRFVSLGIMYDSGAKYSS
FT                   SHKKQIEKDFNLYSPDKEQINYLKYNFKDNKFDAVYKNKKSKEKTQSHIVYAKKQNTRY
FT                   CYGYFNDFFVKNRITTFYKIKDKSGNYLVNLHNEKYSFATPNSDSKIYRVSPELLNNRD
FT                   DFKRVSKDIIKSYKYISFDKQKEDIVKNFGKNLYHTNYEIWVGLSHQAISCFSVLDNID
FT                   TQEAANTFIDALYYIRLMQLYYGKTIPFLWISSEIVRYSSSETHYYIPTEENFENILKI
FT                   ALNRASKPVIERFLIILNIYNNTIDDNTLILIRCRLTIILFEHEEQKLKLKALQKYADA
FT                   YKKNNYKNEINFRAWFESIFHVQNLSLSPNYIGNNILILSLVEELKTKCSEYKKNMINQ
FT                   QIIAKANELNFYQLLIRLIEISTYHRILTKSIITNTTSLLYDILNKPEFQTINKLINKL
FT                   FIYKNKDLNTDKYKAFHTKLITIEKTYKKINSLYKSDFFKKISS"
FT   gene            complement(42620..43336)
FT                   /locus_tag="FTW_0044"
FT   CDS_pept        complement(42620..43336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46048"
FT                   /protein_id="ABO46048.1"
FT                   /translation="MQHINNINKNISLNNFVSLLKSQKYSLKRINFIPVMINKTSSPTI
FT                   LDIYDNKETLNVKINIFKIKPFTKLQSIYQEYIQNNNDLAIEILGYGLKVLLKLYILDT
FT                   KALHKFTTKNSYYIQCAPKYTIDNIINNIYKLLSEDYCTVIDYKEKLINIKRKQIVVGD
FT                   SYVGKSFLGAYIPSYVYIINIKIYLISKNQYVINKIKTQIKKIEEKITNLPFKIELEIS
FT                   IENNKKNQIYLGYFNL"
FT   gene            complement(43359..44510)
FT                   /locus_tag="FTW_0045"
FT   CDS_pept        complement(43359..44510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46049"
FT                   /protein_id="ABO46049.1"
FT                   /translation="MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLID
FT                   NLNTTRSIDIYNLFLSLNSEICLNLDTVDNISKIISSYLSILNTNFTRISPSESKQKNQ
FT                   LAEKGINKFLVTMDANFAQMQNQDKLLPNNIDSIIKIVQEVIIFFEKNNLNYNSDFKIQ
FT                   LNKTLRKIKSSLILKDQKNDTYSDKESINQVEATITDQKTIQGSEKWKTLIEKIEVLKA
FT                   LVESERIFETSIVYNDIQNLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSSI
FT                   QWSIAQKMYNIDYKSFLDTLEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIA
FT                   DTDAIKEEIVIKQRTNNKKNQNDPVEKISNKIDEDYFEDLFDI"
FT   gene            complement(44532..45155)
FT                   /locus_tag="FTW_0046"
FT   CDS_pept        complement(44532..45155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46050"
FT                   /protein_id="ABO46050.1"
FT                   /translation="MKDFKEIEIILDIIKTTREIIEDNDNDNEKISYHRNNIRKSIFFL
FT                   QEELLEKYSETVCKYIVFPLLAYVDEKLMLLREKSASNISWSLLQLEYYDRKDGGEYVF
FT                   EITDNILSENIYPEICYQTISLILHNDFYGKYYDNIYNHSFLAYKKEIDKHIENSTIDS
FT                   VNFIDIPVNSPPLSRKYSKTLKFLLRIGVPLGLFLLSLLILLSW"
FT   gene            complement(45168..46598)
FT                   /locus_tag="FTW_0047"
FT   CDS_pept        complement(45168..46598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46051"
FT                   /protein_id="ABO46051.1"
FT                   /translation="MDEKRKDLSTNDASILKKTFDKLSNDIRDDFDKRIFDYSNTLLFK
FT                   YYSNLYYFVPKSCLLEINDKGHNGYYIPPQEYFFIEDKRTGKTLTYTTKSENIILPIRD
FT                   ITTIKQSDTSINISLEFANNFDYDYVTIWIDPTLCKEDPSFATYIFNQVLEDNGSAKIK
FT                   FSNHSYTTKNVQIEPIKFQLKPTEKLVLNIHSPSLLYGFNIKIKDLFKYKNNDLNKIDF
FT                   FLEVKTENYNDEKLSSLFRVNLIPVFNSFDDYSSTSFASMNLSESKLKHHQKDDAQAIE
FT                   VLSVYENNKQCDFNSFLFVGQNEYYFNRSTQSLNYSSVLPQFSNKIIGTKIHTYTTWTQ
FT                   ITEISDLIEINSNAIASISCNISPIVINKALNNYNSNAKEMFNIIDMIISKNMYSKTTF
FT                   LAIAKLLKINTNDLTLLSMLLQDVEMDSTINELILTLSDKYNPKYKHFLNFHIGIICKF
FT                   INQNTFSFIKKIVLNNSI"
FT   gene            complement(46611..47132)
FT                   /locus_tag="FTW_0048"
FT   CDS_pept        complement(46611..47132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46052"
FT                   /protein_id="ABO46052.1"
FT                   /translation="MLNIINDSLKRLEEITTNDESISSSVSDLVADLNNIKILLAQSKL
FT                   HLSSNASILTTSMGAQIKCSYSLGSGIYLSTRIKTLTNNLPASNITDSKLGANILPFAG
FT                   CTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLENAPITTINSKAMCMFAPGGIVDFI
FT                   SSGQINVKTS"
FT   gene            complement(47133..48863)
FT                   /locus_tag="FTW_0049"
FT   CDS_pept        complement(47133..48863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46053"
FT                   /protein_id="ABO46053.1"
FT                   /translation="MNNNIDKWFENLFSNIHLYYKQEQSYKISKLNECITNVIKFINIK
FT                   DYRKADIYNLTYVIEDVRYSTNLILSDSAIKFNDLILKKLDNLLDCTDINYFTSLMKNL
FT                   KVLLEKYKLVIEKDISNRIELIKTKQIDKLESIFLDYINNHSISAYDDSLVKLYVKTIQ
FT                   NPNSIEAIDEYKSYFDTLKIFIKDHKNIVSFIPFRKNPILSLLKLAYLIRTGLYKTDRL
FT                   LASDIILLRALYSINKDTYKLSLINEKTDTNLSIVSLTSLQAKPSENLKKTIDFIDLQI
FT                   FAISQYFDDFPLQDIFFQKKSQIDIFKSESLEQLIFSLKSISNIMFDEETLYKKIHIKN
FT                   QLYKNLFLNNHNSLIEDIIEKSPANLLTKLANKYFQILLDIATIINIQLVSNNLKLIYP
FT                   FLEFEKYFNQVTLEVSKKSQFNQEKLEKNILNIIRIYPLLNQNYQLLKDMEQKIIDDKN
FT                   SIESNDIYKLSVFVNSKSFSTYKEIRTLTSNDHKDINIHKSLAKLNKNICNAKHKNAAE
FT                   TAKELTMVLLSKSYYMNPTLIGVYNLPPISNSFFLVLKEITNNPIIDSIKSKQEAYWKI
FT                   "
FT   gene            complement(48868..49362)
FT                   /locus_tag="FTW_0050"
FT   CDS_pept        complement(48868..49362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46054"
FT                   /protein_id="ABO46054.1"
FT                   /translation="MSKADHIFNLEEQGLLIDIKDDSKGCTTKLESSGKIKHYATESIE
FT                   SSADKQIIENVKDSKISITEKEILLATKKSSIMLSEDKIVIKIGNSLIILDDSNISLES
FT                   ATINIKSSANINIQASQNIDIKSLNNSIKADVNLNAEGLDVNIKGSVTASIKGSTATMV
FT                   G"
FT   gene            complement(49375..49752)
FT                   /locus_tag="FTW_0051"
FT   CDS_pept        complement(49375..49752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0051"
FT                   /product="hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46055"
FT                   /protein_id="ABO46055.1"
FT                   /translation="MYNKLLKNFCLVLSTIIGLSSCISDGLYINNNIPKTKIVLESKPD
FT                   KNIFYSDNYQSISQRIYDDNVKVLNLKTGKNEFPLDKDIKDYALYFILPENKKTENWKY
FT                   IISSDSVNKFTIKNDSSIEKD"
FT   gene            complement(49742..53023)
FT                   /gene="pdpB1"
FT                   /locus_tag="FTW_0052"
FT   CDS_pept        complement(49742..53023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdpB1"
FT                   /locus_tag="FTW_0052"
FT                   /product="pathogenicity deteminant protein pdpB1"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46056"
FT                   /protein_id="ABO46056.1"
FT                   /translation="MNFIKNHQILIISLTIAIIVLSVLGIFMIKKWLKTSRNPNKKSAS
FT                   KTIKNAKSLIKKNKVKNNLSELYIFYGDYLAAKDYITKIKPQAQIIDNNELPLIAIDKN
FT                   NTSLVFANNEFSYLYKLKKKLNLQFYKLNFCFDISDDYYHENIKISEIYKELLKLRLKN
FT                   FIISFYTLSEHTRSYNNAIDKKSIFKLTSDADTNHKAEEEILSKILSSKDDVNNKYNNV
FT                   KILNQIRRLLKNIHPQLKSINKETFFNFGLNTPDNIIAKKDTIFFSSSPKSIIINLISL
FT                   LFSFIFIVNIFQEINIKEKFSIQELNQLHESDSNKIIEETRKKIDEAILLDILYPKSIK
FT                   YHFIYEQYADTLLKNVILPKYNDTYDLSMITSFLIFFEYLDNKIINQHTNRILKIISSI
FT                   TNLSEKQLDIVINYTTPSIRTEMIKSAINRANKLYTNRLIVVGEDSESYLSTKGFNAEY
FT                   LGISNTKRAKVINNIYIQYLYKCATDNAILDLNDNYIIPIEVNNIFKMYQEQFDTSSKK
FT                   LCNSSYINSITKSVSLILNQEENKRKFESFSDMLDHIYYLVKSLEKNAKDVADDGKKQT
FT                   SSITVSLINYVINSVVNPTYNKNELPLISPVSKNLYMEFAPNFYSKRILISPIYSKEYI
FT                   KDNIDPTNKKFNRLVNNLKNNFNIEPDFMIAIYKSSINNYIEKYIGSYNKMIDSLNNDS
FT                   EFNKNISNKGALKLYLLAMSSKDSSFNSLIEFYSTNTDLITNESETNSSKKINKLQHFY
FT                   GEITKLNKQNNTNDQNDKSLWAPIDNYFKENDKYLESKSYADYKNIFKQLNNLIIEQGY
FT                   SSTYKNIKQGYEPLQKVYSELSKINNHQGNNNLYKLLKKHLDIAINTIKTIAIQDAITK
FT                   LDNTVNIEYEYINNQFPFNKDSNSAATNEAITKDFDNNGYIYSGFIEQLSPLLSYNKTD
FT                   DRWESKDFSKPEEIDYLNKFNKVYLLNKLLWDDKRNPKAIKFDITPIPNKDNDYTFFSI
FT                   ILDKQNYVNSLNIKYSDSIEVLYNWNSLESTTITIKFEDGSNEQISYQGKWSILKAIKD
FT                   ANCDQNNICTWVIKHKGKKYPLSFKIESKFLQVLGWQKQGEVNVQ"
FT   gene            complement(53028..55490)
FT                   /gene="pdpA1"
FT                   /locus_tag="FTW_0053"
FT   CDS_pept        complement(53028..55490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdpA1"
FT                   /locus_tag="FTW_0053"
FT                   /product="pathogenicity deteminant protein pdpA1"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46057"
FT                   /protein_id="ABO46057.1"
FT                   /translation="MIAVKDITDLNIQDIISQLTSEVINGDTTSSSAKFACEINSYIIN
FT                   YKLLNINLINTQLKNTKILYRKGLISKLDYEKYKRYCVICRLKNNIDEFILYFSTNYKD
FT                   SQSLKIAIKELQNSCSSSLILELPHDYIRKIDVLLTSIDSAIQRSSDLNKTIIKQLNKL
FT                   KSSLSRYIGYNNVLQKQEITINIKPINKNFELEDISFVSTRNKQYFKHNSLTLKNPHIE
FT                   KLEVCENIYGINGWLTFDLAYINNHKDFNFLLSPNQPILLDIQINDSFNFYKKESKKDH
FT                   HKRTTRFMAIGFNSNSIDIHENFEYSIYSYTKNVSSGVKKFKIQFHDPLKALWTKHKPS
FT                   YIALNKSLDDIFKENFFFDNLVSLDTNKSNNLKIRIPQAFISTVNRNFYDFFIQQLEQN
FT                   KCYLKYFCDKKSGKVSYHVVDQVDNDLQRNIVNSDEDLKDKLSPYDISCFKKQILISNK
FT                   SNFYVKEKNICPDVTLNTQKKEDRKISDTLIKPFSSILKDNLQSIEYIQSNNDDIQEII
FT                   TTGFEILLTSRNTLPFLDTEITLSKLDNDQNYLLGATDIKSLYISQRKLLFKRSKYCSK
FT                   QLYENLHNFHYKSDSESDVYEKIAFTKYPSLTHDNLITYKIKDYSNLTPEYPKYKSFSN
FT                   FYINGRVTIGENVNNDSKKAYKFFKNYKPEESSIAEFQENGEKGTSAILNSKADILYAI
FT                   EIAKEMLSDKSSDKPIIYLPLKVNINSANNQFIPLRNDDIILIEMQSFTKGEIIELISN
FT                   SAISTKKAQQQLLQRQLLGSKENCEMAYTQTSDSETFSLTQVNEDCENSFLINDKKGIF
FT                   LRYKSKGN"
FT   gene            55860..57388
FT                   /locus_tag="FTW_2069"
FT   rRNA            55860..57388
FT                   /locus_tag="FTW_2069"
FT                   /product="16S ribosomal RNA"
FT   gene            57484..57560
FT                   /locus_tag="FTW_2063"
FT   tRNA            57484..57560
FT                   /locus_tag="FTW_2063"
FT                   /product="tRNA-Ile"
FT   gene            57575..57650
FT                   /locus_tag="FTW_2043"
FT   tRNA            57575..57650
FT                   /locus_tag="FTW_2043"
FT                   /product="tRNA-Ala"
FT   gene            57702..60591
FT                   /locus_tag="FTW_2066"
FT   rRNA            57702..60591
FT                   /locus_tag="FTW_2066"
FT                   /product="23S ribosomal RNA"
FT   gene            60636..60750
FT                   /locus_tag="FTW_2073"
FT   rRNA            60636..60750
FT                   /locus_tag="FTW_2073"
FT                   /product="5S ribosomal RNA"
FT   gene            61033..61797
FT                   /locus_tag="FTW_0055"
FT                   /note="NAD dependent formate dehydrogenase"
FT   misc_feature    61033..61797
FT                   /locus_tag="FTW_0055"
FT                   /note="disrupted due to transposon insertion"
FT   gene            61855..62735
FT                   /locus_tag="FTW_0056"
FT   CDS_pept        join(61855..62184,62184..62735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0056"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46058"
FT                   /protein_id="ABO46058.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPNIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            62760..63179
FT                   /locus_tag="FTW_0058"
FT                   /note="NAD dependent formate dehydrogenase"
FT   misc_feature    62760..63179
FT                   /locus_tag="FTW_0058"
FT                   /note="disrupted due to transposon insertion"
FT   gene            63486..65207
FT                   /gene="kdpA"
FT                   /locus_tag="FTW_0059"
FT   CDS_pept        63486..65207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="FTW_0059"
FT                   /product="K+-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="GO_function: GO:0008556 - potassium-transporting
FT                   ATPase activity; GO_process: GO:0006813 - potassium ion
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46059"
FT                   /db_xref="GOA:A4IVV7"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IVV7"
FT                   /protein_id="ABO46059.1"
FT                   /translation="MISNFILFALFIVTIALITKPLGSYIFRVFNNERTYLDWLAKPFQ
FT                   RVYLLVLGESSKKEQTAKAYFFSLVSFSVMAFIFVLVILLLQGILPLNPQEIKGMSFPQ
FT                   ALNTAVSFITNTNWQSYSGETGVSYFAQMLALAVQNFVSAAVGLCVAIALIRSVARHET
FT                   ATIGNFWNDLGKGVFWILLPISIVIAIVYIFQGVPQNVMAYLHVHTLAGTEQIIPQGPI
FT                   ASQEAIKSLGTNGGGFFNANSAHPYENPTVITNYIQMVSIFAIAAALTYTFGKWVGNTK
FT                   QGWLIFGVMLVLFIISLVVMTISELHGLDFLHSKDIQDIYGQVGHLSNMEGKESRFGVF
FT                   YSTLYNTVSTSASDGGVNSVLDSYSPLAGMMAMLNMAIGEVIFGGVGAGFYGFFMFLML
FT                   AVFIGSLMIGRAPSFLGKRIEANDMKWTMFALLISLCCVLVFTGLAAVIPSVHQTLTNS
FT                   GAHGFSEILYAYISGANNNGSAFAGLSANTNYLNITIALSMLIGRFGVIFAVIMLAGSL
FT                   VKKKRSLQMSEISSLDTTSFIFAILVFFTILLIGGLTIFPALGLGPILDQLNLNFL"
FT   gene            65217..67256
FT                   /gene="kdpB"
FT                   /locus_tag="FTW_0060"
FT   CDS_pept        65217..67256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="FTW_0060"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="GO_component: GO:0031004 - potassium
FT                   ion-transporting ATPase complex; GO_function: GO:0008556 -
FT                   potassium-transporting ATPase activity; GO_process:
FT                   GO:0006813 - potassium ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46060"
FT                   /protein_id="ABO46060.1"
FT                   /translation="MSTRKSPNLLSKELVVPAIKKSFTKCDPRQMIKNPVMFCVEVVTI
FT                   LCTLYLVSEIIQGQNIGFTLQVVIWLWFTILFANFAEGIAEGRGKAQADTLKAAKSKLF
FT                   ALRIEEDGSVTKVDAESLKIGDTVIVETNTLIPCDGDVIEGMATIDESAITGESEPVVK
FT                   EAGSDNSAVTTGTKVLSDSIKVRVTSNPGESFLDKMIDLVEGAKRLKSPNEIALTILLS
FT                   GLTLIFIFAICSLYGMAMYSNTVLSAVVLIALFVTLIPTTIAGLLSAIGISGMDRLLKF
FT                   NVVALSGRAVESSGNIDLLLLDKTGTITLGNRFATDFIPLGATSLEELAYAAWLSSLVD
FT                   ETPEGKSIVKLAEQRFNFNSKDVDISQAEIIPFSAYTRMSGIDYQGLEVRKGAISSIEN
FT                   YLKDKLDSSLINMFRKVTEQISEQGGTPLAVAQKDKLLGVIHLKDIIKPRIKERFEELR
FT                   KMGVQTVMITGDNPLTAAAIAAEAGVDDFVAQASPQDKLDFIIKAQKEGKTVAMCGDGT
FT                   NDAPALAQADVGIAMATGTSAAREAGNMVDLDSDPKKIIEIVKIGKQILVTRGALTTFS
FT                   ITNDIAKYFVVIPALFVNAFPSLGALNFMGLHSSTSAILSAVIFNALIIIFLIPMALVG
FT                   VKNVVASSQTLLRRNLLYYGVGGAIVPFIGIKLIDMLITAMHLV"
FT   gene            67273..67827
FT                   /gene="kdpC"
FT                   /locus_tag="FTW_0061"
FT   CDS_pept        67273..67827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="FTW_0061"
FT                   /product="potassium-transporting ATPase C chain"
FT                   /EC_number="3.6.3.12"
FT                   /note="GO_component: GO:0031004 - potassium
FT                   ion-transporting ATPase complex; GO_function: GO:0008556 -
FT                   potassium-transporting ATPase activity; GO_process:
FT                   GO:0006813 - potassium ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46061"
FT                   /protein_id="ABO46061.1"
FT                   /translation="MKNLLKSFIAMLFFTVLLGLIYPFFVMALGYSFANNQAKGSQTYY
FT                   DGKLVGSELIGQNMPANLFQTRPSASAYNPLATGGTNYAVNNQKQLQDVQQRVKELQAK
FT                   YGNKSIPADLVFASASGVDPDITLQSALYQAAYVAKQNNLSLEQVTKLIQANTKRHVFN
FT                   VDTVNVLNLNIGIMELINKGK"
FT   gene            67931..70612
FT                   /gene="kdpD"
FT                   /locus_tag="FTW_0062"
FT   CDS_pept        67931..70612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="FTW_0062"
FT                   /product="two component sensor protein KdpD"
FT                   /EC_number="2.7.13.3"
FT                   /note="GO_function: GO:0000155 - two-component sensor
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46062"
FT                   /protein_id="ABO46062.1"
FT                   /translation="MDNQQKVDALLNLANKSQESKKGKLKIFLGYAPGVGKSYAMLNNA
FT                   RALQKDNKDVVVGLLVSHGRADTQALLEGLEIMPLKKVNYRGRVFEELDIDAIKARKPD
FT                   VVIVDELPHSNLPTSRNKKRYIDIEELLDEGISVYTAINIQHIASLSYEVTQLTQANVN
FT                   EIVPNDFIQSADELVVVDVSPEELIKRLKQGKVYKSDAIDRALERYFQYTNLTILRDYT
FT                   FRMAANHVGQDIQQYRKLYQHGSAIPTSPYVLVCCGYDEATPSLLRKGKLLATTLNARL
FT                   IAVFVQKPNKVATKLNFGVIRRYKMLASSLGYNIDHILGDRLSDSILEYAKSIGATDLV
FT                   IGKSIRPKWKDKLFGSVVYDIIRNNNNGMQVHIVSINKKEHKLQKQPRHSKIKTKGLII
FT                   DVIKSALIAAVSGVFIFFSLSIAGLVSQTLCFLMVLAACAYRYGLIPSIISSLVGLFLY
FT                   IYLYLEPNFVFHISSLAGIITFAFFMTIVIFSSHVILRTKRAFTLLKERENNISVLYRF
FT                   TKIFNEKSLDKDLRSVFLHALEEYFKCDFVFLSVSDGELDSAAFPQHPNFNQKELAAAK
FT                   WSFKYKDSCGKGTNTFAGLDWAVEPLVIENRVLGVIAIYLSSETAVERITTDSVILSSM
FT                   LSHISHILLKRNLEKEEKKSLLLDEQRRLQKSMLSSVSHDLKTPLASIMGALSSIKSYK
FT                   DSFNPEQQAEMLDLALTESKRLDSYIDNIIQMLKVDSGKLSLNIQNVNSNFFLTEIQET
FT                   CARVYNKQKFRFIMPKEPFEIELDPVLFQQVILNLIDNAVKFTCDFEKEIIISLKRKKA
FT                   AFCLFEVQDKGIGLRESDMEKIFTIFHRIEKRDSYTHGNGLGLAICKGIVTAHNGKIRV
FT                   YSDGEGKGSVFKITLPLKSSTN"
FT   gene            70956..71327
FT                   /locus_tag="FTW_0063"
FT                   /note="response regulatory protein"
FT   misc_feature    70956..71327
FT                   /locus_tag="FTW_0063"
FT                   /note="N-terminal truncated due to frameshift"
FT   gene            71556..72035
FT                   /locus_tag="FTW_0064"
FT   CDS_pept        71556..72035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46063"
FT                   /protein_id="ABO46063.1"
FT                   /translation="MTNAEDSWGMQNRAGHWHLGLMFGGTMGGSNMKMRGATGNVMIMP
FT                   GYNFNKYLGIQYNQMISYSGTFTSIGEATIMIPTGSMIMPYAAAGWSNMSGSVQGAWDV
FT                   GGGVINIALSKTLSAVAAYRYIQTMAASPIAGAGMNQPNARAAMSMVSGGLVWYF"
FT   gene            72482..73678
FT                   /locus_tag="FTW_0065"
FT   CDS_pept        72482..73678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0065"
FT                   /product="Tryptophan/tyrosine permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46064"
FT                   /protein_id="ABO46064.1"
FT                   /translation="MNSRSIGSVFLIIGTTIGAGMLSLPLIVASCGFSMAIILLILSWS
FT                   VMYITALKILRVCAKYPLGVNFTSMMQSQVSRRYLLFFSIIYLLLLYSLMSAYTTQGSS
FT                   LVSAITSLDNSNKAQVGLSAIVFTIIFGALMFSYRISDYANRFFVIVKFLFFAIAVVIM
FT                   LFYIDPSYLSRAPLSLSAFIFAWPTLLPSFGFHNIIPVIYEYQKGDINKIKKSILIGSL
FT                   SVLVIYIIWIFLALALIPQQGLHSYQTLFSFGNNTPAGLAAEIREVSGSGLLEIGLNTF
FT                   IHIAIITSFIGVGISLMHYIRDLFTRYHRQIGNLALGLICFIPPLIFTIFYPRGFILAL
FT                   QYAAIFAVIIFVYTPSFLSRKADLKVYYLNLYVISMGSVVILFQIFNLCFNINPFSGF"
FT   gene            73754..74758
FT                   /locus_tag="FTW_0066"
FT   CDS_pept        73754..74758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0066"
FT                   /product="GTP-binding protein, Obg/CgtA family"
FT                   /note="GO_function: GO:0005525 - GTP binding; GO_process:
FT                   GO:0042254 - ribosome biogenesis and assembly"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46065"
FT                   /db_xref="GOA:A4IVW3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IVW3"
FT                   /protein_id="ABO46065.1"
FT                   /translation="MRFVDEVVIKLQAGKGGNGCVSFRREKYVPRGGPDGGDGGNGGSI
FT                   YLKADENVNTLIDYRYKREYYAENGRPGEGRNCYGKAGEDLYLVVPVGTSVFNIDTNKK
FT                   IGEVLQHGQTFKLVSGGKRGIGNTHFKSSTNQAPRKFTLGEEGEYKEVRLELNLLADVA
FT                   LLGLPNAGKSTLIRSVSEATPKVADYPFTTMYPHLGVVKVGVDSFVMADIPGVIEGAAE
FT                   GAGLGLRFLKHLTRARCVLHVVDICPFNESDPVENYFAVEKELEKYSQELFDKPRFLVI
FT                   NKIDLLADKVEQKCQEFVEQIGYQGNYYTISAAMKKGTDELAKKLNEFLQKQQ"
FT   gene            74765..76639
FT                   /locus_tag="FTW_0067"
FT   CDS_pept        74765..76639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0067"
FT                   /product="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46066"
FT                   /protein_id="ABO46066.1"
FT                   /translation="MKIKNLIFGSPIPNAKQQEQKIGLFAGFAILSSNALSSVSYATGE
FT                   IFIVLATAGAAAVMQYSIEVSIMVILLILLMGFSYAQVIRAHPEGGGSYSIVKTHFNEK
FT                   LLLLTSASLIIDYILTVAVSVSTAAVAISSALPVLDHYSVKLALGLLVLLMIINLRGVK
FT                   STAKIFIWPTYMFIVSIIIMIIVGIYQYNHNSLHTFTYTQNQLDHMQASMGVLTITLLL
FT                   RAFSSGSAALTGIESYANGVSAYKSPTLAKSIIGLLTMTFLSILMFAGVTFIAAKTRIL
FT                   PDFSESVLSQVAHQVLGNGFLYYFLQASTCLILLMAANTCFTGFPILASIMSKDNYLPE
FT                   QLQRVGDRFAFRNGIIMLTILSAILVIIFDAKVSLLIPLYAFGVFIAFTLCQAGLVKYW
FT                   YRNKRKYKSWGIRAFINAFGCVATFVVLITIVESKFFEGVWIVIIAIAIIMYGLYAIKT
FT                   HYIRREHNLALSVDEAVVNACIHENLKPKIVVLVSRIHRGTIEALRLARNLSDDITPVF
FT                   VSANQKKIEKIKSEWKNLAFKEKLLIMRPVYNSFITPVLQILHKNDLRDPERGYSVVII
FT                   PEVVNTKWWHFLLHNQNSRMVKLAIAAMDKKDDKTATRVVISVPYKAE"
FT   gene            76640..78301
FT                   /locus_tag="FTW_0068"
FT                   /note="putative ABC transporter"
FT   misc_feature    76640..78301
FT                   /locus_tag="FTW_0068"
FT                   /note="disrupted due to premature stop"
FT   gene            complement(78291..79718)
FT                   /gene="nhaD"
FT                   /locus_tag="FTW_0070"
FT   CDS_pept        complement(78291..79718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaD"
FT                   /locus_tag="FTW_0070"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46067"
FT                   /protein_id="ABO46067.1"
FT                   /translation="MYKKIILILSIVLLPILSFAEDEKTLSAVSVNAVNHPLAIAAIVV
FT                   FILAYLLVMTEDFTKLNKSKPVIVAAGVIWILVAIVGESLGADNIVHSNFNHIMTEYGE
FT                   LLLFLLVAMAYINLMEDRNVFAKLKSSLLRAGFGYLATFWLTGIIAFFLSAVADNLTTA
FT                   LVMSTVVISIGKDNKKFITMACVNIVVAANAGGAFSPFGDITTLMVWQTGVIKFTEFFA
FT                   IFLPSLINFLVPAIIMSFFIPKMETQSIIEEKVELKRGAIPVIVLFILTIATAVAFEHT
FT                   LHLPPSLGMMTGFGYVMIYNYFYGLKIAHENKNPKKHKMPSHAFDIFDKVKEAEWDTLL
FT                   FFYGILVSVQGLAALGYLGIASQYIYTDMQSIAPSLFSAHTQANTIIGILSAIIDNIPV
FT                   MFAVLSMNPTMEHAQWLLITLTAGVGGSLLAIGSAAGVAVMGKSKGKYTFIGHLKWTWV
FT                   IALGYFASIIVHLLVNH"
FT   gene            79893..81074
FT                   /locus_tag="FTW_0071"
FT   CDS_pept        79893..81074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0071"
FT                   /product="multidrug resistance protein, MFS family"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46068"
FT                   /protein_id="ABO46068.1"
FT                   /translation="MWKYSPLKTILILGPMVFAFALAMDVYMPVLPDMREALHTTQQMV
FT                   QVTLSLFLVVTGVGQLFLGPLSDQLGRFRVILLSAVLFVIGSVLCALSSNIEFLIASRV
FT                   VQGLGCCGLSVCAFAIIRDAFSGKTSSMIYSFINAIISVSPIIGPLIGVQLAIHFHWQS
FT                   AFVFLTGLAVVAFLIVVIFVKESLPVERRKKMSWNVFARYLYVAKSLQFWAFSLAAVSG
FT                   MASFFILFSMTPYIINYLGYPISEIYVVFGSAGLAFLIGSLFAGVIVNALGVYKTALLG
FT                   VACVFAAGILSLSIYEIWGLSLWGFFAPCFLATFGCALTVGTGASGSMEPFYEIAGVAA
FT                   ALFGTMEFAISGIIGSIAMLFPATSSLPIAITMIIMSILCFVLLFLIKGKTKH"
FT   gene            complement(81115..82446)
FT                   /locus_tag="FTW_0072"
FT   CDS_pept        complement(81115..82446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0072"
FT                   /product="peptidase, U32 family protein"
FT                   /EC_number="3.4.-.-"
FT                   /note="GO_function: GO:0008233 - peptidase activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46069"
FT                   /protein_id="ABO46069.1"
FT                   /translation="MKRPELLSPAGTLKAMRYAFAYGADAVYIGQPRYSLRARNNEFSK
FT                   LEILETAITEAHAQGKKIMLANNIAPHNAKIKTYIKDITPVIALKPDAMIMSDPGMIML
FT                   VREHFPDQEIHLSVQANAVNYETVRFWQKFGIKRVVLSRELSLKEIAEIKENVPDMEIE
FT                   TFVHGSLCMAYSGRCLLSGYYSHRDPNQGVCNNACRNNYKVAEAKQNEWGDFEPIQTQS
FT                   TLGIGTPSDKVVLIENDKEPGQYNPMFEDEHGTYIMNSKDLRAIQHVETMMKMGVDCFK
FT                   IEGRTKSFFYAARTAQLYDQAIKDALAGKPFDITLMDKLEGLAHRGYTEGFYRRHVYDE
FT                   YQKYDNSDSRSSTQQFVGEITNFDAHTGYADVNVRNKIKIGDSIELMLPSGSREIILDN
FT                   MQDKDGKHMEEAKGSGYQAKIKFDNVTAEDMKFALMIKNKSPNI"
FT   gene            82766..83386
FT                   /locus_tag="FTW_0073"
FT   CDS_pept        82766..83386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0073"
FT                   /product="putative protein-L-isoaspartate
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46070"
FT                   /protein_id="ABO46070.1"
FT                   /translation="MNFELARENMVKQQVLTEGLSLDGVAKVMADIPREIFLPRELRTL
FT                   AYCDTNLVVNERELRSPMFTARLIEALAIKVSDNVLKLGLESGYPVALIAKLCKSVELV
FT                   DYDELGLAVARRQLASIGIYNVEFNSAEHITNIIKNGKKYNCIYISEVVTEDEIDESLL
FT                   GLLETGGRLIFVVRTAICDKAYLITKTPKQTYEKSFLFNTYNK"
FT   gene            83395..84924
FT                   /locus_tag="FTW_0074"
FT   CDS_pept        83395..84924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0074"
FT                   /product="outer membrane efflux protein, TolC family"
FT                   /note="GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46071"
FT                   /protein_id="ABO46071.1"
FT                   /translation="MKKLTLYLLGFLGFCLALANEDTPVPEYKYAGRPIGTDVAENPYS
FT                   VEKQYAKADQIKVDNKFYNLKKADEVAMVGDTEDKYYSLIDIYKLAAEHNADYQAARST
FT                   FAANVETVPTALGALLPQIDFNYNLRRDLYNQFGGRVNDTSNVVNFSGSQVLFDWSKWK
FT                   TYTQATYLQKSYAMIYAKAEQTLITDTVTAYFELLRAEQALQFQFANEAWNKKLYLTQK
FT                   YQYNSGMVSYADFKTTDAQYRQAIADRVNAQRNFINAKAVMAKLIGKRISSILYISKDT
FT                   EFGNPVPDDINYWLNTAEKYNLDIAQKKFEYEAAQEGVGIQWGKFFPQANLTGGIMMSR
FT                   NALSGSPAQIAEIPTKYDVANIGGQVSWNLLRGGSDYAQLKQASYDNQAANYALLQTKR
FT                   EVYAGTVEAYQTVVLDVVRIEAFRKSVYSGIASVKAILEGFEAGTQTIVDLLNRQAILV
FT                   QAQLSFADAIFNYVEDYVSLKQLQGSLTYKDIEYINTILGTTDIISQIATE"
FT   gene            84933..85574
FT                   /locus_tag="FTW_0075"
FT   CDS_pept        84933..85574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0075"
FT                   /product="4'-phosphopantetheinyl transferase family
FT                   protein"
FT                   /EC_number="2.-.-.-"
FT                   /note="GO_function: GO:0008897 -
FT                   phosphopantetheinyltransferase activity; GO_process:
FT                   GO:0006464 - protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46072"
FT                   /protein_id="ABO46072.1"
FT                   /translation="MPQVSAFILDFEKYKAEDLRGYLCCRNIDSARFNNKQKIFSQFIR
FT                   YFVLEEFYHISSPIFLNQHGKPYLADNSVFFNISHTQTKLIIAVADQEIGVDIEKLSAR
FT                   RNIIRIAQRYFTSLENQWLAASDNPVKDFYTLWTLKEAQVKRDSLGIAKGLSGANFSKI
FT                   NDSWLSNSYPDDFVTFSYDESIVSICCKNIVAQKINLFEIVDFKFKQIQL"
FT   gene            85585..86931
FT                   /locus_tag="FTW_0076"
FT   CDS_pept        85585..86931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0076"
FT                   /product="glutamate decarboxylase"
FT                   /EC_number="4.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46073"
FT                   /protein_id="ABO46073.1"
FT                   /translation="MALHGKKDTIDNLDFFEQSLPKFKLPLNSQDPLEVYQEIKDELML
FT                   DGNSKQNLATFCQTEVDDFIHKLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSS
FT                   AENAIGCSTTGSSEAAMLGGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYW
FT                   DIELREIPMSNESLIMTPEAVLERCDENTIGVVPTLGVTFTGQYEPVEQVCKALDDFER
FT                   QTGVDIPVHGDAASGGFLAPFVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVIWAD
FT                   KKYLPDDLIFNVNYLGGNMPTFALNFSRPGGQIVAQYYNFVRLGFEGYKKVHQLCYDVA
FT                   EYIAKELRKMEIFEIIHAGEGGIPAVSWSLKATKEYSLFDISEKVRAKGWQIAAYTMPN
FT                   NREDLVVMRVLVRRGFSYDLAQLMIRDLVAVIDSLEGKLKILKRSSFAH"
FT   gene            87025..88515
FT                   /gene="purF"
FT                   /locus_tag="FTW_0077"
FT   CDS_pept        87025..88515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="FTW_0077"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="GO_function: GO:0004044 -
FT                   amidophosphoribosyltransferase activity; GO_process:
FT                   GO:0009152 - purine ribonucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46074"
FT                   /protein_id="ABO46074.1"
FT                   /translation="MCGVIGVAGPDQVSYALFYGLSLLQHRGQDAAGIATMDHGHFFIR
FT                   KNTGLVSDVFTDEKLEKSKGNMGIGHVRYPTAGSLGAADSQPFYVNNPHGIVFVHNGNL
FT                   TNVPELAQMLHDIERRHLNTSSDSELLLNFFACGMNKSKGSATSEAVYKACKFVFEHVK
FT                   GGYACTAMIANFGLIAFRDPYGIRPLMLGFKEYDDGEKAYMVASESVALDISGFKVLRD
FT                   VEPGEVIIITEDRKVHSKICAKNPVLAPCLFEYVYFARPDSIMNGVSVYQARVDAGKIL
FT                   SKRIKEAWKDKDIDIVIPVPETGRASAQEIATALGVEYREGFVKNRYVGRTFIMPENVD
FT                   RKNFVRRKLNPIPAEFRDKNVLLVDDSIVRGTTSKRIIEMIRDLGAKSVYLASVSPAVR
FT                   YPNVYGIDMPVKSDLIAHGKTIEEIRQWIGVDGLIYLPLEDLKEIIQKQNPKIREFEDS
FT                   VFSGNYITGDVDDAYLDALEKHRKELKELEKKYKGFDN"
FT   gene            88515..92387
FT                   /gene="purL"
FT                   /locus_tag="FTW_0078"
FT   CDS_pept        88515..92387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="FTW_0078"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="GO_function: GO:0004642 -
FT                   phosphoribosylformylglycinamidine synthase activity;
FT                   GO_process: GO:0006189 - 'de novo' IMP biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46075"
FT                   /protein_id="ABO46075.1"
FT                   /translation="MITIFEGLSALSPFKREKILAAAKKISNKVESVSAQYIHVTELES
FT                   ELNSEQERIVKSLLNYNREYGIAQPMGHTFIIAPRVGTISPWSSKATDIIKNTGIKAVK
FT                   RIERAILFGVEGQVSASELKQIQDIVHDRMVEEVFSCKDDLYRLFSVTAPKELEFVNVL
FT                   EKGAQAIKEADRKLGLALSEQEIEYLADEYTKLGRNPTDTELYMFAQANSEHCRHKIFN
FT                   AKWTIDGQEQDKSLFKMIRNTTEKSPQGVLSAYKDNAAVIEGATAQRFYPNTQTGVYSF
FT                   NQEEVDILMKVETHNHPTAIAPFSGSATGVGGEIRDEGATGLGAKPKAGLTGFTVSNLN
FT                   IPGFEQAWETSKYGKPNHIVTPLQIMLEAPIGGAHYSNEFGRPNLNGYFRTYEQEVNTS
FT                   AGKEMFGYHKPIMIAGGMGNIKRMHVEKGDIKVGAKLICLGGPAMRIGLGGGAASSVVS
FT                   SDTNSELDFASVQRDNAEMERRCQEVIDRCWQMGENNPITFIHDVGAGGISNAFPELVK
FT                   DGGVGGYFELRKVNVGEEGLSPLEIWSNESQERYVLSVDPESLELFEQLCNRERCPFAV
FT                   VGEAISEKHITLNDEYFDNKPVDLPMGLLFGNTPQMHIDVKTVKVEQQAFDTSAIKLDE
FT                   AIERVLKVPAVASKSFLITIGDRSITGMVARDQMVGPWQVPVADCAVTTATVDSQAGEA
FT                   MAMGERTPVAAINAAASGRLAIAETVTNLLAADIEKLSDIRLSANWMVAANQGDENQKL
FT                   YETVRAVGMEFAPALGIAIPVGKDSMSMKTKWSDNGQAKSVTSPLSLVISGFSPVTNAR
FT                   KTLTPVLVDDNDTTLLHIDLSNGAGRLGASCLAQAYNQVGNVAPDIEASKVKVLFENIT
FT                   KLKAENKILAYHDVSDGGVFATLAEMSFAGRKGLDVKLQTQDVLAKLFAEEVGVVIQVR
FT                   NSDVSLVEEMFKDTQIHLCAIAKLNSSDELNIFVNGEKIYSNTRVNLQRWWAETSYQIQ
FT                   SIRDNSECAKQEFDSILNTNDKGIHVEATFDLEEDITAKFVNVEKPKVTILREQGVNGQ
FT                   VEMAAAFTTAGFEAHDVHMSDLHAGRVTLADFKVLVACGGFSYGDVLGAGGGWAKNILF
FT                   TEKLRDEFSRFFGRDDTLALGVCNGCQMLAQLKSLIKGAENWPIFIKNKSEQFEARVSM
FT                   VEIQESDSIWFADMACTKAPIAVAHGEGRPLFENDNQQQAMLASAQVALKYIDGQGQAT
FT                   EMYPYNPNGAVNGLTAVTALDGRVLAMMPHPERVYRAITNSHIPAEYDEYSVWMRMFRN
FT                   ARKWVG"
FT   gene            92375..92885
FT                   /locus_tag="FTW_0079"
FT                   /note="restriction endonuclease FnuDI"
FT   misc_feature    92375..92885
FT                   /locus_tag="FTW_0079"
FT                   /note="contains frameshifts, disrupted due to transposon
FT                   insertion"
FT   gene            92947..93827
FT                   /locus_tag="FTW_0081"
FT   CDS_pept        join(92947..93276,93276..93827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0081"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46076"
FT                   /protein_id="ABO46076.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVDCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            93977..94339
FT                   /locus_tag="FTW_0083"
FT                   /note="restriction endonuclease FnuDI"
FT   misc_feature    93977..94339
FT                   /locus_tag="FTW_0083"
FT                   /note="disrupted due to transpson insertion"
FT   gene            94291..95181
FT                   /locus_tag="FTW_0084"
FT                   /note="restriction endonuclease FnuDI"
FT   misc_feature    94291..95181
FT                   /locus_tag="FTW_0084"
FT                   /note="disrupted due to premature stop"
FT   gene            95466..96305
FT                   /locus_tag="FTW_0086"
FT   CDS_pept        95466..96305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0086"
FT                   /product="aldose 1-epimerase family protein"
FT                   /EC_number="5.1.3.3"
FT                   /note="GO_function: GO:0016854 - racemase and epimerase
FT                   activity; GO_process: GO:0019318 - hexose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46077"
FT                   /protein_id="ABO46077.1"
FT                   /translation="MITIKNDNLLVEISELGAEVRAVINTSTEHGYMWSGVSPVLFPVV
FT                   GKSHDNKIKYQGKEYPMGNHGLARHTVFDIVLHSENSVILAMETSKEDYPFRLRFEVTY
FT                   TLEVNKLITEYNIINLDDGVASCGFGAHPAFACPFDDKHKFSDYEITFSEQKLDFHPIT
FT                   PEAFYTGETKHFKLSKIELDNHTFDNDALVYSGFTDKRVRLAEKGSNRYIEVTFDGFEY
FT                   LGLWSKPKANAPYVCIEPWCGRSDTLGMDVDIEYRIGNVDIEPQQNFSRSYTIEFGY"
FT   gene            complement(96279..97106)
FT                   /locus_tag="FTW_0087"
FT   CDS_pept        complement(96279..97106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46078"
FT                   /protein_id="ABO46078.1"
FT                   /translation="MRKIFFFLIPIILLSSCSTSNYTLIKGSEYISMQPNTQYLYKRTA
FT                   LKADKSIFIDIDIQSCNSDQSKCQYFVSVKSDKGKILEQYYETYYVNFFGDVYLTDSLY
FT                   PNGTLILPARIRLGEELLLDNGDNYGPVQEKLLAYKLIPEIQVNNHEYKNCVNILFETT
FT                   TPTETVDLKLVTDEITCKGIGSVRKEMQMSYKPKFANTNTEDINNSIMKFAATKSISKD
FT                   MAPEGSLKPFGQKKCRTKYSRLYSYRHLLRYFASHYTQISDLLQKLIAKLYSI"
FT   gene            complement(97349..97747)
FT                   /locus_tag="FTW_0088"
FT   CDS_pept        complement(97349..97747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46079"
FT                   /protein_id="ABO46079.1"
FT                   /translation="MKKLIVTSTFITALVSVSYATELKGSDYISTEVGSTYNYQRVNAD
FT                   DQDKFTIETTIKSCNNAKTSCDYVSQIKDVNGKTSANSSYQYSYVVSADGAVYITYPNS
FT                   QQQTLLLPAKIEFNKIRNDNVTNADTNS"
FT   gene            98075..99373
FT                   /gene="purB"
FT                   /locus_tag="FTW_0089"
FT   CDS_pept        98075..99373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="FTW_0089"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="GO_function: GO:0004018 - adenylosuccinate lyase
FT                   activity; GO_process: GO:0009152 - purine ribonucleotide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46080"
FT                   /protein_id="ABO46080.1"
FT                   /translation="MIKRYDIAKISKIWADENKYAKMLEVELAILEALEDRMVPKGTAA
FT                   EIRARAQIRPERVDEIEKVTKHDIIAFCTSIAEQFTAETGKFFHFGVTSSDIIDSALSL
FT                   QIHDSMSYVIKDLEALCDSLLTKAEETKEIITMGRSHGMFAEPMSFGQKFLGAYVEFKR
FT                   RLKDLKDFQKDGLTVQFSGAVGNYCILTTEDEKKAADILGLPVEEVSTQVIPRDRIAKL
FT                   ISIHGLIASAIERLAVEIRHLHRSDVFEVYEGFSKGQKGSSTMPHKKNPISTENLTGMA
FT                   RMLRSHVSIALENCVLWHERDISHSSAERFYLPDNFGIMVYALRRMKNTIDNLVVQRDI
FT                   IEDRVRSTSAYLSSFYLHFLVANTPFMREDCYKIVQQVAFDLKQGESFSKKLQKVMHDE
FT                   HNIILDIPEMDFEGIKKTYLKEIDHVFDRSVKA"
FT   gene            99407..99985
FT                   /locus_tag="FTW_0090"
FT   CDS_pept        99407..99985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46081"
FT                   /protein_id="ABO46081.1"
FT                   /translation="MYNVVKFGCQERPEISSVEEPTKPLAIQDKKTKDNVMTFWRQKLT
FT                   YVGCGEERSVTLHYFIYNNENPKKVYYSIKAKNNSIPLNKTIFEGSFTSLVLRNDVLND
FT                   VVRFLYSKKCSMPEDKLRDHIKYYTASALRYALILSNQKRIKVPQWQEVWSVDACDKNY
FT                   HFPITFTGDGVGGTYWSIGKVTDTEITKS"
FT   gene            100072..101613
FT                   /locus_tag="FTW_0091"
FT   CDS_pept        100072..101613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0091"
FT                   /product="Putative ABC type bacteriocin/antibiotic
FT                   exporter"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46082"
FT                   /protein_id="ABO46082.1"
FT                   /translation="MLYRQIKTVLKIPKHTVYSLVIYSILLGFLSLTIPVSVQTLVNLV
FT                   GVSLSIRPVISLITILFIFLTAAFFVRIFQLKLVEDIQRKVFVETVLRIISAIYKVDFN
FT                   DLIRVNVREKINRAFELKFLQKSVSVIFIILLDIFLQTLFCVIILAFYHPMFLVFDILL
FT                   ITCIVLVIFVPMRAGYEAGLKESTNIYDIVYWFEEKTAEFLSFRQRPEESSVKKVDAKL
FT                   CNYLDARANFFSVVLRQHVYIGLTYIFINILLLGIGSYLIINGQLSIGQLIAAEILVNI
FT                   VLLGLLKFSQYLYDCYGFMVAVRKILDLLEISKKDSPTSEHKNAKLETEVTSLEIALPD
FT                   YQKARFDYTQNHFNNLCLTRQQAQKLLNAFFDDNSEEIIKINNVCLSNYSKEEICNKIH
FT                   IASGIEVVAGTVLDNLCENDFSQEKLKYLSELLDAFGVSFLEKYFEKKIDSQTIKYNLE
FT                   FDTMVVLKMNLIRAILKQPKLLILIDSYGLTNRSNMTITQILQKLAVPTLIISIQ"
FT   gene            101624..102694
FT                   /locus_tag="FTW_0092"
FT   CDS_pept        101624..102694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0092"
FT                   /product="membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46083"
FT                   /protein_id="ABO46083.1"
FT                   /translation="MQLKSFEMLKKDLSFKKIILLVLLSIIVVGVVLAMIPWQQTIDGY
FT                   GDVTTLSPSERQQNISAPIGGRLGKWYVFEGDSVKKGDPIVEVLDLDPEVVSRLEEEKS
FT                   AIELGINSVKLAIKNTKNNIERHKYLVDKGASTQRIYEQAQMEMVNYTQELAKLNVDLA
FT                   KVKVQIARQQSRLVKAPSDGVIVDRIHGLGGVIVKDTDVLATIVPDSKSRIVELWVNSM
FT                   DVPLVKIGDKVMLQFEGWPAVQFSGWPQVAIGTFEGEVIFISPQNNAQGQFKIFVKQSG
FT                   KRDWPSPDVLRLGTKVHGWVLLNNVSLGYELWRRYNGFPINLNSSQLRIGIKKSQEVEK
FT                   PTTIKEQVQNKPSNIK"
FT   gene            102777..103058
FT                   /gene="gatC"
FT                   /locus_tag="FTW_0093"
FT   CDS_pept        102777..103058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="FTW_0093"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.7"
FT                   /note="GO_component: GO:0030956 - glutamyl-tRNA(Gln)
FT                   amidotransferase complex; GO_function: GO:0017068 -
FT                   glutamyl-tRNA(Gln) amidotransferase activity; GO_process:
FT                   GO:0006424 - glutamyl-tRNA aminoacylation; GO_process:
FT                   GO:0006418 - tRNA aminoacylation for protein translation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46084"
FT                   /protein_id="ABO46084.1"
FT                   /translation="MDKKLVKHIAKLSCFDLTEEQLEQYTKDLINICKILDTVKNFDAQ
FT                   GVKPMISPISVDFKFREDIPQDQDNRTSFDKFACEVVDDYFMVPQVVK"
FT   gene            103067..104512
FT                   /locus_tag="FTW_0094"
FT   CDS_pept        103067..104512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0094"
FT                   /product="glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, A subunit"
FT                   /EC_number="6.3.5.7"
FT                   /note="GO_component: GO:0030956 - glutamyl-tRNA(Gln)
FT                   amidotransferase complex; GO_function: GO:0017068 -
FT                   glutamyl-tRNA(Gln) amidotransferase activity; GO_function:
FT                   GO:0004040 - amidase activity; GO_process: GO:0006424 -
FT                   glutamyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46085"
FT                   /db_xref="GOA:A4IVY3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IVY3"
FT                   /protein_id="ABO46085.1"
FT                   /translation="MSYIKKLRARLDSGEISAVELTKEYLAKIKEQDKRINSVITLCEA
FT                   EALKEAEDADAIISAGKQGLLTGIPILHKDLFCTKGIRTTAASKMLDNFVAPYDSTVTK
FT                   NCKDQGMVTLGKLNMDEFAMGSTNEYSYYGAVSNPWDLERVPGGSSGGSAAAVAAGFAP
FT                   ISTGSDTGGSVRQPASFCGLTAMKPSYGSTSRFGMVAFASSFDQAGIFGHYAEDVAIML
FT                   DAIAGECEFDSTCVGVKQNHFTQDLEKDISGKVIGVDESLIKDLPAQIQEAVSKTLDNF
FT                   KKLGAEIKSVKVPDLKEALSTYYIITPAEAAANLARYDGIRYGYRNPEARDLDELYRKS
FT                   RTDGFGAEVKRRIMIGNYVLASSQYDSYYNKAQQLRKVMTDQINQIFTQVDAIFMPASP
FT                   SEAFKKGDKLDPVSAYLSDIYTIPANISGLPAIAFPIGFANNLPVGGQLMAKAFNDNIL
FT                   TQMVVQYQKHYGIEEFILQQARI"
FT   gene            104515..105936
FT                   /locus_tag="FTW_0095"
FT   CDS_pept        104515..105936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0095"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,
FT                   subunit B"
FT                   /EC_number="6.3.5.7"
FT                   /note="GO_component: GO:0030956 - glutamyl-tRNA(Gln)
FT                   amidotransferase complex; GO_function: GO:0017068 -
FT                   glutamyl-tRNA(Gln) amidotransferase activity; GO_process:
FT                   GO:0006424 - glutamyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46086"
FT                   /db_xref="GOA:A4IVY4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IVY4"
FT                   /protein_id="ABO46086.1"
FT                   /translation="MNWEMVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGLP
FT                   GTLPVVNKEAIRKAVIFGLAVDAKISKDSFFARKNYFYPDLSKGYQISQSTNPIVQEGR
FT                   LEIETSKGLKTIRIERAHLEEDAGKSVHGYIAGETGLDYNRAGTPLLEIVTYPDFRSAE
FT                   EVVAYLKKLHQLVKHLGICDGNMQEGSFRCDVNLSIRPQGQAKFGTRAELKNINSFRFI
FT                   DKAIEYEYARQVSVLESGGEVVQETRLYDADANETRSMRAKEDAFDYRYFPDPDLLPLV
FT                   ITDEYIESIKKQMPLKSEEREAVYREHLAEQEVEFLLSNLEIADYYDKVAVVIGYKPAY
FT                   NWITVDLISTLNRAEKEFSSDVVPAEILLEIIANVQKDIISQANAKKVIAEYIDAPSAI
FT                   EAIIEKLGLKQVSDEGMIRELVQGIIAANPQQAADFKAGKTKLMSFFVGQAMKASKGKA
FT                   NPKQVNQIVQEELNK"
FT   gene            105951..106358
FT                   /locus_tag="FTW_0096"
FT   CDS_pept        105951..106358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46087"
FT                   /protein_id="ABO46087.1"
FT                   /translation="MNTNKFYYELMKLNVLSSSYVDDSYKAAWHGNVYPFFHDSKYEFH
FT                   YEVAKYFDRADEKTIDKLCSLLDDYVDERADFSDFEAKVEKVVGKGNVYYVLNYIFRAG
FT                   QYKKLLENIRLNKIHFSQHFIDRFEAGGYLD"
FT   gene            complement(106374..107865)
FT                   /locus_tag="FTW_0097"
FT                   /note="lipase/acyltransferase"
FT   misc_feature    complement(106374..107865)
FT                   /locus_tag="FTW_0097"
FT                   /note="contains frameshift"
FT   gene            complement(107913..109442)
FT                   /locus_tag="FTW_0100"
FT   CDS_pept        complement(107913..109442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46088"
FT                   /protein_id="ABO46088.1"
FT                   /translation="MLNKINIVFICFLVLSITPFMGFSNSFKNSNEQSQKSNSIDKQGI
FT                   TQLQSQIANIQAEINHLTQIKNSNNSAQFATYSSKVENIGLPNSLPDNNKLTLDIMTNI
FT                   DSDSSIINLSDCSIGGIFDKDGGINVGGAPAITTQGEVTFLGAYSGNNTVPIGMISSNL
FT                   FASTVMGLRNKFDSYSIFFGGKIEADAQLWFGSSTISNKATNLASNGQNISLTAANLYF
FT                   LSNVGHYVTAEIEFNTTELNNFSLGNAFVIFGNLDTSPFFLTAGRNKLSVGAFGGGGPW
FT                   TGGITKNFLSPGKVTNVSLNYKSDVWNANVAVFGSNDNQFNFSTGLFYAQKWTQDIAVG
FT                   FNTGYVYNMAGAGNPSLSRFLQSQGHPTDTIGSFNVNTNITYTIAGGFLNLGAGWATTT
FT                   NKKDFTGSGKDVLAGAWYAAANYSLVFRGRKTNFGISYGESYNSTNIPMTLTASPLNFG
FT                   RSSSGIQKQIIVSSQRAYFDNNVLFGPEYSYQQLYNGKHMNTITIDMAVYL"
FT   gene            complement(109528..110718)
FT                   /gene="figD"
FT                   /locus_tag="FTW_0101"
FT   CDS_pept        complement(109528..110718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="figD"
FT                   /locus_tag="FTW_0101"
FT                   /product="transporter, major facilitator family"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46089"
FT                   /protein_id="ABO46089.1"
FT                   /translation="MQIDNKNLKYIPLLVLLTWFLGNMGVHFLLPLLPLLSNNLDASVK
FT                   LTQYVIAFFLAGKALGMIVYGPLSEIYGRRKFMLFGLILYMSSSLLCMLTTDIYWLIFW
FT                   RFVQGLGVSGTILMGRVIINDSYPNDKAANIFGYLFALAAVIIACLPTLGGIIAIFKNW
FT                   QLAFATMMIYSSLIFVIMLKFLPETQSEQFQKSFSLIGIIKDYSNILRNRVFLGYLMCT
FT                   SLMVAGESAFNTNAAFLMIKTYGVSPKIFGMMMSSLLIAHLLGAAICGRYVVKRGISKL
FT                   TGVGALILVLAAMFLSVTSILKFDGPYLTITAMFIYFLGTGFIMTTAAVGVVSPFPKMI
FT                   GTAMAFALSLEFLLSALSSFITSHLSISSLFPITVLITLLSLGSFAMWFFCIKRDK"
FT   gene            complement(110734..111987)
FT                   /gene="figC"
FT                   /locus_tag="FTW_0102"
FT   CDS_pept        complement(110734..111987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="figC"
FT                   /locus_tag="FTW_0102"
FT                   /product="pyridoxal-depedent decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46090"
FT                   /protein_id="ABO46090.1"
FT                   /translation="MSKLSDSKSVFSKLSNKQIETIIQRYASPCFIIDENTLLERARLF
FT                   QQAILNQYQNSIAAYSVKTQSLNTIIQKFYEVGFIPEVVSSDEFEQIQKLQLCDKSIIF
FT                   NGPYKNDASFIKALQLNAMINCDHFDEILRIAKIAKKLNITAKIGLRVADNKTPQNWSR
FT                   FGFALTDQQSNSDIFTTIDKIQQIANIQLAGLHCHIGTNIRDISRFTAMAKNIAELAET
FT                   ILTKYKLTLEWIDLGGGLAGISPTLSDKRLQPYNPFDLELYAATIIAPLKEYLNKTNDK
FT                   TKLIFELGRSLVDYSVALLTTIVGTREQNEDFQSLITDAGIHTIPTISTYRHPIYHLKT
FT                   DSYHKKTLLLGPSCMQHDFLHDDIFLPKLEYGDKLLIDGVGAYNISRNNEFIHLKPSVI
FT                   LIDKNHQYQVLRVRQTHQ"
FT   gene            complement(111980..113242)
FT                   /gene="figB"
FT                   /locus_tag="FTW_0103"
FT   CDS_pept        complement(111980..113242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="figB"
FT                   /locus_tag="FTW_0103"
FT                   /product="transporter, major facilitator superfamily"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46091"
FT                   /protein_id="ABO46091.1"
FT                   /translation="MNNHIKAQILLLCFCQLIIIAAMEMSNPFLPIYLQSLGDFDLLPV
FT                   NAWNVLAYAMPLISAMLFSPFWGKYADRFGYKTMILRAALALAIIQLLIYLTNSALLFI
FT                   TLRFIQGAIAGFLLAAQSYAVVIVSKEFRSRILAWLQSSTAIGIAIGPLIGGVLATLLS
FT                   YNQIFLICAVIACCIFIILLIKLESISNPSLLSKQDNNKNCYHKNTSNNYLIYVYFSVI
FT                   FLAILLSQTAKFLPQSFFAIYAKEFFSSDPIIIAAIYAAPAFSLLLFSAPIGYLFDKLL
FT                   NKQVNNQYFFASSYFIILFAISTVAIYVHGFTHNIYLILAARFILGVTFAGTLPCLFSL
FT                   ACRTKDNNFGFLIGYCNTFSKFGNLCGIFLGGFIFQISSMQTVFYVTAIIYMFLVVIYI
FT                   CLLYLFDLKSSNFKNKELINV"
FT   gene            complement(113249..115168)
FT                   /gene="figA"
FT                   /locus_tag="FTW_0104"
FT   CDS_pept        complement(113249..115168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="figA"
FT                   /locus_tag="FTW_0104"
FT                   /product="siderophore biosynthesis protein, IucA/IucC
FT                   family"
FT                   /note="GO_process: GO:0019290 - siderophore biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46092"
FT                   /protein_id="ABO46092.1"
FT                   /translation="MHIEQLQKNKTPLNIETLELIGLITTDLNPTISSIKASTLKNQFK
FT                   RVALSFYREGLLGKSKKINDTLFFYNINNDKILKINNPILKSLNRIELPDQLTIQDCLT
FT                   KRETSLENIEELINWAKDNNPQINHDDWQQFEYELDNSFENELSMNIYRGLRQKQLANT
FT                   INSANYLNLWQWLTTTMSKNQQLAFLEQWGAVGHIYHPSSKTKIGLSKFENILYSPEFE
FT                   NEVNIIFGAIHKNIAHIEIIDNRIDNYQNWMIINYPEQYKIWYHKLDNRGLDSNNYLMI
FT                   PIHPWQAEHILPAKHKCLIDCQQLIIINDCKYTTKPSMSFRTMLPVATKDKTLMPHIKL
FT                   PVAIHATSVTRTVSPESVKTGPRISKILLEILAKENHLAKNMDILADIAGIHTTKACRK
FT                   DDIRQLSAIFRTNPEELLDSDEVACPLASLFVKTPQNQALICDILELLDYNQPSQILAY
FT                   FRKYTQITLTACLDLYLLYGIALEAHQQNTLVVFKENMPQKLLIRDLGGMRLHLPSFEA
FT                   SGFHFPKDTFSLTFTNSQTITRRKFIHACLQSNIGELVIQLSSHYKIAEGRFWTIVKGE
FT                   IHQRFEYLKPRISPDKYKQEYTQILEKPWSIKALTRMRLNDKLECDKDDMQGDIYINLK
FT                   NPLA"
FT   gene            complement(115423..115845)
FT                   /gene="fur"
FT                   /locus_tag="FTW_0105"
FT   CDS_pept        complement(115423..115845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="FTW_0105"
FT                   /product="ferric uptake regulator protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46093"
FT                   /protein_id="ABO46093.1"
FT                   /translation="MNSKNLDLKEFGFKVTQPRVEILKLFEKNKDKHLSPDDVFSKLKA
FT                   QGSTTGIATVYRVLNQFESAGIINRLKLDNEQVMYELNQGEHHDHIICVKCNMIQEFYS
FT                   PGIEALQKQIVESFGAEMIDYSLNIYVKCKSCREKI"
FT   gene            116054..116452
FT                   /gene="nuoA"
FT                   /locus_tag="FTW_0106"
FT   CDS_pept        116054..116452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="FTW_0106"
FT                   /product="NADH dehydrogenase I subunit A"
FT                   /EC_number="1.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46094"
FT                   /protein_id="ABO46094.1"
FT                   /translation="MSTSVYEQFAPILIFLIIAFGLGAAFAIIGKVLSVIVGANNPNKT
FT                   KGETFECGFPTFGDAREKLDVRFYLIAVLFLVFDLELAFIIPWGINLRASAGMPAISDH
FT                   AFFAMIIFLVVLFLGLIYAWKKGALEWE"
FT   gene            116443..116919
FT                   /gene="nuoB"
FT                   /locus_tag="FTW_0107"
FT   CDS_pept        116443..116919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="FTW_0107"
FT                   /product="NADH dehydrogenase I subunit B"
FT                   /EC_number="1.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46095"
FT                   /db_xref="GOA:A4IVZ3"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IVZ3"
FT                   /protein_id="ABO46095.1"
FT                   /translation="MGIGNENKGFITASADALINWVRTGSLWPVTTGLACCAVEMMHAG
FT                   AARYDLDRFGIVFRPSPRQSDVLIVAGTLCNKMAPALRQVYDQMPDPKWVISMGSCANG
FT                   GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALVYGIIQLQNKIIRKDTIARK"
FT   gene            116922..117566
FT                   /gene="nuoC"
FT                   /locus_tag="FTW_0108"
FT   CDS_pept        116922..117566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="FTW_0108"
FT                   /product="NADH dehydrogenase I subunit C"
FT                   /EC_number="1.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46096"
FT                   /db_xref="GOA:A4IVZ4"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IVZ4"
FT                   /protein_id="ABO46096.1"
FT                   /translation="MSTKLQDHFDKITKILSGFGVEGCISYGEITFSIRDQRDIHLILK
FT                   KLKKEYLFEQLTDVTAVDYLTYGQSDWQVGKVVSQTGFSRGRQQDFKTAAVDNRFEIIY
FT                   QLLSMANNVRIRVKCKLKDAQIILVDSVSDLWPSANWTEREVYDMFGIYFNNHPDLRRV
FT                   LTDYGFVGHPLRKDFPQTGYVEMRYDENLGRVVYEPVEIDDRVNTPRVIRN"
FT   gene            117588..118841
FT                   /gene="nuoD"
FT                   /locus_tag="FTW_0109"
FT   CDS_pept        117588..118841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="FTW_0109"
FT                   /product="NADH dehydrogenase I subunit D"
FT                   /EC_number="1.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46097"
FT                   /db_xref="GOA:A4IVZ5"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IVZ5"
FT                   /protein_id="ABO46097.1"
FT                   /translation="MAEYKNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHR
FT                   GTEKLAEFKPYNQSIGYMDRLDYVSMMCNEHAYVMAIEKLLQLEVPERAKYIRVMFAEM
FT                   TRILNHLLWVAACGIDLGAMTVFLYAFRVREDLFDCYEAVSGARMHAAYFRPGGVARDL
FT                   PTQMPQYQKTRFTSKRKAKKLNEPRQGSMLDFLDHFVVDFEKSLDEIDTLLTDNRLWKQ
FT                   RTVDIGTVTAERAKELGFTGPMLRGSGVAWDLRKTQPYEVYHKLEFDIPIGANGDCYDR
FT                   YLVRMAEMRESNKLIKQCVDWLRANPGPVLSDNHKVAPPKRNAMKNNMEELIHHFKLFS
FT                   EGYCTTEGEVYVGTEHPKGEFGVYIKSDGANKPYRLKMRAPGFAHISAMDELLSGHMLA
FT                   DTPAIISTIDVVFGDVDR"
FT   gene            118851..119339
FT                   /gene="nuoE"
FT                   /locus_tag="FTW_0110"
FT   CDS_pept        118851..119339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="FTW_0110"
FT                   /product="NADH dehydrogenase I subunit E"
FT                   /EC_number="1.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46098"
FT                   /protein_id="ABO46098.1"
FT                   /translation="MSLVDLISPQAREDIDRVLSKFPADQRRSAILEGLHILQDQNGGY
FT                   LTDDLQTALAEYLQVSKVDVYEVATFYCMYNLKPVGRHKLNVCTNVSCMLNGAYEILAH
FT                   IEKKLAIKPGETTKDGRITLKEVECQGACCGSPMLEVDKVFYENLTIEKVNQIIDSLE"
FT   gene            119346..120620
FT                   /gene="nuoF"
FT                   /locus_tag="FTW_0111"
FT   CDS_pept        119346..120620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="FTW_0111"
FT                   /product="NADH dehydrogenase I subunit F"
FT                   /EC_number="1.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46099"
FT                   /protein_id="ABO46099.1"
FT                   /translation="MANEVCFRTLHLDKPYSLESYLSVGGYSYWNKILTEKIPPEQIIE
FT                   ELKISGLRGRGGAGFPTGLKWSFMPRNAPGQKYVVCNSDEGEPGTCKDREILRNNPHQL
FT                   IEGIAIAGYVVGATAGYNYTRGEFYEPIARFEDALIEAYQAGLLGTNIKSSGISFDLYS
FT                   AIGAGAYICGEETALLNSLEGKKGRPRFKPPFPAFKGLYDKPTNINNTETYASVPAILQ
FT                   YGGEWFKKLGTEKSGGTKLFCVSGHVQQQRVVEIGLGMPFKELLDMCGGVRNGNKLKAV
FT                   IPGGSSSKILTADEMMAVTMDYESIAAAGSMLGSGAVVVLDETTCIVRTLARLADFYYE
FT                   ESCGQCTPCREGTGWLARTLHRIVAGEGRPEDIDTLVRVATNIEGNTICSLGDAAAWPV
FT                   QSYIDKFRHEFVYMIENNGRSIVDQ"
FT   gene            120638..123004
FT                   /gene="nuoG"
FT                   /locus_tag="FTW_0112"
FT   CDS_pept        120638..123004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="FTW_0112"
FT                   /product="NADH dehydrogenase I subunit G"
FT                   /EC_number="1.6.-.-"
FT                   /note="GO_function: GO:0009055 - electron carrier activity;
FT                   GO_function: GO:0016831 - carboxy-lyase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46100"
FT                   /protein_id="ABO46100.1"
FT                   /translation="MSDNKESKKISIEIDGKDYQALPNQSIIEVADANGIYIPRFCYHK
FT                   KLSVAANCRMCLVDVEGARRASPACATPVMDGMKVKTRSEKALQMQKDVMEFLLINHPL
FT                   DCPICDQGGECELQDIAMGYGNTTSEYLESKRTVEDPELGPLVATDMTRCILCTRCVRF
FT                   GEEIAGVKELGVMGRGDHSAISTYISGEMVDSEISANIIDLCPVGALTSKPFRFKARSW
FT                   ELKQFPTLSAGDALATEINAHIYQNKLVRVVPRENDITGTWIADRDRFEYTGLYSQDRI
FT                   QQPMIKKAGDWVDVSWEEALDFVKVAIQKTIEKDGADAISAIVSETATSEEMYLTKKLL
FT                   AAVGSVNIDARVRQYADIPGISAGKGLSCSLEDIRESDFILVFGSNIRKEYPLVNIAIK
FT                   DAVEKNAAKAVAWNVCDYNFNYDIKQVRLAADNIQYIALSLLKAIFVRANLPYGDLDEI
FT                   LRKVDPAAEVRDVADRIVAAKAPKIIIGQDIVNTSGFETVFSILDVLEKVTSVRGGVLA
FT                   TNVNSVAADRIFSSSKSKFSTYKCLNGQTNTKLLLTVHTELAKDSLYGEQKLRNALENI
FT                   DIVVSFTAFADKFTKDTADIILPIATHYETSGSFVDLFGNRKEFKQVVKPYAGNKELWR
FT                   VLRVLGNLLELEGFDYNSIAEVTNDAYATRARVGVNHVTQILNANLDYQKEVAFVASNS
FT                   MYSTTSLLRRAEPLQKTTDAKRFAGVRISQELADEIGLKGQSGVIKIYNIDNEINPEVV
FT                   VDPSLQAKNIMLPRALFKDFLSSDNISIKLVEEER"
FT   gene            123006..124016
FT                   /gene="nuoH"
FT                   /locus_tag="FTW_0113"
FT   CDS_pept        123006..124016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH"
FT                   /locus_tag="FTW_0113"
FT                   /product="NADH dehydrogenase I subunit H"
FT                   /EC_number="1.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46101"
FT                   /db_xref="GOA:A4IVZ9"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IVZ9"
FT                   /protein_id="ABO46101.1"
FT                   /translation="MLGYILWTSLYVLLIVIPLILVVAYYTYAERKVIGYMQDRIGPNR
FT                   VGSFGLLQPIFDALKLFLKEIIVPTNSNRYLFFIAPILAFAPAYAAWAVIPFSKGVVLS
FT                   DMNLGLLYILAMTSFSIYGIVIAGWASNSKYSLFGALRAGAQVISYELAMGFAIVGVVI
FT                   AAGSMGITGIIEAQSGGIWHWYFIPLFPLFIVYFIAGIAETNRAPFDVVEGESEIVAGH
FT                   HIEYTGSRFALFFLAEYANMILISILTSIMFLGGWNSPFQATALESIFGFVPGVVWLFA
FT                   KTGIFMFMFLWVRATYPRYRYDQIMRLGWKIFIPLTFVWVVIVACMVRLGVGPWW"
FT   gene            124030..124518
FT                   /gene="nuoI"
FT                   /locus_tag="FTW_0114"
FT   CDS_pept        124030..124518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="FTW_0114"
FT                   /product="NADH dehydrogenase I subunit I"
FT                   /EC_number="1.6.99.5"
FT                   /note="GO_function: GO:0009055 - electron carrier activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46102"
FT                   /db_xref="GOA:A4IW00"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW00"
FT                   /protein_id="ABO46102.1"
FT                   /translation="MRNITNFLKTFLLWELLKGLKVTGKHFFTRKVTVQYPDEKTPISN
FT                   RFRGLHALRRYENGEERCIACKLCEVVCPALAITINSTEREDGTRRTSSYEMDLFKCIF
FT                   CGYCEESCPVDSIVETNILEYHFEERGENIMTKAKLLAIGDKYEAQIAADRLQDKDFR"
FT   gene            124523..125128
FT                   /gene="nuoJ"
FT                   /locus_tag="FTW_0115"
FT   CDS_pept        124523..125128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ"
FT                   /locus_tag="FTW_0115"
FT                   /product="NADH dehydrogenase I subunit J"
FT                   /EC_number="1.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46103"
FT                   /protein_id="ABO46103.1"
FT                   /translation="MVVTDILFYTFASLAIIFALVLVLANNPVNSVIAMIFTFIFTAAV
FT                   WIILQQVYLALLLIVVYVGAVLVMFLFVVFMLDLHVEEQGRVGRFFYALAAVVVCAIFA
FT                   TVISYAATNVFAGAMMQGGVGGLKIIGLTMFSNANLYVFELVDFILLAAMTAAITLTLR
FT                   AKRKGNKTVDPAQQVKVRAKDRLTMVKMPSNNEGAKDE"
FT   gene            125121..125438
FT                   /gene="nuoK"
FT                   /locus_tag="FTW_0116"
FT   CDS_pept        125121..125438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK"
FT                   /locus_tag="FTW_0116"
FT                   /product="NADH dehydrogenase I subunit K"
FT                   /EC_number="1.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46104"
FT                   /protein_id="ABO46104.1"
FT                   /translation="MNSISVSVTHGLIFSTLLFVISVAGIIINRRNILILLMSIELMLL
FT                   AVNTNFLIFANMHQQAMGGVFVFFIMAVAAAETAIGLAIVVAIFRKRKTIDLSKLNTLR
FT                   G"
FT   gene            125448..127457
FT                   /gene="nuoL"
FT                   /locus_tag="FTW_0117"
FT   CDS_pept        125448..127457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /locus_tag="FTW_0117"
FT                   /product="NADH dehydrogenase I subunit L"
FT                   /EC_number="1.6.-.-"
FT                   /note="GO_function: GO:0008137 - NADH dehydrogenase
FT                   (ubiquinone) activity; GO_function: GO:0050136 - NADH
FT                   dehydrogenase (quinone) activity; GO_process: GO:0006118 -
FT                   electron transport; GO_process: GO:0006120 - mitochondrial
FT                   electron transport, NADH to ubiquinone"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46105"
FT                   /protein_id="ABO46105.1"
FT                   /translation="MIINNQVAAVLIAVIVLAPLLGALIAGFGGKSVKNAGVNFFTISL
FT                   CGLSFVLSVILAYGVFSGAEVYSVSFYQWAPISNMFAFDVGFTVNKITVYMMLIVTFVS
FT                   TLVHIYSIGYMKGEEGYARFFAYISGFTFAMLCLVMGNNFLLLFFGWEGVGLFSYLLIG
FT                   FYFNRDKANVASLRAFIVNRIGDLGFLLGIGAVILYTKSVDYTTVFAALPDIDNTQTIH
FT                   FLGISFSPVTLMCSLLFIGAMGKSAQFPLHSWLEGSMEGPTPISALIHAATMVTAGVFM
FT                   VARLSPMFVLSPAALSFVLIIGAITCLFMGLIAIVQTDIKRVIAYCTLSQLGYMMVAQG
FT                   AGAFSIGMFHLMTHAMFKALLFLAAGSVIVAMHHEQDIRRMGGLRKYMPVTYLCMLIGA
FT                   WALAALPPFSGFFSKDLIIEAAQATTVYGHEFAYYMVLACAFVTSFYIFRMFFLVFHGK
FT                   ERMSDEERSHLKESPFSILIPLILLAIPSVFVGEYFFSSILSQEHGLFGNTITPFIQAG
FT                   LGWESVTAHLANEPAIVSSMAFIKHSVTTLPFWLAFSALVLAYVLYVWLPAIPRLFANA
FT                   KSGFGIIYHILVKKYFIDALYDVIFVNIFLAISNFLWKVVDIFIIDKTVVNGTSNLIYH
FT                   TGDSFRKIQRGYLFDYAFVMMVGVLLFMILLISV"
FT   gene            127483..129072
FT                   /gene="nuoM"
FT                   /locus_tag="FTW_0118"
FT   CDS_pept        127483..129072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM"
FT                   /locus_tag="FTW_0118"
FT                   /product="NADH dehydrogenase I subunit M"
FT                   /EC_number="1.6.-.-"
FT                   /note="GO_function: GO:0008137 - NADH dehydrogenase
FT                   (ubiquinone) activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46106"
FT                   /protein_id="ABO46106.1"
FT                   /translation="MNLGNYLLSLIIWLPIVGGFVVLATRTKELHGDAARWVALVFSCL
FT                   TLALCVPLVTSFDYSSSAMQFQESVKWFKVFGMHDIYYSLGVDGFSVLFIVLTSFATLV
FT                   IVLAAWTSIKTKVRQYMAIFLITCGLTNGVFCATDSILYYVFWEALLIPTCVGIGIWGG
FT                   KHKAYAAVKYFMYTFFGSVFLLAAILYIQTRVAASPTHFLVNQDTYSIQNFIAWATQSQ
FT                   GFIDSVKFTLTAQWLVFGAFFLAFAVKIPMWPFHSWLPDAHSEAPAGGSVILAALMLKL
FT                   GAYGFLRFAIPMLPEVTASLEYVLIIMSLIAIVYVGVVAVAQTDVKRLIAYSSISHMGL
FT                   VTLGLFSIFILKNADPVLGTTHAQLALQGAVFQMIAHAFSSGGMFIGIGYLYLRMHTRE
FT                   ISDFSGVAKTMPIFATFFLLFCMANVGLPGTSGFVGEFMILLAVFQYSPLIALIAGLTL
FT                   VIAPIYTLWMYKRVFFGEVVSTQVASLTDLNRMELFVFILLAVPTLLFGFYPEPILQLS
FT                   AAASAHIVGLSL"
FT   gene            129088..130539
FT                   /gene="nuoN"
FT                   /locus_tag="FTW_0119"
FT   CDS_pept        129088..130539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="FTW_0119"
FT                   /product="NADH dehydrogenase I, subunit N"
FT                   /EC_number="1.6.-.-"
FT                   /note="GO_function: GO:0008137 - NADH dehydrogenase
FT                   (ubiquinone) activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46107"
FT                   /protein_id="ABO46107.1"
FT                   /translation="MSLSILYILPEILLALGVIVVMFSGLFLHGKIRNINYIFFQVFTL
FT                   LALIATFAKEYLIQTTGSVFEGQVVFSGFAYTLQLVILVLAVFVALYSRDYVKDRKISD
FT                   GDFYTLLMLCVLGAMVLTAAHSLVTIYVGLELLSLPMYALIAIYRDSGKGLEAAIKYFV
FT                   LGAIASALLLFGMSFVYGMTGKLDITEIANVLAHGNFAGLQQQFLLVCLVMMIATFLFK
FT                   LGAFPFHMWLPDVYQGAPNAVANIVATIPKVAAFAMLVNILFVGFPSLKDSWIYLFRII
FT                   GILSIFFGSLVALSQTNVKRLLGYSTVSQIGFVLLATTLNPQGYALTAASFYVIVYVFT
FT                   TLAVFGVLTTISVGGYEVQDLNDLKGFNTKDSWLAFILLIVLFSMAGIPPFGGFIAKLF
FT                   VVMGLINDGNYFLACFVLFMAVIASFYYVRVIKTMYFDDPDNDETVKPPLTSLIALSIN
FT                   GLVLLFLGIMPMLLLGVLTQVTNVI"
FT   gene            130615..130809
FT                   /locus_tag="FTW_0120"
FT   CDS_pept        130615..130809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46108"
FT                   /protein_id="ABO46108.1"
FT                   /translation="MKEILGPLNDVIKNSKENIVNKSLKKLDVVSREEFEVQKKILLKT
FT                   RQKLEQVEAKLDKLLAEKK"
FT   gene            130811..132318
FT                   /locus_tag="FTW_0121"
FT                   /note="Mg chelatase"
FT   misc_feature    130811..132318
FT                   /locus_tag="FTW_0121"
FT                   /note="disrupted due to premature stop"
FT   gene            132372..133406
FT                   /gene="hemE"
FT                   /locus_tag="FTW_0123"
FT   CDS_pept        132372..133406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="FTW_0123"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="GO_function: GO:0004853 - uroporphyrinogen
FT                   decarboxylase activity; GO_process: GO:0006779 - porphyrin
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46109"
FT                   /db_xref="GOA:A4IW07"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW07"
FT                   /protein_id="ABO46109.1"
FT                   /translation="MRKLFLDAFGEKKLDKPPVWIMRQAGRYLPEYRAVRAKFDNFMDM
FT                   CRNADACCEVALHPLQRYDLDAAIVFSDILTIPEAMGMDLKFIKGTGPVFSEPIQSQKD
FT                   LDKLKSIEDSIGSLDYVYNAVKTTSSAINVPLIGFTGSPWTLAAYMIEGSGSKQFNKLR
FT                   KMMYANPQLMHSLLQRLADITIIYLLEQVKAGASSVMIFDTWGGILPLEHYKNFSLKYM
FT                   EYIAKNVKQKINIPIVFFTKGGSNFFEEIKDKSCDGVGVDWSVTLKQARHRIGVGKVLQ
FT                   GNFDPAFLYGSKQSIRETVRANIEFIQSDKLNNYIVNLGHGIYPDIDPDSVRVMIDAIR
FT                   EFSA"
FT   gene            133480..133556
FT                   /locus_tag="FTW_2053"
FT   tRNA            133480..133556
FT                   /locus_tag="FTW_2053"
FT                   /product="tRNA-Met"
FT   gene            133632..134084
FT                   /locus_tag="FTW_0124"
FT   CDS_pept        133632..134084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46110"
FT                   /db_xref="GOA:A4IW08"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW08"
FT                   /protein_id="ABO46110.1"
FT                   /translation="MLLDDLYEIVEPITADLGYILWGIEVVGSGKLTIRIFIDHENGVS
FT                   VDDCQIVSKEISAVFDVEDPVSGKYILEVSSPGMNRQIFNIIQAQALVGFNVKAVTLAP
FT                   VGSQTKFKGVLERVEGNNVILNLEDGKEISFDFDELKKLRVSPDFS"
FT   gene            134102..135571
FT                   /gene="nusA"
FT                   /locus_tag="FTW_0125"
FT   CDS_pept        134102..135571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="FTW_0125"
FT                   /product="transcription factor NusA"
FT                   /note="synonyms N utilization substance protein A L factor;
FT                   GO_function: GO:0003715 - transcription termination factor
FT                   activity; GO_function: GO:0003723 - RNA binding;
FT                   GO_process: GO:0006353 - transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46111"
FT                   /protein_id="ABO46111.1"
FT                   /translation="MSKELLLVLETVANEKDISKDLLFEAMEEALAIITKKELDEHMNI
FT                   EVKIDRVTGDFKADRVWHIVSEDEDLIDYSKELYEDVVQEKGYNVKAGDVMREPVEVKE
FT                   YGRIAATMAKQILMKKIKNFEREKSARFYQNKIGDIVYGEIKRATYEILVVDLGNNAEG
FT                   ILPKKDLIARERYRVGDKIRACVEAVESDESGKPNTIMLSRSSNTMLKALFKLEVPEVE
FT                   EELINIVNVVREPGFRSKVTVKSNDQRIDPCGACVGVRGSRIHSIMSELNGEKVDVILW
FT                   NEDMVQYAINSLSPVDAADILEVNVDEETNSIDIVVKQESLSKAIGKNGVNVRLASSLI
FT                   GWKINVLSDAEQEEKQMSIVEKFVEALDIDHDFALVLIEEGIETLEDLAYLDRAELLEI
FT                   EGFDEEIVDELQERAKAVILSQALGGKKPAQDLLDMQGMSLDLAEQLAQNNIVTMEDLA
FT                   ELSVDELLDIVDIDEEQATNLIMQARAPWFE"
FT   gene            135610..138141
FT                   /gene="infB"
FT                   /locus_tag="FTW_0126"
FT   CDS_pept        135610..138141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="FTW_0126"
FT                   /product="translation initiation factor IF-2"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0005525 - GTP binding; GO_function: GO:0003743 -
FT                   translation initiation factor activity; GO_process:
FT                   GO:0006413 - translational initiation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46112"
FT                   /db_xref="GOA:A4IW10"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW10"
FT                   /protein_id="ABO46112.1"
FT                   /translation="MAEITVGQLAQQTNKEVDALLKQLKSFGIEKSSEKDTLTPTEMKT
FT                   LLEKINSAKNTATRKKVTSVKLDGKHKINVSVKRKRRVAKKVEQQESTTLEQPQELETM
FT                   VQEVSQQVDIVKEQDNIEQIVENKEAVKVQEQRQAEIAKPVIKDSGFKITAMPEIKIEE
FT                   IVAEDDEGLAASDKQAKKKAAKKVFSEAVNTNTKYKREEEEKKSKAKKAGGKGFKKANP
FT                   RQLSQLAGDLESFDEFGAKKGKLKAPKVKKQEFTKPVENTVRTVEIHEGITVSELAQKM
FT                   AVKGAEIVKVLFNMGVMATINQSLDQDTAILIVEEMGHKYTLHNENALEEAVTIVDRSS
FT                   YKKISRAPVVTIMGHVDHGKTSLLDYIRQTRVVAGEAGGITQHIGAYSVKTDKGSITFL
FT                   DTPGHEAFTSMRARGAKSTDIVILVVAADDGVMPQTEEAIQHAKAARVPIVVAVNKIDK
FT                   PEADPDKVISELAQRNVIPESWGGDVMFVNVSAKTGEGVADLLEAVLLQSEVLELEAFA
FT                   EGLAEGVVIESRLEKGRGPVATVLVQNGNLKQGDNILCGTEYGRVRAMHNDLGKKIKAA
FT                   GPATPVEILGLSGVPAAGDEMVVIENEKKAKELAAQRSQKQKEAKIAQEQSLKLSNMFN
FT                   NMGKEGEQQVLKIILKGDVQGSVEAIRESLLKLSTDEVKVDIIASGIGAITSSDVTLAV
FT                   ASTAVVIGFNVRADSAAKKLAETDGVEFRYYNIIYDLIDDVKKAMSGLLSPEMKEQIIG
FT                   IAEVREVYRSSKFGSIAGCMVIEGVVKRTNPIRVLRNNVVIYEGTLESLKRFKDDASEV
FT                   KKGLECGIGVKNYNDVREGDQIEVFEVAKEL"
FT   gene            138144..138575
FT                   /gene="rbfA"
FT                   /locus_tag="FTW_0127"
FT   CDS_pept        138144..138575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="FTW_0127"
FT                   /product="ribosome-binding factor A"
FT                   /note="GO_function: GO:0019843 - rRNA binding; GO_process:
FT                   GO:0006396 - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46113"
FT                   /db_xref="GOA:A4IW11"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW11"
FT                   /protein_id="ABO46113.1"
FT                   /translation="MAAEGRVQRVASEFQKVISLLLRTRIKDAKLASATITEVDLSKDL
FT                   SYAKIYYTCLAIEDAEYIDKAFEKSKGFFRSSIAKSLSLRIVPNLKFIYDTSLDYGMQM
FT                   EEKIQQALEADSKIIKQDDKSLQENYKQNDKETKAEKLR"
FT   gene            138583..139848
FT                   /gene="hisS"
FT                   /locus_tag="FTW_0128"
FT   CDS_pept        138583..139848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="FTW_0128"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004821 - histidine-tRNA ligase activity; GO_process:
FT                   GO:0006427 - histidyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46114"
FT                   /db_xref="GOA:A4IW12"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW12"
FT                   /protein_id="ABO46114.1"
FT                   /translation="MSKLTIVRGFNDVLPLDSYKWQLLESKVKLILDRYNYSETRLPIV
FT                   ERSELFHRSVGESSDIVSKETYDFQDRNGDSLTLRPEGTAGCVRMVIENNLATRGQTQK
FT                   LWYCGPMFRYERPQKGRYRQFYQLGVEAYGFDGIAIDLEVIAIAWSLFKELGIYEYVTL
FT                   ELNSLGSSLNRQEYTQALLQYLKPYHAELDEDSIKRLDKNPLRILDSKIEKTQKILANA
FT                   PKLIDFIDHDLRLRFKQTCQYLDALGVRYKLNENLVRGLDYYTGLVFEWTTDKLGSQSA
FT                   ICAGGRYDGLVENLGGQKTAAIGFAIGMERLLLLLEDLGKLPNQDNACDVFFILDSAQL
FT                   HQSLAIVENIRQELPQLKIDMDLKFGSFKSQFKKADKSGAKVAIIIGQDELDNGFAGIK
FT                   FLQQNEEQQQVAFNELINFLER"
FT   gene            139855..141153
FT                   /locus_tag="FTW_0129"
FT   CDS_pept        139855..141153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0129"
FT                   /product="transporter, major facilitator (MFS) family"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46115"
FT                   /protein_id="ABO46115.1"
FT                   /translation="MKLHNIKGYAWIVVGLSSFLLIDKYIMNVSPSLIANELMSSFSIN
FT                   ATEMSAMVSLFLWSVVFCQFFVAGPIIDKLGFRKVSFFSLILSAIGLLLFVLSADIHSF
FT                   ALGCVSRLMIGIGASFATVGYIKAAAVWFDPRKFAFVCSFLMTAAMTGALLGQVPLVYL
FT                   IELTGSWHRALISYACFSIVIALLYLALVRDYNPDASYSNQTKGNTGTLAGIKKVLLNK
FT                   NNWYLTLYTGLTFTTIDVFGGIWGNNYFRELYSIPAKDASYIVSMMFLGLAIGSPIIGK
FT                   LSEKFDNRVGIMVAFHIIATISLAVVLQFKLTPTISGVLLFVFGFCLGVYMLAFAIGNR
FT                   INPVVVAATVAALINTGEPLLGALFDLLIGHLLDLTWTGQYIDAQNHISAIASEGAHRY
FT                   FHINAYHHAFLILVFSMIVSFFLLILVKDKEVK"
FT   gene            141156..142223
FT                   /locus_tag="FTW_0130"
FT   CDS_pept        141156..142223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0130"
FT                   /product="ATPase, AFG1 family"
FT                   /EC_number="3.6.-.-"
FT                   /note="GO_function: GO:0016887 - ATPase activity;
FT                   GO_process: GO:0019538 - protein metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46116"
FT                   /protein_id="ABO46116.1"
FT                   /translation="MKLENIYLQKIRELDLKVDSLQLEAIRRLQEIVDQLYSKKKSKLR
FT                   LFKKSFYPAIKGLYMWGGVGRGKTFIMDIFYNNLTIKNKKRQHFSHFMKNIHTQLRKYQ
FT                   GEKNPISKVAFDMAKQTQIICFDEFFVEDIADAMILGSIFTELFKFGVVLVATSNIEPE
FT                   KLYKNGLQRELFLPATDVLLKNVDVLNLDSGVDYRFRLPTEYLNYLYPYNEHNRKNFFD
FT                   KFFLRNSHFDKDLSIRVLARDIPTILLSHKDVCFDFKVICGDGRSAHDYIDICHKYEQL
FT                   FIYNLVVFGPHNEDMARRFIALIDEFYDQNKKVVILANCDFKDLYNGERLKFEFQRTIS
FT                   RLNDMQNSRFGVINE"
FT   gene            142216..143145
FT                   /gene="rluC"
FT                   /locus_tag="FTW_0131"
FT   CDS_pept        142216..143145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluC"
FT                   /locus_tag="FTW_0131"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="5.4.99.12"
FT                   /note="GO_function: GO:0009982 - pseudouridine synthase
FT                   activity; GO_process: GO:0009451 - RNA modification;
FT                   GO_process: GO:0001522 - pseudouridine synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46117"
FT                   /protein_id="ABO46117.1"
FT                   /translation="MNKVELIEVTEDVIDQRIDNFLLSRFSRLPKSLIYRWIRKGELRV
FT                   NKKRVKQTSRVSAGDIVRVPPFSLEEDSKPIKISQSHLDFLEQRILYENDDYIIVDKPS
FT                   GMAVHGGSGVNSGLVERLRQLRPKVRRLDLVHRLDKETSGCVLLAKKHSSLVYFFDIFK
FT                   QRKVDKIYYAIVHGHWDKKIIKIDLPLKRTETKDGQRVVKVDSKDGKQALTRIISVRHL
FT                   QGGFSLLEIKLETGRTHQIRVHTKAMGHPIVADKKYGFATKDQLLLDKGVDRLLLHAAK
FT                   LEFYDDKQNKQISVTAALDSRFEKFIQE"
FT   gene            complement(143147..144451)
FT                   /locus_tag="FTW_0132"
FT   CDS_pept        complement(143147..144451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0132"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46118"
FT                   /protein_id="ABO46118.1"
FT                   /translation="MEQRIYNIRGYAWIIIILSSFLLFDKYVMQVFPSLITDDMMSNFG
FT                   TNATQTGALGSAFFWSIIICQLFLAGPIIDKFGFRLISPISITISATGVILFVVAANLG
FT                   SLSMAYIARITTGLGVSFATISYLKAVSVWFEPRKFAFAASFLATAAMIGALCAQAPLA
FT                   YLITICGDWKMAMLLFSVASLLIAVVYYIVVRDFNPKQPEASSPNNQLKTLDVLKEVIK
FT                   NKNNWLLTFYVGLSFTAVDAFAGFWGNAYFREAYHISREEAASIISMIFIGMAIGSPII
FT                   GKLSEILDSRKGVMIFSHIIGTIALSFVLLTKTSSTISAILLFIFGLCLGIYMLSFAIG
FT                   NRINPIIITATVAAFINTGEPILGAIFDPLIGYFLDWSWTGKYINKAGEVVSQYTSSAD
FT                   IKYFELESYHFAFTTLVASMIASLVILVMIKDKKD"
FT   gene            144528..144959
FT                   /locus_tag="FTW_0133"
FT   CDS_pept        144528..144959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0133"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46119"
FT                   /protein_id="ABO46119.1"
FT                   /translation="MLIWAFLVLCESVFMNEIHVMLTNIKIDTKKFILLQLILVLVGYF
FT                   VILVFYNYDYANSFLIGSLTMFLTNFVFFFRLFINKQFSPGIEIAIFYLSELLKLSIVA
FT                   LLTILLAIYVKPKLFSYIFGLVLLQLAVCFVPILFKRVR"
FT   gene            145012..145803
FT                   /gene="atpB"
FT                   /locus_tag="FTW_0134"
FT   CDS_pept        145012..145803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="FTW_0134"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="GO_component: GO:0045264 - proton-transporting ATP
FT                   synthase complex, coupling factor F(o) (sensu Bacteria);
FT                   GO_component: GO:0045263 - proton-transporting ATP synthase
FT                   complex, coupling factor F(o); GO_function: GO:0046933 -
FT                   hydrogen-transporting ATP synthase activity, rotational
FT                   mechanism; GO_process: GO:0015986 - ATP synthesis coupled
FT                   proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46120"
FT                   /protein_id="ABO46120.1"
FT                   /translation="MANTEAGSQVATEYVQHHLHHWQVSLGQGSFWQLNVDSLLVSGIL
FT                   GVVFILAMFLAARKANSGVPGKFQNMIEAVWEWMDGMVANNYHHKRDFVTPLVLTIFVW
FT                   VVLMNFMDLLPVDLFGWIISFFTASHEAYFRVVPTADPNVTFAMSIAVFFLVIFYNLKA
FT                   KGFGLIKEVLSSPFGIWLFPLNIFFRLVDEIVKPVSLSLRLFGNIFAGELIFILIALLP
FT                   WWFQWTLGGIWAIFHILIVLIQAFVFMMLTVVYLNMAQEAH"
FT   gene            145854..146159
FT                   /gene="atpE"
FT                   /locus_tag="FTW_0135"
FT   CDS_pept        145854..146159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="FTW_0135"
FT                   /product="ATP synthase F0, C chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="GO_component: GO:0045264 - proton-transporting ATP
FT                   synthase complex, coupling factor F(o) (sensu Bacteria);
FT                   GO_component: GO:0045263 - proton-transporting ATP synthase
FT                   complex, coupling factor F(o); GO_function: GO:0046933 -
FT                   hydrogen-transporting ATP synthase activity, rotational
FT                   mechanism; GO_process: GO:0015986 - ATP synthesis coupled
FT                   proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46121"
FT                   /protein_id="ABO46121.1"
FT                   /translation="MDMSLQVLGNLNGLTAVAVALLISLPALGTAIGFGVLGGKYLEGV
FT                   ARQPELGGMLLGRMFIVAAFVDAFAAISIAIGFLVLYANPLAIPGLAEAAQKVIGA"
FT   gene            146205..146675
FT                   /gene="atpF"
FT                   /locus_tag="FTW_0136"
FT   CDS_pept        146205..146675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="FTW_0136"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="GO_component: GO:0045264 - proton-transporting ATP
FT                   synthase complex, coupling factor F(o) (sensu Bacteria);
FT                   GO_component: GO:0045263 - proton-transporting ATP synthase
FT                   complex, coupling factor F(o); GO_function: GO:0046933 -
FT                   hydrogen-transporting ATP synthase activity, rotational
FT                   mechanism; GO_process: GO:0015986 - ATP synthesis coupled
FT                   proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46122"
FT                   /db_xref="GOA:A4IW20"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW20"
FT                   /protein_id="ABO46122.1"
FT                   /translation="MDINITLIGQMITFAIFVGFTMKFVWPPLRKALEERREKIAEGLA
FT                   SADRASRELEVAKRQSAEILREAKAKATEIIENAYVRAHKVDEQAKEEAIAAADKIKSM
FT                   AIAEIEQEKVKAKEQLKQELVNLAMAAASKIIAASVDEKASKKVLEDFVEKV"
FT   gene            146695..147219
FT                   /gene="atpH"
FT                   /locus_tag="FTW_0137"
FT   CDS_pept        146695..147219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="FTW_0137"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="GO_component: GO:0045261 - proton-transporting ATP
FT                   synthase complex, catalytic core F(1); GO_component:
FT                   GO:0045262 - proton-transporting ATP synthase complex,
FT                   catalytic core F(1) (sensu Bacteria); GO_function:
FT                   GO:0046933 - hydrogen-transporting ATP synthase activity,
FT                   rotational mechanism; GO_process: GO:0006754 - ATP
FT                   biosynthesis; GO_process: GO:0015986 - ATP synthesis
FT                   coupled proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46123"
FT                   /db_xref="GOA:A4IW21"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW21"
FT                   /protein_id="ABO46123.1"
FT                   /translation="MTNISVIAKPYAKAAFEFANEHNLLQQWSKLLQTFSELIKDKSVA
FT                   AIVSSPTISQIEVVDALKKQLDENFFNFLALIAENKKMLIMPEIADQFESIKNIHNNVR
FT                   VADVTLAYATDKNILDSLKTSLEKKFGCTIDMHINIDPAIIGGAVVKVGDTVIDSSVSG
FT                   HLEKLKSILLS"
FT   gene            147238..148779
FT                   /gene="atpA"
FT                   /locus_tag="FTW_0138"
FT   CDS_pept        147238..148779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="FTW_0138"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="GO_component: GO:0045262 - proton-transporting ATP
FT                   synthase complex, catalytic core F(1) (sensu Bacteria);
FT                   GO_component: GO:0045261 - proton-transporting ATP synthase
FT                   complex, catalytic core F(1); GO_function: GO:0046933 -
FT                   hydrogen-transporting ATP synthase activity, rotational
FT                   mechanism; GO_process: GO:0015986 - ATP synthesis coupled
FT                   proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46124"
FT                   /db_xref="GOA:A4IW22"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW22"
FT                   /protein_id="ABO46124.1"
FT                   /translation="MQLSPSEISGLIKQRIEKFDNSVELKSEGTIVSVADGIVTIYGLN
FT                   DVAAGEMIKLPGDVYGLALNLNTDSVGAVVLGDYEHIKEGDKAYCIGRILEVPVGEALL
FT                   GRVVDALGNPIDGKGEVATDLTSPIEKIAPGVIWRKSVDQALQTGIKSIDSMVPIGRGQ
FT                   RELIIGDRQIGKTAIAVDTIINQKGTGVKCIYVAIGQKASTIANIVRQLEEHGAMEHTI
FT                   IVAATASDSAALQYIAPYAGCSMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVNEEYVEKFTNGEVKGKTGSLTALPIIETQAGDISAF
FT                   VPTNVISITDGQIFLETDLFNSGLRPAINPGNSVSRVGGAAQTKIIKKLGGGIRLALAQ
FT                   YRELEAFSQFASDLDEATRAQLNRGQRVTELLKQKQFSTLSVALMALSLYAADNGYLDN
FT                   LEVSEVIPFESALHALAETKYSDVIAEINETGKYDADIADKLKIIVEDCKANQAW"
FT   gene            148794..149690
FT                   /gene="atpG"
FT                   /locus_tag="FTW_0139"
FT   CDS_pept        148794..149690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="FTW_0139"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="GO_component: GO:0045262 - proton-transporting ATP
FT                   synthase complex, catalytic core F(1) (sensu Bacteria);
FT                   GO_component: GO:0045261 - proton-transporting ATP synthase
FT                   complex, catalytic core F(1); GO_function: GO:0046933 -
FT                   hydrogen-transporting ATP synthase activity, rotational
FT                   mechanism; GO_process: GO:0015986 - ATP synthesis coupled
FT                   proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46125"
FT                   /db_xref="GOA:A4IW23"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW23"
FT                   /protein_id="ABO46125.1"
FT                   /translation="MSNAREIRSKVQSVKNTQKITGAMELVAASKMRGTIVKMNNVRPY
FT                   VESANTIIKNVTAASIDYPNPYLFDRDVKRVGYIVISTDRGLCGGLNINLFKHVLKEIK
FT                   NNIEDRVGVDVCVIGSKAENFFAKLKDVNIVATAHYNDKDKEGSIRAIGGAVKVMLDKF
FT                   TAGEIDRLYMSSNQFVSTIKQRPRLQTLLPIQDIFSAEEIKANKEKATKGHWDYIYERD
FT                   IEEVLNALCIRYIEAQVRGAILENAACEQAARMMAMKNATDNASDIIDQLKLDYNKIRQ
FT                   AMITQELAEICSGAAAV"
FT   gene            149700..151076
FT                   /gene="atpD"
FT                   /locus_tag="FTW_0140"
FT   CDS_pept        149700..151076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="FTW_0140"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="GO_component: GO:0045261 - proton-transporting ATP
FT                   synthase complex, catalytic core F(1); GO_component:
FT                   GO:0045262 - proton-transporting ATP synthase complex,
FT                   catalytic core F(1) (sensu Bacteria); GO_function:
FT                   GO:0046933 - hydrogen-transporting ATP synthase activity,
FT                   rotational mechanism; GO_process: GO:0015986 - ATP
FT                   synthesis coupled proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46126"
FT                   /db_xref="GOA:A4IW24"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW24"
FT                   /protein_id="ABO46126.1"
FT                   /translation="MSTGKIIQVIGAVIDVEFARDNTPKVYDALNVVEAGLVLEVQQQI
FT                   GDGVVRTIAMGSSDGLRRGMEVKNTNAPISVPVGHGTLGRIMNVLGEPIDEAGPIEYTE
FT                   KRSIHQAPPAYDELALSTEILETGIKVVDLICPFAKGGKVGLFGGAGVGKTVTMMELIN
FT                   NIAKEHSGYSVFAGVGERTREGNDFYYEMKDSNVLDKVSLVYGQMNEPPGNRLRVALSG
FT                   LTIAEGFRDEKRDVLMFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAAEMGALQERI
FT                   TSTKTGSITSVQAVYVPADDLTDPSPATTFSHLDATIVLSRQIAELGIYPAVDPLDSTS
FT                   RQLDPLVVGQDHYETARAVQKVLQRYKELKDIIAILGMDELSDEDKKIVDRARKIQRFL
FT                   SQPFHVAEVFTGNPGKFVSLKDTVASFKAIVNGEYDHLPEQAFYMVGSIQEAIEKAKTL
FT                   "
FT   gene            151089..151526
FT                   /gene="atpC"
FT                   /locus_tag="FTW_0141"
FT   CDS_pept        151089..151526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="FTW_0141"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="GO_component: GO:0045262 - proton-transporting ATP
FT                   synthase complex, catalytic core F(1) (sensu Bacteria);
FT                   GO_component: GO:0045261 - proton-transporting ATP synthase
FT                   complex, catalytic core F(1); GO_function: GO:0046933 -
FT                   hydrogen-transporting ATP synthase activity, rotational
FT                   mechanism; GO_process: GO:0015986 - ATP synthesis coupled
FT                   proton transport; GO_process: GO:0006754 - ATP
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46127"
FT                   /db_xref="GOA:A4IW25"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW25"
FT                   /protein_id="ABO46127.1"
FT                   /translation="MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLS
FT                   TLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIMVDDMERAENLNQAEAEKARARAKE
FT                   VLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD"
FT   gene            151737..154580
FT                   /locus_tag="FTW_0142"
FT   CDS_pept        151737..154580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46128"
FT                   /protein_id="ABO46128.1"
FT                   /translation="MRKLFINLILLTLIFPLILQAELLSDSDSSSSKSLLPNRTIAGFL
FT                   DIRTPGSTTRVDMQKVKKDGYNVMIVAYGEVYDDNIGFYTNSVTSTQTIIDKIRDAKKA
FT                   GMKVLLAVGGSPNTFHPGVKQGAPDPKIFGNDLTDAQIKSLANNIVSFLNKNDIDGILY
FT                   CIKKFTSPEFITKLSADIKKINAKIIIAAEPEVNNYKLVTTGLSNDYDKAIEDGNIDYL
FT                   FIQEYNTYPEYDPNFISESYPKIIESVNIPIKTKILIEEPTNAVSGGTNTIYHPQGNAT
FT                   KSLSTEQAIKLLLPQLEKLKFKPRFAGVAGWSLNTDYAADLYGDSSHNAGAFAKGLSAC
FT                   IYKNTCTEIDNQIHGPVVAGILPLWGKSSSYNISGQQINTIPISISMPKDKEYCDYNPN
FT                   VCKYNVIIAAYLTYTSSKGFELSFNEENGSSKKIYSPEELKAFITYMNSKGKHTIVSIG
FT                   GKYSHINWETINFSDLVKIVQEYGFNGINFDLSSSDMPKNDKVAKIAADKINKLITALR
FT                   QNNHGFWLTFSPEWHYIVAPLAKNDKDNIYVNHNYIELLDSLGMNKIDYIWLNTFADKP
FT                   SDGILSFYKDKDGEHIKITPADGYAKFLASLAWALTTREGYDANMPKYDEIDKPLHIPA
FT                   NKLVLMIPATKGTTHSDMVYVLSEKDIKEVVSLMKGNNASFAGFAVWSIDFDATNINNG
FT                   DLGNDYSHKPWSTTAAISDISLPPIVSQLKDQIKQETKATSPIQEQEQSINTGIINYPD
FT                   KIGAYNVDTIINFQDKKYKCKSNLEVKLCNDKGYIPNGLYGYLAWDEIDSAKQTKVKRK
FT                   QRKLAVGEIVKYPKFIGNYNVGQIVIAGDRKFECQKQELCNDKSYRPIGKSGYLAWSDI
FT                   TDDVAHLATEAKQVKPKGAEYIYPFGIEDYSAGTVVAIGQELYRCKVGPESSLCNSEAY
FT                   KPTGKYGTDAWTKIDSK"
FT   gene            complement(154597..154926)
FT                   /locus_tag="FTW_0143"
FT   CDS_pept        complement(154597..154926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0143"
FT                   /product="glutaredoxin-like protein"
FT                   /note="GO_function: GO:0030508 - thiol-disulfide exchange
FT                   intermediate activity; GO_process: GO:0006118 - electron
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46129"
FT                   /protein_id="ABO46129.1"
FT                   /translation="MYTPEEQKVVERIEKQLKENDIILYMKGSPNLPQCGFSAHAATAI
FT                   RSCGKPFAFVNILENPDIRAILPKYADWPTFPQLWVKGELIGGCDIIMEMNESGELKKL
FT                   IDSVK"
FT   gene            155062..155640
FT                   /gene="sodB"
FT                   /locus_tag="FTW_0144"
FT   CDS_pept        155062..155640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodB"
FT                   /locus_tag="FTW_0144"
FT                   /product="superoxide dismutase (Fe)"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46130"
FT                   /protein_id="ABO46130.1"
FT                   /translation="MKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEG
FT                   TEHDGRNLEEIVKTSNGGIFNNAAQVFNHTFYWNCLTPNKTEASSQLKAALIETFGSVE
FT                   NFKEQFSKAAIATFGSGWAWLVKNTEGKLEIVTTSNAGCPLTENKKPLLTFDVWEHAYY
FT                   IDYRNARPKYVEALWDIVNWQFVSEQFAD"
FT   gene            complement(155648..155833)
FT                   /locus_tag="FTW_0145"
FT   CDS_pept        complement(155648..155833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46131"
FT                   /protein_id="ABO46131.1"
FT                   /translation="MPENKSDSINTIHGNNRIINKIFLNIADSRKPGNNTAIKITTTID
FT                   KTPITKENKEILFFAT"
FT   gene            complement(155845..157110)
FT                   /locus_tag="FTW_0146"
FT   CDS_pept        complement(155845..157110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0146"
FT                   /product="major facilitator superfamily (MFS) tranport
FT                   protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46132"
FT                   /protein_id="ABO46132.1"
FT                   /translation="MTSSPSFIDKLKAPFKEAKMFTMLILGYASGFPLMLTASSLFLWY
FT                   KDNGIETKDIGFLTLIAIPYTFKYLWAPFLDKIKIPILGRRKGWILITQVSLVILIAIM
FT                   SRFSPANSPLIIAFIGFLICFISATQDIAINAYQTEVLLEHERALGNAIAVMGYRIGML
FT                   VTGSLVLIIVDKLNNNWNLAWLMIIPFFIICPLYTLLIKESQYQDAPKSFKDAFILPFV
FT                   EFFKRQGLYTAIIIIIILISYKLADAIAFSLNSIFFIDLGFSKTTIAVSYKAFSLFASL
FT                   AGLFVGGLIAKQIGVYKSFLYFSIIMACANLTYVLLAIVGKNYYLMLASVSVEYFCGAM
FT                   GTAMLVAMIMSLVNVKFSATQFAILSSIDSLARVFVGPLAGYIQAHYKWEGLFIFSFIV
FT                   GMFISLLIFIFRTRIKLMANLQ"
FT   gene            complement(157199..158464)
FT                   /gene="gltA"
FT                   /locus_tag="FTW_0147"
FT   CDS_pept        complement(157199..158464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="FTW_0147"
FT                   /product="citrate synthase I"
FT                   /EC_number="2.3.3.1"
FT                   /note="GO_function: GO:0004108 - citrate (Si)-synthase
FT                   activity; GO_process: GO:0006099 - tricarboxylic acid
FT                   cycle"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46133"
FT                   /protein_id="ABO46133.1"
FT                   /translation="MLMSKYATLKYADKNIEIELPVYSPSLGNDCIDVSSLVKHGIFTY
FT                   DPGFMSTAACESKITYIDGGKGVLLHRGYPIEEWTQKSNYRTLCYALIYGELPTDEQVK
FT                   SFRQEIINKMPVCEHVKAAIAAMPQHTHPMSSLIAGVNVLAAEHIHNGQKESQDEVAKN
FT                   IVAKIATIAAMAYRHNHGKKFLEPKMEYGYAENFLYMMFADDESYKPDELHIKAMDTIF
FT                   MLHADHEQNASTSTVRLSGSTGNSPYAAIIAGITALWGPAHGGANEAVLKMLSEIGSTE
FT                   NIDKYIAKAKDKDDPFRLMGFGHRVYKNTDPRATAMKKNCEEILAKLGHSDNPLLTVAK
FT                   KLEEIALQDEFFIERKLFSNVDFYSGIILKAIGIPEDMFTAIFALARTSGWISQWIEMV
FT                   NDPAQKIGRPRQLYTGATNRNF"
FT   gene            158809..159189
FT                   /gene="sdhC"
FT                   /locus_tag="FTW_0148"
FT   CDS_pept        158809..159189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="FTW_0148"
FT                   /product="succinate dehydrogenase, cytochrome b subunit"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46134"
FT                   /protein_id="ABO46134.1"
FT                   /translation="MKKITNIDLMSIKSYNFPITAISSIMHRISGVVLIIAIPLCVVAM
FT                   NYALAGPDGYQQTVTVLTKSWFSVFFWLFLSSITYHVYAGIRHMIMDMGFGESMKVAKI
FT                   TSLLVIVLGVLSAILWGCYLWL"
FT   gene            159180..159533
FT                   /gene="sdhD"
FT                   /locus_tag="FTW_0149"
FT   CDS_pept        159180..159533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="FTW_0149"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /EC_number="1.3.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46135"
FT                   /protein_id="ABO46135.1"
FT                   /translation="MAVISLTSSGIKDFFVQRVTAVIIAVYFGYLILEALYLSHIGALN
FT                   YDSWRGLFTDGMFFRVATLMAYLAMFFHAWVGIWIICGDYIKFAWASALVMLSFVLVYI
FT                   FCFFWLFAVLFFY"
FT   gene            159546..161339
FT                   /gene="sdhA"
FT                   /locus_tag="FTW_0150"
FT   CDS_pept        159546..161339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="FTW_0150"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="GO_function: GO:0050662 - coenzyme binding;
FT                   GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_function: GO:0000104 - succinate dehydrogenase activity;
FT                   GO_process: GO:0006099 - tricarboxylic acid cycle;
FT                   GO_process: GO:0009061 - anaerobic respiration; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0009060 -
FT                   aerobic respiration"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46136"
FT                   /protein_id="ABO46136.1"
FT                   /translation="MSIATQEFDAIVIGAGGAGLRASFQLSQSGFKTAVVSKVFPTRSH
FT                   TVAAQGGIAAALGNIEFDDGLPSDDWKWHMYDTVKGSDYIGDQDAIEYMCEHAPQSIIE
FT                   LEHMGMPFSRLKNGKIYQRAFGGMSRNYDPANQAERTCAAADRTGHALLHTLYQGNLAH
FT                   KTDFYTEWFAVDLVKADDGSIAGVIALCIETGETVFLKAKITILATGGAGRIYESSTNA
FT                   YINTGDGMGLALRAGLPLQDMEFWQFHPTGIAGAGVLVTEGCRGEGGVLRNKDGERFME
FT                   RYAPNAKDLACRDVVSRASQQEIMEGRGDTFSGTSCVWLDLTHLGEDVINERLPTVREL
FT                   GRTFAGIDPVEKPIPVVPTCHYQMGGIPTNKHGQVITQVDGKDKVIGGLYAVGECASVS
FT                   VHGANRLGSNSLLDLVVFGRAAGMHAEQSLKEGMPMKEVSQENIEKATARITKWDTSEQ
FT                   RGCKEKISELRKELQRVMQQYFSVFRQESTMKEGLDKLFNIRERLDNAVLEDNSRIFNM
FT                   MRIEALELDNLVLTAIATAKLALERKESRGAHSRVDYPERDDKNWMKHTLYFLEGDRTS
FT                   LRDVNMSPTKVKAFQPAERKY"
FT   gene            161357..162058
FT                   /gene="sdhB"
FT                   /locus_tag="FTW_0151"
FT   CDS_pept        161357..162058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="FTW_0151"
FT                   /product="succinate dehydrogenase iron-sulfur domain
FT                   protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="GO_function: GO:0000104 - succinate dehydrogenase
FT                   activity; GO_process: GO:0009060 - aerobic respiration;
FT                   GO_process: GO:0006099 - tricarboxylic acid cycle;
FT                   GO_process: GO:0009061 - anaerobic respiration; GO_process:
FT                   GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46137"
FT                   /protein_id="ABO46137.1"
FT                   /translation="MEVRFKIYRYNPEVDKKPYYDEYTVEVENEGVKVLTALELIKEQD
FT                   PTLALRRSCREGVCGSDGMNINGKNRLACITSVGELKQPIKVNPLPGLPVIRDLIVDMK
FT                   QFYKNYEKVKPYLINDDEPPVKERLQSPEDRAKLDGLYECILCACCTTSCPSFWWNPDK
FT                   FIGPSGLLQAYRFIADSRDTATEQRLEDLKDPFSLFRCRTIMNCVSVCPKGLNPTEAIG
FT                   KIRSALLKKNV"
FT   gene            162076..164901
FT                   /gene="sucA1"
FT                   /locus_tag="FTW_0152"
FT   CDS_pept        162076..164901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA1"
FT                   /locus_tag="FTW_0152"
FT                   /product="2-oxoglutarate dehydrogenase, E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="GO_component: GO:0045252 - oxoglutarate
FT                   dehydrogenase complex; GO_function: GO:0004591 -
FT                   oxoglutarate dehydrogenase (succinyl-transferring)
FT                   activity; GO_function: GO:0005488 - binding; GO_process:
FT                   GO:0006554 - lysine catabolism; GO_process: GO:0006568 -
FT                   tryptophan metabolism; GO_process: GO:0006099 -
FT                   tricarboxylic acid cycle"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46138"
FT                   /protein_id="ABO46138.1"
FT                   /translation="MGAYMKKKQPDFSQWLETTQFFGGNLEYLESIYDDYIRGNHDGID
FT                   PKWLSFFDSIASSTDTVHGELVDEFKYLAKNKNNTANVNTVVSTEGDIGLKAKALVKAY
FT                   RSYGYKSANIDPLGLTRFERDSDLELAAHGLSEKDLTQLVNLGDFTDNKAIPLQQVINK
FT                   AKAIYESNIGYEYRYIGNKEEKLWLQDRIEDTAVIPSDSKKWILQQLVAAEGLEKYLAL
FT                   RYVGQKRFGLEGGESLIPSLQHIVEKAVSRHSTRFIQLGMAHRGRLNVLVNVMGKNPKD
FT                   LFEEFEGKQSEKSLSGDVKYHMGYSNYRSIDGKEAKIALAFNPSHLEAVDPVVEGAAKA
FT                   IQDKLDGDVYSKVLPILIHGDSAFCGQGVVMETFGFSLTEAYGTGGTIHLVVNNQVGFT
FT                   TSSAFGVNRSSNYSTDVAKMVDAPIFHVNGDDPEAVLKVTDIALEYRMKFNKDVVIDLV
FT                   CYRRNGHNETDEPSGTQPQMYEVIKKLPSTLKLYSDKLIKEGVVDADHFARMNANYRSK
FT                   LDNGKVTIDVLDRKIVKDKLNVCDWLPYLGKQESDYNYMPIPEKTLKELALKISEVPAE
FT                   VEMQMQVKKAVTDRIKMANGELPLNWGFAESLAYATLLSDGYPVRISGEDSGRGTFSHR
FT                   HAVIKNMNTKSQPKEYVPLRHINEKVRFDVIDSTLSEYGVLGFEYGYSCYSPDALVVWE
FT                   AQFGDFVNTAQVVIDQFLVAAEEKWGILSGLTLFLPHGQEGAGAEHSSARLERFLNSCA
FT                   NDNMQVCTPTTPAQIYHLLRRQVIRPLRKPLIVMTPKSLLRNPMAVSSLQELSQGKFEA
FT                   IIDDVNAKAAKVTKLILCNGKVYYDLMAKKQDNYEHIAVVRLEELYPFPQQQLAQIFTK
FT                   YNNVNKVVWLQEEPENKGAWYNIRHFIEKLVDKKQELLCVARERSSTPAVGYHALYVKQ
FT                   QEEIINTALEI"
FT   gene            164927..166396
FT                   /gene="sucB"
FT                   /locus_tag="FTW_0153"
FT   CDS_pept        164927..166396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="FTW_0153"
FT                   /product="2-oxoglutarate dehydrogenase, E2 component,
FT                   dihydrolipoamide succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="GO_component: GO:0045252 - oxoglutarate
FT                   dehydrogenase complex; GO_function: GO:0004149 -
FT                   dihydrolipoyllysine-residue succinyltransferase activity;
FT                   GO_process: GO:0006554 - lysine catabolism; GO_process:
FT                   GO:0006099 - tricarboxylic acid cycle"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46139"
FT                   /protein_id="ABO46139.1"
FT                   /translation="MVELKVPMFPESVADGTLAQWNKNEGDFVNEGDILAEIETDKVVL
FT                   EVPATSSGVLKGIKKHAGDTVLSEESLAIIDTAVSTSEPNQQTTNQGNASEATATGQEI
FT                   DIKAPVFPESVADGTISEWHKKEGEAVSEGDILAEIETDKVVLEVPATSNGVLTKILKT
FT                   AGETVLSAELIAKITAGGATATTKSEASVGVSQANNDPHLVPSARKAFNASGLDTAANI
FT                   EGTGKKGRITSEDVKKAVASVNKPQQQTVVINQGARYEKRVKMTRLRQTIANRLVEVQH
FT                   TNAILTTFNEVDMSAVMELRNKYKDMFVKEHDTKLGFMSFFIKAATEALKKFPDVNASI
FT                   DGDEIVYHNYFDIGIAVGTDRGLVVPVLRDTDTKSLAELEADVLDKAIKGRDGKLSLED
FT                   MQGGTFTITNGGTYGSMLSTPIINSPQSAILGMHNIVERPVVVKGEIKIRPIMYLALSY
FT                   DHRIIDGGTSVRFLKMIKELIEDPNRILLQV"
FT   gene            166436..166963
FT                   /gene="apt"
FT                   /locus_tag="FTW_0154"
FT   CDS_pept        166436..166963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="FTW_0154"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0003999 - adenine phosphoribosyltransferase activity;
FT                   GO_process: GO:0006166 - purine ribonucleoside salvage"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46140"
FT                   /db_xref="GOA:A4IW38"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW38"
FT                   /protein_id="ABO46140.1"
FT                   /translation="MNLDFIKSKIAAVPDFPKPGIMFRDITPLLADPQGLRKTAEAMAQ
FT                   ELKNKGIQPTIVAGTESRGFIFGVALAEVLGLGFVPVRKPGKLPRATYSVKYDLEYGSD
FT                   SLEIHQDAFKVTDEVLVVDDLLATGGTAKATVDLIEKTQAKVAGLIFVMELDGLSGREV
FT                   LAGYNVSALIKF"
FT   gene            166974..168305
FT                   /gene="mrsA"
FT                   /locus_tag="FTW_0155"
FT   CDS_pept        166974..168305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrsA"
FT                   /locus_tag="FTW_0155"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="GO_function: GO:0008966 - phosphoglucosamine mutase
FT                   activity; GO_process: GO:0009103 - lipopolysaccharide
FT                   biosynthesis; GO_process: GO:0009252 - peptidoglycan
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46141"
FT                   /db_xref="GOA:A4IW39"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW39"
FT                   /protein_id="ABO46141.1"
FT                   /translation="MAKYFGTDGIRGEVANSTITVEFTQKLGNAVGSLINQKNYPKFVI
FT                   VGQDTRSSGGFLKFALVSGLNAAGIDVLDLGVVPTPVVAFMTVKYRAAAGFVITASHNK
FT                   FTDNGIKLFSSNGFKLDDALEEEVEDMIDGDFIYQPQFKFGSYKILANAIDEYIESIHS
FT                   RFAKFVNYKGKVVVDCAHGAASHNFEALLDKFGINYVSIASNPDGLNINVGCGATCVSN
FT                   IKKAVKEQKADLGISLDGDADRIIIVDENGQEIDGDGILNILAQYSDICGGTNGIVGTQ
FT                   MTNMSYENHYRANKIPFIRSKVGDRYVLEDLVKYGYKIGGESSGHVINLNFGTTGDGLF
FT                   TAIQLLAIFSQADKPVSEFKLQGELMQQTLINVPLTKKVAREDLQKVASDVNDVEKRLG
FT                   NRGRVLLRPSGTEPVLRVMVEADDKSLATNEAEYLVEKVKQKLV"
FT   gene            168323..169069
FT                   /gene="tpiA"
FT                   /locus_tag="FTW_0156"
FT   CDS_pept        168323..169069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="FTW_0156"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="GO_function: GO:0004807 - triose-phosphate isomerase
FT                   activity; GO_process: GO:0006096 - glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46142"
FT                   /protein_id="ABO46142.1"
FT                   /translation="MGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVI
FT                   SQLPEKVGVGLQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFK
FT                   KLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYEPVW
FT                   AIGTGVVASLEQIQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDG
FT                   GLIGGASLKAAEFNEIINQANKICTE"
FT   gene            169057..169410
FT                   /gene="secG"
FT                   /locus_tag="FTW_0157"
FT   CDS_pept        169057..169410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="FTW_0157"
FT                   /product="preprotein translocase, subunit G, membrane
FT                   protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0015450 - protein translocase
FT                   activity; GO_process: GO:0009306 - protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46143"
FT                   /protein_id="ABO46143.1"
FT                   /translation="MYGIILTIDIIAAIAIVVLVLLQQGKGANMGVSFGAGASSTVFGS
FT                   KGAASFLFKMTVFFTAVFFVSCLTLGYLGKSSAITANISTANTDSSIASQYDQYQKEVS
FT                   QAGTADTSKQASK"
FT   gene            169419..169504
FT                   /locus_tag="FTW_2029"
FT   tRNA            169419..169504
FT                   /locus_tag="FTW_2029"
FT                   /product="tRNA-Leu"
FT   gene            169580..170209
FT                   /locus_tag="FTW_0158"
FT   CDS_pept        169580..170209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46144"
FT                   /protein_id="ABO46144.1"
FT                   /translation="MSKIIKEVVDKNVIEGTIYFISLVELGSYTAVKNLYSVEINTVRS
FT                   KLELLEKYLGVKLVQPNSNKIEITRDGKKYYASCHRLYTDLENSILSSKYKGIDNLKYI
FT                   RIFGTRAFIDFISPKIHQVDESGKYTFTFDSYFLYQVNNYFYQLSNYDVAIVTSKDLEK
FT                   IDQDRWIIAANIDGTKIPSRIYVNRDVYIEYNLENEPNNIFIMFLL"
FT   gene            170263..170535
FT                   /locus_tag="FTW_0159"
FT   CDS_pept        170263..170535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46145"
FT                   /protein_id="ABO46145.1"
FT                   /translation="MTPSLKHIRYIVEDDIHKAKLIEKGLGAGCLVNKYEHILNLNILP
FT                   IEGITTETLVQERTVIVSKHLENKTKLVKFFREQAEEYINTVVGK"
FT   gene            170642..171094
FT                   /locus_tag="FTW_0160"
FT   CDS_pept        170642..171094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46146"
FT                   /protein_id="ABO46146.1"
FT                   /translation="MNKILGLILTIVLTVTTLSSNGFAADIPNSTALPLAKVVNNIYSQ
FT                   GYSGINKIEFDDGVYKATVINKDGQEQYLYIDPTTAAVPVPKQGTKEINMSQAIAAVSQ
FT                   DRCKNITSVEHYNGAYKVECLDANSQQVEVLVDAVSGKISQISYDD"
FT   gene            complement(171091..172233)
FT                   /locus_tag="FTW_0161"
FT   CDS_pept        complement(171091..172233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0161"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /note="GO_function: GO:0004109 - coproporphyrinogen oxidase
FT                   activity; GO_process: GO:0006779 - porphyrin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46147"
FT                   /protein_id="ABO46147.1"
FT                   /translation="MFEINKQIGIYIHFPWCVRKCPYCDFNSHPIKDDSYLSEQYYQKL
FT                   IADFDTHLDDLQAREVISIFIGGGTPSLFKAEYLDKVLQHITKNTKISINCEITLEMNP
FT                   GTVERGSILSYQNIGINRISLGVQSFQDDKLKILGRIHNCKNVYTTIDEIKNSKISNFN
FT                   IDIMHGLPNQSFDDGIFDITQAIAMQPTHISWYQLTIEPNTLFAAKRPKLPDEEILESI
FT                   EIAGKEALAHAGFKQYEVSAFAKNTLRSIHNSNYWMFGDYIGIGAGAHSKITNLKTKQI
FT                   KRVWKHKHPKIYTQTDKFIKDSNIVTQDEIIYEFMLNTLRLKNGFKLSEFEQQTFLSSN
FT                   IISQKLQLGIDKGLLELNANQIKPTAKGYLFLNDCINIFS"
FT   gene            complement(172238..172615)
FT                   /locus_tag="FTW_0162"
FT   CDS_pept        complement(172238..172615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0162"
FT                   /product="hypothetical protein, gtrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46148"
FT                   /protein_id="ABO46148.1"
FT                   /translation="MLKKQLSLFIIVGILASITNFIIVWILVELNIFRPLVANFFAFLI
FT                   AFNVSYFGHRFLTFSTTTQSHKKAATQFFINVMIGLGLNESIYYVLLHILKIQYLLALF
FT                   ITMGLVAVYTFVVSKFLIFKA"
FT   gene            172685..173563
FT                   /locus_tag="FTW_0163"
FT   CDS_pept        172685..173563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0163"
FT                   /product="Dyp-type peroxidase family protein"
FT                   /EC_number="1.11.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46149"
FT                   /protein_id="ABO46149.1"
FT                   /translation="MEIIKYQLGIVENLPLSALYMMFNIKKNSDVSFGLKILQRFVDGK
FT                   SVVAGFGNNLLKMFKIPENESFKRTKFNNPRMSDNDGYDLVLWLRDDDRGELFHKSIAI
FT                   KKALEDYFDIEKVISSYTYRGKYDLSGFEDGIENPKGLEVVPAAIISEGELEGSSFWVL
FT                   QQWLHDFDWLNNASQSAKEECIGRSLDDSHQFESLKDFAHVKRSAKENFNPEAQILRKS
FT                   MPWSDDQLNGGFMFSGFAPSFRSFNLQMGNMLGGSDGIIDGVFKFSKIIETSYLWCPPF
FT                   KKGKLDISLLN"
FT   gene            173668..176481
FT                   /gene="acnA"
FT                   /locus_tag="FTW_0164"
FT   CDS_pept        173668..176481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="FTW_0164"
FT                   /product="aconitate hydratase 1"
FT                   /EC_number="4.2.1.3"
FT                   /note="GO_function: GO:0003994 - aconitate hydratase
FT                   activity; GO_process: GO:0006099 - tricarboxylic acid
FT                   cycle"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46150"
FT                   /protein_id="ABO46150.1"
FT                   /translation="MSDIKNITKLQIEDKGKKYSLYSLKKLSQELGKDVTRLPYSIRVL
FT                   LENQLRNIDGYKVKEDDMHKVLDWDAKASSRPEIPHMPARVVMQDFTGVPAVVDLAAMR
FT                   KAIKDAGGDADKINPLVDTAMVIDHSVQVDFYGTKTALAQNVAKEFERNGERYSLLKWA
FT                   QKAFDDFIVVPPGMGIIHQVNLEYLAKDALVKNINGEDVIYPDTLVGTDSHTTMINGVG
FT                   VVGWGVGGIEAEAVMLGQPYYMVLPDVVGVKFTGKLKTGVTATDLVLKVTEVLRKHGVV
FT                   GKFVEYYGEGLESLPLPDRATIANMAPEYGATIGFFPVDEVTLDFFNNTNRSELVDAAR
FT                   EMYKEQLLFRENPAEEPEYSSIVEIDLSEVESNLAGPKRPQDRVAFHDMKKAFAEALVH
FT                   EQGLHGFGLTDEQLQKSAEVKGLNERITHGSVAIAAITSCTNTSNPSLLLGAGLLAKKA
FT                   NEKGLKVKPFVKTSLAPGSQVVTQYLEKANLLPELENLGFNLVGYGCTTCIGNSGPLDE
FT                   PVVEAINEADLIVASVSSGNRNFEGRINPHVKANYLASPIHVVAYALAGTVDFDPVEDA
FT                   IGKDAEGNDVYLADIWPTTEEIAAIQSHVINSDMFKKAYATVLDGTEDWQKLKAPEGKL
FT                   YEFDSSSTYIQCPNFFEKFAEGNDDLDIKGARTLLMLGDSVTTDHISPAGAIPEEYPAG
FT                   QYLKSHGVEKKDFNSYGSRRGNHEVMMRGTFANIRIRNLLLDNVEGGFTKYHLDGSQQY
FT                   VFDAAMKYKEKSIPLVILAGKEYGTGSSRDWAAKGTFLLGVKAVIAESYERIHRSNLVG
FT                   MGVLPLEYVNGQNAKTLGLDGTEMFNIKNLNNIKPRQIVIVEAVHPKTAHTTTFEALAR
FT                   LDADVDVDYLKNGGILQTVLKDIMGDKKESKSTQSTTSKGCGSADTSSETSCPFAKIAN
FT                   FFKKLFK"
FT   gene            176576..177604
FT                   /gene="pilT"
FT                   /locus_tag="FTW_0165"
FT   CDS_pept        176576..177604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="FTW_0165"
FT                   /product="pilus retraction ATP ase protein"
FT                   /EC_number="3.6.-.-"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0030255 - type IV protein secretion system; GO_process:
FT                   GO:0043107 - TFP-dependent motility; GO_process: GO:0015628
FT                   - type II protein secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46151"
FT                   /protein_id="ABO46151.1"
FT                   /translation="MIRKLLTLCVQKKASDLHLSSGCKAKYRIDGDLIDIESSPVLNDK
FT                   MISQMLLEIMTDDQKDELIETYECDFSIDDRDNDARFRVNAFFHNRGYGAVFRRLENTI
FT                   PTLDQFGAPRILKEVQAKKGGLILVTGPTGSGKSSTLAALVNEINHKEDSHILTIEDPV
FT                   EFVHTSQRSLVNQREVKRDTKSFNAALKSALREDPDCILVGEMRDLETIRLALEAAETG
FT                   HLVLGTLHTISAIKTVDRVISVFPPAEQELVRNMLAESLQIVISQRLLKRKGGGRVAAY
FT                   EVLISNTGIRNMIKENKLSQIYTALQTGTAKGMATIEQSIENLLKAGTITPEEAAKYIV
FT                   VR"
FT   gene            complement(177684..178670)
FT                   /locus_tag="FTW_0166"
FT                   /note="NAD/FAD-dependent oxidoreductase"
FT   misc_feature    complement(177684..178670)
FT                   /locus_tag="FTW_0166"
FT                   /note="contains frameshift"
FT   gene            complement(178667..179113)
FT                   /locus_tag="FTW_0169"
FT   CDS_pept        complement(178667..179113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0169"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46152"
FT                   /protein_id="ABO46152.1"
FT                   /translation="MKNQKSIDVYLAYSGLIPFLFFTICLLFNYKHTLIFGNTIQALSI
FT                   YGLIIASFLAGTHWGRQINIESPIVKLLLQISSNINVITIWFAYLNLNSKYFILLLIIE
FT                   FLVLLKIDYYIYKLKITSSRYFLYIRLPITIAVVILLAISWSLI"
FT   gene            complement(179124..180085)
FT                   /locus_tag="FTW_0170"
FT                   /note="cytochrome oxidase bd-II, subunit II"
FT   misc_feature    complement(179124..180085)
FT                   /locus_tag="FTW_0170"
FT                   /note="contains frameshift"
FT   gene            complement(180089..181465)
FT                   /locus_tag="FTW_0172"
FT                   /note="cytochrome D ubiquinol oxidase subunit I"
FT   misc_feature    complement(180089..181465)
FT                   /locus_tag="FTW_0172"
FT                   /note="disruption due to premature stop"
FT   gene            181701..182582
FT                   /locus_tag="FTW_0174"
FT   CDS_pept        181701..182582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0174"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0009225 - nucleotide-sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46153"
FT                   /protein_id="ABO46153.1"
FT                   /translation="MRILVAGGSGFVGRELSKYLSTRHHLTLLTRVANQNLGDYKELIT
FT                   WQQLTEDNIVNYDIIINLCGYNIGQKRWTKAVKDRILSSRIEPTNKLIRLISNKNIWLI
FT                   NASAIGYYNFSKLAQDEDNHDRSYDKFTFGQKVVDQWEKCLVDSHLQRYTILRFGVVIG
FT                   NGGVLEKMALPAKFGFLTMFGDGHNYMSWVSAYDLSRAIEFIIDKKLDSKEIFNLTAPD
FT                   ACQHKLLVELLRKYLAKKRIIKIPTFMIKLMFGQMGEELLLSSQNIKPAKLQRLGFVFE
FT                   DSNIQQALERYI"
FT   gene            complement(182579..184006)
FT                   /locus_tag="FTW_0175"
FT   CDS_pept        complement(182579..184006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0175"
FT                   /product="putative sensor histidine kinase"
FT                   /note="GO_function: GO:0000155 - two-component sensor
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46154"
FT                   /protein_id="ABO46154.1"
FT                   /translation="MFLKNKKESSILSFLVVSFASFFAVFMLVISIFSFYQVKHQNDSL
FT                   LDYQLRTAAEVIETVLKIYPLEDDENTTHMIMNRISNSFLNIKNYNKSIGFIVYDRKHK
FT                   KLLLKTSNLPNFHKNYDGITSTTGFEWVYTNEEDGQKNWYTYTLKTDNGNLITVFANDT
FT                   IKDKISRQIIFKFALLLASTYIVLIGFIYYILKTALHPLERINKRVAKINPRKNEKLNE
FT                   DVIPYEIKSIVDQINLLIEKFHETLEREKRFSGDAAHELKTPIAGVKTLVEIALASDDI
FT                   DEIKQKLERIKSSTNRYSHIIDQLLTLSRIQPNEQVTFGKKLMINKVLEFFIAENAIKA
FT                   IEKNIEIVFYPSQQHLYCYSNDYLLGILFKNLISNAIKYTPNGGLIEISSYQEENNIVV
FT                   EIKDNGIGVPQENIERIFDRFYRETGTGEEGSGLGLAIVAEIVRLHNGKIFAQNNINQK
FT                   GLTITVKIPIDHKYEEN"
FT   gene            184122..185078
FT                   /locus_tag="FTW_0176"
FT   CDS_pept        184122..185078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46155"
FT                   /protein_id="ABO46155.1"
FT                   /translation="MLNSVNNITQPFYTKYYECVALYFYTQENLKFDVLITCPHAELGK
FT                   SFVEFDFPAISQLIKLSKDDFNDFLAIEYDFGTHSLGHAIAQKLYAEYGLYTLVAEPSF
FT                   PRSILDAGRLYPNCLRNIVDYDQHPQLKQALIKLYDQYMQKLCHIVAVAKSYNAISIDL
FT                   HTMSSYSPNIVQERYSEAVIETPDTLNEYIQLYKNAHKDGEKRVTELFTGDARNGIFAS
FT                   KVLLESLSYELQQIGVEVEYDKPYILAEHLVAHYLVCELEAVCIDIPKDLLSKTTTADE
FT                   LYDIASLEIDHTKLNLMAEAFAKAIMNTQKQKQLKDA"
FT   gene            185082..185318
FT                   /locus_tag="FTW_0177"
FT   CDS_pept        185082..185318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46156"
FT                   /protein_id="ABO46156.1"
FT                   /translation="MTKKTTNAISERIWGKKAIHIPNTTDIYGADLVSSFVNKYVTRTL
FT                   CLLAKDHKIFYLKKHSLKLKKLLAILMISVLVI"
FT   gene            185321..186097
FT                   /locus_tag="FTW_0178"
FT   CDS_pept        185321..186097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46157"
FT                   /protein_id="ABO46157.1"
FT                   /translation="MDNFIFLDKLIEHYRLSTIVMNYADQIQEFSDPEYTHLVPFTVAT
FT                   AVELLGIKYNKNYGLPEALSQFLNDKSFLRQMLHAKGILVLSINIVSTISDDDYVKKAL
FT                   EIYREYENNGIYECAVIELCAQMTEILRDMGVRGIVGVDLLIREINGQIVPYVLEVNAR
FT                   QTGAIYAGFLAYELRNGEHKPWIGHNNVVVPKGSTIDDYHQYLKVNVVDYNYGDSEGVI
FT                   ITCIDNLDLNNKVMILVIADTDERLDEILKIATSFK"
FT   gene            186231..186776
FT                   /locus_tag="FTW_0179"
FT   CDS_pept        186231..186776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46158"
FT                   /protein_id="ABO46158.1"
FT                   /translation="MGLNLLKNMEEKTIYRGINVTIVTKHLVQIERPSKLLEILFYKYV
FT                   FKHQTYADLALEYGKTKRWAYDQIHSYEVAKKEHNPRAVTLLCDTTFYGKRKDKLATVV
FT                   FCDTIENEVLLWRHVDSEKSKYYKEMLQQLLSLGYTVNAVTIDGKRGLNTVKVCPIQMC
FT                   HFHQKIVDRYIVNPRVFC"
FT   gene            complement(186754..187634)
FT                   /locus_tag="FTW_0180"
FT   CDS_pept        complement(join(186754..187305,187305..187634))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0180"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46159"
FT                   /protein_id="ABO46159.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPNIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            187736..188479
FT                   /locus_tag="FTW_0182"
FT                   /note="transposase ISFtu2"
FT   misc_feature    187736..188479
FT                   /locus_tag="FTW_0182"
FT                   /note="Every ISFtu2 ORF in this genome has a premature stop
FT                   at the identical position resulting in disruption of the
FT                   ISFtu2 sequence in compariosn to Schu4 ISFtu2 elements."
FT   gene            188566..188919
FT                   /locus_tag="FTW_0184"
FT                   /note="IS1016 family transposase"
FT   misc_feature    188566..188919
FT                   /locus_tag="FTW_0184"
FT                   /note="N-terminal truncation"
FT   gene            189148..190161
FT                   /locus_tag="FTW_0185"
FT   CDS_pept        189148..190161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0185"
FT                   /product="putative LD carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46160"
FT                   /protein_id="ABO46160.1"
FT                   /translation="MLLKNNYLVSIILVVLIMIVTKSFACAATDYNKVALINVSTQYYP
FT                   NDIKQAEKALKDTGYNTTYKYLDIYPSDFGYSNPDLIRAKILLDALLDKNIDIIWFLKG
FT                   GGGAFNLLPYLYDHINELKKAKPKILVGFSDVTAIHFFVNNVLGWKSLHGVVAAYNKNA
FT                   YSSQKIGKIRINDLERIPNITEIINNGISYDKLMPMNKMAYNGTDGSIVGGNMTLIYSY
FT                   FSTVYQQDISTKILFLEDTGISFRQLDRSLHQLLYLPENKKPEAIIFGQFYPLDPTDDQ
FT                   RLIYKTVIKKFAKTFNRPVYYFPFIGHGQYNKPLLLGVTSNIKCSKETIFCTLKQK"
FT   gene            190812..191246
FT                   /locus_tag="FTW_2101"
FT                   /note="transposase IS4"
FT   misc_feature    190812..191246
FT                   /locus_tag="FTW_2101"
FT                   /note="disruption due to premature stop"
FT   gene            191341..191469
FT                   /locus_tag="FTW_0187"
FT   CDS_pept        191341..191469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46161"
FT                   /protein_id="ABO46161.1"
FT                   /translation="MCKGLKGLVFGDRGYISKDKAQLLEQQGLKLITTLKKYKKSS"
FT   gene            complement(191606..192187)
FT                   /locus_tag="FTW_0188"
FT   CDS_pept        complement(191606..192187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46162"
FT                   /protein_id="ABO46162.1"
FT                   /translation="MDKDVLDIYTDYLISQTKYATATKLSDILDQEVSHDKITRFLSKP
FT                   YLTSLEFWKYIKPLVRKHNSEYEVLCLDDTISEKPSTDENDIVCWHHSHAKGVHVKGIN
FT                   IVSCILSTSNLSIPIDYEIVKKYKRYYDEKDKRYKRRSKITKNQMFQNMINRAVINQVK
FT                   FKYILTSVRQLFHRQTLRIIDFNWVNNKLS"
FT   gene            complement(192432..193712)
FT                   /locus_tag="FTW_0189"
FT   CDS_pept        complement(192432..193712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0189"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46163"
FT                   /protein_id="ABO46163.1"
FT                   /translation="MDKSHLPNTKVLVTLSWIICLIATLNYSYDFFIRAAPSVMGNNLI
FT                   IDFGISHTELGMLSSAYFVSYTIMQIPAGVILDKYNRKVVISIATAFCVLGNYLFSATN
FT                   YYEVAYIGRIFMGIGSAFGFIGAAKMAGMWLPEKLFSTFIGFATVVGILGGLVTDTLLS
FT                   SLVSDLGWRDGNAVFTYIGVGILLLIVIFIRDNPKHVAKFTHLSEANFKETIVKVLKIF
FT                   CNLKFWAASIIGAVLFIPINVLGSLWGVGLIQAKFGLTQEIASHLNGALFIGAAVGFTV
FT                   AAIIASLTNRYRLMLTLSIVSLAMLLAIILYVPMSLSMFTVLYFLLGAAAGPQAVTFGI
FT                   AKIISPKGTTGSATARVNMINNFVPIILLPLVGYILTHFGTFIANSRTIYTITSYQNAL
FT                   DMVIIFLLVCLPIAMLIPKQIQADLNH"
FT   gene            complement(193844..196957)
FT                   /locus_tag="FTW_0190"
FT   CDS_pept        complement(193844..196957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0190"
FT                   /product="RND transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="GO_component: GO:0016021 - integral to membrane
FT                   [Evidence ISS] [PMID 11152613]; GO_function: GO:0015562 -
FT                   efflux permease activity; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46164"
FT                   /protein_id="ABO46164.1"
FT                   /translation="MRLIDLFIRRPVLSLSISFMIIVVGVGSFFKLQVRQYPYIDSATI
FT                   TVTTSYPGANPATIQAFVTRPLEAAVGSSKGIDYMTSESALGTSTITVYVKLGYNTNDV
FT                   LSEVVQNVNSILNQLPQDAYSPAIKLNPADNFPSLILAFTSKTMNTSEISAYINSELTP
FT                   KLLAEGGLSEINVWGNMPYAMRIYPNKTRMAEYGITPTELATAIGSNSLVSAGGQIQGP
FT                   YLNYTLNPETSMSTAQEYRNLIIKKSDNQIVRLSDVARVELGAQNYNSSVYFDGKNAVL
FT                   AGAVVSPEENPLDVVNRLVKQLPNIKASLPNGLNVDVAYNSTLYIESSIDEVLHTLLEA
FT                   VIIVSIVMFLFLGSLRAIIVPIIAIPLSIIGSFFLMSIMGFSINLLTLLAMILAIGLVV
FT                   DDAIVVLENIYRHIEEGMEPFAAAIKGAREIANPVILMTLTLIVVYAPIGMMGGFTGQL
FT                   FTEFAYSLAGAVLISGIVAYTLSPMMCSKVLNREMMSSKLVKFIDNVFSKLAAKYKALL
FT                   MFVLDIKPAIAIVGIIVLASCFIMGKGIKSELAPNEDMGFLGVMGQAPSSANINYLETF
FT                   GKKLANTLDEIPGKQNVFILNGVMSSNVIFGGFIMQPWDERKISQQQAANIAQAKVTEL
FT                   PGVQTYTYQTPALPGIPRGAPLSLVIQSVNDYEAIDEITNKIIAKMMSNGLFVFAQSDL
FT                   KFDNPIVDINIDRDKAGILGITMSDIAKTLGYSYAGGYINYFFLKGYSFQVIPQLARNE
FT                   MLTQEQLGNIYIRSDEMNKLFDSEVPLSALVTFKTEGQPLTLNTFQQLNASTISAVMAP
FT                   GITQGQAIEYVQSVVKSMLPEGFSYNFSGSARQYIENGNTMMVAFAFAIVLIFLALSAQ
FT                   FESFRDSLVILVTIPMAISGALIPLYVGQYLGASWASLNIYTQLGLVTLIGLISKQGIM
FT                   VVEFANHLQKHNGMNKYDAIVTSSSQRLRPILMTVSAMVVGVIPLVTSSGAGAISRNCI
FT                   GVVISSGLVIGAIFSLFVLPVVYMYIASDKSKSVKTDAEQQQIIDQIK"
FT   gene            complement(196957..198330)
FT                   /locus_tag="FTW_0191"
FT   CDS_pept        complement(196957..198330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0191"
FT                   /product="membrane fusion protein, RND family"
FT                   /note="GO_function: GO:0005215 - transporter activity;
FT                   GO_function: GO:0008565 - protein transporter activity;
FT                   GO_process: GO:0009306 - protein secretion; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46165"
FT                   /protein_id="ABO46165.1"
FT                   /translation="MDVKKTFLNIKQKINSSKRNYAIFVIATIILAWLVLGKLGISLAI
FT                   VYFIFQINYIKNKLHKLKDKKTASIAIVVATLILFGGIFGFAEFIQSMIKKGMAAYVPQ
FT                   PVAVTSSVVEKTDWKQVINTIGEAQAVQSTAISSQSGGIVSEIHFKSGQEVKKGDLLFK
FT                   LDTSQLKANLEEALSNLKLAKITKDRYNKLVEQKATSKESADKANADYLSALAQVQNIE
FT                   SQIGFKEVRAPFDGKIGIRNISLGQYFNNGDNAATLTTIDPIFITFPVPQNKVSMISVG
FT                   QEINFYSDSYPGETFTGKITAINSFINDSNRSITVQATYANPHHKIVAGMFLTVHVSLP
FT                   VRKNSIVIPRNAISYSLYGQSVFTLEPVMKDGQPVKASYTSTADGGMKTINTDKTLYKV
FT                   GQANIEVLETRNNLALVTGLESGTTIITSGQNKVHKGMNAIINNSVEIDNNIYKQGIQ"
FT   gene            complement(198343..198834)
FT                   /gene="dsbB"
FT                   /locus_tag="FTW_0192"
FT   CDS_pept        complement(198343..198834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="FTW_0192"
FT                   /product="disulfide bond formation protein"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006457 - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46166"
FT                   /protein_id="ABO46166.1"
FT                   /translation="MKKLSNCIFIFNTLACFVALGVVIFTISVLDWKPCPMCLLQQLCV
FT                   LSIMLLSLLVLATKKFKSFSTLLQLITIIVIATGAYIAADQVYLQYFLTDTSNNNAACG
FT                   AINNKFLLDATKSITGTINSCTDISEKISGVSLTVYSFIFFISLLIINCINFLVRILKK
FT                   "
FT   gene            complement(198874..199956)
FT                   /locus_tag="FTW_0193"
FT   CDS_pept        complement(198874..199956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0193"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase
FT                   family protein"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46167"
FT                   /protein_id="ABO46167.1"
FT                   /translation="MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAAN
FT                   FPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSKYITLEDDLKRRDLTINSIAIDQNN
FT                   KVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALIKEL
FT                   VKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCILPLIPNKSFFE
FT                   NPIYKGSNINEKITLCLLKIPQQQLDDIRKELLLTNKHYKLLKASIAISKILEDRSITA
FT                   EEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPHRNYQLLQTTINTIKNASIDS
FT                   LTIKTIPKDKLRNTLKQLKL"
FT   gene            200061..201890
FT                   /gene="msbA"
FT                   /locus_tag="FTW_0194"
FT   CDS_pept        200061..201890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbA"
FT                   /locus_tag="FTW_0194"
FT                   /product="lipid A transport protein, ABC type transporter,
FT                   ATP-binding and permease protein"
FT                   /note="GO_component: GO:0043192 - ATP-binding cassette
FT                   (ABC) transporter complex (sensu Bacteria and Archaea);
FT                   GO_component: GO:0009898 - internal side of plasma
FT                   membrane; GO_function: GO:0005319 - lipid transporter
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0042626 - ATPase activity, coupled to
FT                   transmembrane movement of substances; GO_process:
FT                   GO:0006869 - lipid transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46168"
FT                   /protein_id="ABO46168.1"
FT                   /translation="MANMIDKIDLKSQGSSNLSGEMTNHQKVGTLYKRLLLQVKHLWHF
FT                   LLLAAIGSIFFSAADASMIYLINPILNYGFGPGGGITKQSATILMLMGVGMVGLLALRS
FT                   VGSFVSQYFIGSLGQKVVYKFRKDIYKRLMDLPASFFDKHSTGQIISRLLYNVDQVTEA
FT                   TSTAIITVVQDGTFVIGLIVVMFVSSWQLSLFLIVVGPFLGLFISIINKKFRNLSRNTQ
FT                   SSMGNVTHTAEETIRNYKEIRIFGAQQKQQNKFFKNLDYTYSQQIRTIALDALTSPVIQ
FT                   IIASLVLAFSLFTIAIFGTNEGDGSSWLTAGSFASFFAAAAAILKPIKNLTKVNVVIQK
FT                   AVAATEDIFYILDYPAEKETGSKELAKVDGNVTIKDLSFAFGEHKVLSGVSVDIKAGQT
FT                   VAFVGKSGSGKTTLTSIISRFYTQHEGEILLDGVDTRELTLENLRSHLSIVSQNVHLFD
FT                   DTVYNNIAFGLSREVSEEEVIDALKRANAYEFVQELSDGINTNIGNNGSKLSGGQRQRI
FT                   SIARALLKNAPVLIFDEATSALDNESERVVQQALESLTKSCTTIVIAHRLSTVENADKI
FT                   VVMDGGRVVESGKHQELLEQGGLYTRLYQSGLQ"
FT   gene            201896..202864
FT                   /gene="lpxK"
FT                   /locus_tag="FTW_0195"
FT   CDS_pept        201896..202864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="FTW_0195"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="GO_function: GO:0009029 - tetraacyldisaccharide
FT                   4'-kinase activity; GO_process: GO:0009245 - lipid A
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46169"
FT                   /db_xref="GOA:A4IW67"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW67"
FT                   /protein_id="ABO46169.1"
FT                   /translation="MLDKIWYRSKPNLLSRVLQPISLVFIDIANKRKIKQQLKQYKSKI
FT                   PIIVVGNISVGGTGKTPVVRMLAQQYLAQDKKPAIISRGYGAKADNYPFEVTSGTLATQ
FT                   CGDEPAMLFDALQAQVPIVIAPERVQAVKYIEKNFPDTDIIMSDDGLQHYKLARDKEIV
FT                   VVDAIRMFGNKLCLPAGPLREPIERLKEVDQIIVIGNCSDKDKELLKNYKNVTYAKVVA
FT                   TEFVNILTAKKVAKTEFNHQNAIAIAGIGNPTKFFKTLEESAINITAKKVFKDHHKFTQ
FT                   SDFEGIDSDITVVMTYKDAIKCKNFAKANWWYLDIALDINV"
FT   gene            202960..205653
FT                   /gene="polA"
FT                   /locus_tag="FTW_0196"
FT   CDS_pept        202960..205653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="FTW_0196"
FT                   /product="multifunctional DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="GO_function: GO:0008408 - 3'-5' exonuclease
FT                   activity; GO_function: GO:0003887 - DNA-directed DNA
FT                   polymerase activity; GO_function: GO:0008409 - 5'-3'
FT                   exonuclease activity; GO_process: GO:0006308 - DNA
FT                   catabolism; GO_process: GO:0006260 - DNA replication;
FT                   GO_process: GO:0006139 - nucleobase, nucleoside, nucleotide
FT                   and nucleic acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46170"
FT                   /protein_id="ABO46170.1"
FT                   /translation="MKKIVLVDGSSYLFRAYHALPHLTNSQGEPTGAIIGVINMLKKLP
FT                   IMYDTEYVAVVFDAKGKNFRHQLYPQYKAHRKDIDDELRVQIQPLHQIIEKMGFAVIIE
FT                   DGVEADDVIGTLAQKLQKQDYQIIISTGDKDMAQLVTDNIVLYDSMKNVTTDVAGVLEK
FT                   YQISPHQMIDYLALMGDSSDNIPGIPKVGPKTAVKWLQDYQNIDGIIANQQQIKGKVGE
FT                   NLRNNIDLLKLSYQLATIKCDLELDLTVEDLKCKAADKAYLIEAYTRYEFKSLLKDLDN
FT                   SDIKIVTSQAQAADVAIEYITITTQTQLDDLIAELEKYDSFAFDTETDSLNTYEANLVG
FT                   LSFCAKEGRAFYIPLQHRYLGVPQQLELGFVLDKLKPLFADSKKVKVAHNFKFDEKVLS
FT                   KYAIEINGKVDDTMIMAYVLKSSGKHDMDSLSKEHLGIEPIAYTAIAGTGKQQQTLDQV
FT                   DIEIVAKYAAEDADITFRLFNHFKALLEQDKVLFKLYCELEMPLTIILNQMEKTGVKID
FT                   ATKLIQQSASLETSIKELESKCYNLAGQEFNLSSPVQLREILFEKLGLPPVKKTAKGQV
FT                   STSEEVLVQLAEDYEIAALIMKYRHLSKLKNTYTDKLPKMLDANGRVHTSYNQTGTVTG
FT                   RLSSSDPNLQNIPIKSPEGRKIREAFIAEDGYCIVAADYSQIELRIMAHLSKDKNLLKV
FT                   FNQNLDIHSATAAEVLGISIDEVSSEQRRKAKAINFGLIYGMSAFGLARQLEIPRAEAQ
FT                   EYIDIYFNRYPSVKEYMTTAKEFAKQNGYVETILGRRLYLPEINSKNVMQRNAAERAAI
FT                   NAPMQGTAADIIKKAMINVNMMISQEYNSEIKMVMQVHDELVFEVKKTKLEEIVAKIKS
FT                   IMEAAVKLNVPLEVNVDSGKSWDQAH"
FT   gene            205673..206449
FT                   /locus_tag="FTW_0197"
FT   CDS_pept        205673..206449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0197"
FT                   /product="transcriptional regulator, bvg accessory factor
FT                   (baf) family"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46171"
FT                   /protein_id="ABO46171.1"
FT                   /translation="MLLVMDMGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFLR
FT                   QALRENSVDLGKIDGCGISSVVPHLNYSLGSAVIKYFNIKPFFISMDTTDLDMSAVEAH
FT                   QVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLNALC
FT                   QGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYTIATG
FT                   GFAGLFKEEDIFNEISPDLILRGIRIAFLENNKKGV"
FT   gene            206454..207698
FT                   /gene="deoB"
FT                   /locus_tag="FTW_0198"
FT   CDS_pept        206454..207698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="FTW_0198"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="GO_function: GO:0008973 - phosphopentomutase
FT                   activity; GO_process: GO:0006139 - nucleobase, nucleoside,
FT                   nucleotide and nucleic acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46172"
FT                   /protein_id="ABO46172.1"
FT                   /translation="MLKDKKVVILLFDSFGIGQAPDAADFGDEGADTLGHTVDYFTNNG
FT                   MSISLPNLSKKGLKKAAEYNRCKEFSQDIAQSEQVENAKYGYCAEVSKGKDTPSGHWEL
FT                   AGVPVMFDWYYFTKKQHQSCFDKEFIDKWVERAGITEGFIDAGHASGTEVLKEHGCESC
FT                   VTKKPIIYTSADSVFQVAAHEDYYGLDKLLKICLVAREVLDEMGMKVGRVIARPFIGES
FT                   ADEYVRTGNRRDFSILPPAPTLLDKLVKAGGEVVSIGKIADIYANQGITKKVKATGLEE
FT                   LFDKTIDEYTLAKQNTLVFTNFVDLDSSFGHRRDPKGYGKALEYLDSRIPDLDAKLDDN
FT                   TIVVLAADHGCDPTAPGSDHTRECVPFLLWGRNIKPEFIGARDTFADIGQTIADFMGIE
FT                   SLEYGKSIFGASHDN"
FT   gene            207688..208422
FT                   /gene="deoC"
FT                   /locus_tag="FTW_0199"
FT   CDS_pept        207688..208422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="FTW_0199"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="GO_function: GO:0004139 - deoxyribose-phosphate
FT                   aldolase activity; GO_process: GO:0009264 -
FT                   deoxyribonucleotide catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46173"
FT                   /protein_id="ABO46173.1"
FT                   /translation="MITKQEIVSLIDLTQLGDSDTQVDIVNLCSKARNSLGEVAALCVY
FT                   KQFIPVVKKQLGNNFKVATVVNFPNGDNTIEDVISEVKQALSLGADEIDLVIDYKEYLD
FT                   QGFSEKSCQMMVEVKKLCKDKTFKVIIESGELKTAKLITKVCQDVIDAGADFIKTSTGK
FT                   TSEGATLAAAQVILETIKSSAKRIGFKASGGIRNYNQAVAYIELAANILANNFINPQTF
FT                   RFGVSGLLDNLLNEQQEQIDDY"
FT   gene            208412..209611
FT                   /locus_tag="FTW_0200"
FT   CDS_pept        208412..209611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0200"
FT                   /product="nucleoside permease, NupC family protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_function: GO:0005337 - nucleoside transporter activity;
FT                   GO_process: GO:0015858 - nucleoside transport; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46174"
FT                   /protein_id="ABO46174.1"
FT                   /translation="MIIKSLYFILGLIVIYFLAYIWSNNRRNIRYKNLIIILIVQLILA
FT                   KFMLSTSIGINIINYVNKCFEVLLDSTHIGVEFVFGNLANTKEFIFFFNAAMPIVVMSA
FT                   VIGILQYFRILQFLVVAIGSILSKVTGMGKLESFNAVSSLSVGQSENFLYYKKIIKYLP
FT                   SNVLYTMVATAMSTVSIGTAAAYMTIIDPSYVCVAIVMNMFGAFFVLNIINPYEKTKEV
FT                   TYEFLTDQVEDYERQRFFEMLSEYILDGFKVAIIVCVMIMGYIAFLNLADGIFSSLVGI
FT                   SLRDILGYIFYPIAWILNIHGNEIFLSSQIMGTKIVTNEFVAMQELANHSTQLSQHTKA
FT                   VVSVFLVSFANFSSIGIIIGAIQALSREASVKVARFSLKILYGAVLVSFLSANIVGFIL
FT                   "
FT   gene            209630..210832
FT                   /locus_tag="FTW_0201"
FT   CDS_pept        209630..210832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0201"
FT                   /product="nucleoside permease, NupC family protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_function: GO:0005337 - nucleoside transporter activity;
FT                   GO_process: GO:0015858 - nucleoside transport; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46175"
FT                   /protein_id="ABO46175.1"
FT                   /translation="MFVKILYLLLGLVTVFILAFIWSSDRKKIKYKHLFIILFFQLLVC
FT                   FFILQSSEGIKLVAIISTGFDKILQHAHEGTAFVFGSLADTSKNGFVFFFNVGMPIVLI
FT                   SGIIGVLQYFRILPLVIRGVGFILTKITGMGKLESFNAVSSLTVGQQENFLIYKKIIGH
FT                   LPANVLYTMAATAMSTVSLAIAGSYMSIIEPKYVCTAIVLNMLSTFFVLHIINPYDKDP
FT                   SLNYDTLHADYETGRQSFFEMLSEYLLDGFKIAVIVCAMLVGFIALLNLVDGIFQEILG
FT                   ITFRQILGYIFYPIAWVLNIHGNEIFLSSQIMGTKIVTNEFVAMQELAKNSQQLSEHTK
FT                   AVVSVFLVSFANFSSIGIIVGAVQALNKEASIKVARFSLKILYGAVLVSILSACVVGFI
FT                   V"
FT   gene            210845..211474
FT                   /gene="tmk"
FT                   /locus_tag="FTW_0202"
FT   CDS_pept        210845..211474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="FTW_0202"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="GO_function: GO:0004798 - thymidylate kinase
FT                   activity; GO_process: GO:0015949 - nucleobase, nucleoside
FT                   and nucleotide interconversion; GO_process: GO:0006234 -
FT                   TTP biosynthesis; GO_process: GO:0008655 - pyrimidine
FT                   salvage"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46176"
FT                   /db_xref="GOA:A4IW74"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW74"
FT                   /protein_id="ABO46176.1"
FT                   /translation="MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKI
FT                   AEELRNLVLHNKYDEEIHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMA
FT                   YQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEF
FT                   FNRTRKVFKDLVKDSDNAIEIDAAKSIQEVEKQIYLILDKHFNFQN"
FT   gene            211536..213113
FT                   /gene="prfC"
FT                   /locus_tag="FTW_0203"
FT   CDS_pept        211536..213113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="FTW_0203"
FT                   /product="peptide chain release factor 3"
FT                   /note="GO_function: GO:0003747 - translation release factor
FT                   activity; GO_function: GO:0005525 - GTP binding;
FT                   GO_process: GO:0006415 - translational termination"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46177"
FT                   /db_xref="GOA:A4IW75"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW75"
FT                   /protein_id="ABO46177.1"
FT                   /translation="MSEYLQQIAKRRTFAIISHPDAGKTTITEKMLLFGNAIKTAGTVK
FT                   AKKSGIHATSDWMEMEKQRGISITTSVMQFPYNGRIINLLDTPGHEDFSEDTYRTLTAV
FT                   DSALMVVDAVKGVEDRTIKLMNVCRLRDTPIVTFMNKFDRDTRDPLELLDEVENILKIK
FT                   CAPMNWPIGMGKYFKGVYDLYNDEVTLFETGHGHEIYPYKKIKGLANAKDAIGIDLYED
FT                   LEMEIDLVRGASHEFDEQEFLEGNLTPVYFGTALSNFGVKEMMDGFTRYAPAPQHREAD
FT                   QRVVAADEQKLTGFVFKIQANMDEKHRNRIAFFRICSGKYEKGMKIFHERTGKQMQISK
FT                   ALTFMAGEREQVEEGYAGDIIGLHNHGSIQIGDSFTQGEKLKFKGIPNFAPEIFKRVKL
FT                   NDPLKMKALQKGLVQLSEEGATQVFKPFISNDLVLGAVGVLQFDVVAQRLASEYNVKCS
FT                   YEGVNVTLARWIFCNDEKKLNDFKKKYEVNLAYDGAGYLTYLAPTGVNLQLAQEKNPDI
FT                   IFSATREH"
FT   gene            213188..214504
FT                   /locus_tag="FTW_0204"
FT   CDS_pept        213188..214504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0204"
FT                   /product="LysM domain membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46178"
FT                   /protein_id="ABO46178.1"
FT                   /translation="MLKSISRVLVAGFALAMVSPVFSMEIYTVKSNDYLYKIAKNHAVT
FT                   GVSISELTDAIKGINKSEIPGIIDNRIRIGDKLAIPTTKAEVEDGLTLMRNQIIQSSYQ
FT                   QPSSDTTSQQPSTPAANLGDNTAAANDADDSSTPSVVSQDKIPVLIPTDDNSTPETYKS
FT                   NLDTQINSDNIQETASYEQQPTQSSSTWGSLFRFIIYVIILAVVVVVGKRFWETRNSKK
FT                   EQELELISKKKRDHLMSRISPVVSDNEFYRSDKVNNSPQEEFDFFGAAKSSRSEVTTVD
FT                   EEIQSQQESEDTFEQPAQNEEDLFAQRDKNIIVKTEKGVVFETNTDDTLVNSTADETKV
FT                   EEIDSQQQAEQELQYINELIEQFLDSEKYVEASITIQDSLEKDPNNIDLRYKLLEVYAR
FT                   AGDEIAFEGEVHFIKSKNIVSMFDPLHQKIAKLRDKYFE"
FT   gene            214537..215532
FT                   /gene="ftsY"
FT                   /locus_tag="FTW_0205"
FT   CDS_pept        214537..215532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="FTW_0205"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="GO_function: GO:0003924 - GTPase activity;
FT                   GO_function: GO:0005047 - signal recognition particle
FT                   binding; GO_process: GO:0009306 - protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46179"
FT                   /protein_id="ABO46179.1"
FT                   /translation="MFFKKKKNTEIESPIERVQEQDNKKGLFSRLQAGLSKTANKFGSG
FT                   LSTILMGQKVVDEELLEDIEMQLLTADVGVEATDEIVTYLRDKVARNELQTADKLNQII
FT                   QQKLTEIILPCEKPLEVDTQKSPFVILVVGVNGVGKTTTIGKLTKKLQSQGKSVILAAG
FT                   DTFRAAAVEQLREWGDRNNTHVVYQHEGADSASVIYDAIGSAKSKGIDVVIADTAGRLH
FT                   NKDNLMQELKKVVKVIKKTDETAPHEIMLVVDATTGGNALNQAEAFNQIVNLTGITITK
FT                   LDGTAKGGIVFSIAKKLGLPLRFIGVGEKIDDLQVFNARDFTTALFNSND"
FT   gene            215623..217845
FT                   /gene="uvrD"
FT                   /locus_tag="FTW_0206"
FT   CDS_pept        215623..217845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="FTW_0206"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /note="GO_function: GO:0004003 - ATP-dependent DNA helicase
FT                   activity; GO_process: GO:0006281 - DNA repair; GO_process:
FT                   GO:0006268 - DNA unwinding during replication"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46180"
FT                   /protein_id="ABO46180.1"
FT                   /translation="MSNYDFTLGLNPEQQKATLLEDRNALILAGAGSGKTKVLTSRIAY
FT                   LCRDKGVSIENILAVTFTNKAAKEIQQRVEKMLGISTFGMWIGTFHGIAHRLLRKHAHE
FT                   LGLDKNFRILDQDEQAQLVKKLINNLDLDDKKYPPKLLQNFINKQKDKAIRSNKLTKQY
FT                   DANYAHIYTAYEERLQLDNALDFADLLLHLYELFSFNQQLREYYQNKFKYILIDEFQDT
FT                   NHVQYMWLKLLITDNNYMMAVGDDDQSIYGWRGAVVDNIHNYVKDLKNVEIIKLEQNYR
FT                   STKNILKVANSVIKNNDNRMSKELWSAAEDGEKVVLYCAVNERDEAKYIIDKIRQLHND
FT                   GVDYSDIAILYRSNYLSRVLEESCIYASIPYRIYGGFRFFDRAEIKDALAYLRLAVTNS
FT                   DNLAFERIINTPTRGIGNKTLETIRNYAQINSLSYWQATLDVIQKELVTKRTASLLLKF
FT                   IELISGISAQINQHSLDKLLESVINQSGLLASYQEKNSEKDRQKIDNLKELISAAKDFE
FT                   PQIELLDDNTDILQDFLSFAVLEAGEMQADEATDSVQLMTIHASKGLEFRYVFLVAAEE
FT                   GVFPPSSIVNFEEVFDNTSSKKMQEKLAEERRLFYVAVTRAMKALTISYAQVRSIFGRS
FT                   SFQVKSRFVAEIDSQHLSQGKLEFTAAKPKTKQKANFGMSPFDFLKSNNTTNSFKPGDK
FT                   VFHKVFGKGVFIKAQAQGTKEFYTVDFGIDVGQKILLADIANLVKV"
FT   gene            217987..219444
FT                   /locus_tag="FTW_0207"
FT   CDS_pept        217987..219444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0207"
FT                   /product="putative oligopeptide permease, ABC transporter"
FT                   /note="GO_function: GO:0005488 - binding; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46181"
FT                   /protein_id="ABO46181.1"
FT                   /translation="MVDYNQKSEVIPTGASSWKISKDGKTYTFYLRKNAKWTNGGPVTA
FT                   DDYVYSYRRSVTPETLTRAYASYFNPIVNAVAIQAGKKSPETLGVKALDKYTLQIKLTE
FT                   PNPTFLDSLTIYAFFPVNKKAIEKYGDSWAAKPDTIISNGAYKLTKWIHNGYALAEKSS
FT                   NYWDAKNVSIDSVKYLMINDVSSDLENYKAGGESLTYNNLPANTAEWYKEHFTNNQFQP
FT                   SPMLAQAYFIFNMRDTKFQDIRVRKALSMVIDRKGIAEGVKKGLVTPSYLVVPETVAGG
FT                   RYKDLAKDIPDYDWVNEPIEQRIKQARQLLKEAGYSKKHPLEFTINFNTSDVNRLMAQI
FT                   LQGSWQQDFGDLVKVSIFNEDWKVYLDSLKNGNFDVARMAWIADFNQPNTYTEMYTCDS
FT                   DNNYGHYCDKEADEIYNKSLTTNSMDEFYKLQKELIIKQTAGYPTIPLFTQPAIQLVQP
FT                   YVKGFKPKENVIGRYRAKQLSIKQSEV"
FT   gene            219469..220406
FT                   /locus_tag="FTW_2102"
FT                   /note="oligopeptide permease protein, ABC transporter"
FT   misc_feature    219469..220406
FT                   /locus_tag="FTW_2102"
FT                   /note="contains frameshift"
FT   gene            220406..220931
FT                   /locus_tag="FTW_0210"
FT                   /note="oligopeptide permease protein, ABC transporter"
FT   misc_feature    220406..220931
FT                   /locus_tag="FTW_0210"
FT                   /note="contains frameshift"
FT   gene            221083..222051
FT                   /gene="oppD"
FT                   /locus_tag="FTW_0213"
FT   CDS_pept        221083..222051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="FTW_0213"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="GO_component: GO:0043192 - ATP-binding cassette
FT                   (ABC) transporter complex (sensu Bacteria and Archaea);
FT                   GO_component: GO:0009898 - internal side of plasma
FT                   membrane; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0015440 - peptide-transporting ATPase
FT                   activity; GO_process: GO:0006810 - transport; GO_process:
FT                   GO:0015833 - peptide transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46182"
FT                   /protein_id="ABO46182.1"
FT                   /translation="MKDLALQIKDLNVGFKTDDGMFSAVRDISFDLKKGHTLGIFGESG
FT                   SGKSQTVLSLMGLLAGNAVVSGQALFHDQNLINMPTKNLNKIRGDKIAMIFQDPMTSLN
FT                   PYLTIHKQLLEPLTIHKGMSHKDATKKVLEMLDAVQIPDAKNRLKLYPHEFSGGMRQRV
FT                   VIAMALLYSPEILIADEPTTALDVTVQGQILQLLSDLQKEFHMSMLFITHDLGVVAEIC
FT                   HDVMVMYCGNIMEQGTVDNIFANAQHPYTKGLLNTMPSITRDVDILQTIPGETPNIHNM
FT                   PKGCPFVTRCDFAIDICKDTKPELISYLDQRTACHLVKEYK"
FT   gene            222230..223027
FT                   /locus_tag="FTW_0214"
FT                   /note="oligopeptide ABC transporter, ATP-binding protein"
FT   misc_feature    222230..223027
FT                   /locus_tag="FTW_0214"
FT                   /note="N-terminal truncation due to frameshift"
FT   gene            complement(223031..224233)
FT                   /locus_tag="FTW_0215"
FT   CDS_pept        complement(223031..224233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0215"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46183"
FT                   /protein_id="ABO46183.1"
FT                   /translation="MQKFKLSLILVVGISFYCYEFFLRILTGAYQEQIVEHFNISTHIG
FT                   FSFLVSSYNITYLLMQIPAGILLDRYGSKKVLIGATILCGIGNIIFVSGEYELALFGRL
FT                   LVGLGSSFAFIGVLKLTLENFESKYFPIITSLVISLGTLAAAFSQNISVIISHYDTSWI
FT                   NIFIYSGVIALPLAIFFQLIIPHEKYSSALMPKFSEILKRGKQLIKNSLIWKNAIWAGL
FT                   LYTPTVILISQYGVLYFKQSYGFDSIYSTTMITAIFIGWIIFSPIMTHLCNKFSGKKII
FT                   TISIVGILLVSILINAQLLKNYAISIAFLFGTFSASQVLVWYYFNKICPPSFAAVRIAI
FT                   TNMLITLVIEIGQLSAGLAIDSGDHFNINANTSITIAFSIVLALAFIIMRSMIKKIKNN
FT                   S"
FT   gene            224367..224948
FT                   /locus_tag="FTW_0216"
FT   CDS_pept        224367..224948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46184"
FT                   /protein_id="ABO46184.1"
FT                   /translation="MKKVITFSALFLCSIFGYSDNNLNQQTGMYYITANNFFYRPSTER
FT                   GNEVVDRQNASEFSDRISSSAINITDSLVFDAYTSSTSLIAQGSMGDLKDTKFYTQETK
FT                   LVKKLWNDKLEIYGGTVLGANPYQLNNMNSAYDPGSRIAAFASGRTGAKYNVSRNFGLL
FT                   IEGQYNLTGEMADNTDMFTGFNGAQYRTQL"
FT   gene            complement(224998..225123)
FT                   /locus_tag="FTW_0217"
FT   CDS_pept        complement(224998..225123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46185"
FT                   /protein_id="ABO46185.1"
FT                   /translation="MYFRYLKIMLKKPEYVNTNNFLDTNKLISYRSPNNQSVYKP"
FT   gene            225137..226360
FT                   /locus_tag="FTW_0218"
FT   CDS_pept        225137..226360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0218"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46186"
FT                   /protein_id="ABO46186.1"
FT                   /translation="MQKVTKAGFIIWFICAFFYALEFIIRASGNSLYNDFSIAPYNLSP
FT                   EQISVLSSAFYWAYVASQLPAGILIDKFGVKKIMLVSTLLFSVGVFIATRATSQEYLIL
FT                   YRVLAGVGGGFAFLSALKSIAIWLPKRTFPLFTGATQMLMYGAGTLTGLPLVILANHFS
FT                   IQVIMSVILVVSILLFLSVVFFIPTVEPHNQKDTDELADTHTKIEDIPIVFKIKQILLN
FT                   GFFCFTIYGTTAIFADLWSYRFLSLDGYSVHYAGLASSMIFIGIAIFSPLWGVIATLLN
FT                   KQKSLLVLASIFGLFIVIAIVYMHVDPIIMCILCILWGGMQAVHVLNFTILRMHISPLY
FT                   IATGIAAVNLFIPLSGAVLQPFVGFVVSLLENHGFEQLIAFKYALAILPVLMLLSIVLS
FT                   LFITEKKN"
FT   gene            226417..227925
FT                   /gene="glpK"
FT                   /locus_tag="FTW_0219"
FT   CDS_pept        226417..227925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="FTW_0219"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="GO_function: GO:0004370 - glycerol kinase activity;
FT                   GO_process: GO:0006071 - glycerol metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46187"
FT                   /db_xref="GOA:A4IW85"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW85"
FT                   /protein_id="ABO46187.1"
FT                   /translation="MSTDFILAVDQGTTSSRAIIFDKKGNIRKIAQKEFTQIYPKSGWV
FT                   EHDAMEIWGTQSGVMREALEFGRVKPDQIAAIGITNQRETVVVWDKETGDPVYNAIVWQ
FT                   CRRTSSICDEIKRDPQFVKYIKENTGLVVDAYFSGTKVKWILDNVEGAREKANAGKLLM
FT                   GTIDTWLIWNLTRGKVHATDYSNASRTMLFNINSLEWDKKILDYLNIPESMLPEVKNSS
FT                   EVFGVTDSHTLGGAEIPIAGVAGDQHAALFGHCCFEKGMAKNTYGTGCFALMNVGDKPV
FT                   YSDEGLLTTIAWAENGKPTYALEGSVFIAGAVIQWIRDGLGLVRSAEDSEYYATKIDST
FT                   NGVYLVPAFVGLGTPYWDMYARGTIVGITRDTKREHIIRAALEAIAYQAKDVLECMKED
FT                   TGLDLAGLRVDGGAVQNNFLMQFQSDILQSEISKPKINEITGLGAVFLAGLAVGFWKDK
FT                   QELKSILTTEKVFEPQKDSQAVAHDYRGWKKAVERSKAWAECYS"
FT   gene            complement(227922..228802)
FT                   /locus_tag="FTW_0220"
FT   CDS_pept        complement(join(227922..228473,228473..228802))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0220"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46188"
FT                   /protein_id="ABO46188.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFSKILSD"
FT   gene            229118..230650
FT                   /locus_tag="FTW_0222"
FT   CDS_pept        229118..230650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0222"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /EC_number="1.1.99.-"
FT                   /note="GO_function: GO:0050660 - FAD binding; GO_function:
FT                   GO:0016491 - oxidoreductase activity; GO_process:
FT                   GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46189"
FT                   /protein_id="ABO46189.1"
FT                   /translation="MKKEYDIIIIGGGATGFGCAIEAVSRGYKTLLLEASDFGKGTSSK
FT                   STKLIHGGLRYLENFDFALVKEGLEERFSFLHNAPHLTHKQSYLIPTRSYFETIKYTIG
FT                   VKLYEFLSGKYKIGKSYNLNKHQTLAELPNIEASKLKKSLVYYDGQFDDTRLLISLMKT
FT                   FEAKGGVALNYHKVEKIFSSTDSKLDTVKVVDTLSGEQKEFTAKHIINATGTFSDKTIS
FT                   LANQQDAHKYVSVAQGTHIVFDREKFPTEHAILIPETEDGRVLFILPWHDHLIVGTTDI
FT                   KKEVPSLEPRADKSEIDFILKTFNQYAKDKATIVDIKSVYCGQRPLVTPKKAKNSAKIS
FT                   RKHEIVESKDGLITVVGGKWTIFRRMGQDTLDYIETKKIAQKISKTSDQLLIDAIEPKD
FT                   TYPLKVYGKNAEDIKTIQNELDNFELLARGLPYYQAEVVYHVRHEKAKTIEDVLARRTR
FT                   AAFLDIKASIDAAPKVAELMAKELGKDEVWQNQQIDSFIEFSKNFNVEELYK"
FT   gene            230660..231424
FT                   /locus_tag="FTW_0223"
FT   CDS_pept        230660..231424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0223"
FT                   /product="Major Intrinsic Protein (MIP) family permease"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46190"
FT                   /protein_id="ABO46190.1"
FT                   /translation="MLTACIAELIGTMLLILLGNGVVAGVVLNKTKAHDGGWIVITFAW
FT                   GLAVFIGVLVAGPISGAHLNPVVTLSLALAGKFSWAWVLPFIISQIIGAMLGQLLVWIM
FT                   YYPHYSATDNPELKLATCCTSPAIKHLPANFASEVIGTFVLVLAILTMHGVVLHVGDSS
FT                   ITTTYPVDMGALGGIPVAFVVVVIGMSLGGTTGYAINPARDFGPRLFHAIMPIQGKGSS
FT                   QWSYAWVPILGPVCGSIIATAFYLLLKVKGVF"
FT   gene            231428..232141
FT                   /locus_tag="FTW_0224"
FT   CDS_pept        231428..232141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0224"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46191"
FT                   /protein_id="ABO46191.1"
FT                   /translation="MCEITFIPLLADDVLRLFISFILFLSCVILSYIFAKQKPWDIAFW
FT                   ICFSIFLFSMGGYGYIIHHIYLENTFSYDGFISGAAFITVCGLLFSRKRYINFADSFVN
FT                   KNTAILIATFVVFALIYILTIRYNFSCVEEPHQFFIDALQIVIYPLLLLFAITAFLYRF
FT                   AICLSAFAVSMALFIIENILFIAHAIAAQHKYDIVFEEVLFATISIVLSAIAVYILTRA
FT                   KRIYKENSDVRSIRQ"
FT   gene            232119..232616
FT                   /locus_tag="FTW_0225"
FT   CDS_pept        232119..232616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46192"
FT                   /protein_id="ABO46192.1"
FT                   /translation="MFDQLGNSGAFLINAIVAVVILVVGFWASKYIKSLVYSLLKEYDK
FT                   TVSQFLASLVYTIFLVLVVVIALAKLGVPISPVTGVLTGVVFGISMSLKTSYNTVACGI
FT                   MLAFSKPFEVGEKVDFGGIKGTVKSIGFLYTKLDDEDGNEIVISNNLVLSKVITRFTQT
FT                   DK"
FT   gene            232616..234031
FT                   /locus_tag="FTW_0226"
FT   CDS_pept        232616..234031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0226"
FT                   /product="putative ATP-dependent exoDNAse"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46193"
FT                   /protein_id="ABO46193.1"
FT                   /translation="MQKTLLSSDEILYLPNGQKIVLNQQQLEAVNQIKKFLKSDERYFL
FT                   LSGFAGTGKTTVVKKILDEYPKKAIVSALTRKANAVISQATATQGYTIHSLLGLQPDIN
FT                   LEDFNPNDPVFGQIKKATIRSYNLIIIDEASMINTALFELIDSEINRSLITKVLFLGDQ
FT                   AQIPPIGDQLSPIFTLENSYQLTQLMRQATENPLAPLTQQLRNVNNQLPEFLIKKQTLL
FT                   SEAAEGILFVDSNEEFREQLIEVFGSSHAKTDPNYAKLIAWRNKTVMQSNRIIRDLVFG
FT                   DDAKLVEKGDVLTGYRAIKANSKEEFLINNCVDYKVVDVSERQRNINGLFGYMVSILEK
FT                   AKIFKGFEQKDIFVIDSQDETNLYDYAEIHDSLLLIARSDKLWNAYYEFRKNNLLLIDI
FT                   DRYRDGRSRSKNNLIKKDLDYGFAVTAHKAQGSTYNKVFVLLKDIQLNTNITERNQILY
FT                   VAMTRARKLSIVL"
FT   gene            234188..234272
FT                   /locus_tag="FTW_2056"
FT   tRNA            234188..234272
FT                   /locus_tag="FTW_2056"
FT                   /product="tRNA-Tyr"
FT   gene            234274..234347
FT                   /locus_tag="FTW_2049"
FT   tRNA            234274..234347
FT                   /locus_tag="FTW_2049"
FT                   /product="tRNA-Gly"
FT   gene            234376..234451
FT                   /locus_tag="FTW_2060"
FT   tRNA            234376..234451
FT                   /locus_tag="FTW_2060"
FT                   /product="tRNA-Thr"
FT   gene            234496..235680
FT                   /gene="tufA"
FT                   /locus_tag="FTW_0227"
FT   CDS_pept        234496..235680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="FTW_0227"
FT                   /product="translation elongation factor (EF-Tu)"
FT                   /note="GO_function: GO:0003746 - translation elongation
FT                   factor activity; GO_function: GO:0005525 - GTP binding;
FT                   GO_process: GO:0006414 - translational elongation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46194"
FT                   /db_xref="GOA:A4IW92"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW92"
FT                   /protein_id="ABO46194.1"
FT                   /translation="MAKEKFERSKPHVNVGTIGHVDHGKTTLTAAITKVMAEKNGGMAR
FT                   KFDEIDSAPEEKARGITINTSHVEYESPNRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPKIVVFLNKCDMVDDEELLELVEMEVRELLDQYEF
FT                   PGDDTPVIMGSALRAIEGDEAYVEKIVELVQAMDDYIPAPERDTEKPFILPIEDVFSIS
FT                   GRGTVVTGRIERGVVNVGDEVEVVGIRPTQKTTVTGVEMFRKLLDRGEAGDNVGILVRG
FT                   LKRDDVERGQVLCKPGSIKPHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITG
FT                   AVELPEGVEMVMPGDNVKMTITLINPIAMDEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            235700..235775
FT                   /locus_tag="FTW_2046"
FT   tRNA            235700..235775
FT                   /locus_tag="FTW_2046"
FT                   /product="tRNA-Trp"
FT   gene            235896..236342
FT                   /gene="secE"
FT                   /locus_tag="FTW_0228"
FT   CDS_pept        235896..236342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="FTW_0228"
FT                   /product="preprotein translocase, subunit E"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0015450 - protein translocase
FT                   activity; GO_process: GO:0009306 - protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46195"
FT                   /protein_id="ABO46195.1"
FT                   /translation="MKDCFVKRNQGFNNNKVWISGATKTTEVKKISKSNNLMLWLAVVA
FT                   IIVLGVAVTMYSDILGDSYSTYNTSLAVVVVLLAVVVARFTNQGRRFWAFFQASRLELA
FT                   KVVWPTRKETMTISLMVIVVVIIFALIISLFGIIFENFIQYFLG"
FT   gene            236358..236891
FT                   /gene="nusG"
FT                   /locus_tag="FTW_0229"
FT   CDS_pept        236358..236891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="FTW_0229"
FT                   /product="transcription termination factor NusG"
FT                   /note="GO_function: GO:0003715 - transcription termination
FT                   factor activity; GO_process: GO:0006353 - transcription
FT                   termination"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46196"
FT                   /protein_id="ABO46196.1"
FT                   /translation="MLWYVVQVHSGYEKRVKAQLEENIEIAGLKNNFGRILVPTENVVE
FT                   MKGGQKRKSERKYFPGYVLIEADLSTDAWNLVKSVPRVLTVVGSKGKPIPLSKAEVDRI
FT                   LDFVEGSKSTVEPRLRKSYHVGEVVRVLEGPFNDFTGVIEEVNYEKSRLRVAVSIFGRS
FT                   TPVELEFSQVEKES"
FT   gene            236960..237394
FT                   /gene="rplK"
FT                   /locus_tag="FTW_0230"
FT   CDS_pept        236960..237394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="FTW_0230"
FT                   /product="ribosomal protein L11"
FT                   /note="GO_component: GO:0009282 - cytosolic large ribosomal
FT                   subunit (sensu Bacteria); GO_component: GO:0000315 -
FT                   organellar large ribosomal subunit; GO_function: GO:0003735
FT                   - structural constituent of ribosome; GO_process:
FT                   GO:0006412 - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46197"
FT                   /db_xref="GOA:A4IW95"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW95"
FT                   /protein_id="ABO46197.1"
FT                   /translation="MAKKKIEAIIKLQVAAGKANPSPPIGPALGQHGVNIMGFCKEFNA
FT                   KTQGMEPGMPIPVEISVYSDRSFTFEMKTPPASYLIKKAINVKSGSSKPSKEFVGTITR
FT                   AQLEEIAKVKDPDLTAADLDAAVRIIAGSARSMGVKVEGV"
FT   gene            237397..238092
FT                   /gene="rplA"
FT                   /locus_tag="FTW_0231"
FT   CDS_pept        237397..238092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="FTW_0231"
FT                   /product="ribosomal protein L1"
FT                   /note="GO_component: GO:0009282 - cytosolic large ribosomal
FT                   subunit (sensu Bacteria); GO_component: GO:0015934 - large
FT                   ribosomal subunit; GO_function: GO:0003735 - structural
FT                   constituent of ribosome; GO_process: GO:0006412 - protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46198"
FT                   /db_xref="GOA:A4IW96"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW96"
FT                   /protein_id="ABO46198.1"
FT                   /translation="MAKVSKRMKEISAKINAEKKYPVSEAFDLLREVSSVKFVESVDVS
FT                   VALGVDPRKSDQVVRGASVLPNGTGKTVRVAVFAKGPAADAAKEAGAEVVGMEDLADEV
FT                   KKGNMDFDVVIASPDSMRVVGQLGQILGPKGLMPNPKVGTVTMDVAKAVRDAKAGQVRY
FT                   RVDKAGIIHTTIGKVNFTSDALKQNLERLLTDLKKAKPAVSKGIYLKKVSVSSTMGPGI
FT                   NVDFSDLNI"
FT   gene            238262..238780
FT                   /gene="rplJ"
FT                   /locus_tag="FTW_0232"
FT   CDS_pept        238262..238780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="FTW_0232"
FT                   /product="ribosomal protein L10"
FT                   /note="GO_component: GO:0015934 - large ribosomal subunit;
FT                   GO_component: GO:0009282 - cytosolic large ribosomal
FT                   subunit (sensu Bacteria); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46199"
FT                   /db_xref="GOA:A4IW97"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW97"
FT                   /protein_id="ABO46199.1"
FT                   /translation="MALRIEDKKAIVAEVAEQVSSALSAAVADYRGLTVNEMTSLRKQA
FT                   RESGVYLRVVRNNLARLAIKGTEFECLADALKGPLVLALSKDEPGAAAKLFKNFQKDHN
FT                   AFEVKNLAMSGELFGPEKLDDFAKLPTREEALATLLNVMQAPVTKFVRTLNEIPSQAVR
FT                   VFAAVGDSK"
FT   gene            238843..239220
FT                   /gene="rplL"
FT                   /locus_tag="FTW_0233"
FT   CDS_pept        238843..239220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="FTW_0233"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="GO_component: GO:0009282 - cytosolic large ribosomal
FT                   subunit (sensu Bacteria); GO_component: GO:0000315 -
FT                   organellar large ribosomal subunit; GO_function: GO:0003735
FT                   - structural constituent of ribosome; GO_process:
FT                   GO:0007046 - ribosome biogenesis; GO_process: GO:0006412 -
FT                   protein biosynthesis; GO_process: GO:0042255 - ribosome
FT                   assembly"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46200"
FT                   /db_xref="GOA:A4IW98"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW98"
FT                   /protein_id="ABO46200.1"
FT                   /translation="MAITKEDILNAVAEMSVMDVCDLVKMMEDKFGVSAAAAVAVAAGP
FT                   VAGPAEAAEEKTEFDVVLVDAGSNKIAAIKAVRGATGLGLKEAKDAVEGTPFTVKEAAS
FT                   KEEAEALKKQLEEAGAKVELK"
FT   gene            239374..243450
FT                   /gene="rpoB"
FT                   /locus_tag="FTW_0234"
FT   CDS_pept        239374..243450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="FTW_0234"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="GO_component: GO:0000345 - cytosolic DNA-directed
FT                   RNA polymerase (sensu Bacteria); GO_function: GO:0003899 -
FT                   DNA-directed RNA polymerase activity; GO_process:
FT                   GO:0006350 - transcription"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46201"
FT                   /db_xref="GOA:A4IW99"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IW99"
FT                   /protein_id="ABO46201.1"
FT                   /translation="MSYSYAEKKRIRKEFGVLPHILDVPYLLSIQTESYKKFLTADAAK
FT                   GRLHSGLEIVLKQSFPVESKNGQYELHYVDYQIGEPTFDETECQVRGATYDAPLNVKLR
FT                   LVVYNKDALPNEKIVEDIREEYVYMGDIPLMTTNGTFIINGTERVVVSQLHRSPGVFFS
FT                   KDDSEEGAFSARIIPYRGSWLDFEFDSKGIIWARIDRKRKFCATVILKALGYTQEQILE
FT                   NFSESKTITFNSKGFALRLDNLSNMKGELLKFDIVDAQDNVIVKKNKKLTSRDVKKIKD
FT                   AGVDSVAIDFDLVSTLRVAKDIVNEATGEVIAYANDDVTESLLESCVEVGMLELEVIDF
FT                   ITTERGRYISDTLKYDLTRNTDEALVEIYKVLRPGDPPAAASVKALFEGLFFIESRYSL
FT                   SDIGRMKLNARLGSDKVSKDIYTLENSDIVGVIEELINIRDGKGKVDDIDHLGNRRVRS
FT                   VGEMVENQFRIGLYRVEKGIRESMSLVHKDKLMPKDIVNSKPITAAIKEFFTSGALSQF
FT                   MDQDNPLSEVTHKRRISALGPGGLSRDRAGFEVRDVHATHYGRLCPIETPEGPNIGLIN
FT                   SLASYARVNDYGFLEAPYRKVVDGKVTDEIEYLSAIDEDNYVIAQASTKLDENNHFVED
FT                   LIQCRSGGEAIFTESSRVQYMDVSAKQMVSAAAALIPFLEHDDANRVLMGANMQRQAVP
FT                   TLKSEKPLVGTGMEKIVARDSGNCIIARNAGEVAEVDSNRIVIKVDTEKSQTSNLVDIY
FT                   SLTKFKRSNKNTCINQRPIVNVGDKVEAGDILADGFATDFGELSLGHNLMVAFMPWNGY
FT                   NFEDSILLSERIVKDDKYTSIHIEEFTCVARDTKLGPEEITADIPNVSESSLAKLDESG
FT                   IVHIGANVEAGDILVAKITPKAEQQLTPEERLLRAIFNEKASNVADSSLRMPSGTSGTV
FT                   INVQVFENDKGGKSKRALKIEKELIDKARKDFDEEFAVIESVVKSSIEQEVVGAKIQKA
FT                   KGLKKGAILTKEFLATLPFSKWLEISFEDEKLEEKVQNAREYYEEAKIAIDAKFEAKKK
FT                   SITQSNELSPGVLKTVKVFVAIKKRIQPGDKMAGRHGNKGVVSRVLPVEDMPYMEDGTP
FT                   VDVCLNPLGIPSRMNIGQILEAHLGLASYGLGKKIEKTLEKTRKAAELRKTLEEVYNSV
FT                   GDKKVNLEALNDEEILTLCDNLKGGVPIATPVFDGAKEEDIKSLLKIGGFATNGQMKLF
FT                   DGRTGKPFDRHVTVGYMYMLKLDHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGE
FT                   MEVWALQAYGAAYTLREMLTVKSDDIAGRSKMYKNIVDGKLTMNVDVPESFNVLRNEVR
FT                   ALGIDMDFDYSSEEE"
FT   gene            243512..247765
FT                   /gene="rpoC"
FT                   /locus_tag="FTW_0235"
FT   CDS_pept        243512..247765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="FTW_0235"
FT                   /product="DNA-directed RNA polymerase, beta prime subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="GO_component: GO:0000345 - cytosolic DNA-directed
FT                   RNA polymerase (sensu Bacteria); GO_function: GO:0003899 -
FT                   DNA-directed RNA polymerase activity; GO_process:
FT                   GO:0006350 - transcription"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46202"
FT                   /db_xref="GOA:A4IWA0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWA0"
FT                   /protein_id="ABO46202.1"
FT                   /translation="MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYR
FT                   TFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVVCERCGVEVEQAKVRRERMGHID
FT                   LVCPVVHIWYLKSLPSRIGLFLDMPLKNVEKVLYFESYIVTDPGMTPLEKKQLLTDEEY
FT                   AEALENYGYEFEASMGAEAIRDLLADTDIESEIELLQAECEESKSTAKKEKAIKRLRLL
FT                   ETFQASGNKPEWMVMTVLPVLPPDLRPLVPIEGGRFATSDLNDLYRRVINRNNRLKKLL
FT                   DLNAPDIIVRNEKRMLQEAVDALLDNGRRGRAVTGSNKRPLKSLADMIKGKQGRFRQNL
FT                   LGKRVDYSGRSVITVGPSLRLHECGLPKKMALELFKPFVYSKLRLGGHATTIKQAKRMV
FT                   ELEEAVVWDILETVINEHPVLLNRAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNAD
FT                   FDGDQMAVHVPLTVESQLEARVLMMSTNNILSPASGQPIITPTQDIVLGLYYITREKEG
FT                   ARGEGKLFSSYEDVSRAYNSGTIDIHAKIKLRIDRQVFDTKGNTYNEKGVVNTTVGRAL
FT                   LLNILPEGLSFSLLNKVLVKKEISKIINQAFRVLGGKATVVLADKLMYAGFKYSTLSGV
FT                   SVGVDDMTIPDNKEAKIEEAEKEIKQITEQYQSSLITENERYNNIINIWSKTSDEVGAS
FT                   MMDAISKDTVSINGEKKEIESFNSVYMMAKSGARGSYNQMRQLAGMRGLMAKPDGTMIE
FT                   TAITANFREGLSVLQYFTSTHGARKGLADTALKTANAGYLTRRLVDVAQDLVVIEEDCG
FT                   TDDGLMFSAIVEDGEVKVPLVERALGRTLAADVVTEKGVVLLEAGTLLDENLVELLDDN
FT                   GIDMIKVRSPITCKTRRGLCAKCYGRDLARERQVNVGESVGVIAAQSIGEPGTQLTMRT
FT                   FHTGGAASLGITVSDIKVKTAGKIKFKNIRTVTNKEGQEIVISRAGEIIVSDTMGRVRE
FT                   QHKIPMGAVVPLASGKAVEIGDVIATWDPHAQPLITDVAGKVVLEDVIDGITSKHTYDD
FT                   LTGQQTIEITSISQRTTSKNLKPVVKIVDEKGAELKSIPLAVGAVLNVADDSILEVGDI
FT                   VAKIPLEGSKNKDITGGLPRVAELFEARRPKDAAILSPCDGMVRLGNRDTKEKQRIEII
FT                   DKNGHIVEEILLPKSRHLVVFDGEQVSRGDVLADGPTDPHDLLKYKGLEEFADYILIEA
FT                   QSVYRMQGVVINDKHIETIVRQMLRKAVILDEGDSKFVKDESIELVRILEENDKLRKQG
FT                   KKEVEYELVLMGITRSSLSTESFLSAASFQETTRVLTEASINSQIDNLRGLKENVLIGR
FT                   LIPTGTGLAVRKESAKIEKMREELGVEDNMVFTDLSSFNPEEISFDSIQSQKEDKDINE
FT                   DIEESLRNALESLDF"
FT   gene            247868..248104
FT                   /locus_tag="FTW_0236"
FT   CDS_pept        247868..248104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46203"
FT                   /protein_id="ABO46203.1"
FT                   /translation="MFDMLAKLFWQIFFGILIILIVILSILNTDKVSFDYIFGTTTLPL
FT                   IVLMSIAFVLGLLLGSFITKFIQITKTSGGAKK"
FT   gene            248104..249114
FT                   /locus_tag="FTW_0237"
FT   CDS_pept        248104..249114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0237"
FT                   /product="putaive metalloendopeptidase , glycoprotease
FT                   family"
FT                   /EC_number="3.4.24.-"
FT                   /note="GO_function: GO:0008233 - peptidase activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46204"
FT                   /db_xref="GOA:A4IWA2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWA2"
FT                   /protein_id="ABO46204.1"
FT                   /translation="MIVLGIESSCDETGLAIYDYSKKKLIADELYSQVKLHKKYGGVVP
FT                   ELASRKHIAKLNLLAKKIFKETGLSFEDIDCIAYTAMPGLVGALMVGATFAKTLGLIHN
FT                   IDTIAVHHLEGHLLSPLLDHNSNIEYPFVALLVSGGHTQLFEVKEFGEYSLLGESIDDA
FT                   AGEAFDKTTKLLGMGYPGGVEVANLADQATDKSKYILPRPMKNKPNLDFSFSGLKTAVL
FT                   NTWYDEQDQSLENKANLCYAFQDAAIDVLVSKCAKALQKTKNTRLVISGGVSANKLLRH
FT                   QLDLLAKNRGYQIFFPPMKYCTDNGAMIALAGAYRYVNGFKDSNLEINVKARSPL"
FT   gene            249228..250394
FT                   /locus_tag="FTW_0238"
FT   CDS_pept        249228..250394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0238"
FT                   /product="fatty acid desaturase"
FT                   /EC_number="1.14.19.-"
FT                   /note="GO_function: GO:0004768 - stearoyl-CoA 9-desaturase
FT                   activity; GO_process: GO:0006633 - fatty acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46205"
FT                   /protein_id="ABO46205.1"
FT                   /translation="MNNNEIIHQTIEKQGSIVWKSVFGLLLLPLVALIAIPWYAMTYGF
FT                   STSDYVCLVVFYMLTGVGITMGYHRLWSHKTYKANKIVSYALLLFGTAALQNSVIQWSS
FT                   DHRKHHKDVDDPIKDPYAATRGFWFSHFGWLLRHSSPDVQEIRGVNDLLKDKALVFQHN
FT                   HYTVLAILSCFGLPALLGFIFGFLSGHTLTAAWHSALGFLLLGGLLRVILVHHATFCIN
FT                   SLAHTIGKRPYSTKNTARDSWITAIVTGGEGYHNYHHAFAGDYRNGIRWFDLDPSKWFI
FT                   AGLAKIGWCYDLKTTPKHLIEIAKAKVKLEEALTKKNKTFHLGIEEKYAKLVANVKNMY
FT                   NAKQEYLKAKKDNVLSKADIKEIKSKYKDLKIEFIQAKKKYNKASTIA"
FT   gene            complement(250606..251766)
FT                   /gene="metK"
FT                   /locus_tag="FTW_0239"
FT   CDS_pept        complement(250606..251766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="FTW_0239"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="GO_function: GO:0004478 - methionine
FT                   adenosyltransferase activity; GO_process: GO:0006556 -
FT                   S-adenosylmethionine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46206"
FT                   /db_xref="GOA:A4IWA4"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWA4"
FT                   /protein_id="ABO46206.1"
FT                   /translation="MSKNYLFTSESVSEGHPDKLADQISDAILDEILKQDKNARVACET
FT                   LVKTGMALVAGEITTSAWVDIKELVRNVITETGYDNASKGIDGRTCSVINAIDKQSRDI
FT                   TQGVDRGSLEDLGAGDQGLMFGFATNETPTLMPSAIYYSHLLMRKQAELRKSGKLAWLR
FT                   PDAKAQVTLAYENDKPKFIDTIVLSTQHNESISQKELHDAVIEEIVKKVIPNELITKDT
FT                   KYHINPTGVFLIGGPQGDCGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSGAYMGR
FT                   YIAKNIVAAGLADKCEVQVAYAIGVAKPVSLMVNTFGTGKITDNQIEKLVAEVFDLRVG
FT                   KIIENLDLLRPIYRKTSNYGHFGRELPEFTWEKIDKADILKSAARI"
FT   gene            252060..252308
FT                   /gene="rpsP"
FT                   /locus_tag="FTW_0240"
FT   CDS_pept        252060..252308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="FTW_0240"
FT                   /product="ribosomal protein S16"
FT                   /note="GO_component: GO:0009283 - cytosolic small ribosomal
FT                   subunit (sensu Bacteria); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46207"
FT                   /db_xref="GOA:A4IWA5"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWA5"
FT                   /protein_id="ABO46207.1"
FT                   /translation="MVVIRMARGGAKKRPFYRIVVADKRSPRDGRFIEKLGFFNPLAKG
FT                   GEERLKLDVAKAEAWLAKGAQPSDRVASLIKEAKKAA"
FT   gene            252351..252860
FT                   /gene="rimM"
FT                   /locus_tag="FTW_0241"
FT   CDS_pept        252351..252860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="FTW_0241"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="GO_function: GO:0003723 - RNA binding; GO_process:
FT                   GO:0006364 - rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46208"
FT                   /db_xref="GOA:A4IWA6"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWA6"
FT                   /protein_id="ABO46208.1"
FT                   /translation="MSQDFVEIAKIGATYKLNGELNLYSLANSIETLLSYGDWYIQLPA
FT                   TNVWQQLKGESVLKRADKVYIKLANINNADTAKKYVNALIGVPKRALPQLAEDEVYFKD
FT                   LIGCSVKNINNDSFGVVVDIIETGANEVLVCKEDNSEYLIPYVKQYIVSEDLNSKKIVV
FT                   DWEYDY"
FT   gene            253263..254021
FT                   /gene="trmD"
FT                   /locus_tag="FTW_0242"
FT   CDS_pept        253263..254021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="FTW_0242"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="GO_function: GO:0009019 - tRNA
FT                   (guanine-N1-)-methyltransferase activity; GO_process:
FT                   GO:0030488 - tRNA methylation; GO_process: GO:0006400 -
FT                   tRNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46209"
FT                   /db_xref="GOA:A4IWA7"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWA7"
FT                   /protein_id="ABO46209.1"
FT                   /translation="MKFGIISIFPEMFKAINDFGVTARAIKDSKVSISCFNPRDYTTDR
FT                   HATVDDTSFGGGAGMVMKYQPLSAAIEDAKNTLGCGTKVVYLSPQGSIFNHRKAQELLQ
FT                   NDSLILLCGRYEGVDERLIQDYVDEEISVGDFVLSGGELPAMLVMDSLIRLLPEVLGNK
FT                   ESVVEDSFYDGLLDYPHYTKPAVLPNGNAVPDVLLSGNHKEIAKWRRKQKLIRTYERRK
FT                   DLIECLCLSAKDKQILDDYKIDKVSTKGEE"
FT   gene            254021..254368
FT                   /gene="rplS"
FT                   /locus_tag="FTW_0243"
FT   CDS_pept        254021..254368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="FTW_0243"
FT                   /product="ribosomal protein L19"
FT                   /note="GO_component: GO:0009282 - cytosolic large ribosomal
FT                   subunit (sensu Bacteria); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46210"
FT                   /db_xref="GOA:A4IWA8"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWA8"
FT                   /protein_id="ABO46210.1"
FT                   /translation="MKNKFVELVEKSQLRTDLPEFNPGDSITVNLWIKEGDKQRIQAFK
FT                   GFVLRKRNRGLHSAFTVRKMSSGVGVERTFQTHSPLIDSIIVEKRADVRRAKLYYMRGL
FT                   TGKAARIKEKV"
FT   gene            254534..255412
FT                   /gene="xerD"
FT                   /locus_tag="FTW_0244"
FT   CDS_pept        254534..255412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="FTW_0244"
FT                   /product="tyrosine recombinase/integrase XerD"
FT                   /note="GO_function: GO:0009009 - site-specific recombinase
FT                   activity; GO_function: GO:0003690 - double-stranded DNA
FT                   binding; GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0015074 - DNA integration; GO_process: GO:0006310 - DNA
FT                   recombination"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46211"
FT                   /protein_id="ABO46211.1"
FT                   /translation="MSSAVDAFLDNLWLEHGLSQNTISSYRTDLKFLQNYFAKTDLISL
FT                   DFEQLYAFISYRSKNGYSSHSNARMISTLRKFYAWLISTGQTNNNPTAKLTLPKLAKKL
FT                   PKDMTETDVERLLQAPDMTEDVGIRDKAMLELMYATGLRVSELVGLNIDDIDINIGVIQ
FT                   VMGKGSKERIVPIGEYALEYLQKYFAEARRSLSKNFKEKAVFISKHAKRITRQSFWHRI
FT                   KNYALIAGINTDISPHTLRHAFATHLLNHGADLRSVQLLLGHSNVSTTTIYTHISQNRL
FT                   QEIYQKHHPRG"
FT   gene            255535..256380
FT                   /locus_tag="FTW_0245"
FT   CDS_pept        255535..256380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0245"
FT                   /product="oxidoreductase, iron/ascorbate family protein"
FT                   /EC_number="1.-.-.-"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46212"
FT                   /protein_id="ABO46212.1"
FT                   /translation="MNILSVDYYSDDAAELFTRSLKETGFAVLRTHPIDWNLIQTVYKE
FT                   WQEFLKSGAADKYIFDVENQDGYFPIDVSEVAKGETVKDIKHFYHLYFPNGRYPTEVSS
FT                   AAREMFEKMIRLGETLLQWIDDYMDPAVASKLPQRLRDTASYENTLLRILHYPAIQGDE
FT                   EPGAVRAAAHEDINLITLLPIASSPGLQVLSPFNNQWYDVPCDSESIIVNIGDMLQEMT
FT                   NGEYIATKHRVVKPQDEKENLDRISTPCFIHPKSDVYLSDKYPRAEIFLNERLKELGLK
FT                   "
FT   gene            256385..256969
FT                   /locus_tag="FTW_0246"
FT   CDS_pept        256385..256969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0246"
FT                   /product="acid phosphatase, HAD family protein"
FT                   /EC_number="3.1.3.-"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46213"
FT                   /protein_id="ABO46213.1"
FT                   /translation="MTQQQVISYYESTAHENEVELILARAKKIIQAQQSLQGNAIVLDI
FT                   DETALNHYYSLKLAGFPQGENHTIWNELLSRTDAYPIKATLDFYLYCLTSGLKVFFISA
FT                   RFAQYLESTKQALRNAGYVNFEDVFVFPENIEQYNSKDFKNFKAERRAYIESLGYKILI
FT                   SIGDQSSDLLGGYTLYTLQLPNYLYGENSRF"
FT   gene            complement(256966..257850)
FT                   /locus_tag="FTW_0247"
FT   CDS_pept        complement(256966..257850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0247"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46214"
FT                   /protein_id="ABO46214.1"
FT                   /translation="MNFKKRAFVFGSLSGIFWGLDYTLAGQVHTLLTMTFLVSMWLTSI
FT                   HDLGVAATIAAISTSSVKRIKDLKLWQIINICCIPLLGGFAMTMYMLSTRDIATGTAII
FT                   ISSCYPAVGMIGARIFLRESLTTFKIVGFIIVIIGITLTATNQLYDKSNSFVGLSFAIL
FT                   AAIFWGLEGVIYKMLLNANIAINTLLFLRKISTIIIFLPFTWAIIHSVNISILPLTLAI
FT                   GIIGYIADLSYMKAFKHSNVTLAMSLNITYIIWGPLFALLLFDQNINITITISCAILIF
FT                   LGNFLIFKSKSVY"
FT   gene            complement(257968..259489)
FT                   /locus_tag="FTW_0249"
FT                   /note="hypothetical membrane protein"
FT   misc_feature    complement(257968..259489)
FT                   /locus_tag="FTW_0249"
FT                   /note="contains frameshift"
FT   gene            259652..260119
FT                   /locus_tag="FTW_0251"
FT   CDS_pept        259652..260119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0251"
FT                   /product="hydrolase, NUDIX family"
FT                   /EC_number="3.6.1.-"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46215"
FT                   /db_xref="GOA:A4IWB3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWB3"
FT                   /protein_id="ABO46215.1"
FT                   /translation="MIDKSGYRANVAIVLLNKQNRVFWGQRRNRTSWQFPQGGVATGET
FT                   PLQAMYRELHEEIGLRPQDVEVIASTRDWYKYDIPDSLVRTKEPICIGQKQKWFLLKLK
FT                   SPESYIDLDANDSPEFDNWRWVSYWYPINHVVYFKQEVYRKALTYFKEYIA"
FT   gene            complement(260129..260755)
FT                   /locus_tag="FTW_0252"
FT   CDS_pept        complement(260129..260755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0252"
FT                   /product="phosphatidic acid phosphatase (PAP2) family
FT                   protein, membrane associated"
FT                   /EC_number="3.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46216"
FT                   /protein_id="ABO46216.1"
FT                   /translation="MNYFDHKLAKTTAIYGFLTLIIAILSYNFLDIKFATLVHSSELFG
FT                   TGISTIAAFTSNIFSPKVWTVITAIATVICIYKHIVKKPSQKLYIMSLSLIMTIIITTI
FT                   VKVILARYRPEMLLFDNHYGFHFFSFKKAYNSMPSGHTALTFAGLLAIANFFEKKYITL
FT                   IAIIISGLVAVSRIIILDHFISDVIVAAYIGIFTYLWSKAFVESK"
FT   gene            260829..261353
FT                   /gene="ampD"
FT                   /locus_tag="FTW_0253"
FT   CDS_pept        260829..261353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="FTW_0253"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine amidase"
FT                   /EC_number="3.5.-.-"
FT                   /note="GO_function: GO:0008745 - N-acetylmuramoyl-L-alanine
FT                   amidase activity; GO_process: GO:0009253 - peptidoglycan
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46217"
FT                   /protein_id="ABO46217.1"
FT                   /translation="MFNQGWYKKAKCIKSPNFNQRADKNDINLVVIHCISLPEGGYANC
FT                   NVEKFFTNQLDCSLHPSFASLKGVEVSAHFYIKRDGEIVQFVSVDDRAWHAGVSEFQGR
FT                   QGCNDFSVGIELQGTDKTAYTEQQYLSLNSLLKDLRKAYPTLLNITGHEDIAPQRKTDP
FT                   GKCFEWNKVIW"
FT   gene            complement(261401..263284)
FT                   /gene="parE"
FT                   /locus_tag="FTW_0254"
FT   CDS_pept        complement(261401..263284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="FTW_0254"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /EC_number="5.99.1.-"
FT                   /note="GO_component: GO:0009340 - DNA topoisomerase IV
FT                   complex; GO_component: GO:0009330 - DNA topoisomerase
FT                   complex (ATP-hydrolyzing); GO_function: GO:0003918 - DNA
FT                   topoisomerase (ATP-hydrolyzing) activity; GO_process:
FT                   GO:0006265 - DNA topological change; GO_process: GO:0006260
FT                   - DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46218"
FT                   /protein_id="ABO46218.1"
FT                   /translation="MQNYNAKSIEVLTGLDPVKKRPGMYTNTENPNHLIQEIIDNSVDE
FT                   VLAGFASKINITLYEDNSIEVADDGRGMPVDIHPEHKMSGIELIMTKLHSGGKFSNKNY
FT                   THSGGLHGVGVSVVNALSTRLEAEIKRDGNVYHIVFEDGFKTKDLEIIDNVGKKNTGTK
FT                   IRFWPNKKYFDDIKVNFKALKNLLEAKAILCKALTIKYSNEIKKEKLTWHFETGLKGYL
FT                   DHKIEAETLPAEPFMIDNFSNGDSYLDAVFCWCEDPSESIKNSYVNLIPTPQDGTHVTG
FT                   LKNGIYDAIKAYIEKNSLSVKNIKITANDSFAQLNYVISVKITNPQFAGQTKEKLSNKD
FT                   VTNFVATAVKDLLTIWLNQNPDEARQIVENISKVAQKRINADKKTTRKRIMNTTIRLPG
FT                   KLTDCISSDVNSTELFIVEGDSAGGSAKQARDKNFQAVLPLKGKILNSWELDADTIMNS
FT                   QEIHNIATAIGVDPDSDDISALRYNKICILADADSDGLHIATLLCAMFLKHFRKLIENG
FT                   HIYIAQPPLFRIDIGKSTFYALDENERDTILTKNSKLPGKVNIMRFKGLGEMNPAQLRE
FT                   SAMDVSSRRLLQLTISDVYDDTEMLDMLLAKKRAKDRRDWLENYGDRASVE"
FT   gene            complement(263374..264555)
FT                   /locus_tag="FTW_0255"
FT   CDS_pept        complement(263374..264555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0255"
FT                   /product="drug resistance transporter, Bcr/CflA family"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46219"
FT                   /protein_id="ABO46219.1"
FT                   /translation="MYKGIRPSIFILILMVSLGPFGDTIYAPALPELKTILGTDYPHVQ
FT                   LTITSYLLGYSISQLLYGPFSDRFGRKPVMLVGTCFFIISSIICIFSNHINTLIYARMI
FT                   QGFGAAAGGVIATVAVKDAFKVNEQGAVFAIMNIAFALAPAFGAVLGVFLSPTAIFWVL
FT                   LVAASILFIKVAIFFPETIREKNFEALTFKSFFKNYFLLFKDHQFFFATFVLGINISVI
FT                   YACLVTAPDIFVNILKLEKSNFLYLLTIMVTAVVLGSIVCSKLSRLIAYKHLVNFGMFC
FT                   TLISGVLCIYAFKKLTGLELSIALTAILSLTFIGVSFSVPLLTPIALENFTTTAGAASS
FT                   VMGFMQMGIASITTAIMSQISLGSEFTLSFAFVILPLIGLTIFLPYSCYFLKK"
FT   gene            complement(264555..265925)
FT                   /locus_tag="FTW_0256"
FT   CDS_pept        complement(264555..265925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0256"
FT                   /product="hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46220"
FT                   /protein_id="ABO46220.1"
FT                   /translation="MKKLLFITAPLLLSVLTASCSKSNVPPPTPLAEKPPRETFVKVIW
FT                   KRKTGNGNGGLANYNVAPAYANDTVFVPNQNGMAYALAITNGKIIWKNDTGTNLSVQPN
FT                   TIANAVIFGSIKGTLTAIDDKDGQTLWRTDAPSSIFSQPTIYDNSIYLQTHDGSVSAFD
FT                   ARNGSKEWSVANNIPEITLPSNSSPIILNNTVMIGNAFGAVLGFTIKSGDRTINIPIAI
FT                   SHGSSPADKMVDITANPMLYDHYLIFAAYQGAIVALDKDSGKMLWAKKASIINNMAINN
FT                   GVIFTTQDDSELKAYDIQTGDTVWTQDTLKWRKITAPIYYKGLIVVADYQGYLHFFNSL
FT                   NGEYLGRYKLTSKSDIFDYGISGQLVPTEKGIIIEADNGTTYLVDAYSNKVIYDSILSD
FT                   YQVDKGKSVARIYPLEQDKPTKATAPLATKTTQTTETKSKGINATIIIGDFSKGKPS"
FT   gene            complement(265928..266566)
FT                   /locus_tag="FTW_0257"
FT   CDS_pept        complement(265928..266566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46221"
FT                   /protein_id="ABO46221.1"
FT                   /translation="MKNLSKKQTQALYTIAGIIIVAIICAIFLQFYNSSNDKKMLEAST
FT                   IYQKALIANENPKSSVETKIAKFEQVVNDYPNTSFGIFASWQLADLYTTPTKPDSKNFN
FT                   VNITNLPKAIAILQQSIENNPKDSLSDISKVRLARLYIVAKQPDQAIKTLQGIKSFKDN
FT                   AYPLMLLGQAYSEKKDKVKAIESWQKALQDPNSSDQFKQIISQLINNTN"
FT   gene            266746..267990
FT                   /gene="hemA"
FT                   /locus_tag="FTW_0258"
FT   CDS_pept        266746..267990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="FTW_0258"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0008883 - glutamyl-tRNA reductase activity; GO_process:
FT                   GO:0006779 - porphyrin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46222"
FT                   /db_xref="GOA:A4IWC0"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWC0"
FT                   /protein_id="ABO46222.1"
FT                   /translation="MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAV
FT                   ILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPNYKIKDYFKLRQGTEVIMHLMKLAC
FT                   GLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGHCPVS
FT                   VAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKIT
FT                   SAFRNASAHYLSELPQLIKKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPK
FT                   LGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAIISNSAIKE
FT                   LFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSD
FT                   CLVCMKRMFGLNVEK"
FT   gene            267991..269076
FT                   /gene="prfA"
FT                   /locus_tag="FTW_0259"
FT   CDS_pept        267991..269076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="FTW_0259"
FT                   /product="peptide chain release factor 1"
FT                   /note="GO_function: GO:0004045 - aminoacyl-tRNA hydrolase
FT                   activity; GO_function: GO:0003747 - translation release
FT                   factor activity; GO_process: GO:0006415 - translational
FT                   termination"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46223"
FT                   /db_xref="GOA:A4IWC1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWC1"
FT                   /protein_id="ABO46223.1"
FT                   /translation="MKDSIKAKLQSLIERHEEVSALLSEAGIISDQNKFRDLSKEYSHL
FT                   EPIVKAFKEYTQALEDKQAAYEMLNEKDAELVEMAKEELKLANEAIEKLESELQIFLLP
FT                   RDPNDDANVFLEIRAGTGGDEASIFSGDLFKMYSKYAEQRGWKIEVISASEGEHGGYKE
FT                   IISRIYGDGVYSQLKFESGAHRVQRVPATESQGRIHTSACTVAVMPEADEVEGIDINPA
FT                   DIKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQDQRSQHKNRAAAMSMLKSKLL
FT                   QAEIDKQQKEQSDTRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDEVMEGSLD
FT                   SIIQPLVLEHQADLLATMSDE"
FT   gene            269069..269923
FT                   /gene="hemK"
FT                   /locus_tag="FTW_0260"
FT   CDS_pept        269069..269923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="FTW_0260"
FT                   /product="methyltransferase, hemK family"
FT                   /EC_number="2.1.1.-"
FT                   /note="GO_function: GO:0008168 - methyltransferase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46224"
FT                   /protein_id="ABO46224.1"
FT                   /translation="MSNITISQLLALSLAKFNQCDISTKHDLQMIICDVLGVDKTYLYI
FT                   NLDKQLDKNTLKKIDEKILRLLAGEPLAYILGYKYFWNQKLYVTKDTLIPRADTETVVA
FT                   TVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQVVAVDLYQQSLDVAKKNAQANN
FT                   ITNVKFIQSSWYTNLDTDKFDIIVSNPPYIDLADTNIDQSVKDYEPARALFAADNGLAD
FT                   IRIIISQAKDFLNLGGFIYIEHGFTQADAITALFSQCNFTDIKIVKDLNNNDRCTKAQL
FT                   GYL"
FT   gene            complement(269914..270225)
FT                   /locus_tag="FTW_0261"
FT                   /note="conserved hypothetical protein"
FT   misc_feature    complement(269914..270225)
FT                   /locus_tag="FTW_0261"
FT                   /note="disruption due to transposon insertion"
FT   gene            270407..271287
FT                   /locus_tag="FTW_0262"
FT   CDS_pept        join(270407..270736,270736..271287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0262"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46225"
FT                   /protein_id="ABO46225.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPNIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFSKILSD"
FT   gene            complement(271407..273041)
FT                   /gene="groL"
FT                   /locus_tag="FTW_0264"
FT   CDS_pept        complement(271407..273041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="FTW_0264"
FT                   /product="chaperonin GroL"
FT                   /note="GO_function: GO:0016887 - ATPase activity;
FT                   GO_function: GO:0005515 - protein binding; GO_process:
FT                   GO:0006457 - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46226"
FT                   /db_xref="GOA:A4IWC4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWC4"
FT                   /protein_id="ABO46226.1"
FT                   /translation="MAAKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFG
FT                   APTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGL
FT                   KAVAAGMNPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIA
FT                   DAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENPYILI
FT                   VDKKISNIRDLLPILEGVSKSGRALLIIAEDVESEALATLVVNNMRGVVKVCAVKAPGF
FT                   GDRRKAMLEDIATLTGATFVSEDLSMKLEETNMEHLGTASRVLVTKDNTTIIDGAGEKE
FT                   AIAKRINVIKANIAEANSDYDREKLQERLAKLSGGVAVIKVGAVTEAEMKEKKDRVDDA
FT                   LHATRAAVEEGIVAGGGVALIRAQKALDGLTGENDDQNHGIALLRKAIEAPLRQIVSNA
FT                   GGESSVVVNQVKANQGNYGYNAANDTYGDMVEMGILDPTKVTRSALQHAASIAGLMITT
FT                   EAMIGEIKEAAPAMPMGGGMGGMPGMI"
FT   gene            complement(273079..273366)
FT                   /gene="groS"
FT                   /locus_tag="FTW_0265"
FT   CDS_pept        complement(273079..273366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="FTW_0265"
FT                   /product="chaperonin GroS"
FT                   /note="GO_function: GO:0051087 - chaperone binding;
FT                   GO_function: GO:0030188 - chaperone regulator activity;
FT                   GO_process: GO:0006457 - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46227"
FT                   /db_xref="GOA:A4IWC5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWC5"
FT                   /protein_id="ABO46227.1"
FT                   /translation="MNIRPLQDRVLVRRAEEEKKSAGGIILTGSAQEKPSQGEVVAVGN
FT                   GKKLDNGTTLPMDVKVGDKVLFGKYSGSEVKVGDETLLMMREEDIMGIIA"
FT   gene            273617..274051
FT                   /locus_tag="FTW_0266"
FT   CDS_pept        273617..274051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0266"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46228"
FT                   /protein_id="ABO46228.1"
FT                   /translation="MNIKNMSFLARLIHTIGFEFFGIIIFTPFAMFILHQDVFHIASLA
FT                   IIISLIAMLWNFIYNYIFDIIEIKFGMHRSKRGIIIRALHALLFELGLLIATIPLVAYI
FT                   INMSFLSALLVDIGFVIFYLVYAFVYNYIFDRIYFEFIHK"
FT   gene            274062..274137
FT                   /locus_tag="FTW_2040"
FT   tRNA            274062..274137
FT                   /locus_tag="FTW_2040"
FT                   /product="tRNA-Arg"
FT   gene            complement(274479..274578)
FT                   /locus_tag="FTW_2077"
FT   misc_RNA        complement(274479..274578)
FT                   /locus_tag="FTW_2077"
FT                   /product="SRP_bact"
FT   gene            274692..275456
FT                   /locus_tag="FTW_0267"
FT   CDS_pept        274692..275456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46229"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWC7"
FT                   /protein_id="ABO46229.1"
FT                   /translation="MIIVISPAKSQNFEPIKTAYQFTQPIFKQQIIKLINILKHYEVEE
FT                   IEKLMKISPKLAEEVFAKHNSFNPNKYDNSNAKAAIFTFNGDVYKGLEADTLDNKTIEY
FT                   AQNHLLMLSGLYGLVRPLDLIQAYRLEMGTNIKIDGKILHKYWQDKITTQLNEYFSQQQ
FT                   NKILINLASNEYSQAIDKKSLAVKWLDIDFKENKAGAYKTIGIHAKKARGLMTRYILEN
FT                   RIENVSDIKKFNVAGYQFNPDFSDENLLCFTR"
FT   gene            complement(275503..276383)
FT                   /locus_tag="FTW_0268"
FT   CDS_pept        complement(join(275503..276054,276054..276383))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0268"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46230"
FT                   /protein_id="ABO46230.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVDCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPNIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFSKILSD"
FT   gene            276475..277643
FT                   /locus_tag="FTW_0270"
FT                   /note="restriction endonuclease HsdR family"
FT   misc_feature    276475..277643
FT                   /locus_tag="FTW_0270"
FT                   /note="contains frameshift"
FT   gene            complement(277794..277870)
FT                   /locus_tag="FTW_2055"
FT   tRNA            complement(277794..277870)
FT                   /locus_tag="FTW_2055"
FT                   /product="tRNA-Met"
FT   gene            277908..278027
FT                   /locus_tag="FTW_0272"
FT   CDS_pept        277908..278027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46231"
FT                   /protein_id="ABO46231.1"
FT                   /translation="MSILINIDVKKNITDVLLLAKYISFVVRYNSSVQRVYPI"
FT   gene            278047..278748
FT                   /locus_tag="FTW_0273"
FT   CDS_pept        278047..278748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0273"
FT                   /product="putative activator of osmoprotectant transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46232"
FT                   /protein_id="ABO46232.1"
FT                   /translation="MSEGRNKLNDFLLLQSLLGGSSKIEEKTSRMKQARDRNISKNKSI
FT                   PKPTVVKKVEERDTSFIRIPQYGHRINNKIVDELQNPQLEDNQEILVTVDIEKERQKEE
FT                   ARLFKWLCHRFPKCFDPINKKPLKIGISEEIEIIYQNENYAPVDKMVLRNVLRRYVGDT
FT                   RYHKAVFELKQRFNLQGQPVEDYAPEHVEYSKKRLDEIAEKAEFRAKGLSMKDYYEYKK
FT                   QQQQEKVDTEE"
FT   gene            278771..279316
FT                   /locus_tag="FTW_0274"
FT   CDS_pept        278771..279316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46233"
FT                   /protein_id="ABO46233.1"
FT                   /translation="MSLSLFRFILLYTVFKFFVMTMYSKKAKVFFSRKVIIVMLMTLLV
FT                   TSCATDKYQARELPLLKHGYSKKNLTAYNIFGFYCDNTPSGIFNIIDKKPTEFLVNIYV
FT                   GDNQGCKFIYAADTKGKQGEITQTGSFTAYLSGRNELLKLECKGKDSNIDYKVIAYANA
FT                   IEYDRVGNLSYLVESGGL"
FT   gene            complement(279331..280785)
FT                   /locus_tag="FTW_0275"
FT   CDS_pept        complement(279331..280785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0275"
FT                   /product="cation/potassium uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46234"
FT                   /protein_id="ABO46234.1"
FT                   /translation="MMLSQKPKIIGIFLMFLSLTMLSPLLVDYIYDEDNAYPFVLSFTV
FT                   TFLCGFLLWFISRKSNKKLSNRDGFLIVTLVWIFVTVFGAIPYMSFPGLNLSFTNAVFE
FT                   SVSGFTTTGGTVIEGLDKLPHSILFYRQQTEFFGGMGIIVLSVAILPLLGVGGMQLYKA
FT                   EVSGQWKDDKIAPKISSTAKALWMVYLLLTFLCFISYLLVGVEPFDAICYTFSTVSTGG
FT                   FAPSDASMTDKPLGMLIVCAIFLFLGATSFKAHYIALSKFKISHYFRNIEFKAYFYFLF
FT                   FTSFIVCITIIAHTNDLSNIFSIVTNSIFQVISISSSAGFVSDNNYYLWPSFLPIMLMF
FT                   IAIIGGCGGSTAGGLKMIRAILFKEKAILEAKRVIHPQGVFTVKLGDIHISEQALNRVS
FT                   GFISVYIIIFAGGWLALLGCGLDIPTAFSTIATTLSNVGPGLGDIGSNFKNLPKEALWI
FT                   CNFAMIAGRLEIFTILVLFMPDFWRK"
FT   gene            281349..281480
FT                   /locus_tag="FTW_0277"
FT   CDS_pept        281349..281480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46235"
FT                   /protein_id="ABO46235.1"
FT                   /translation="MKKCCKLLVIAGLLMLLNSCIWLAVAGIGAAGGATGAYMVEKK"
FT   gene            complement(281497..282114)
FT                   /gene="lolA"
FT                   /locus_tag="FTW_0278"
FT   CDS_pept        complement(281497..282114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolA"
FT                   /locus_tag="FTW_0278"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="GO_function: GO:0008320 - protein carrier activity;
FT                   GO_process: GO:0009306 - protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46236"
FT                   /db_xref="GOA:A4IWD4"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR018323"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWD4"
FT                   /protein_id="ABO46236.1"
FT                   /translation="MKKIIICFIFVFSINVSFADATSELIDKIKNIHSMTANFNQKLID
FT                   GQTNNNLNSKGNMSLKKPQYFKWITTSPNNQEIVSNGTKLWIYDGDLDQLIIKKVSNDI
FT                   AQFPYLILLSKNTNNINKLFTVTAQDNNSYILKPKNDQMIDSIKIKFTPNNQLEYLEIS
FT                   TSLNQFTKIEFNNVKTDVDISNTSFDFKAPQNTDIIDETKSA"
FT   gene            complement(282115..284616)
FT                   /locus_tag="FTW_0279"
FT   CDS_pept        complement(282115..284616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0279"
FT                   /product="putative cell division protein with DNA
FT                   segregation ATPase, FtsK/SpoIIIE domain"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46237"
FT                   /protein_id="ABO46237.1"
FT                   /translation="MTDNNINKTSHAVGRLKITLVVILTASIIYLFIALFSFNINDPGW
FT                   SSVSSETTIKNYAGPVGAYIASFILSIFGVIGFILPFLLIDFVRILLIKRKQQSLSYLL
FT                   FTVKTIGIIVFILSCCGLAELYLSFANYWVPQRSGGILGYESVKLTIKYLGSVGGNFAL
FT                   LIALLVGLTLYSGTTWIYLFKNLAIFVAKVFTYITKSKTNDNKNIPDINGFENFESKNN
FT                   LTSPLNRDNKVVSSIFEDNQQTHKKDIFREVLDNTKVTNELSFRDPKTESPQNSDLEIV
FT                   SDSDSILDLDVLDEDIDLDSELSSQSDNESKPAMTKEQLKGITTVSSPISSSASKALNK
FT                   KMLPSLDLLIEPEAKQTVISQAQLDETSSLLEQTLNDFNINAKVVAAYPGPVITRYEID
FT                   LARGTKVSKLTNIAQDLARALSTTAVRVVEVIPGKPYVGLELPNPTRQMVRIKEVLAAP
FT                   EFVKSKAPTLMGIGVDISGKPTFAELAKMPHLLVAGTTGSGKSVGVNAMILSMLYKCSP
FT                   DELKFIMIDPKMLELSIYDGIPHLLTPVVTDMTEAANSLRWCVKEMERRYALMSAAGVR
FT                   NIALLNDKIEQAEKVGRPLKDTMFIKMNPERAHEAPLLTKMPYIVVVADEFADMIMVVG
FT                   KKVEELIARLAQKARAAGIHIILATQRPSVDVVTGLIKANIPTRMSFQVSSRIDSRTIL
FT                   DQQGAEQLLGQGDMLYLKPGFGAPMRIHGAFVDDNEVHRVVEAWKEYGEPEYVQDILEA
FT                   AEESENGGSPSNSGDSEDPLYNEAVEIVIKTQKASISAVQRKLKIGYNRSARLMEEMEE
FT                   NGIVSEMNQNGMREVLIKRDS"
FT   gene            284738..285406
FT                   /locus_tag="FTW_0280"
FT   CDS_pept        284738..285406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0280"
FT                   /product="putative membrane associated lipid phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46238"
FT                   /protein_id="ABO46238.1"
FT                   /translation="MARFHIILGLVVCFFAWIFFLIFPNLDIQFAGHFYNSSAHQFIDG
FT                   YDGFLGFLHWFARFFPIFFSIIVILFLLGSLFIDKFKIKYRKAIFFIAVCLWIGPGLVV
FT                   NYVFKDHWGRPRPVMVKQFNGDKIFQPPFVISSQCDKNCSFVCGDASMGFWLFAFMPLL
FT                   ATRKKKLVAFIAAVVAGGGLGLMRMSQGGHFFSDVVFCGIFVYISTWVVYALMYRKKEY
FT                   "
FT   gene            285653..287107
FT                   /locus_tag="FTW_0281"
FT   CDS_pept        285653..287107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0281"
FT                   /product="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46239"
FT                   /protein_id="ABO46239.1"
FT                   /translation="MSQKLKRGLHTRHMSMIALGGCIGTGLFVALGGAIADAGPGGTVL
FT                   AYVIIAIMVYFLMASLGEMAAHSPVSGTFCEYATRYVDPALGFSTGWSYWFNWAITVAT
FT                   EVIAAALIMQYWFPGSSILLWSGFFFVLVFALNIFSVKIYGEVEYWLSFIKVSTVIIFI
FT                   IVGFLSILGLVGNHQSVGFQNWHIGDAPFHNGWWGFISVFMIAGFSFQGSELIGVTAGE
FT                   AKDPNTSIPKAIKQTFWRLFIFYILAVVIISFLIPYNNPSLIKAGASNDVSVSPFTIVF
FT                   ENVGLNSAATIMNVIILTAIISACNASMYSATRVLWHLGNIKQAPQFFATTNSKGTPMI
FT                   ALLVTAVIGSSFFFVSFVGSGYIFTWLVNVSSLAGFIAWFTIALSHYRFRRAYIKQGKS
FT                   LEDLPYVAKFFPWAPIIALTMVSIVIVGQGVTMLTMEGRTWFSVIIEFLSTYIGFFAFV
FT                   ILYFVYKFIKKTKLIRLEDCDLTRES"
FT   gene            287116..287754
FT                   /locus_tag="FTW_0282"
FT   CDS_pept        287116..287754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46240"
FT                   /protein_id="ABO46240.1"
FT                   /translation="MDTFFIQGQAGRIETAYDKVKGANKDIVAVICHPHPLYQGSMHNK
FT                   IVTTIVRAMKTFNIESYRFNYRGVGESQGQYGDGVGELEDLISVCDWIKHNSTAKKIIL
FT                   CGFSFGGAIAYKGLSSLDNIVSLITIAPAVDRFDLTKFSQPQDIPWLVVQGIDDDTVNP
FT                   NSVFDFTLKAIKSDLTLVKMNQVGHFFHGKLIELKTVIENFLTPIVDKL"
FT   gene            287774..288760
FT                   /gene="glpX"
FT                   /locus_tag="FTW_0283"
FT   CDS_pept        287774..288760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="FTW_0283"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /note="GO_function: GO:0042132 - fructose-bisphosphatase
FT                   activity; GO_process: GO:0006094 - gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46241"
FT                   /protein_id="ABO46241.1"
FT                   /translation="MNRKVALEAVRVTELAALASWSQMGRGDKIAADQAAVDAMRKALN
FT                   EVDIDGTVVIGEGELDEAPMLYIGEKVGAGGCEVDIALDPLEGTTITSKGGANALTVLA
FT                   MADKGGFLNAPDVYMQKIAVGGINAPKGIVDLDDSVTNNLKRIAEFKGVHMSALVVCTM
FT                   DRPRHEHIIKEARECGARVILINDGDVSGVIATATENSGIDVYIGTGGAPEGVLAAAAL
FT                   KCLGGQMQARLIFNDEEEIKRAHRLGITDLNKKYDIDDLASGDIVFAATGVTDGNMLQG
FT                   VKRVNSTRRGSYAVTHSVVMRSTTKTVRHITAEHSFDFKEGIEKFMS"
FT   gene            289067..290533
FT                   /gene="putP"
FT                   /locus_tag="FTW_0284"
FT   CDS_pept        289067..290533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putP"
FT                   /locus_tag="FTW_0284"
FT                   /product="sodium/proline symporter"
FT                   /note="GO_component: GO:0016020 - membrane; GO_component:
FT                   GO:0005887 - integral to plasma membrane; GO_function:
FT                   GO:0015370 - solute:sodium symporter activity; GO_function:
FT                   GO:0005298 - proline:sodium symporter activity; GO_process:
FT                   GO:0015824 - proline transport; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46242"
FT                   /protein_id="ABO46242.1"
FT                   /translation="MSQNSILWITFIIYIIIIFGIGIYSYFQTKKVSDYMLGGRSLNAP
FT                   IAALGAGASDMGSWLLLALPGAFMVSGINQIWLPLGLTIGAFINWGVIARRLRIYTEIA
FT                   RDSITIPAYFENRFHDSKGMLRSLTAIVVVIFFTIYIGAGFVSGGVLFSSMFGISYHQA
FT                   LLLTAAIIFIYTCVGGFLAISWIDFFQGSLMLLALVIVPIVVYFDIGSDNIGSVLSNID
FT                   IKGFYDITSGVPLITIISLLAWGLGYFGQPHIIVRFMAIKDPNKTSKAMFICMTWMILA
FT                   LLGAACVGILGAAYYKDGIANPESVFLKLSAVFFNPWMEGVLLAAVLSAVMSTSSAQLL
FT                   SLSSAFSVDVYAKFIRSKASHRELLNVSRLIVFLVTIAAIILSYNPDTTILNLVGFSWA
FT                   GLGSSFGAVVIFSLFWSRMNKIGAIAGILSGALAVLIWSMFEHLGGWFKVYAMVPGFAL
FT                   SSICIIVFSLLTSKPEETVQLEYQKYKQSL"
FT   gene            290604..292283
FT                   /locus_tag="FTW_0285"
FT   CDS_pept        290604..292283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0285"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46243"
FT                   /protein_id="ABO46243.1"
FT                   /translation="MKKTLVLILAMLVLYCLSLAGETFAGITMLLLLLCFVFYLFITSK
FT                   SRNFNLITSMYVVLSFAFVVCATQVLLSVDYSTHPFISMLILFVLLPTFFLLGYRIILS
FT                   IHCFIDSFLARDKIFVEEAPELECSIVITTRNEPLDVCKLTFDSAYSIDYPAKKLEIVV
FT                   VDNSDLSHKDFARWQQYVNQHNMLEGISCKFIHRNGTEGFKPRNLDIAMEHIRFDYVLF
FT                   LDADSTLPENALKVALPEFKQNSKLGFVSFLIESTNYSTNLVAKVASIFQNTIRYFNEF
FT                   VGKYGYCNYQGHNGIWSRKALEATSKWEEYYRSQVMVTEDIAAGFRCYEAGFTSKPVFL
FT                   KTGEWVPTSLKEFEKMWLRWSFGGMQVMHKYMSNIISSSNLYFRVKLDMLYLLFKVVAS
FT                   GFPIFALLLVLFPRSNPAFVSIVNVTLVPLLILSLWYYLYGDIKGSFLSKISQIYMAMF
FT                   MLSSFVFWCGIKAEINYYLNKPQGWKPTSKVFDKVDGWIRVIYDNIGKLSFSAFGLIVA
FT                   VYSICKFYPQPNFSMYLLCMLPSILLFLNTILCVMVLGRAKY"
FT   gene            292294..293601
FT                   /locus_tag="FTW_0286"
FT   CDS_pept        292294..293601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0286"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46244"
FT                   /protein_id="ABO46244.1"
FT                   /translation="MIGYNNIVYIAIAFGFVLLNAFFVIAEFSLVKLRSSQVELLRNKK
FT                   ALQGKVLYKVHNNIDIYLSACQFGITLASLGLGWIGEPAFSKLLEPLFIFLGVTANLSK
FT                   FIAFATGFALISFLHIVIGELMPKSMAIRQTERLSLLTCIPLYIFYWVMFPFIWILNAT
FT                   ANKLLELFKLDVVGEAEYGYTTDEIKVILKSSYLKKPLTEEHRDILLRMVEFAHLHAID
FT                   AMRPIKEMVSIDYDLTNREKLAVIKEFLYTRYPVYQKDKNNIIGVVHTKDILCALDTEL
FT                   MKQDLRPILKVSYHDRLIDVLNKFQQGRPHFALVYKKNQLIGFITLDNLLTILIGRISD
FT                   EFHLVKKPWITLANNKFLIKADAPVYAIERLADIDLSEYPADTVLDLLQTVLAEKISTN
FT                   TMWEHDKFILKAYRVDEDGLKDVILELKSLDQIKFN"
FT   gene            293672..294019
FT                   /locus_tag="FTW_0287"
FT   CDS_pept        293672..294019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46245"
FT                   /protein_id="ABO46245.1"
FT                   /translation="MKARFSSTSKQRGLSLVESLISSGLILFVLLSSFLVINSVITTSV
FT                   TVEKKFQLSQQLDKKIAQYILTGRFNDMAVGNSDFLQAKSSNSNLVKFVGIDRNFGIRV
FT                   SKEVIKYGTTF"
FT   gene            294003..294923
FT                   /locus_tag="FTW_0288"
FT   CDS_pept        294003..294923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0288"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46246"
FT                   /protein_id="ABO46246.1"
FT                   /translation="MAQRFNKISTNHFTRGFTLVELMVAVTISAIVMAINIYFSAKQNY
FT                   QKTKQGADQDIKALVTKKIFYDALINAGLSCKYGSKKQQYINKTAENQINANFIYNGSA
FT                   IRIGKISEITDLIQDSLGDNKGFLYQYDTNYIMVKSEKSFTSLASTPINLSLPLATSQQ
FT                   WHSGDYLALCNNDYVDIVKVASIDKNKRKVNLVVAPANEFDRGDYVGKFSIQIFYIAAT
FT                   HDPKDSQKIIYSLYMYNREGSANAVTYPLVDGVSDLNVSYALIDKDNLAWRDIATATDL
FT                   DDLKTKALKISFKIDDKYFEKIILL"
FT   gene            294929..296326
FT                   /locus_tag="FTW_0289"
FT   CDS_pept        294929..296326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46247"
FT                   /protein_id="ABO46247.1"
FT                   /translation="MKLKKSTKILGSSLVSVMIFSFVVLVTVSSLVYVVRFNLLGIKSL
FT                   NQQEAVITAEQQYIHNIFAKNSIKLGKNNIGDYDFGNVLKSSLAIFSNTNVDVSLYNAQ
FT                   PTAISNNIIHRLFYKGNLKLTKDIIYKDLPKHSMINYNSEFVPINIPYIDITRMNSSEQ
FT                   FYRLNQEQQISDNQHGFIGVIEKEYDWILISLNNGKTQVISLSGLNIAGDYKINIGWQL
FT                   SQGRWQLLLAIYDNQHLYIFKTALNDLINNFDKAILDLSTPIDIIDPPKDIVTLSWYYH
FT                   HDNSQPSLAVLTKRNDSAGNTSIIVEDIEYNSFNNNYKTSIKDAINGLGKLGDNNIYVE
FT                   ALDPSYTLAKSQLYVFVGDKLIVYNLANSNKNDTLIVPLQNIVKHKPIIVKKDFYEYYI
FT                   LTYSGDRYYQYKYTSNTNIISLANTVIYPEQKIENIVVRYGLKFIITNKNIYIDDFTNK
FT                   QLSEVAT"
FT   gene            296337..296957
FT                   /locus_tag="FTW_0290"
FT   CDS_pept        296337..296957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46248"
FT                   /protein_id="ABO46248.1"
FT                   /translation="MLKISAIFLVLIVSICNVYAANCQLIDAQNGSNGLVEFSCDQDVS
FT                   LDDNKVIFYIVGKDVEIDSIKVSRGDIDFTIDQVTKNVKRVSLNIVKKTILDFELDYIA
FT                   YRQQPVKLIIQAKKDSNLDYQILWGGVVKNSYTNTENNNNNFQFYITKSKLFVVKNGLE
FT                   CSIKGDCDANINILDRNDSPQATQLLQKLATYFDFGIVHQRLV"
FT   gene            297068..297205
FT                   /locus_tag="FTW_0291"
FT                   /note="hypothetical protein"
FT   misc_feature    297068..297205
FT                   /locus_tag="FTW_0291"
FT                   /note="contains frameshift"
FT   gene            297392..297712
FT                   /locus_tag="FTW_0292"
FT   CDS_pept        297392..297712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46249"
FT                   /protein_id="ABO46249.1"
FT                   /translation="MQRANEIYVNANATVIDDPAVLSDIEVARNTLLLPSTAKWSSNTG
FT                   VLLNLGNTQIVTAVPLDDPPLGSGAYITVAPFTNADITPAIRWQCTAFGFDSELLPSWC
FT                   VL"
FT   gene            297731..298651
FT                   /locus_tag="FTW_0293"
FT   CDS_pept        297731..298651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0293"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46250"
FT                   /protein_id="ABO46250.1"
FT                   /translation="MSLKLSQKKLAGLTIIELLISTAIAVMMLSALITTYIAVKSKYSE
FT                   YKDKTTTEAKELLVKNILYNFVKDVGFACKFGYSQQTYYDRTSDSLDSIFYSPAMIRVG
FT                   RLPLATSSHFPQSLEDGCSGDCYQTGTDYIMIKKEESHSSLTQINSSSTTLHLRSVDGL
FT                   AADDYLFLCNKNSINLVKASNVNSGSSIVSLSQSPQGGDYYPGDYVGKYSLEILYVRDT
FT                   GEQDSQGQDIYSLYVYIKDSGANGMSYELVRGVENLQVEYATVSNNVVTWNNVTTDIDI
FT                   NSTSHPALKISYSIAGQTFSKIISI"
FT   gene            298664..299512
FT                   /locus_tag="FTW_0294"
FT                   /note="hypothetical membrane protein"
FT   misc_feature    298664..299512
FT                   /locus_tag="FTW_0294"
FT                   /note="contains frameshifts"
FT   gene            complement(299828..300708)
FT                   /locus_tag="FTW_0295"
FT   CDS_pept        complement(join(299828..300379,300379..300708))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0295"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46251"
FT                   /protein_id="ABO46251.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFSKILSD"
FT   gene            complement(300838..301329)
FT                   /locus_tag="FTW_0297"
FT   CDS_pept        complement(300838..301329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0297"
FT                   /product="acetyltransferase, GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /note="GO_function: GO:0008080 - N-acetyltransferase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46252"
FT                   /protein_id="ABO46252.1"
FT                   /translation="MIRLERFTESNISDLLSELNRHDIRFLYQFGGINYQFPLDYLQIK
FT                   QTMDNKSNLLFNVLDDEDKSVGHCQIIRLDQANKKASIGRLLIYEEYRAKGLGKLMIKK
FT                   LLEFAKSIGLQNISLRVFDFNNSAIKCYETIGFEKTIEEYIDIPSLKEKWKIISMEIEI
FT                   "
FT   gene            complement(301343..302535)
FT                   /locus_tag="FTW_0298"
FT                   /note="putative drug transporter"
FT   misc_feature    complement(301343..302535)
FT                   /locus_tag="FTW_0298"
FT                   /note="contains frameshift"
FT   gene            complement(302591..303535)
FT                   /locus_tag="FTW_0300"
FT   CDS_pept        complement(302591..303535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0300"
FT                   /product="methyltransferase, HemK family"
FT                   /EC_number="2.1.1.-"
FT                   /note="GO_function: GO:0008168 - methyltransferase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46253"
FT                   /protein_id="ABO46253.1"
FT                   /translation="MYSQQKQQDIINNLHTIRDYIRWSISEMTANNVYFGHGSESIWDE
FT                   AVHLVLSAINVAHDIDSNMVGSRLLTEEKKIIIDYVYQRACLRKPLPYILKKAWFAGME
FT                   FDIDERVIIPRSPIAELIRNEFSPWINDIDDVTSVLDLCTGSGCIGIACSNVFEDANIT
FT                   LVDISDDALAVANHNIKKHQLSDRVRAIKSDLFDNLHGQKFDLIVSNPPYVDKQDLDTM
FT                   PHEYHYEPKLALEAGDDGLDLAKRIILEADKYMTENGVLIVEVGNSQYALMEMCPDIPF
FT                   TWLSFADGGDGVFLLTYDELVKYKDAFKKYFQK"
FT   gene            complement(303539..304933)
FT                   /gene="cysS"
FT                   /locus_tag="FTW_0301"
FT   CDS_pept        complement(303539..304933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="FTW_0301"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004817 - cysteine-tRNA ligase activity; GO_process:
FT                   GO:0006423 - cysteinyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46254"
FT                   /db_xref="GOA:A4IWF2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWF2"
FT                   /protein_id="ABO46254.1"
FT                   /translation="MDFCFMIFYNSLSGQKEQFKPIEANKIKMYACGVTVYDDCHIGHA
FT                   RTYIAFDVINRYFKYRGYDVTLVRNITDIDDKIIKRANENGESTTELVERNIKAMHDVF
FT                   ARLNILKPSKEPRATETIPEMVAMIETLIKKGYAYQGANGDVFYRVTKFADYGKLSKQN
FT                   LEALQQGSRVDVVEEKENPMDFVLWKMAKEGEPAWDSPWGAGRPGWHIECSAMSKKLLG
FT                   DTFDIHAGGSDLRFPHHENEIAQSEACNECTFANYWLHSGMVKVNAEKMSKSLNNFFTI
FT                   VEVLEEYHPEVVRYFLASTVYRSEINYSKENLENAKASVERLFNALRDIEPIEVNLPDD
FT                   ASEYEEKFIKAMDNDFNTPEALAVLFSLAKEINTLKTTNKYKASGYAYLLRKLCDVLGI
FT                   LFTDIEEYFKQGDGADASEIEKLIAERTQAKKDKNYARADEIRNQLQQQGIILEDSATG
FT                   TTWKKG"
FT   gene            complement(305001..305231)
FT                   /locus_tag="FTW_0302"
FT                   /note="hypothetical protein"
FT   misc_feature    complement(305001..305231)
FT                   /locus_tag="FTW_0302"
FT                   /note="disruption due to transposon"
FT   gene            complement(305309..306189)
FT                   /locus_tag="FTW_0303"
FT   CDS_pept        complement(join(305309..305860,305860..306189))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0303"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46255"
FT                   /protein_id="ABO46255.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFSKILSD"
FT   gene            306255..306419
FT                   /locus_tag="FTW_0305"
FT   CDS_pept        306255..306419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0305"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46256"
FT                   /protein_id="ABO46256.1"
FT                   /translation="MGILGILVAMIAGFVMPKNLISIDSLAYAGLYLCGFLFVCSLFTL
FT                   FVYWRNKKL"
FT   gene            complement(306433..306714)
FT                   /locus_tag="FTW_0306"
FT   CDS_pept        complement(306433..306714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0306"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46257"
FT                   /protein_id="ABO46257.1"
FT                   /translation="MNETTNQNPMVNFLKKFISFESFLTPSIIIFIFWLSIIGVCFSGL
FT                   TAIFSGYFIAGILEIILGAIFAKVFCEILIVLFKINDSLKEIAKNTRK"
FT   gene            complement(306727..308229)
FT                   /locus_tag="FTW_0307"
FT   CDS_pept        complement(306727..308229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0307"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46258"
FT                   /protein_id="ABO46258.1"
FT                   /translation="MEINTSQKMSLFSAILIGVTSMVGSGWLFSAQLTAKTAGNWAFLA
FT                   WVLAAIMIMMVGLCLAKVVSVFPVRGATTRSSALSHNSVFAMPFAFANWFGIVVMISTE
FT                   AQATTQYLAGIKGFEWLMHNGIISTYGMLLSLFILVIYLIINFYGVKLLASVNNGITVF
FT                   KMFVPAAIVIIFIIYAFTHSTEHHSLVSADIPNNNFTVGNALTAIVAGGLVYTFNGFQI
FT                   VVAYSSEIKNPSRNVPLAIILSLALVLLLYMGLQYAFMQAVPHEYLISKGGWAGLDFES
FT                   PLLQVATLIGLGYIAVLLIIDSIVSPSATGYSYLGASSRMLYAMSAEGQMPRYFAKINK
FT                   QVNISRRSLIANFLICAGFLIFSDNWVALMLIVTGFNIIGYMAAPISMGAIAPKTRIFG
FT                   MIVFVLLTMLLNTVEVETNIHLSIILVILMSIFGIFEYRRVGFRSLVILIMPFIIFVCI
FT                   ISPIDHTYFEGIIGAIFYLIVTDKRYVTYCKKTANQDNIVED"
FT   gene            complement(308595..309338)
FT                   /locus_tag="FTW_0309"
FT   CDS_pept        complement(308595..309338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46259"
FT                   /protein_id="ABO46259.1"
FT                   /translation="MQYNYFNYPNEKLPPYGSVVYFAYRKLNTDKQQIIYLLDQLKSQI
FT                   ISCTELYNNLEVANEKMNWWLKEVNNLANKKNISSPQLKKLAEIFDQEILYQKLIEDIS
FT                   LSIDNSSATERNFKQHFSKNFLGIETLKALYLNDFTAIDNNKIEQINANNEIIRHIFCI
FT                   PKHFYNQISFDNRISPTMSSQDFKDITTQWLGLYKKTTINKKLKPLEKINQIHYKMIKK
FT                   YIRNIDSPFKETLDFSPLNLLFYSI"
FT   gene            complement(309341..310036)
FT                   /gene="ubiG"
FT                   /locus_tag="FTW_0310"
FT   CDS_pept        complement(309341..310036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="FTW_0310"
FT                   /product="ubiquinone biosynthesis O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46260"
FT                   /protein_id="ABO46260.1"
FT                   /translation="MINIDNNEVDKFSRLADSWWNHNGELKTLHQVNPLRLEFIKKFTS
FT                   LDNKKIIDIGCGGGILSESLTTNNNDVYGLDASSEAINVAKQHAKQNKLKINYINSTIE
FT                   DFVTQGNLDFDIVTCMEMLEHVPEPESIIASIAKLIKKDGLFFASTLNRNLKSYLLSIV
FT                   AAEHILKMVPQGTHQYNKFIKPYELVKTTEKYGFVALEIIGVHYNPLTNSFKLASGADV
FT                   NYIIAFRKV"
FT   gene            310178..311278
FT                   /locus_tag="FTW_0311"
FT   CDS_pept        310178..311278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0311"
FT                   /product="putative VacJ like lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46261"
FT                   /protein_id="ABO46261.1"
FT                   /translation="MKLNAKSTLLLSLLGVTLSSCSSLKATKDNRDPFESYNRKMYAFN
FT                   DKAYETLTPAANSYEKVVPDTLKSGIFNIFQNLAEPARVANDMFQGEWDYAGDDGFRFL
FT                   TNTTLGLAGYFDVADSWFNKPMRYHQSFAVTLHKWGVYKDNEASPYVVWPLIGPGTLED
FT                   ITTGVDALFNPLTYIFFFAPVGSAISWGVSVGTTGAYYVNQGVSYLPSYSNLKEVSIDP
FT                   YIAMRNAYLQNYDYGMAKVLKQQLSKDDATIQTDQAVLGVLGLDSDNINAQIATTGGTK
FT                   VKSSEPPVIFKSNISTVNKASQVEEAFDQDYSNDSTALDLANVDNDDTTQSEASKLKTE
FT                   IRDAKADLPGDADSPASAVQTLAEQG"
FT   gene            complement(312393..314681)
FT                   /locus_tag="FTW_0313"
FT   CDS_pept        complement(312393..314681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0313"
FT                   /product="glycosyl hydrolase, family 18 protein"
FT                   /EC_number="3.-.-.-"
FT                   /note="GO_function: GO:0004553 - hydrolase activity,
FT                   hydrolyzing O-glycosyl compounds; GO_function: GO:0030246 -
FT                   carbohydrate binding; GO_process: GO:0000272 -
FT                   polysaccharide catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46262"
FT                   /protein_id="ABO46262.1"
FT                   /translation="MKKMKLISSVTCALMGMGTISIATATTIKSASSANSWNANTVYNS
FT                   GDQVSYNGKTYTAKWWTKGDIPRNSDVWSSPKEEGAEWNSSQAYSGGDTVTYQGNQYKA
FT                   KYWTRGDNPANSGQYGPWELVGSQNSKGIVAIILPSKPEFVTDSSLASIQVEKDGTVIA
FT                   EVKDAKWGSTTNLNIPFSGSSTNLTINVLPLNGAKGTASPSNFTLKNEGTQKVEIEYKQ
FT                   TEIGSIHIKTNADVATTTGYSLKNSAGETVANGFLDTNGDTIIDNLPSSQKGITYKLYV
FT                   DSFSKDGFTYTPKQIAPIIVHDFNTTDVEVNFTKETLPSEVLVVNVSGLPKDKSTTITF
FT                   TNSNGQSIKTQIKSDGTISKEIEKDGSTWNIAVTSVTGYKAIISPSSFTADQDTQNINI
FT                   SFEQLAPIESGKKVIGYWENWKPGLISNDYKGSAEDVAPYTHVIYSFLTLDGSPNPDVP
FT                   ANKNWSGAYLNESMAGTDVLKVMGNYENPWDNNSNWQRVRIDNLIKVTHENKGKFIWAI
FT                   GGWSDLQQTLKDDQVDAFVDQVVELLKLAGDGIDFDWEHMSQLANGSPNPNKDQQLAVL
FT                   AKTLKTLRDRLDAEGMQDKQIGYTTRFNAFFESSKAHGFASDYNSDGEGIAIQKWLRDH
FT                   DSSLEKTVNWVNIMAYDVSPQEMPKAQTWNMPLYKDMLSSFAKYVDPSLVVLGFEPGGQ
FT                   AGSGMWEGMEVDKQAIDYVTDNGFGGSMFWAINQPALGQGNSTYYPDTITGDNVNILAN
FT                   YTQEKYTSK"
FT   gene            315218..316210
FT                   /locus_tag="FTW_0314"
FT   CDS_pept        315218..316210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0314"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46263"
FT                   /protein_id="ABO46263.1"
FT                   /translation="MSRRITLKQLNVFVETAMNKSITIAAEKCYITQPSASKAILQLEE
FT                   ALQKVLFERGAGKEISLTYEGELLFVEAKSILDRVSELIKDKENITGKIVIGASVTICD
FT                   YVLPKILPQFQKLFPKINIRIERVLSDRIRYYVENAVCDIGLVEGRVISRELEQTLWKE
FT                   DRIEIICAKNHELAKKDKVSLEEVLVGQNWVLWHHDMGTRDIYIQTKGREKLTQSFGFG
FT                   AEDLGNGLLKFSEVAWDNQESITRASTNYISSSIVFDSAEAIKNYVANSNFLASLSKTM
FT                   LDNTLCNDIKILNVEGGYQTRDFYILKHKQRFFSQASDVFLDWISNYNL"
FT   gene            316430..317155
FT                   /locus_tag="FTW_0315"
FT   CDS_pept        316430..317155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46264"
FT                   /protein_id="ABO46264.1"
FT                   /translation="MKVKKLVKSIFIASCSMISLSTIPSISYAEVSDITEVNKQVINQN
FT                   STIITGKILPNDSYVIRDSNGNTILEGVSDSNGVFHKKVRGLDENDTLVLNYRGQSITA
FT                   DNDGFMAIFKYKPHILFASSPFDPPEYDDPSYWWGQAKNMQALFFQTTLGLFNIRQAYK
FT                   EALISGKGMSWYQATNFENITLGLLSVGQGFYDAYKSQQATKETLEKLSKDFNESYSKI
FT                   MKKLDWFVNNIDVEFSFNT"
FT   gene            317222..318679
FT                   /locus_tag="FTW_0316"
FT   CDS_pept        317222..318679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46265"
FT                   /protein_id="ABO46265.1"
FT                   /translation="MLNTILEGDEYNSFKSGYDGYKMPTPKELGQMSSDAKNEEIFRLM
FT                   SKLAKYEKASGIEDGIDATLDSFYEQQIKNQGGYIELQSSQLAVMIEAINNLNSLDDIT
FT                   KNKFAYKISQIDSEFDVNNYDSEAKMYNPAGKVCDGSISTLYIQAIERDNKFLDYMASV
FT                   YYLTIADNIVTQYPSSNINPSAVDTSLPIQDQRIRMAAYNMISAYYDQKQKIINIADST
FT                   LNNCQYFGDFNAPRIPGISYQTQISSHDYYDLYLVLDLQDDGGSSDIPAAAEIFNNKNL
FT                   RLQYFSEIQNKFLDTIFDNSLDSVIAIKYLDGNVNQIGVKLKLKKDTLVNAKELISSMS
FT                   KQNAYISYVSEGISLLFVHYPNFTGIAPDNVITQKIQQQLSDPNNYYIRIAETTFKEPT
FT                   DIYIENHILIYDTNSFNYMNYLMTNIGQDIRNIYISCHDHGKCYYPVTAELHYVDPNTN
FT                   SDQVIDKKEIVLGTGYKTPEEYALAII"
FT   gene            318743..321577
FT                   /locus_tag="FTW_0317"
FT   CDS_pept        318743..321577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46266"
FT                   /protein_id="ABO46266.1"
FT                   /translation="MRFLNQKGKKLIVTAALASLMFSPLYSFAYPSQATSDTQSQVQQV
FT                   ASTLVGGKIQPYMQYSIRNQNGYLVAQGETNAKGYFIEDVANVGIGDTLTLEYGIRRIS
FT                   QTINSRVVLFTESNNNTMLLQAPMLGGMDGGDAAFSIANIAIMAATGDYVFAVIGFVNL
FT                   LLGILGPDQQDIVMMFTEKSLQDLTEAVTAQIDTDNQNMLANFANAQKYRADKDFTDLK
FT                   GVSQKLSNYTTLLDNSVFMMDDFKGSPVGSKYKNAYQQLQQGGRPNIDYWGLYGDISDY
FT                   EDANGITAADKNSVRKVMVKYLANSFAYEDDFNFEDLLAQFRSLNKKLSVLQSELNLYK
FT                   PDIASILTDMGVTGTYNYDVCDGSVMSLTEGTVKLTKLNLDQLYMLKRISLAYNHASAK
FT                   QIANLDTEYANALAELRSLVAVSSSCRYFFNQDATAWGGVSYMTFLESRPGVAYKIKID
FT                   NLNRAEDFNGNIDNLVFDPEVRKQYLTPSQNAFFKRFLDDTDTGPAIYAPDQDDTNVRL
FT                   INEDAGGGNAVYLEGYFYVNHGTDLGREDIILRDDRKDPSIKYISYDGFFKGTIDVAIS
FT                   LPKGVNPSNYYIKSSSDGRAYQLSEVKDGVTHVTINVDASDKSVNKFDDEVSISLRDMD
FT                   NNQIDSKEIFISVPETAMDMMQSKFSFTEDLFAGHVEEVFIYPNKEFPVPFKDMKLYVY
FT                   GYKDGLRTGLRSSRPFEVFEERLESDFRAPYVYLSGGDVAFQELDAIVIPFDFKYMEQN
FT                   LKYDCSIGSAKCSHDEIWTMPYMNYSLAMPDYKVFDLKVTSSGGYIAQVVFNPGPQVDP
FT                   EQINITVNDEAGRNCSIKAYNNNQFVELGKGNTTVSYTPDSMVWSGKHMLVGYYCDQSF
FT                   DGIDGNVTFTVDVPSVGLKSITEMVKVPLSVFDLKVTSSGGNIAQVVFNPAPQGTPNPV
FT                   TISVNDEANRNCSI"
FT   gene            complement(321578..322458)
FT                   /locus_tag="FTW_0318"
FT   CDS_pept        complement(join(321578..322129,322129..322458))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0318"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46267"
FT                   /protein_id="ABO46267.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPNIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            322452..323372
FT                   /locus_tag="FTW_0320"
FT   CDS_pept        322452..323372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46268"
FT                   /protein_id="ABO46268.1"
FT                   /translation="MAFLLDIITFLQISFGLTIAPKFVIKNSDGKVVSEGNLNFTNPVH
FT                   IANLPASEDRVKYTLEVEGYIENGFKYTPSFTSTIVITNAEPTNVTIAFDKESLPVQVD
FT                   KVTFDISGLPEGKITILKLASSEGEFKEIKLDGNKTYTIEIPQDKSAYTIIASELDGYE
FT                   VLIAPSNVFVADKESESFSINYTQKFKPLFELGLVSYDTRPKYGKIMFVGKPNIEREEI
FT                   TVNVDDLGKNNCAVRVLNNDIWQVLGFGNHEFKFIPDKKVWNGGVTLVSYDCVYAPNLT
FT                   KDTIVRFDVTVNGVTKSISENVLAN"
FT   gene            complement(323652..323888)
FT                   /locus_tag="FTW_0321"
FT   CDS_pept        complement(323652..323888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0321"
FT                   /product="putative BolA like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46269"
FT                   /protein_id="ABO46269.1"
FT                   /translation="MTKEQLKDILENSLKNCSADVQSDDNVHFSATIIAEEFNDMPSKV
FT                   KRQQLVYSKINKYILSGELHAIAMKTIATNEVK"
FT   gene            complement(323905..324198)
FT                   /locus_tag="FTW_0322"
FT   CDS_pept        complement(323905..324198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46270"
FT                   /protein_id="ABO46270.1"
FT                   /translation="MITVTNHKWTIETELTLKTVANIYRNFRKNLKKIDKTWIIDFARC
FT                   DRIDSAGLSLIIEYIKYAQKNNIQIVFKNIDQKTLSLAKVHGAKTILEEYIN"
FT   gene            complement(324198..324860)
FT                   /locus_tag="FTW_0323"
FT   CDS_pept        complement(324198..324860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46271"
FT                   /protein_id="ABO46271.1"
FT                   /translation="MLRKISIFLSLIILMVSSAWAIENPVDMLNRTIVKTQDKLIKNAN
FT                   EYKQDPYKLLRLVDREIIPVVAPSVIAQLVVSTPKWKKATPAEQKQFIRSATEMLAFMY
FT                   AKNVAYAGKYKLTLFPFNKNDTSWKNKPIVIVNGKITNIDNDQNSDFAVKMFQKDGKWH
FT                   VYDFDVAGVSILRTYQQQFAPYPNVVEMTKAVEKVTTKIKEKTYPKLLDKNYNLQSV"
FT   gene            complement(324935..325468)
FT                   /locus_tag="FTW_0324"
FT   CDS_pept        complement(324935..325468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0324"
FT                   /product="hypothetical protein, mammalian cell entry (MCE)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46272"
FT                   /protein_id="ABO46272.1"
FT                   /translation="MRNKYFETSVGIFIIIGVLCLLFLTFKVSGTSFKAFNTQEYTITA
FT                   DFKSVGSLRTNASVKIAGVEIGRVTKIALEKSYNGFMAVVTMAINSDKKIPANYSASIA
FT                   MSGILGDNYVALSPPSEDIMAIAGIADANNSSEQDKYLHQGSVIQLENTQSAIDLGSLI
FT                   NTFVAGKDDDKSKE"
FT   gene            complement(325468..326232)
FT                   /locus_tag="FTW_0325"
FT   CDS_pept        complement(325468..326232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0325"
FT                   /product="ABC-type transporter involved in resistance to
FT                   organic solvents, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46273"
FT                   /protein_id="ABO46273.1"
FT                   /translation="MTIFSKVYTLTFSLIYSLVKSLSLILRIVISKLNIRDCIIQIKAV
FT                   GVNSIIIIVTSGVFIGLVLSLQGYYTLSKFGAHSLLGVMVALSVLRELGPVVTAMLFAG
FT                   RACSSITSEIGLMKATDQINSLKVMNVNPISFILSTRFWACMISGPILALIFASVAILA
FT                   GFILAEAALGISYGEFWSNIQSSVIASDISNGIIKSIVFAFITAWIALYQGYYCIPDSN
FT                   GIAKATTKTVVYCCMSVLGADLILTSIMFGGV"
FT   gene            complement(326236..327039)
FT                   /locus_tag="FTW_0326"
FT   CDS_pept        complement(326236..327039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0326"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="GO_component: GO:0009898 - internal side of plasma
FT                   membrane; GO_component: GO:0043192 - ATP-binding cassette
FT                   (ABC) transporter complex (sensu Bacteria and Archaea);
FT                   GO_function: GO:0042626 - ATPase activity, coupled to
FT                   transmembrane movement of substances; GO_function:
FT                   GO:0005524 - ATP binding; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46274"
FT                   /protein_id="ABO46274.1"
FT                   /translation="MCDISFKNVSFYRDSRCIYDDITFTIPTNKITTILGPSGAGKTTI
FT                   LQLIAGLIKPTLGKICIDNAIIEKNTKETQLEKLRHRMGFLFQSGALFTHLSVYDNIAF
FT                   PLRKNTNLDEKLIRNIVLLKLQAVGLAHTINMMPSELSGGMARRVALARSIAMDPDIMM
FT                   YDEPFTGQDPASFNKLLELISTLNESLNMTSIIVSHDIQESLSISDHIIIVGNKKIIAS
FT                   DSPENIKNSKDQQIQNFLAGKPLDYNYHNHNDLEKNFFKKEILGS"
FT   gene            complement(327053..327325)
FT                   /gene="minE"
FT                   /locus_tag="FTW_0327"
FT   CDS_pept        complement(327053..327325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="FTW_0327"
FT                   /product="cell division topological specificity factor
FT                   protein, MinE"
FT                   /note="GO_process: GO:0000910 - cytokinesis; GO_process:
FT                   GO:0000918 - selection of site for barrier septum
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46275"
FT                   /db_xref="GOA:A4IWH3"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWH3"
FT                   /protein_id="ABO46275.1"
FT                   /translation="MLAKLFGLSKKQQSASVAKERLQIIVAHQRSELHPRSSKISSHLL
FT                   AELKDEIIEVVKKYVALSEENIRDIDLKVEDSSKNSTIEVNIPFN"
FT   gene            complement(327328..328152)
FT                   /gene="minD"
FT                   /locus_tag="FTW_0328"
FT   CDS_pept        complement(327328..328152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="FTW_0328"
FT                   /product="septum site-determining protein MinD"
FT                   /note="GO_function: GO:0000166 - nucleotide binding;
FT                   GO_function: GO:0016887 - ATPase activity; GO_process:
FT                   GO:0000918 - selection of site for barrier septum
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46276"
FT                   /protein_id="ABO46276.1"
FT                   /translation="MSEKKQGKVFVVTSGKGGVGKTTSSAAVAYAFAKKGLKTVVIDFD
FT                   VGLRNLDLIMGCERRVVYDLINVVREEATINQAIIKDKRIDDLYIIPASQTRDKDALTE
FT                   EGVDRLIEELRNSFDIVLCDSPAGIEKGSLMAMRCADAAIIVTNPEVSSVRDSDRILGM
FT                   LSSKTLKAQREGEFKEIHLLLNRYDAARARAGAMLKAEDVSEILYTPIVGIIPESKDIL
FT                   EASNSGHPITHFSDSIAAKAYFDAVDRILGKDVPMRYTEQKTSFFKKLIGKS"
FT   gene            complement(328192..328878)
FT                   /gene="minC"
FT                   /locus_tag="FTW_0329"
FT   CDS_pept        complement(328192..328878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="FTW_0329"
FT                   /product="septum site-determining protein MinC"
FT                   /note="GO_function: GO:0004857 - enzyme inhibitor activity;
FT                   GO_process: GO:0000918 - selection of site for barrier
FT                   septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46277"
FT                   /protein_id="ABO46277.1"
FT                   /translation="MKQAFHFKGGNYTISAININVTEFTQIESLLNSKISQSKSFFHNT
FT                   PFAIDIRDIDEDEKCSVNFLEKVIATFKANGMIPVGFVVNNKELKTKLARAGHNILKGG
FT                   KSKEVNVDEDKSFTSAKIVTTPVRTGQSINARDCDVIVTANVNNGAEIIADGSIIVYGR
FT                   IGGRVIAGSSGNKDAKIICKDLRAELVSIAGKYVTLNNESIPVENTNTDGYIVYLQDDK
FT                   IHIEGF"
FT   gene            complement(328913..329068)
FT                   /gene="rpmG"
FT                   /locus_tag="FTW_0330"
FT   CDS_pept        complement(328913..329068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="FTW_0330"
FT                   /product="ribosomal protein L33"
FT                   /note="GO_component: GO:0009282 - cytosolic large ribosomal
FT                   subunit (sensu Bacteria); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46278"
FT                   /db_xref="GOA:A4IWH6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWH6"
FT                   /protein_id="ABO46278.1"
FT                   /translation="MREKIRLVSSAKTGHFYTTTKNKKEMPNKMEIKKYDPVVRKHVMY
FT                   KEAKIK"
FT   gene            complement(329095..329331)
FT                   /gene="rpmB"
FT                   /locus_tag="FTW_0331"
FT   CDS_pept        complement(329095..329331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="FTW_0331"
FT                   /product="ribosomal protein L28"
FT                   /note="GO_component: GO:0009282 - cytosolic large ribosomal
FT                   subunit (sensu Bacteria); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46279"
FT                   /db_xref="GOA:A4IWH7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWH7"
FT                   /protein_id="ABO46279.1"
FT                   /translation="MSKVCIVTGKRPATGNNVSHAQNKTKRRFLPNLHAHRFWVESENR
FT                   YIKLRVSSKGMRIIDKKGIDTVLSDLRAQGHKI"
FT   gene            complement(329465..329809)
FT                   /locus_tag="FTW_0332"
FT   CDS_pept        complement(329465..329809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0332"
FT                   /product="hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46280"
FT                   /protein_id="ABO46280.1"
FT                   /translation="MKKQLFAISITTALLVLSACGQTGPLYLPDEDKLNSGSTLAKSGS
FT                   SIMVKQNQQNNSTSTSDNQSDTSTKVDNDPTAPVRNNNPTTSELFEGENNFNYNNNIQN
FT                   SQNAGGTPTL"
FT   gene            329939..331978
FT                   /gene="recG"
FT                   /locus_tag="FTW_0333"
FT   CDS_pept        329939..331978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="FTW_0333"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="GO_function: GO:0015668 - Type III site-specific
FT                   deoxyribonuclease activity; GO_function: GO:0008026 -
FT                   ATP-dependent helicase activity; GO_function: GO:0003676 -
FT                   nucleic acid binding; GO_function: GO:0004386 - helicase
FT                   activity; GO_function: GO:0004003 - ATP-dependent DNA
FT                   helicase activity; GO_process: GO:0006139 - nucleobase,
FT                   nucleoside, nucleotide and nucleic acid metabolism;
FT                   GO_process: GO:0009307 - DNA restriction-modification
FT                   system; GO_process: GO:0006310 - DNA recombination;
FT                   GO_process: GO:0006268 - DNA unwinding during replication;
FT                   GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46281"
FT                   /protein_id="ABO46281.1"
FT                   /translation="MRFVDFNGVGEATIKALAKYNIHDPNDLLTIFPKDYKDTRVITPI
FT                   NHLVAGKRSLIQGRVTNLTYKKFGKKFLRFNINDNTGFCSVILFKFYPNQLAILEKSEY
FT                   VRCYGKVEFSLSPQMVHPEWATVNNGECALKQGFSAVYRLKKIPDRLISKMILKMLQDN
FT                   RVENIIPSQLLRRFNLISFCDALYYVHALTNFIDEKYLSIARFSIKFEEMLAYKLAEQN
FT                   IYKNTVKAQAPQLFLTKIQQNEFYEKLPYQLTNAQQRAITEILDDIKKSNAMNRLLQGD
FT                   VGAGKTIVATIAAYAAVKSGYQVAMMAPTEILAEQHFSFLSQYLASFDIKVIPLLGKLS
FT                   AKQTRESLDRIKDQKDCVVVGTHAIFQERVEYCNLGLVIVDEQHRFGVEQRLALVSKSS
FT                   SNFSDLTPHQLIISATPIPRTLAMTLYGNLKLSILDELPPKRKPIITTVLNRAKKQNLI
FT                   EKVKQAVLRGEQVYWVCPLVEESENMDFLQAVKTLYQELLEALGKENVGLVYGSMKSKD
FT                   KIEQMAAFKAKKYAVLVATTVIEVGVDVPNATIMIIDNAERLGISQLHQLRGRVGRGAK
FT                   ESYCILLYSDKISEVGKRRLSLVRESQDGFYLAEKDLEIRGAGDIIGKEQSGVSTFKTF
FT                   DINEYYDNYDKVVEFADMLDKHYPELVDKLIQRWFDRRVNYVEV"
FT   gene            331982..332179
FT                   /locus_tag="FTW_0334"
FT   CDS_pept        331982..332179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46282"
FT                   /protein_id="ABO46282.1"
FT                   /translation="MILLSVVSILIALLVTLGVAKILYNSSFRKNKLNSTKELLINATI
FT                   VTFIFFCVCSLIYVFLLNIV"
FT   gene            332733..334247
FT                   /gene="fumA"
FT                   /locus_tag="FTW_0335"
FT   CDS_pept        332733..334247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumA"
FT                   /locus_tag="FTW_0335"
FT                   /product="fumerate hydratase"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46283"
FT                   /protein_id="ABO46283.1"
FT                   /translation="MAVIKAEDLVNSVAEALQYISYYHPKDFIDAMYEAYQREESKPAK
FT                   DAMVQILINSRMSAIGKRPICQDTGMVCAFVKVGMDAKLDKTDRTITELINEGVRRGYN
FT                   DPHNPLRASMVFPPHGSRKNTKDNTPAIVHIDLVHGDKIEVDIAAKGGGSEFKSKFKVL
FT                   NPSDSIIDWVEEMLPTMGAGWCPPGIIGIGIGGTAEKAILLAKESLSEEINIQDIIKNG
FT                   PQNETEQLRLDIYNRVNALGIGAQGLGGLTTVLDVKINEYPTHAACKPVALIPNCAATR
FT                   HVHFVLDGSGAVDLPAPKIEDWPVIEQAQNDDVKRINLDTVTREEIEALRSGDNVLISG
FT                   KILTGRDAAHKRLQDMYNAGEDFPVDLNGRFIYYVGPVDPVGDEVVGPAGPTTATRMDK
FT                   FTPFMLEKAGIMGMIGKSERGQATIDSIKKNKAIYFMGVGGAAYLISKSIKKAEVVAFE
FT                   DLGMEAIYEFEVEDMPVTVAVDSLGVSAHQQGPKLWKQKIAEINKV"
FT   gene            334251..334391
FT                   /locus_tag="FTW_0336"
FT   CDS_pept        334251..334391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46284"
FT                   /protein_id="ABO46284.1"
FT                   /translation="MQELVFFIIKIFFVILAISVVGIVSAVVIKSFKQSKEDKLSSDNQ
FT                   K"
FT   gene            334732..335612
FT                   /locus_tag="FTW_0337"
FT   CDS_pept        join(334732..335061,335061..335612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0337"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46285"
FT                   /protein_id="ABO46285.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            complement(335590..335991)
FT                   /locus_tag="FTW_0339"
FT   CDS_pept        complement(335590..335991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0339"
FT                   /product="putative transposase, IS1016 family"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46286"
FT                   /protein_id="ABO46286.1"
FT                   /translation="MVLMRRSRLSSYKQDKLIELFIAGSTARTASQLVSVNKTTASYYF
FT                   HRLRLLIYQNSEHLEMFAGEIEVDESYFGGTRKGKRGIAAGGKVPVFGLLKRNGKVYTV
FT                   IIPDAKSNTLLPIIREKVKPDIVNPRVFC"
FT   gene            336212..336948
FT                   /locus_tag="FTW_0340"
FT                   /note="type III restriction-modification system"
FT   misc_feature    336212..336948
FT                   /locus_tag="FTW_0340"
FT                   /note="contains frameshifts"
FT   gene            336929..337745
FT                   /locus_tag="FTW_0342"
FT                   /note="site-specific DNA-methyltransferase"
FT   misc_feature    336929..337745
FT                   /locus_tag="FTW_0342"
FT                   /note="contains frameshift"
FT   gene            337873..338157
FT                   /locus_tag="FTW_0344"
FT   CDS_pept        337873..338157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0344"
FT                   /product="putative excinuclease abc subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46287"
FT                   /protein_id="ABO46287.1"
FT                   /translation="MAFVYILASKRNGTLYIGVTANLIKRVYEHRQGFADGFTKKYDIK
FT                   ILVYYEQFKNIQDAIYREKRLKTWQRQWKIDLINEFNSDWLDLYESILD"
FT   gene            338226..338756
FT                   /locus_tag="FTW_0345"
FT   CDS_pept        338226..338756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46288"
FT                   /protein_id="ABO46288.1"
FT                   /translation="MKKIIIWVLEQIIALLDKGKNKSNEYNYGNSNKGIQVVESMPIDN
FT                   SVTNNISYGTPELEPNCQIIEEKILGSVFNWIYKPYIMMGTIIYILILVAEIVLYPRFE
FT                   ITIENTWSIIFFTPLVITMMFLLFLLSYEEYRFSVLSEIRKNDWCEDTRNQFVYKKIND
FT                   EIIRYRYKIYSPI"
FT   gene            338994..341868
FT                   /locus_tag="FTW_0346"
FT                   /note="type III restriction enzyme"
FT   misc_feature    338994..341868
FT                   /locus_tag="FTW_0346"
FT                   /note="contains frameshift"
FT   gene            341865..342527
FT                   /gene="ung"
FT                   /locus_tag="FTW_0348"
FT   CDS_pept        341865..342527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="FTW_0348"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004844 - uracil DNA N-glycosylase activity; GO_process:
FT                   GO:0006281 - DNA repair; GO_process: GO:0006284 -
FT                   base-excision repair"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46289"
FT                   /db_xref="GOA:A4IWI7"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWI7"
FT                   /protein_id="ABO46289.1"
FT                   /translation="MTWSDILAEEKQKPYFKQILDFLACESAKGKVIFPTKENIFNAFK
FT                   YTELDNLKVVILGQDPYHNYNQAHGLAFSVQKGVDIPPSLQNIYKELARSIPEFKTPNH
FT                   GYLVDWAKQGVFLLNTTLTVEAHKANSHKDIGWETFTDTVINKISENKHNVVFMLWGSH
FT                   ARKKKVLIDSSRHLILESTHPSPLSAHRGFLGCNHFVDCNKYLIEKKDQKIDWNLLC"
FT   gene            complement(342563..343579)
FT                   /locus_tag="FTW_0349"
FT   CDS_pept        complement(342563..343579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0349"
FT                   /product="carbohydrate binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46290"
FT                   /protein_id="ABO46290.1"
FT                   /translation="MYHDQWNKCLENSQKNTAGGLTFPFVMNIVYNAGDYSPVLKTYLN
FT                   ICAEGSTNTKEYKNINNWLLETINYQTIIGAEKPNTGEATYYRYPRQVSFYINQIFNNN
FT                   NKKLEDTGITVNNQVTFSISRLKQVFAMVMHKLSYRDNNDDLHFISIEDANKAFDQAIN
FT                   QITTTDGQIPEDLSFSNTQKTTNQQRLLIYKIIQKAISNLAQNNDIDFTKTYDESKPSP
FT                   EPGPTPEPQYTYPDGIGSYVNGTVVKAGDSEYKCKEANWCNNPAYTPLGNFSDAAWENL
FT                   NPQPKPTPVGTWDPTKEYVAGDTVEINGVKYAAQWWNKGVNPVENHTQYQDPWNIVK"
FT   gene            complement(343684..344229)
FT                   /locus_tag="FTW_0350"
FT   CDS_pept        complement(343684..344229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0350"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46291"
FT                   /protein_id="ABO46291.1"
FT                   /translation="MKKLIVSSIIASIMLPATTFANNKQLNQGEVAYHNTFPISQSEAY
FT                   DIFITNTDYANTVIMSNTIAGVMYGYLIKQKYPKMKFNKDYLYGSLIGQLMQESDMSSQ
FT                   LAQNFNPNDPDQLIHNSTYANILLQAGQGGPYQINDYSKRLPSAEAKGALGLVNYNAVA
FT                   AILGYSIQDQDDGSQTKK"
FT   gene            344487..347093
FT                   /gene="gyrA"
FT                   /locus_tag="FTW_0351"
FT   CDS_pept        344487..347093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="FTW_0351"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="GO_component: GO:0009330 - DNA topoisomerase complex
FT                   (ATP-hydrolyzing); GO_function: GO:0003918 - DNA
FT                   topoisomerase (ATP-hydrolyzing) activity; GO_function:
FT                   GO:0003916 - DNA topoisomerase activity; GO_process:
FT                   GO:0006260 - DNA replication; GO_process: GO:0006265 - DNA
FT                   topological change"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46292"
FT                   /protein_id="ABO46292.1"
FT                   /translation="MSIITKESSSINIEKELKQSYLDYAMSVIVGRALPDVRDGLKPVH
FT                   RRVLFAMNELSNYYNRPYKKSARVVGDVIGKYHPHGDTAVYDTIVRMAQPFSLRYTLVD
FT                   GQGNFGSVDGDSPAAMRYTEIRMEKLTHELLIDIDKETVDFSPNYDNTELVPDVLPTRV
FT                   PNLLVNGSSGIAVGMATNIPPHNMTEVINGTIALIDNPNLTIEELIEYILAPDFPTGSY
FT                   INGTDGILEAYKTGRGRVIMRAKADIHEDEASGKAQIIVTEIPYQVNKAKLVEKIAELV
FT                   KDKKVAGISELRDESDKDGIRVVIDLKRDESPEVVLNTLYAQTQLQCSFGINMVALSDN
FT                   RPKLLNLKEILEQFIKHRKEVVTRRTIFELRKSKERAHILEGLLLSLANIDEMIELIKA
FT                   SPSPADAKESMLARSWNGSMVKSMLEGVDVKMYRKETLASHYGIQVDSSYNLTEEQADA
FT                   ILALRLHRLTGLEQDKIVNEFKELIDRIKYLISILSDIKELIRVVKDELVEIRDNYGDQ
FT                   RKSEIIESRLDLTREDLIAEEDMVVTLSMDGYVKTQPLSMYNAQKRGGVGKSATKTKEE
FT                   DSIFKLMLASTHDTMLCFSSLGRVYWSKVYDFPVASRISKGRPINNILPLEKDERITAM
FT                   MPISQFNEGWYVFMATKLGRVKKVDLSEFARPRSTGKIAIGLNDGDELSYVALTDGNKQ
FT                   IMMFSDAGKAIRFDESDVRAMGRSAAGVTGMRLHHNQKIVSVIVTNPDEGIVLAATENG
FT                   YGKRTAVSEYRKTKRASQGVIAISTSERNGKVVVAVLVENDEDIVMITDNGTLVRTSSD
FT                   EVRECGRSAQGVRLINLRNNEKLISLKVVKQDDVEDNQDIENNEDIESSDVTVQSE"
FT   gene            347099..348256
FT                   /gene="dxr"
FT                   /locus_tag="FTW_0352"
FT   CDS_pept        347099..348256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="FTW_0352"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0030604 - 1-deoxy-D-xylulose-5-phosphate
FT                   reductoisomerase activity; GO_process: GO:0019288 -
FT                   isopentenyl diphosphate biosynthesis,
FT                   mevalonate-independent pathway"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46293"
FT                   /db_xref="GOA:A4IWJ1"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWJ1"
FT                   /protein_id="ABO46293.1"
FT                   /translation="MFKKTKITILGATGSIGDSTLAVIRETNDFEVFALTAFSNVEKLA
FT                   ELCQEFKPKFAVVPDLSKKQKLQSLVTDVEVLVGESGLEKVSSLAEIDIVMSAIVGIAG
FT                   LKPTFAAAKAGKKILLANKESLVTAGHLLIDEVVKNNAQLIPVDSEHNAIFQCIDNHDK
FT                   KCLPEIDKIILTASGGPFRDKQLHELTDVTPEQACNHPNWQMGRKISVDSSTMVNKALE
FT                   VIEAYWLFSVSADKIGVLIHPQSVTHSMVRYVDGSYIAQLGVPDMKTPIANAMYYPKRG
FT                   SVNVESLDFTKYQLTFREACFERFEALKIVFNNLQNKNYAANIVFNAANEELVAAFLNK
FT                   KIKYLEIIEVNKKVTKELNFENPKNIEEVFEIDRKTREYVDSVLG"
FT   gene            348262..350640
FT                   /locus_tag="FTW_0353"
FT   CDS_pept        348262..350640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0353"
FT                   /product="outer membrane protein"
FT                   /note="GO_component: GO:0009279 - outer membrane (sensu
FT                   Proteobacteria)"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46294"
FT                   /protein_id="ABO46294.1"
FT                   /translation="MFFLRKKFVLASLLVGIAFNGWADNDSFILDNVSINGLEGLQSDV
FT                   VKSRIGYKKGSYITPEDTNQIINNLYGTGFFNSVDLYRKGSNLFINVKERPIIAGFSFS
FT                   GNKKLSKDNLEKVFTDAGIYVGNVYNPNTMFLLKQSLLNQYSMMGLYGAKIEENIRKLP
FT                   NNRIDINVNFQEGKPAIIDSINFVGNKSFADSDLDSSVAFEVPSIWNLWGFLAPFDSYS
FT                   SDGMNQSVQGLTNYYLDRGYLDFKVTSKQASMSKDREHSYITFDVAEGQIYKVGSVSLT
FT                   GKFILPKSELESLVKIKQGEVFSKSKLVQTVEGIKTLLGSKGYAFATVNPIPTVDKDNH
FT                   IVSFKIVVDAGKKVYVNRINFFGNNVTNDYVFRRQLQYYEQSQYNKEAIDKSQRRLEQL
FT                   PYVGAADMELVPVAGSDDLVDVNYNIKERNANSISGSLGFSDLYGFMIGGRLNMPNVFG
FT                   TGNTFNLNAQLSIPFQQLDISYIDPFFTTSGVSQSISAYINRSNFAKTNAVAAYQLDTI
FT                   GARLMYGVPISTFSNVSGGITFANNTVKQSDGYQSSIVQWFIQQQGGRNNFNEPALTAG
FT                   WSYDNSNKYIFATDGGSFNLNGSVNIPVISNINAYKIEVGGTYNIAVPNTDMSALTIRA
FT                   GVQYGGGYGKTKQLPFYENFYGGGWGSVRGFLQGSLGPRDINLVNGEVGNSIGGNLNIY
FT                   NNYDVLFPVPFIKDSSKMRIGAFLDIGNTYTTYNLNGVVAPQPKQETTPSFSNLKYSVG
FT                   VEFRWASPMGPLAVSFAQPFNVQKGDITQVFQFSLGQNF"
FT   gene            350776..351279
FT                   /gene="ompH"
FT                   /locus_tag="FTW_0354"
FT   CDS_pept        350776..351279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompH"
FT                   /locus_tag="FTW_0354"
FT                   /product="outer membrane protein OmpH"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46295"
FT                   /protein_id="ABO46295.1"
FT                   /translation="MKKIALSICVLASAFTAAYADTKIAVVNPVEIFNDSDLGSVSVKK
FT                   LENDLKPDATKLKQEQDNIMQQMKTLQDNSATMTKSELDKKQQQIQQEQQNFAEKARIL
FT                   QQKEYTAKDKLSKKFQASFDKAVQTIAKQKNYNVVLTTQALAYVNNVDDISSQVVELMN
FT                   KDSE"
FT   gene            351298..352311
FT                   /gene="lpxD1"
FT                   /locus_tag="FTW_0355"
FT   CDS_pept        351298..352311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD1"
FT                   /locus_tag="FTW_0355"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="GO_function: GO:0016410 - N-acyltransferase
FT                   activity; GO_function: GO:0008415 - acyltransferase
FT                   activity; GO_process: GO:0009245 - lipid A biosynthesis;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46296"
FT                   /protein_id="ABO46296.1"
FT                   /translation="MYSLDFLASKLDGEVKGDKNVEIKKIATLSLAGEGDISFCTNPKY
FT                   LKALSETKASAVLITEEVLEFCNTNAVVLSNPYMALAKVMELFDKSPRPDGKIHSKAVI
FT                   AASAIIGENVTIGANAVVGENVVIGDNVYIGACATIDNGTKIGNDTLIKSNVSIAHDVV
FT                   IGTGCIIHQNAVIGCDGFGNARDEDGSWTKIPQLGRVIIEDDVEIGSGTTVDRGAIDDT
FT                   IIKKGARIDNLVQIAHNVVIGRNTALAGVTAVAGSTTIGDNCLIGGQSAITGHISICDN
FT                   TIIGGASNIGKSITKPGMYYAAFEAKPRIQWGRFVAKLAKIDTLITKVKQLEEKIK"
FT   gene            352326..352817
FT                   /gene="fabZ"
FT                   /locus_tag="FTW_0356"
FT   CDS_pept        352326..352817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="FTW_0356"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /note="GO_function: GO:0016836 - hydro-lyase activity;
FT                   GO_process: GO:0006633 - fatty acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46297"
FT                   /db_xref="GOA:A4IWJ5"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWJ5"
FT                   /protein_id="ABO46297.1"
FT                   /translation="MSQFNQNNKQIDVMGIRKILPHRYPFALLDKIVDWSVEDRTIVAQ
FT                   KNVTINEDFFNGHFPDFPVMPGVLIVEAMAQATAILGELMAETLFAHVVEKAGGGRRTF
FT                   MLAGIDKVRVKRPVVPGDVLVIESRMVKQKNIICTAESVAKVDGQIVCSAELMAAYKDY
FT                   "
FT   gene            352820..353599
FT                   /gene="lpxA"
FT                   /locus_tag="FTW_0357"
FT   CDS_pept        352820..353599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="FTW_0357"
FT                   /product="acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_function: GO:0008780 -
FT                   acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine
FT                   O-acyltransferase activity; GO_process: GO:0009245 - lipid
FT                   A biosynthesis; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46298"
FT                   /protein_id="ABO46298.1"
FT                   /translation="MIHSLAVVHESAKIADSAIIGPFCVIGKNVVIGENTELKSHVTIG
FT                   DNAVIGKNNRIFQYASIGDDPIDYTYKKGDFSQVVIGDNNIIRECATIHGGTAKEIGVT
FT                   SVGNNNIIMCYVHIGHDCKMGSYINLVNGVGLAGHVHIDDYAILSSNVGVHQFCRVGKH
FT                   AFIAHAALVGKDVPPYLMVTAVNAGSTPCGINTEGLKRRGFTPEEMKKIKEVYKVLYRK
FT                   GLMMKEAFEIIKAMAKEDKVLEPFVDVIGTSRRGILR"
FT   gene            353599..354741
FT                   /gene="lpxB"
FT                   /locus_tag="FTW_0358"
FT   CDS_pept        353599..354741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="FTW_0358"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="GO_function: GO:0008915 - lipid-A-disaccharide
FT                   synthase activity; GO_process: GO:0009245 - lipid A
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46299"
FT                   /db_xref="GOA:A4IWJ7"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWJ7"
FT                   /protein_id="ABO46299.1"
FT                   /translation="MRIGIVAGELSGDQLGGTLVEALKQKYPNAIIEGIGGPKMAAAGF
FT                   KSLYPMDALSLIGFLEIISKGLRILSIRRKIINYFKQNKPDIFIGIDAPDFNLTVEKEL
FT                   RSAGIKTIHYVSPKIWVWREYRIKKIRKATDKILAILPFETEYYKNRHKFEAIYVGHPL
FT                   AKNIPIHIDRAKYRDKLGLKGSSLPILSVLPGSRTTEVSRLLPLFLLALQKLVDAGYKF
FT                   KAIMPLAKPSLKPLFAKYKEQIDSLGIEVFETNSHDVLKASDLSLLASGTATLEAMLCK
FT                   LPMVVGYKLSWLSALIGRMLIGNHSYWAFPNILHKNEIIKELIQEDCTVDNLFSELKRL
FT                   FDDKRRNDYIVEEFEKIHKEMVIDTESKIIQVLDTMIEKS"
FT   gene            354800..355387
FT                   /locus_tag="FTW_0359"
FT   CDS_pept        354800..355387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46300"
FT                   /protein_id="ABO46300.1"
FT                   /translation="MTLILALVLVLVVLIIIDLYRKSLRLKQVEILRNIEQNNAQELIT
FT                   QAKSFPEYAANIENVQQEYPLLRDGFLLLYFEAIEPIQVKDLATFLKYYGIKYTDDKAF
FT                   QKVNYKDVIFSILPDNQEQEFSSATDGSVTGIIAVMNYRKLASMDYDVKTCYELMLDIL
FT                   EALAKAFHGTLMNEHKVRLTKKDKQNYLAAIL"
FT   gene            355478..355852
FT                   /locus_tag="FTW_0360"
FT   CDS_pept        355478..355852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46301"
FT                   /protein_id="ABO46301.1"
FT                   /translation="MEYKYHHIGIPVTEPRPGERYSPSMDMYTSGGELPGRVQYHRFGP
FT                   KCSLDKLIQTMPHIAYKVSDLDQAIKDKNILLKPYFPIEGFRVAIIEENGAIIEFIETD
FT                   LSDEEIWDKPNLKNSILYPS"
FT   gene            356259..357291
FT                   /locus_tag="FTW_0361"
FT                   /note="glycosyl hydrolase family 3"
FT   misc_feature    356259..357291
FT                   /locus_tag="FTW_0361"
FT                   /note="contains frameshift"
FT   gene            complement(357522..357598)
FT                   /locus_tag="FTW_2054"
FT   tRNA            complement(357522..357598)
FT                   /locus_tag="FTW_2054"
FT                   /product="tRNA-Met"
FT   gene            complement(357662..358471)
FT                   /locus_tag="FTW_0363"
FT   CDS_pept        complement(357662..358471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0363"
FT                   /product="polyphosphate kinase 2"
FT                   /EC_number="2.7.4.-"
FT                   /note="GO_function: GO:0008976 - polyphosphate kinase
FT                   activity; GO_process: GO:0006793 - phosphorus metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46302"
FT                   /protein_id="ABO46302.1"
FT                   /translation="MKVLSQEERQKLFLENIFPYKHKIPRNVYEKQKHYLQIELLKFQK
FT                   WVKENNKKVLIIFEGRDAAGKGGTIKRMMEHLNPRGAKVIALEKPSEQERNQWYFQRYI
FT                   EHLPSGGEIVLFDRSWYNRAGVERVMGFCTEREYFLFLEQAPQLEKMLVDSGTMIIKFW
FT                   FSVSQQEQKNRFAARESHPLKQWKLSPIDKASLDKWDDYTEAKERMFIYTDKPYAPWVI
FT                   VKSDDKKRARLNAIRYILNNVDYDNKDHEVAIPPDPLIVGTSSKIYK"
FT   gene            complement(358541..359305)
FT                   /locus_tag="FTW_0364"
FT   CDS_pept        complement(358541..359305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0364"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46303"
FT                   /protein_id="ABO46303.1"
FT                   /translation="MQVQTIQKIYAWLVHLFTSLGAVFGILAIIFSIEAAKTIVLGQTD
FT                   LHHYYIKLSMFSIIMAIFIDSIDGSLARLVDIKKLAPIDGALLDNIIDFTTYSIVPCIW
FT                   IYVSAVVSQQWLIPIIIMITISSSYQFCQLNAKTDDYFFVGFPSYWNVIVMYMLCFQSN
FT                   QLINEIMITILSIFSFIPIKYIYLSRTEHISKSKLVKIFTFIFTMLAAIATFLAVLLYP
FT                   LKTPTPLVTIILVFTIFYIIFSLKLNIKPVKS"
FT   gene            complement(359353..360234)
FT                   /locus_tag="FTW_0365"
FT   CDS_pept        complement(359353..360234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0365"
FT                   /product="polyprenyl synthetase"
FT                   /EC_number="2.5.-.-"
FT                   /note="GO_function: GO:0004659 - prenyltransferase
FT                   activity; GO_process: GO:0008299 - isoprenoid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46304"
FT                   /protein_id="ABO46304.1"
FT                   /translation="MSSENIIKDFEIFAEKVFDQLNCVSKTLLSAMHYSFFSGGKRIRA
FT                   QFVYAIGEALAIDKSNCDKIAFAVESIHTYSLIHDDLPAMDNDTLRRGKPTCHIKFNEA
FT                   TAILAGDALQALAFEILQDINYSDIDKLKKINKLFAQYCGASGMVGGQQLDIEGENKKL
FT                   KIEELQILHTNKTAKMFRACIVLPYILSQNQNSQIEDLLVRLSDLIGLCFQIKDDILDV
FT                   TKTTNELGKTSAKDIDANKSTYVSLMGLKDANKYLLDKKNEITQIITKLKNNNFSSTSL
FT                   ENLIDLVINRNC"
FT   gene            complement(360231..361526)
FT                   /locus_tag="FTW_0366"
FT   CDS_pept        complement(360231..361526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0366"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="GO_function: GO:0016757 - transferase activity,
FT                   transferring glycosyl groups; GO_function: GO:0016740 -
FT                   transferase activity; GO_process: GO:0000271 -
FT                   polysaccharide biosynthesis; GO_process: GO:0009244 -
FT                   lipopolysaccharide core region biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46305"
FT                   /protein_id="ABO46305.1"
FT                   /translation="MEHLKKFFYVFLAHIYSSIFITLIPILYLKKFKRSFKNINYRKRW
FT                   AERFAQIPIRLNSSIWIHSVSVGEAVSAEPLVKELLKNFPNENFVITTTTPTGSDVVNS
FT                   LYSNYPNVHHMYIPYDVIPFINSFFAKTNPKIFIIVETEIWPNILNKCFAEKVPVVITN
FT                   ARLSKKSMRNYTKIPFAKEFLFKNISHINAQTEKDAKRFYSLAVDKNNISVTGNLKYNL
FT                   ITPENLENKMYSLKDSLKGRPVWIAGSTHQGEEEIILEAHKQILKIHPDCLLILVPRHK
FT                   ERFQKVEKLIVYNSLKYQKRSSFECQIFSDTQVYLGDTMGELLHLYYIADITFVGGSLI
FT                   DNGGHNLLEPAALAKPILSGPSLFNFSQISKELIRNKALIRIRNQQEIANNILKILEDK
FT                   QLLQQMSSGALKTFKSHSDVLEKQYNNIVKFL"
FT   gene            complement(361631..362209)
FT                   /locus_tag="FTW_0367"
FT   CDS_pept        complement(361631..362209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0367"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   RdgB/HAM1 family"
FT                   /note="GO_function: GO:0016462 - pyrophosphatase activity;
FT                   GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46306"
FT                   /protein_id="ABO46306.1"
FT                   /translation="MKEIVLASSNKGKIREFTNIFKQKNIKILPQTDFNVPDADEIGLS
FT                   FIENAILKARNCAKHTGLPAIADDSGLEVFSLNGEPGIYSARYSGEHGNDKANIQKLLA
FT                   KLTGNDNRNARFVCALAYVKHEFDPAPILAYGFLEGKIAHKISGSNGFGYDPIFILPQL
FT                   QKTLAEISETDKNKISHRAIALDKIMQLL"
FT   gene            362316..363140
FT                   /gene="proC"
FT                   /locus_tag="FTW_0368"
FT   CDS_pept        362316..363140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="FTW_0368"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="GO_function: GO:0004735 - pyrroline-5-carboxylate
FT                   reductase activity; GO_process: GO:0006561 - proline
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46307"
FT                   /protein_id="ABO46307.1"
FT                   /translation="MKICFIGGGNMAAAMIAGMTSHGYKSQDIIVFDRNEHKCLNLIKK
FT                   YNINTSTSLLNTIKLADILILAIKPQNMFELIKNIRDTVTSTQVIVTVAAGIQTSAYEE
FT                   LFNKEISFARTIPNTPSSLGYGATGIFFNKVIAADKKDLVIDIMQTMGVVTVVEDEKEI
FT                   DIIAAIASSGPAYYFQFMEHMVEAAIKQGLDKKQAEKLVVQTCLGAAQMALNTNENMSE
FT                   LRKNVTSKKGITYEALNIFEQFNLGGIVDKAIQANIARAQQLAIEFTKLIDN"
FT   gene            363377..364468
FT                   /locus_tag="FTW_0369"
FT   CDS_pept        363377..364468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46308"
FT                   /protein_id="ABO46308.1"
FT                   /translation="MESFLKGSIYRGGTSKALLLNKEDLSNYQLNHIDDIVISIMGSPH
FT                   KRQIDGIGNGDSLCSKVAIVSKSLDEGVDLEYFFMQVGVNDRFVDKTVNCGNIASSIDP
FT                   FAVNSKIINIEDDLSSATLKVKNINTNVIFETKICVKNGSYLPDGDMSIDGVNNTYSPL
FT                   ELNFFNPVGAKTGKLLPTGNVVDNIDGIDVSCIDVAVPMIIIDSTKFDKTGKDPKDLLD
FT                   EDKELLRKIEKIRKKASYLMGLGDCSNKVIPKVCLISKPASKANSICSRYFTPFDCHST
FT                   HSVSGTMCLASSLFIEGSIACQVINNRIGNDTGIINIEHLSGIIPISYQVDNNQDVRKI
FT                   NIIKMGFFRTARELVRGIFFYKL"
FT   gene            364899..365585
FT                   /locus_tag="FTW_0370"
FT   CDS_pept        364899..365585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0370"
FT                   /product="Two-component response regulator"
FT                   /note="GO_function: GO:0000156 - two-component response
FT                   regulator activity; GO_process: GO:0000160 - two-component
FT                   signal transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46309"
FT                   /protein_id="ABO46309.1"
FT                   /translation="MRILLAEDDLHLGEGLLEALQKEGLIVNLVSDGEAAQTFIESGLY
FT                   DIVVLDIGMPIKTGLEVLRNIRNRGIKVPIILLTARDGLEDRIKGLDLGADDYLTKPFE
FT                   LKELVARIKAISRRIDTRSGKSVNEEIRFGDYSFNPSSETVTKDGVIIPVSKKELALLA
FT                   ILVQNAGRVVPKTQLLEEVYSTDKEMDTNTLEVHMHNLRKKINIPNFIQTIRGVGYFVQ
FT                   KDKVIK"
FT   gene            365590..366453
FT                   /gene="lepB"
FT                   /locus_tag="FTW_0371"
FT   CDS_pept        365590..366453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="FTW_0371"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="GO_function: GO:0009004 - signal peptidase I
FT                   activity; GO_process: GO:0009306 - protein secretion;
FT                   GO_process: GO:0006465 - signal peptide processing"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46310"
FT                   /protein_id="ABO46310.1"
FT                   /translation="MEILNYILNLGFTFWLLFLTIASGLIYIIDFVFFQKSRLAAYTDE
FT                   LKGLSKKQKRQFYKDRGLKAPFIADQARSLFSVFFVVFLLRTFLIGNFLIPTASMTPTL
FT                   PVGDFIFVNKTAYGIRAPFTNETLIKVGEPKRGDIVVFHFPVNPNVDFVKRVIGLPGDV
FT                   ISYKDKMLTINGKKLEYTNCNRDAMNYYNQSLAAGSGDTVCTENLDGVKHEVDWIESIK
FT                   GTDFENLKVPAGQYFVMGDNRDNSEDSRYWGFVPDKDLVGKAKVVWMSWDKIDKKVRWD
FT                   EIGKVF"
FT   gene            366460..367152
FT                   /gene="rnc"
FT                   /locus_tag="FTW_0372"
FT   CDS_pept        366460..367152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="FTW_0372"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="GO_function: GO:0004525 - ribonuclease III activity;
FT                   GO_process: GO:0006396 - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46311"
FT                   /db_xref="GOA:A4IWK9"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWK9"
FT                   /protein_id="ABO46311.1"
FT                   /translation="MVPEYSRFYNILGYNFKDCTLLIRALTHRSKTKKNYERLEFLGDS
FT                   VLSFVIAEVLYKQFTDLAEGKLSQLRSKLVKGTTLAQLASSLKMDEYIILGASEQGGHK
FT                   REKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPIISSINLDTIKVKDSKSKLQEILL
FT                   QNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAEQKTAEKMIEMLS
FT                   QQGLHEKK"
FT   gene            367139..368047
FT                   /gene="truB"
FT                   /locus_tag="FTW_0373"
FT   CDS_pept        367139..368047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="FTW_0373"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="5.4.99.-"
FT                   /note="GO_function: GO:0004730 - pseudouridylate synthase
FT                   activity; GO_process: GO:0006400 - tRNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46312"
FT                   /db_xref="GOA:A4IWL0"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWL0"
FT                   /protein_id="ABO46312.1"
FT                   /translation="MKKNRLNLNGVVVINKAKDISSNKVLQQLKYLFNAQKVGHTGTLD
FT                   PMATGVLPICFGRATKIAQYLLDADKEYIATIRLGIETDSGDAEGEIIAKSINIPELSA
FT                   EYLETVLAKFRGDVVQIPPMYSALKYNGQPLYKLAREGKTVEVKSRNIKIYELELLEFN
FT                   IDSLKIRVKCSKGTYIRSLAIDIGKTLGCGGHLIALQRTQSGPFKLSEAFRLEQLKDLS
FT                   FEQKIASITNIESVFIDKPIYSLLEEEKDDLYKRGLFADKPHLDGTVRIYDVEKFVAIA
FT                   EFDKGKLINKKFFDQDILISE"
FT   gene            368040..370337
FT                   /gene="rnr"
FT                   /locus_tag="FTW_0374"
FT   CDS_pept        368040..370337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="FTW_0374"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /note="GO_function: GO:0004527 - exonuclease activity;
FT                   GO_function: GO:0016896 - exoribonuclease activity,
FT                   producing 5'-phosphomonoesters; GO_function: GO:0008997 -
FT                   ribonuclease R activity; GO_process: GO:0006401 - RNA
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46313"
FT                   /protein_id="ABO46313.1"
FT                   /translation="MSKYSIHNDPNKDIEAQKYENPIPSREVILNYIRDVKLPVSIENI
FT                   ANALEIFKKNLFEGLVNRLGAMVRDGQLEKDRSYYNLPEMAPIYITSKVAADRDSRLEL
FT                   FSHTLNTKVGIVSHQAKMVMVGDEVTAKVLGLNKRGRIDAEIKTIVTRAQKTVTGYYYK
FT                   SFDCDFIKPISKSIISDIVLLPPKQKIEHNSLIEAEIIVYPSISSAAVAKFKQEVEAVS
FT                   PVKEAMMMTTQKYDLIEQWSKKALRYLDNISDDVVVGNRVDLRNQHFVTIDGEDAKDFD
FT                   DAVYAHRTKSGSWKLYIAIADVSNYVEKDSALDLDAKRRSTSVYFPGYVIPMLPEKLSN
FT                   GLCSLRPNEDRYSLVCEMNISKEGKLSRYKFYSAVINSKARLTYTEVAKLLEKKQNTIV
FT                   ENTPELVPNIFDLYELYKVLHQARQERGAIDFDTVETQIILDEHNHIESIVPRHRNDAH
FT                   RLIEECMLVANVAAAKFTIKHKKTSPFRVHSEPKEDRMETLKKYLAKHGIHLAHGKNGK
FT                   VTPKALAQMLDSIKDRPDYDDIQMMTLRSMNQAVYSINNDGHFGLAYSEYTHFTSPIRR
FT                   YPDLVVHRIIKSIIGEYEHGAADYKPSELANICENASDQERNADAASKQVENWLKCYFM
FT                   QDYIGHILEAQIKHVNGLGLFAELKDMYIEGLIHVSAIPGDYYIYDEAKDILIGKRTHK
FT                   VYKVGQDITVRVVRADLERIHIDFELYDPRKPFAENSSDKPFAKKTKKLKKAKKKKVRS
FT                   RKKNKTKAKLAH"
FT   gene            complement(370361..371191)
FT                   /locus_tag="FTW_0375"
FT   CDS_pept        complement(370361..371191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0375"
FT                   /product="fatty acid desaturase"
FT                   /EC_number="1.14.19.-"
FT                   /note="GO_process: GO:0006633 - fatty acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46314"
FT                   /protein_id="ABO46314.1"
FT                   /translation="METQSNKLTIVAFAIMHLACLAIFFVNYNITALVVFVVTFSARTF
FT                   ALTAGYHRYFAHKAFQTSRVFQFILALVGTWASQKGPLWWSGHHRYHHIHSDKDTDLHS
FT                   PKNGIFQSHVGWVFESRSDHVDPKFTKDWVKYPELVWIDKYAHVSFALYLVGLFALGSL
FT                   ISHFYPSLETSGLAFVFWGGILSTVLLYHTTFSVNSICHIFGSKDYETSDNSCNNWFIA
FT                   LITFGEGWHNNHHKFAYSVRNNLKVWQIDITYMILCVLRKFRIVWDFKQPKKTI"
FT   gene            complement(371205..371948)
FT                   /locus_tag="FTW_0376"
FT   CDS_pept        complement(371205..371948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0376"
FT                   /product="oxidoreductase, short chain alcohol
FT                   dehydrogenase/reductase family"
FT                   /EC_number="1.-.-.-"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46315"
FT                   /protein_id="ABO46315.1"
FT                   /translation="MQKFVGKTIWIIGATDGIGKAVLKKLDNSIQADFIISARSLDKLQ
FT                   NIAANLKNTAHVLSFDVADFAEFEKVAASALNYKPDFIIYFPAFYEPSLIADIAIANLN
FT                   KTIQTNLTAVFYLIIFVLPFLKKNPHCQLAITASVAGYIGLPRSQPYAATKAGVINLVE
FT                   SLKTENPELDIRLINPSFVKTKLTDKNNFKMPSLLKPEQAADSIIKGLQTSKFEIHFTK
FT                   KFTIILKLIAALPYKLYFKIAKKMI"
FT   gene            complement(371950..372492)
FT                   /locus_tag="FTW_0377"
FT   CDS_pept        complement(371950..372492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46316"
FT                   /protein_id="ABO46316.1"
FT                   /translation="MKKLISKIGVIIMALGLFGCSADISSYKGEGSKLDLQQYLQGKIV
FT                   GTGIIQDYKGKVTKQFDFSGTASWDGNLGTFDEHMVYYDGQKDHRIWKIKKISDNYYEG
FT                   TTADVIGIAKIYVEGNAMNWQYQMDIPVGDKKYKINFDDWMYLMNDGVLINKNSFKKFG
FT                   LTVGSLTLFMHKEKTGA"
FT   gene            complement(372489..372956)
FT                   /locus_tag="FTW_0378"
FT   CDS_pept        complement(372489..372956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46317"
FT                   /protein_id="ABO46317.1"
FT                   /translation="MAEELTLQQIKSQQSQQVGKVHFSKWFFDVYDAELYSENGHFSWD
FT                   KPFLLKIHYLRSFSGKNIANHTVKEIAEQHPQLAHTTLDKYKEIFTRLMPDVKNGTNLY
FT                   GYMDKDGNGYIYSDKGLLGEIPNKTLSKYFFEIWLSDKSSHIKLSKQLRGL"
FT   gene            complement(373000..373686)
FT                   /locus_tag="FTW_0379"
FT                   /note="cyclopropane-fatty-acyl-phospholipid synthase"
FT   misc_feature    complement(373000..373686)
FT                   /locus_tag="FTW_0379"
FT                   /note="disruption due to transposon insertion"
FT   gene            complement(373658..374538)
FT                   /locus_tag="FTW_0380"
FT   CDS_pept        complement(join(373658..374209,374209..374538))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0380"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46318"
FT                   /protein_id="ABO46318.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            complement(374562..375113)
FT                   /locus_tag="FTW_0382"
FT                   /note="cyclopropane-fatty-acyl-phospholipid synthase"
FT   misc_feature    complement(374562..375113)
FT                   /locus_tag="FTW_0382"
FT                   /note="disruption due to transposon"
FT   gene            complement(375233..375745)
FT                   /locus_tag="FTW_0383"
FT                   /note="conserved hypothetical protein"
FT   misc_feature    complement(375233..375745)
FT                   /locus_tag="FTW_0383"
FT                   /note="N-terminal truncation"
FT   gene            complement(376002..377255)
FT                   /locus_tag="FTW_0384"
FT   CDS_pept        complement(376002..377255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0384"
FT                   /product="putative flavin containing amine oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46319"
FT                   /protein_id="ABO46319.1"
FT                   /translation="MEKIAVIGSGISGLAVSYLLKDKYQITLYEKNNYFGGHTRTLDIN
FT                   NTSVDTGFIVFNYHTYYHLSRLFKQLDIPVAESNMSFGVSIKSGKFEYGSSSIKILFAQ
FT                   WTNIFRPSYYKMIKDILKFNKISRQHLENNTLDENITLAEYLNSIKVGNFFKDYYLLAM
FT                   GACIWSTPLEKMYDFPALSFIRFFNNHGLLTTTKPVQWYTVKGGSKVYVEKIISQLKSA
FT                   NVKFAPQATKVIRSEKTVITDINNNNEEFDKVIFACHSNEVLELLDDANSYEKELISAI
FT                   KYQPNSVILHNDSTIMPKRKTAWSSWNYLSAETKDKRDVVSLSYWMNNLQPLDADIDYF
FT                   VTVNPDQKPDPQKIINEHTFDHPVFDKKAIQAQKEFDKIQGLNNTYYCGAYLRYGFHED
FT                   GILSAVNVATKLGVKTPW"
FT   gene            complement(377332..378303)
FT                   /locus_tag="FTW_0385"
FT   CDS_pept        complement(377332..378303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0385"
FT                   /product="two-component system sensor histidine kinase"
FT                   /EC_number="2.7.-.-"
FT                   /note="GO_function: GO:0000155 - two-component sensor
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46320"
FT                   /protein_id="ABO46320.1"
FT                   /translation="MAMLFTVLLGLSIVSWIYIIFSAVGDRVIEHIIPLSIGIFCTVSV
FT                   VIISYLISVFVVKKINHIASSAAAIVNTQDFSQRIKSNTNWDDLSNLANILNILLANIK
FT                   ELLVDIKSVSNNIAHDLKTPLTRLKNKLEDLEQTNPNKDSSDALAECNQLLDIFNSLLR
FT                   LNLLEHGRESLTKKRLDIKNIIDDAIELYEPIFEQKNIQLQTNILAKKLNLNKNLIFQS
FT                   IINILDNCYKYSKDNTEISINTKIQNSKYIIEIADQGIGINNENTDKIFERFFREEKSR
FT                   SQTGNGLGLALVKKIIQLHNGDIIAQNNKPQGLKMIISLPLH"
FT   gene            complement(378353..379042)
FT                   /locus_tag="FTW_0386"
FT   CDS_pept        complement(378353..379042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0386"
FT                   /product="two component response regulator"
FT                   /note="GO_function: GO:0000156 - two-component response
FT                   regulator activity; GO_process: GO:0000160 - two-component
FT                   signal transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46321"
FT                   /protein_id="ABO46321.1"
FT                   /translation="MSDNPKVLVADDDKKIAQFIKTKFEENGIDTTVAFDGKEALFLIN
FT                   TNNYDVIVIDWMMPYLDGISLLKILRKQNINTPVIILSALDSTENKIEGLKSGSDDYLT
FT                   KPFSIDELIIRVNILYKRTKQITEAQTHKLSCGDIVLDELAHEVRRNRELILLQQREYK
FT                   VLHLLLKHKNEVVSKTMILKEVWDYDFDPQTNVVEVHISRLRNKLTEGGLSDPIKTIRG
FT                   FGYVIQE"
FT   gene            379185..379721
FT                   /locus_tag="FTW_0387"
FT   CDS_pept        379185..379721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46322"
FT                   /protein_id="ABO46322.1"
FT                   /translation="MKRVIATILGLTVVSGVYADSYTMYAKPDTKSPKLATIDDQDPNY
FT                   KAIFSKGEWIEVVDNKDGSVGWVKQKPQDKTSQAISKDPIEQMMANFQKQQQLLDQHFN
FT                   KMLANIDQNIAQMQAQPNSTKAKNNPQVLKKFSSITINSDGKTAKIVKKTEDGNGNIQT
FT                   VEKEIPADQLGTIKL"
FT   gene            379839..380240
FT                   /locus_tag="FTW_0388"
FT   CDS_pept        379839..380240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0388"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46323"
FT                   /protein_id="ABO46323.1"
FT                   /translation="MYEEQFLAEKLQQFSLLDIALVKIVYFLVGLLVATNYIVLTSVSW
FT                   IFYLLMFLIAVFPIVIHLFSFEGSYIQKARKYLKTNKPSYQVLLFFSMFFFACTLAVLI
FT                   PALSLVPWYVYLILIIIFAIKPMRSNMFW"
FT   gene            380415..381023
FT                   /locus_tag="FTW_0389"
FT   CDS_pept        380415..381023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0389"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46324"
FT                   /protein_id="ABO46324.1"
FT                   /translation="MKKKLLFITISASLALALSSCGKTTVAYEDPNGVDTTSINFSSTD
FT                   LQAITNKMAEDMLNSPAVKRITAMDTPTLFFSNIRNETREHINTTMLSNTAQTQIIKSG
FT                   LFQVTDMSQIKNVREQLGYQANSGMVDQATATKIGQHIGARYMVYGSIQDIDNTNVDGD
FT                   KRSKFFLATLKMMDLKTGLVVWQDDKQIRKSQTKSTFGW"
FT   gene            381080..382510
FT                   /locus_tag="FTW_0390"
FT   CDS_pept        381080..382510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46325"
FT                   /protein_id="ABO46325.1"
FT                   /translation="MKKKILTSLIASSLLAISLFAADDTVVDSKTTQQQTQAKVDMGAD
FT                   VANLNNAISTDSKPVATTSQDKRSAEEILNDVMENYIDQNNLRDRYDYVGSAIGTASVN
FT                   QTNSNYVDSAQLAFEKALIKAQAEYISFISANTKVDKSLNIDSTQGSTANEIDTDADKP
FT                   KQGTQAAIDAKQKALDEAKLDNQLKEQGLNPNDFATPEEKKKALLSQQMTIKSLTTGFG
FT                   NLSGLLPIKTFVVEKDGNAAIGVVVIYSDKIKGMFEDIKHGNESVIVGKGGQSPSDLYK
FT                   DKSGEDMMGDYGIRVGFGEDNKPYILAYGQGSYNGPSIQGVSAGDYGYKQAAIMARANL
FT                   VTLIAGQMSTQEALTMSEDISSTLAKNTKTQQTRRIDATDIEKTLSTYYKTKANLDIVG
FT                   LKTVKRWRYKLPGTENIVYGVVLKWDPKQVATANKIKNFSYDEYRKQNTQNTESGQSSL
FT                   NGKVIIRQSDDNKYLNQY"
FT   gene            382521..383504
FT                   /locus_tag="FTW_0391"
FT   CDS_pept        382521..383504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46326"
FT                   /protein_id="ABO46326.1"
FT                   /translation="MQKRLITFLVSSMSFMTATGVAAQNNLADTNMLSGSTVISSASSI
FT                   LSSASSTYKGVDERSKLKMFRVAILPFDTKGAKIDGDIDQEQLQSGLNDSIVAQITQSR
FT                   KFRVSNRDVNDEKAYESEIKRILNSNTDNDKGMLNQKIGADFILTGDILNLNITKNKTS
FT                   YYGEDFTTLNVSATVAYRMVELATMEVKWSNVVTIEVPTNIANQYANADDANYMQLLSY
FT                   LGKQLGKTISDQVIGAIYPLQVLKVDDGEIYFNQGGDRIIKGSVYEVRQDGGVTLDPAI
FT                   GQHIVLDSKVLAKIKITDVMPKYSIGIVIDGSLAKVQPGLRAYLTK"
FT   gene            383510..384904
FT                   /locus_tag="FTW_0392"
FT   CDS_pept        383510..384904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0392"
FT                   /product="hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46327"
FT                   /protein_id="ABO46327.1"
FT                   /translation="MKTKSYSLLLLLCGVISSCTTFSGSHPDKVDNAKKAIETCQYKPT
FT                   ETKFIKTFDNDGVDAAIGFLETGRFEQLISNTTLSQKKYTKATDYVAKSEAEAKIRVRN
FT                   ILKDTQATLLSDKERYYYITDYEITFLYAYQALNYLKQHDLENATVSIRNLSYAQYATF
FT                   QAKDLATQTRDTNYQELSHVNSRQISSNISNSKQYRQLATIASRVRNSYENAFGYYLEA
FT                   IIYQSYDTDLNNANLSMSNAFRVVPDNPYVSADYQQIKKAFDSGGNIYPQDQGKLVIIY
FT                   ESGWVEPLKKFDIPKTIFFQQAGVQKISLPYYGSYNLAQNADIQIFKDNKLIDHGKSAL
FT                   LVDTTAMAAKSLSDQYPAIVTREVLRLVTKTAISVAAIRSSGDYAALAAIGTSIYNLAT
FT                   TEADQRSWNLLPKNVDLFSKNLAVGKYTLKINNKSTTVTLQPQKITLVWLTKEGCYEQI
FT                   LLNQVL"
FT   gene            385044..385958
FT                   /locus_tag="FTW_0393"
FT   CDS_pept        385044..385958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46328"
FT                   /protein_id="ABO46328.1"
FT                   /translation="MNKYIANTVVMVEPKYLCFNQETSVNNAFQNQLDISNDELQNRVI
FT                   HEFENMVAKIRANGIEVIVLESKPNTPDAVFPNNWFSTHLIDNQPYVFIYPMYTQNRRN
FT                   EVQVDKLLEQLNKLTTTNYKVIDLRGDYSKALEGTGVFIFDHEFKTAYMSLSPRADAQL
FT                   AQQVCDKIGYKLVTFTSYDKKGPIYHTNVMLSIGEHLAIVCLESIKSAIERELVIKTLQ
FT                   QSNKQIIDISLEQMYQMCGNVLEVKNKADKSFLILSQTAYNGFSQSQLALISKYATPIA
FT                   CDITNIEVVGGGSARCMLAEVFL"
FT   gene            386283..387218
FT                   /locus_tag="FTW_0394"
FT   CDS_pept        386283..387218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0394"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46329"
FT                   /protein_id="ABO46329.1"
FT                   /translation="MSKTRLYSWSEFDKSPRYAAHVPGGVLELMPTADKELFTYKYVNG
FT                   HPGNPKYGKQTVIATGQLSEIKHGYPLLISEMTILTALRTAAATILATDYLARKDSKTM
FT                   ALIGTGAQSEFQTLAHKLIRPIQTVRYFDTDPQAMKKYANNMKDVDLEFIACDSAKEAC
FT                   EGADIIVVCTACKLHAIVIENDWIKEGVHISGLGGDCPGKTELDMDILFRGKVVVEYKE
FT                   QSMIEGEIQNLSPQQVEQVLHAEVWEILTGNKKGCENDKEITIYDSVGFAIEDFSALRL
FT                   TLDLAEKYDIGSQMDMVPPIKDPKNLFSVL"
FT   gene            387289..388704
FT                   /locus_tag="FTW_0395"
FT   CDS_pept        387289..388704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0395"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.12"
FT                   /note="GO_function: GO:0004516 - nicotinate
FT                   phosphoribosyltransferase activity; GO_process: GO:0019358
FT                   - nicotinate nucleotide salvage"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46330"
FT                   /protein_id="ABO46330.1"
FT                   /translation="MSFDNLLLMTDSYKHSHRYQYPRDTHYLHFYLESRGTANKDLGNY
FT                   TKFFGLQYYVKKYLSQPITQQMIDDAEKILLAHGLPFYRSGFEKILNNYNGYLPIRIRA
FT                   VREGSLIPLHNVLMTIESTDEELFWLPGFVETLLLKVWYPTTVATISFNIKQLIKRYLL
FT                   ETADSLDKLDFMLHDFGYRGVSSEESAGIGGAAHLTNFLGTDTLAALHVCKEFYAEDMA
FT                   GFSIPASEHSTMTSWGVGTECEREAFENMIAQFGDSSVLYACVSDSWDFKKAIQTWVDL
FT                   KDRVTAKKANLVIRPDSGDAVDNILYALYELDKGYGSRLNSKGYKVLNNVALIQGDSVS
FT                   ISLAKKVLEAMKIQGYSAENIAFGMGGALLQGNYESSINRDSFKFAIKCSAIMRGNTLI
FT                   GVKKEPITDLAKKSKQGRLDLIKDAKGNYKTIVLDDSYALGEYHPESQLQTYYDNGEIK
FT                   FEQSLAQIRNYTN"
FT   gene            388789..389016
FT                   /locus_tag="FTW_0396"
FT   CDS_pept        388789..389016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46331"
FT                   /protein_id="ABO46331.1"
FT                   /translation="MLERHPLVKEFPELREQLHAIKEDHYISNQMKKYEDLDKKIYSLE
FT                   STGMFEDSQLEDLKKQRLEIKDMLYKALKS"
FT   gene            389166..390379
FT                   /locus_tag="FTW_0397"
FT                   /note="putative sugar transporter"
FT   misc_feature    389166..390379
FT                   /locus_tag="FTW_0397"
FT                   /note="contains frameshift"
FT   gene            complement(390372..390860)
FT                   /locus_tag="FTW_0399"
FT   CDS_pept        complement(390372..390860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0399"
FT                   /product="thioesterase family protein"
FT                   /EC_number="3.1.-.-"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46332"
FT                   /protein_id="ABO46332.1"
FT                   /translation="MINLDDYKPIDFPWNFTCFSDIAKNPLGVKLPLYHIGEHMYTKFK
FT                   CLPNHVGWDNVIHGGIIALICDDILGKHVLSISKSFCMTRNLNIKYLKPTYSKVEHIFK
FT                   TTVIRKGRTTVWIKVDIFNEKGDLCAYADADFALLEEHHAKQKDIANYKLDDLVAHLK"
FT   gene            complement(390922..392109)
FT                   /locus_tag="FTW_0400"
FT   CDS_pept        complement(390922..392109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0400"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="GO_function: GO:0003985 - acetyl-CoA
FT                   C-acetyltransferase activity; GO_process: GO:0006631 -
FT                   fatty acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46333"
FT                   /protein_id="ABO46333.1"
FT                   /translation="MSENVYIVAAKRSAVTKGKKGGFAKKRPDELLADVLRRTVAEANI
FT                   NPNDIEDIVVGCAMPEAEQGLNVARISSLLAGLPNSVPAFTINRYCSSGLQSIAIAANE
FT                   IAQGNIDVAIGAGVESMSMIPFGGNKMSFSKEIFAKDENVAIAYGMGITAEMVAKDWNV
FT                   SRQDQDAFALESHQKAIHAIESGYFKDEILPIDVDHNKPDEATGEIIIHKQTITEDEGA
FT                   RKDTSLEALAKLKPAFANGGSVTAGNSSQVSDGAAAVILVSEKYLKEHNLKPLGKFLGF
FT                   AVAGVDPRIMGIGPIKAIPKVLRQTGLNIDDIDWIELNEAFAAQSLAVINDLKLDKNKV
FT                   NPCGGAIALGHPLGATGTILTVKALHGLQRTSKKYAMITMCIGTGMGAAGIIEAC"
FT   gene            complement(392122..394818)
FT                   /locus_tag="FTW_0401"
FT   CDS_pept        complement(392122..394818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0401"
FT                   /product="fusion product of 3-hydroxacyl-CoA dehydrogenase
FT                   and acyl-CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46334"
FT                   /protein_id="ABO46334.1"
FT                   /translation="MTELEKKFEEMLIAVRDATIDFKPDNSQKLKLYAFYKQVKEGDNN
FT                   TKKPSALKMVERAKWMAWDAIKGMSKEDAMRGYLRVFGEEYLPAGESDNDSPSSTIASK
FT                   LEPVESKSQRKAIDKIAVLGAGTMGAQIAAHFANAKFLVVLFDLKSQQGSANVIIEDSL
FT                   AKLTKLNPAPFGSKDSIKYITPANYEDNLELLADCDLIIEAVAERIDIKESLYTKISSH
FT                   IKENAILASNTSGLSITKLAQVLPENLKVNFCGVHFFNPPRYMPLVELIPHADTNSEIL
FT                   DKLETFLVEKLGKSIIRAKDTPNFIANRLGVFSMLVTCYYTEQMNIPLEVVDELTGKKL
FT                   GRAKSATYRTADLVGLDVLSHVVETMKDNLEDGWQKLYNTPNWIQNLINNGSLGQKTKK
FT                   GLYIKASDGIKVLDLGTNEYRPADKKADKEILDILAERDWSKKLEGLRNSDNHQAQFLW
FT                   ATFREMFLYAAHLVGDISNFPKDMDLAIRWGFGWKQGIFEIWQLAGWHKVASWLKDDIS
FT                   TGKALSTNTLPSWIDTLDISVYQNNKEFSYKDKELISRDSLDVYKRQLFADNIVEHTST
FT                   LATQTLYENDGVKLWQIDDYSNIGILSFKSKMCAIGDDVLDGISESINYAEEKLDGLVI
FT                   WQEQDVFSVGANLEEFGIKFAMNGEAAIEEVIRKGHSIISKKLRYSKIPVVAAVKGFAF
FT                   GGGCETILHSDAAVAAYESYIGLVEAAVGIIPGWGGSKEMAVRASQAQDHWKDFERRYK
FT                   NLALAQVAKSAYEAKEMGFLRDDDIVVMNTKEILLVAIKKAQLMALAGYQPPLKQKVPV
FT                   FGETGIATIKALLVNMRDGNQISEHDYKIAVNLADTMCGGQIEKDTEVSEDWLLERELI
FT                   NFKELAISEKTEARMKYMLETGKPLRN"
FT   gene            complement(394891..397131)
FT                   /locus_tag="FTW_0402"
FT   CDS_pept        complement(394891..397131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0402"
FT                   /product="acyl-coenzyme A dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="GO_function: GO:0003995 - acyl-CoA dehydrogenase
FT                   activity; GO_process: GO:0009062 - fatty acid catabolism;
FT                   GO_process: GO:0009395 - phospholipid catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46335"
FT                   /protein_id="ABO46335.1"
FT                   /translation="MFNKIYKIAKKATPAISQTEQTALNAGNNWFEQDIFQGKPDFNKL
FT                   HSLKKFELTAEEKSFLANETTELCKLIDDWKINYQEKDLSVEAWDFIRNKGFLGLVIGK
FT                   EYGGKGFSAAAHSEIVMKLATKSVTAAITVMVPNSLGPGELLVHYGTDEQKDHYLPRLA
FT                   SGQEIPCFALTGPTAGSDATSLPDYGVVCHEEFNGKKTLGIKLKNINKRYITLAPIATL
FT                   VGLAFQLQDPDNLLGDTGKEGITCALLPYNHKGLEIGKRGFPLGQTFMNGYIKAKDVFI
FT                   PIDWIIGGQKMAGEGWRMLVECLSIGRAISLPACGTANTLMSAVMTAAYASVREQFKVP
FT                   IAQFEGVQEKLAQTAGLAYIANATRQFTVAAVDSGLRPSVSSAIAKYHLTEMGRTTINN
FT                   AMDIHGGRAIIMGPNNYLAIPYMATPIGITVEGANIMTRNLMIFGQGAMKCHPYIRNEI
FT                   ESLMNDDEEQFTTNFKSHFKYMALNGSRTLWYGLSGGFTAPSYPSKFKRYYRYISHMST
FT                   AYSYVNDISITVLGAGLKRKERLSARLGDIMSYLYMAVAVLKYYKDTGEPQSDDIYVDW
FT                   SIQHCLYQAQQAMLDLFRNFPNRIFATKMKLFVFPYGKKFRRPSDKLEAQICNSLVSNS
FT                   DTRQWMKDKCYIPNDDNDPIGRVENAYLASLTTQPIKKKIIDAIKTAKLPKASWQNSID
FT                   IALENKIITQQEANIAHEMLTKVNNIIQTDEFDDYALGPKNAHLEWQKDTDK"
FT   gene            complement(397169..398857)
FT                   /locus_tag="FTW_0403"
FT   CDS_pept        complement(397169..398857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0403"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46336"
FT                   /protein_id="ABO46336.1"
FT                   /translation="MITKPWTKNYPKKVPLNIDISDITLKDMLEEATKTFANKKALSCH
FT                   GEKLNFSEIDSYADKFAGFLQNKWKLRKGDHIAIMLPNLLQFPIIIFALVKLGCVFVNI
FT                   NPLYTSREVKGILQDSKAKGVIVLSGLAHNVEAIADECKDLKYKMVTGIADLYPMPKKQ
FT                   IISFVVKYIKGMKDKYSKDKFDSFTDAIESSHTPDYSSIGLKPDDIAALQYSSGTTGTP
FT                   KGTILLHKNIVANIYQIKAWTEGFDIELSEQIVLTALPIYHIFSLTANLFLFYCFGAFQ
FT                   ILIPNPKDIKSLVAEMRKSNFSTIFAVNTLYIALLNNKKFRKSNFSNFKLSISGGMSTS
FT                   EAVANEWKKVTGVNIKEGYGLSEMSPVVTVNSLEDSDFNGSVGFPLPNTDVKIYDDKGN
FT                   ELPQGETGEIWVAGPQKSPGFWSLPEINKEHFTDDGWLKTGDMGYLDAQGRLVISGRIK
FT                   HMIIVSGFNVFPKEVELVLTEREEIEDAAVIKGHSNETGEMPVAFVVLKNDKKLTEKEI
FT                   FKYCETKLAHYKLPRKIIFTDELPKNTVGKIDVNALQKEYAEKYE"
FT   gene            399073..399420
FT                   /locus_tag="FTW_0404"
FT   CDS_pept        399073..399420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0404"
FT                   /product="putative arsenate reductase, ArsC family"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46337"
FT                   /protein_id="ABO46337.1"
FT                   /translation="MKFYHNPKCSKSRQAKQILDQNNIDYEIHLYLDKPLSKDQVIVLL
FT                   QKLKLSIRDIIRTKENIWKENFSDKEFTEAELIEIVVANPGLLERPIIENGDFAVVARS
FT                   DEKIQQILNTY"
FT   gene            399469..401685
FT                   /gene="icd"
FT                   /locus_tag="FTW_0405"
FT   CDS_pept        399469..401685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icd"
FT                   /locus_tag="FTW_0405"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="GO_function: GO:0004450 - isocitrate dehydrogenase
FT                   (NADP+) activity; GO_process: GO:0006099 - tricarboxylic
FT                   acid cycle"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46338"
FT                   /protein_id="ABO46338.1"
FT                   /translation="MHKIFYTFTDEAPALATGSFLPIVESFTKVADIELETKDISLSAR
FT                   ILANFNDYLTAEQKCSDDLAILGELAKTPDANIIKLPNISASIPQLTAAIKELQSKGYK
FT                   IPDYPYEPKDDKEQEIKARYAKVLGSAVNPVLREGNSDRRVADAVKKYAEKHPHSMGEW
FT                   TKDSKSHVASMSADDFYANEKSYIVPKATKVKIVHIDTKGTQTVLKDNLALEEKEIIDA
FT                   TKISIKALREFYKNEIAKAKKEGTLLSLHLKATMMKVSDPILFGHAVEIFFEDIFKKYA
FT                   KEFKELGVNPRNGWGDAVEKIKQLPQELQDKINADIEKVFAKQPDIAMVNSNKGITNLN
FT                   VPSDVIIDASMPAAIRSSGKMWNKDGKLQDMKAMIPDRCYAGVYAATIDFCKENGAFDV
FT                   ATMGDVSNVGLMAKKAEEYGSHDKTFEIQADGKVEVIDAEGNVIFEHQVEKGDIWRACQ
FT                   TKDIAVKDWVKLVVNRAKITQNPAIFWLDSKRAHDRNLIAKVNEYLTHHDTTGLDIQIL
FT                   SPVEATKYSLKRMKEGKNTISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLLAGGGLF
FT                   ETGAGGSAPKHVEQLIEENHLRWDSLGEFLALGASLEDLAIKTRDAKIKVLAETLSQAN
FT                   KDFLDNDKSPRRKVGELDTRGSHFYLAYYWVKALAEQTGNAELKAKFEPIYIELKANKD
FT                   KIVKELNDAQGKKVDVGGYYHMDRVKLDAVMRPSKTFNTILAQI"
FT   gene            401699..402586
FT                   /locus_tag="FTW_0406"
FT   CDS_pept        401699..402586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46339"
FT                   /protein_id="ABO46339.1"
FT                   /translation="MAEIKNDEYIEISLIKILVGLFSNIKTFLVVLVLGCCLTAVAAWL
FT                   FKPSYSYLQMIQPPYYLKGYSANSIISDNKLNVILNNILQDAQQSQPDNKILNNIDIIK
FT                   PGDDVDVKSNKDEKAIYFGLSTSAKLSDKGAIDSVFSDVMERFSNSNIVQRQIKLWKDN
FT                   LQRTILANQQNIDRYKQIIKSDQDYVKQLSSSKNVGSLQGQTLLASYMERIDSYQNKVF
FT                   SLEDSQKDLKLTLESLQSKVVGIGNIVYVKNSETSKVKLVVIGLVLSVVIALIVVFLKV
FT                   IFSRAITEYRNLKQ"
FT   gene            402610..406878
FT                   /locus_tag="FTW_0407"
FT                   /note="ATP-dependent helicase HrpA"
FT   misc_feature    402610..406878
FT                   /locus_tag="FTW_0407"
FT                   /note="disruption due to premature stop"
FT   gene            407360..408103
FT                   /locus_tag="FTW_0409"
FT                   /note="transposase ISFtu2"
FT   misc_feature    407360..408103
FT                   /locus_tag="FTW_0409"
FT                   /note="Every ISFtu2 ORF in this genome has a premature stop
FT                   at the identical position resulting in disruption of the
FT                   ISFtu2 sequence in compariosn to Schu4 ISFtu2 elements."
FT   gene            408344..409942
FT                   /gene="wbtA"
FT                   /locus_tag="FTW_0411"
FT   CDS_pept        408344..409942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbtA"
FT                   /locus_tag="FTW_0411"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="component of putative O antigen gene cluster;
FT                   GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_function: GO:0003824 - catalytic activity; GO_process:
FT                   GO:0009225 - nucleotide-sugar metabolism; GO_process:
FT                   GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46340"
FT                   /protein_id="ABO46340.1"
FT                   /translation="MSSFLLLRDYMASWRKSTQKTFLRKAFINLPVFFIVALFFYGKVT
FT                   FSLIFSEFLFYVFLISLSVYFYWYLMNRGSVDKSKTAVIYGAGAAGTKIAQELASAGYR
FT                   IKCFVDDNETLQKRSIDSKKVLSKAELTKLLLSSRFDLLVIALPRNANQVVKNIYKEFE
FT                   KDFNQIRIMPPLEEILQDENFMSQLKPVSLYDLLARDTKSLDKESISNFIKNKVVLVTG
FT                   AGGSIGSEIVHQCIKYQAKELILVDHSEFNLYKITEECSHFNINSVLCSVCDRKALAEV
FT                   FQKYTPNIVFHAAAYKHVPLVEENISRAIRNNILGTKNAIDLAIEAGVESFILISTDKA
FT                   VRPTNVMGATKRVCELYLQNVDPKNTKLAAVRFGNVLGSSGSVIPKFEEQIRNGGPVTV
FT                   THPEITRYFMLIPEACELVLQAGAIAKNSEVFVLDMGQPVKIIDLAKQFIRLSGRGDID
FT                   IKIVGLRPGEKLYEELLIEEDDVSTDYKDIFIGRRTFYDINTLNQDIESLIKDDVDQLV
FT                   ILKKIVPEFEHRLNG"
FT   gene            409935..410567
FT                   /gene="wbtB"
FT                   /locus_tag="FTW_0412"
FT   CDS_pept        409935..410567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbtB"
FT                   /locus_tag="FTW_0412"
FT                   /product="glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="component of putative O antigen gene cluster;
FT                   GO_function: GO:0016757 - transferase activity,
FT                   transferring glycosyl groups; GO_process: GO:0005975 -
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46341"
FT                   /protein_id="ABO46341.1"
FT                   /translation="MGSGFMFYEVFKRLLDILLSFMGLLLLSPIFLIIIFMIKKDSKGP
FT                   IFFKQKRYGKDKQFFYIYKFRTMYVDTPKDMPTHMLQDPSKCITKVGGFLRKSSLDELP
FT                   QIINILKGEMSIVGPRPALWNQDDLIAQRDKYGANAVPVGLTGWAQINGRDELPIPDKA
FT                   KLDGDYVKNKSTWFDLKCIFLTVFSVFAKKGVVEGGTGALGNKEDLK"
FT   gene            410569..411360
FT                   /gene="wbtC"
FT                   /locus_tag="FTW_0413"
FT   CDS_pept        410569..411360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbtC"
FT                   /locus_tag="FTW_0413"
FT                   /product="NAD dependent epimerase/dehydratase family"
FT                   /note="component of putative O antigen gen cluster;
FT                   GO_function: GO:0003824 - catalytic activity; GO_process:
FT                   GO:0009225 - nucleotide-sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46342"
FT                   /protein_id="ABO46342.1"
FT                   /translation="MKKRILVTGLSSYIGNSFAAKYNSDFSIDKISLRDVSWANIDLSG
FT                   YDAVLHVAGIAHTSKDPKLKEKYYKINTQLTYDLAKQAKDQGVRQFVFLSSIIVYGDSA
FT                   PIGQQKVITKYTEPKPDDFYGDSKLQTEIKLNSLASDDFNIAIIRPPMVYGEGSKGNYP
FT                   KLVKLAKYTFIFPNINNQRSVISIDNLSKEIAEIILQTKHGVFLLQDNEYFCTSQFIKN
FT                   YRKDVLGKRTYLTKIFNPIIRLLAKKVDFINKVFGNLTYEK"
FT   gene            411350..412441
FT                   /gene="wbtD"
FT                   /locus_tag="FTW_0414"
FT   CDS_pept        411350..412441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbtD"
FT                   /locus_tag="FTW_0414"
FT                   /product="glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="component of putative O antigen gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46343"
FT                   /protein_id="ABO46343.1"
FT                   /translation="MRSKLLFIANDFDIVIYRFRREVIESFAAKEYEIVLVTPYSKKAE
FT                   VFCKSLGVKYINVDIDRRGKNPFKDLLLLFNYFKIIKKEKPDYIFSYTIKPNLYVGLVN
FT                   LFFRKKFYPNVTGLGSVFANHGIVQKFIISLYKLSFKSTTKVFFQNEQNKKLFIAKKII
FT                   SGEKSILLPGSGVNLDENKYVDYPKDQGILKFVFLGRIMKEKGIYELLEAFAILEKKYK
FT                   NISLDIYGFCDENKSNFMGKVNTIKSVKFYGFTDNTKEKIASAHAVVLPSYHEGMSNVL
FT                   LEAAAIGRPVIASDIPGCREIFDDGLSGLSCNPNDVSSLRNSLEQFINMSYTDKIAMSY
FT                   KARAKIEKDFDRSIVVNAYLQQN"
FT   gene            412459..413769
FT                   /gene="wbtE"
FT                   /locus_tag="FTW_0415"
FT   CDS_pept        412459..413769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbtE"
FT                   /locus_tag="FTW_0415"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="component of putative O antigen gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46344"
FT                   /protein_id="ABO46344.1"
FT                   /translation="MSLYEDIVAKREKVSLVGLGYVGLPIAIAFAKKIDVLGFDICETK
FT                   VQHYKDGFDPTKEVGDEAVRNTTMKFSCDETSLKECKFHIVAVPTPVKADKTPDLTPII
FT                   KASETVGRNLVKGAYVVFESTVYPGVTEDVCVPILEKESGLRSGEDFKVGYSPERINPG
FT                   DKVHRLETIIKVVSGMDEESLDTIAKVYELVVDAGVYRASSIKVAEAAKVIENSQRDVN
FT                   IAFVNELSIIFNQMGIDTLEVLAAAATKWNFLNFKPGLVGGHCIGVDPYYLTYKAAELG
FT                   YHSQVILSGRRINDGMGKFVVENLVKKLISADIPVKRARVAIFGFTFKEDCPDTRNTRV
FT                   IDMVKELNEYGIEPYIIDPVADKEEAKHEYGLEFDDLSKMVNLDAIIIAVSHEQFKDIT
FT                   KQQFDRLYAHNSRKIIFDIKGSLDKSEFEKDYIYWRL"
FT   gene            413769..414740
FT                   /gene="wbtF"
FT                   /locus_tag="FTW_0416"
FT   CDS_pept        413769..414740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbtF"
FT                   /locus_tag="FTW_0416"
FT                   /product="NAD dependent epimerase/dehydratase family"
FT                   /note="component of putative O antigen gene cluster;
FT                   GO_function: GO:0003824 - catalytic activity; GO_process:
FT                   GO:0009225 - nucleotide-sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46345"
FT                   /protein_id="ABO46345.1"
FT                   /translation="MAYDNVKFPHGSFFLVTGGAGFIGSNLCEVLLSKGYRVRCLDDLS
FT                   NGHYHNVEPFLTNSNYEFIKGDIRDLDTCMKACEGIDYVLHQAAWGSVPRSIEMPLVYE
FT                   DINVKGTLNMLEAARQNNVKKFVYASSSSVYGDEPNLPKKEGREGNVLSPYAFTKKANE
FT                   EWARLYTKLYGLDTYGLRYFNVFGRRQDPNGAYAAVIPKFIKQLLNDEAPTINGDGKQS
FT                   RDFTYIENVIEANLKACLADSKYAGESFNIAYGGREYLIDLYYNLCDALGKKIEPNFGP
FT                   DRAGDIKHSNADISKARNMLGYNPEYDFELGIKHAVEWYLIN"
FT   gene            414757..415986
FT                   /gene="wzy"
FT                   /locus_tag="FTW_0417"
FT   CDS_pept        414757..415986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzy"
FT                   /locus_tag="FTW_0417"
FT                   /product="O-antigen polymerase"
FT                   /note="component of putative O antigen gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46346"
FT                   /protein_id="ABO46346.1"
FT                   /translation="MYIKKVSFKILYLYLLAFCIIFSLEFKFAILNIIVYLPACILGFL
FT                   ALKKLFVGNIVKKQLAFLFFFFFLSMIYLIIVQIILLDAASLFPQFLFNILIAIGFCNF
FT                   IFVSYDNNENYFFNMSKIIFFVTFLQSIFVFLSRYYIFLNDWIFFFLVKKGNIEISNVI
FT                   EYKLRVFGLSNAGGDGLGFSITIGLCFSIFYFIKYIKGKSIFTKLMLFVPLILIVFSNI
FT                   FISRTSLLTSSLILLITIFYIYIKKEKLLFIIILALFFLSIWILFKLNLNLSWAFENIY
FT                   SYIQSGDFSHGSLSVLINKMLFVPDNLLTWIFGCEDVSNTDIGYIKYLYYYGIIFSMFF
FT                   YILIIFLYFEMRKCFISSEYRSLFLLLLIVCLVFQAKIIFLTVGLFTKLTIILFIFSLK
FT                   ENSFTTRSVI"
FT   gene            415983..417083
FT                   /gene="wbtG"
FT                   /locus_tag="FTW_0418"
FT   CDS_pept        415983..417083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbtG"
FT                   /locus_tag="FTW_0418"
FT                   /product="glycosyltransferase group 1"
FT                   /EC_number="2.4.1.-"
FT                   /note="component of putative O antigen gene cluster;
FT                   GO_function: GO:0016757 - transferase activity,
FT                   transferring glycosyl groups; GO_process: GO:0000271 -
FT                   polysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46347"
FT                   /protein_id="ABO46347.1"
FT                   /translation="MKRFVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVF
FT                   ANKLEAYGVKVYTLNLNKFNVLFVLFKYIKIIRRIKPDVIHAWMYHANVISILCKPFYR
FT                   KTKYINSIRMGLENYDGHKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQC
FT                   FIANGFDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNISRFLQIANLLLKS
FT                   NPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGFP
FT                   NILAEAMLCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRM
FT                   REYIINNFSIEAILEKHEKLYHEGSV"
FT   gene            417083..418969
FT                   /gene="wbtH"
FT                   /locus_tag="FTW_0419"
FT   CDS_pept        417083..418969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbtH"
FT                   /locus_tag="FTW_0419"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="component of putative antigen O gene complex;
FT                   GO_function: GO:0004066 - asparagine synthase
FT                   (glutamine-hydrolyzing) activity; GO_process: GO:0006529 -
FT                   asparagine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46348"
FT                   /protein_id="ABO46348.1"
FT                   /translation="MCGVVGFYSFNKEEGFDSIINQSLLSIKHRGSDDSGYWCDNQVTL
FT                   GHTRLSIHDITNAGHQPMLSNSGNTAIVFNGEIYNYLSIKNQLLSEYSNLKFKSNSDTE
FT                   VLVNAIELWGIDKTLEKCIGMFAFGVYSRKTSCLILARDRFGEKPLYFGIQNGILGFAS
FT                   ELKALKPLKECGWRFDIDRDALATYMRYAYVPTPYSIYKNISKLNVGSYIKFDAKGNSK
FT                   EYKYWDSKKVLDSEKYKDSYDQAILDLEIKLKSTLSIQMQSDVPLGAFLSGGIDSTTVV
FT                   ALMQSMSKDKINTFSIGFNQKEYNEAEHARAVAKHIGTNHTDMYVTERDALDVIPKLAG
FT                   IYDEPFADSSQIPTYLVSKIAKSKVTVALSGDAGDELFGGYNRYFLAPNIAKKIKFAKL
FT                   LKYAPDAWIKKAEILNFGKFALLADKLLKLKRVLEKAKTNKELYVLLCSQINDTSFVLG
FT                   AKEYDILRDKNIYDIPQLSFQEWMMFVDSNTYMIDDILVKVDRAAMANSLETRVPFLDH
FT                   NIYEFAYSLPIDYKIQRGNGKRILKDLLYKYVPESLVNRSKMGFGIPLAKWLREDLREW
FT                   ADNLLDYSKIDKQGYLSPEVVQKYWQEHLSGKRNWQAILWNILIFQEWLDNE"
FT   gene            418962..420044
FT                   /gene="wbtI"
FT                   /locus_tag="FTW_0420"
FT   CDS_pept        418962..420044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbtI"
FT                   /locus_tag="FTW_0420"
FT                   /product="aminotransferase, DegT/DnrJ/EryC1/StrS family"
FT                   /EC_number="4.2.1.-"
FT                   /note="component of putative O antigen gene complex"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46349"
FT                   /protein_id="ABO46349.1"
FT                   /translation="MSKVNVTKPYLPDINKYKSYVNKIYKNGWLTNNGPLVQELEKRLA
FT                   KYLGVKNIVLVSNGTIALEIAYRALGVKGSAITTPFSFVATTSSLVSNNVKPVFVDIDE
FT                   NTLSIDVSKIKYAIEEDTSAIVPVHVFGNGCEVEKIDMLAKKHNLKVIYDAAHAFDVKY
FT                   KGESILNYGDISTLSFHATKIFHSIEGGALIINDDSLVEKVRYFINFGIESSESIPYLG
FT                   TNAKMNEFEAAMGLCVLDDIIEIKSKRKVITEIYEAGLDGLVKFQEQNQHSSRNYSYFP
FT                   VIFRTEEELLRVQKALIQNDIISRRYFYPSLDSLSYIEPKQYMPISRDISKRILCLPIY
FT                   AELEDDKINKIINNIKEVSS"
FT   gene            420041..420766
FT                   /gene="wbtJ"
FT                   /locus_tag="FTW_0421"
FT   CDS_pept        420041..420766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbtJ"
FT                   /locus_tag="FTW_0421"
FT                   /product="formyltransferase"
FT                   /EC_number="2.1.2.-"
FT                   /note="component of putative O antigen gene complex"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46350"
FT                   /protein_id="ABO46350.1"
FT                   /translation="MKKIFVVTDNRTILSDFKNIIGSKNDVEVDYFCSFKSQTSFAKEI
FT                   YNSEIKPIDMKKNGNDLIGKYDLGFSCHSKQLFPAKLVNSVLCINIHPGLNPYNRGWFP
FT                   QVFSIINKLPIGATIHVMDEEIDHGDIIIQEEVEVNSFENSFDVYAKVQKKEVELFTKV
FT                   IDDILNNKFTRIKPNSEGNYNSIHDYKNMCEIDLDKIVTMREAIDYLRAMTHPPYKNSY
FT                   FIDEHGNKVFVALELEKIS"
FT   gene            420771..422258
FT                   /gene="wzx"
FT                   /locus_tag="FTW_0422"
FT   CDS_pept        420771..422258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzx"
FT                   /locus_tag="FTW_0422"
FT                   /product="O-antigen flippase"
FT                   /note="component of putative O antigen gene complex"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46351"
FT                   /protein_id="ABO46351.1"
FT                   /translation="MSLKKNTISNYITQLYTSLIGIVILPLYLQHLSHDAFGLIGFFTV
FT                   FQTWLRLLDVGITPTLSREVAHVRGSTDDYHYLRKLVRSLELFFIIVGVLVFIVISTHS
FT                   RYISTSWLHIGSLDADSVSVCIALMGLMFALRWVSDLYGGGLRGFERQVLYNNLSIIQT
FT                   TLQFIGGLLFICYVSTNIMYYFVYQTIIAILYLVCIAIAFYKILPSSFSVGLRFDFKII
FT                   RKVLPFALGIAYSTTVWIIVTQSDKLVFSHVLPLSEYGYLSLLIVISGAVTILSSPISI
FT                   AIQPRMTMLLAQQNVKGMESLYLKSSLISITFLSAVVTCVLMYSHQLLQSWTGSMEIAN
FT                   WGSNILNIYVLSASIICIISFQYFLQYAYGKLKLHNTYNTISLVFFAPIVIYTAYNYGV
FT                   YTTALLWLGYAIVGLIIWMPIVHHVFAKGINRYFFINLAVITIVCFLLSLIFKGWYIYP
FT                   SKIGLVELILIGFAFLFIQICIEYVLFRYKVLRCIDD"
FT   gene            422251..423111
FT                   /gene="wbtK"
FT                   /locus_tag="FTW_0423"
FT   CDS_pept        422251..423111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbtK"
FT                   /locus_tag="FTW_0423"
FT                   /product="glycosyltransferase group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="component of putative O antigen gene complex"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46352"
FT                   /protein_id="ABO46352.1"
FT                   /translation="MIKVSVCVMTYNQEKYIGQCLESLVTQETDFDFEIIVGDDFSTDG
FT                   TRDVIQEYQKKYPDIIKPVFRDKNVGITENIKEIYFVANGEYIAHMDGDDYALPGKLQI
FT                   QADFLDNNPRCTGVFHNINILYPNGNIQHSRFACSNKSIFNLSDTLRGVAVGANSSKMF
FT                   RTSVLDDLILPDIELLDYYFHVITAEKGYLSFLNSNESYSVYRKGIGITSKSKEKIYNT
FT                   YAGLFEYFLDRYPEEKLNICIPVVQMIISAIKGRCFISAIRLFKILIRSRCIPLVSWFK
FT                   YRFEK"
FT   gene            423136..424020
FT                   /gene="wbtL"
FT                   /locus_tag="FTW_0424"
FT   CDS_pept        423136..424020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbtL"
FT                   /locus_tag="FTW_0424"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="component of putative O antigen gene complex"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46353"
FT                   /protein_id="ABO46353.1"
FT                   /translation="MKGIILAGGSGTRLYPLTLGVSKQLLPVYDKPLLYYPLSVLMLAG
FT                   IREILIISTVRDISLIQELLGDGSQFGIQLSYKIQPSPDGLAQAFILGEEFLAGDSACL
FT                   ILGDNIYYGQGMTTMLESARAQCGGPAGGACVFGYYVNDPHRYGIVEFDKQKNVISVEE
FT                   KPQNPKSHYAITGLYFYDNNVVEYAKQVKPSARGELEITSLNELYLKENKLNVELLGRG
FT                   FAWLDAGTHDSLLEAGQYVATIEKRQGLKIACLEEIAWRKGFISTQQVLAQAEKLSKTE
FT                   YGQYLKNLIKDSL"
FT   gene            424132..424326
FT                   /locus_tag="FTW_0425"
FT   CDS_pept        424132..424326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46354"
FT                   /protein_id="ABO46354.1"
FT                   /translation="MTKNGFMYILTNKDNTVLYIVVTSNLIKRMYEHKHSLADGFTKKY
FT                   NVNKLVYFEIYEDIKAAIL"
FT   gene            424583..425584
FT                   /gene="wbtM"
FT                   /locus_tag="FTW_0426"
FT   CDS_pept        424583..425584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbtM"
FT                   /locus_tag="FTW_0426"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="GO_function: GO:0008460 - dTDP-glucose
FT                   4,6-dehydratase activity; GO_function: GO:0003824 -
FT                   catalytic activity; GO_process: GO:0019305 - dTDP-rhamnose
FT                   biosynthesis; GO_process: GO:0009103 - lipopolysaccharide
FT                   biosynthesis; GO_process: GO:0009225 - nucleotide-sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46355"
FT                   /protein_id="ABO46355.1"
FT                   /translation="MNYKPKNILVTGAAGFIGSNYVRMMLSRYSDIKIISYDKLTYAGS
FT                   LDNLKDLNNEHNHTFIKGDICDEVLVYQTMKEYKIDTIVHFAAESHVDNSIANPKVFLE
FT                   TNVIGTFTLLDCAKRYWLDELGLEETSCRFHHVSTDEVYGTLAKDEPAFTEIKAYEPNS
FT                   PYSASKAGSDHIARAYHHTYKLPVTISNCSNNYGPYQHREKLIPVVINSCINYKPIPVY
FT                   GDGSNIRDWLYVEDHCDAIQTIVEKGVVGEVYNIGGINEVDNLTLVKTICKLMDEYKPE
FT                   NAPHSNLITFVEDRKGHDWRYAIDNSKIQNELGWKPSQDFDKMFRQTIEFYL"
FT   gene            425713..426593
FT                   /locus_tag="FTW_0427"
FT   CDS_pept        join(425713..426042,426042..426593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0427"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46356"
FT                   /protein_id="ABO46356.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            complement(426658..427173)
FT                   /locus_tag="FTW_0429"
FT   CDS_pept        complement(426658..427173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0429"
FT                   /product="acetyltransferase"
FT                   /EC_number="2.3.-.-"
FT                   /note="GO_function: GO:0008080 - N-acetyltransferase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46357"
FT                   /protein_id="ABO46357.1"
FT                   /translation="MHVKIRYEKLKDQELIYKLISEAFDTSDEEKLVRLLHTDHQSLIS
FT                   LVAETDDSSIIGQAIISKMTAEKDETLKIYALAPMSVAPKYQHQGIGSKLIEAIIKEAK
FT                   KNNIDAIFVLGHPSYYPKFGFKPATEYQIKCEYDVPADVFMVLDLSAKLASLKGQTVYY
FT                   AEEFGKIF"
FT   gene            complement(427178..427894)
FT                   /locus_tag="FTW_0430"
FT   CDS_pept        complement(427178..427894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46358"
FT                   /protein_id="ABO46358.1"
FT                   /translation="MKIARYKKGFIKASEYNSKLHFDNIFCPDCGKAKVKIVRKADQEP
FT                   YFVFVQDQLHDELCPRVAKPIQDQKIKELILSDSKKDMSKLNYLVNKNLEKCINLVTKL
FT                   ENNSELKKADELNLMPQKKQQITEKRIKEYAKQDIYTINIVDLSDIDTQQLNNKYCLIY
FT                   GVAGITLADVGDSKKLFFKADQDSRFSLFVVPSQIKYLDFDKGKRAKFAVFGRFKKVGK
FT                   FINLEIRSTRDLVIRD"
FT   gene            complement(427904..428595)
FT                   /locus_tag="FTW_0431"
FT                   /note="putative methyltransferase"
FT   misc_feature    complement(427904..428595)
FT                   /locus_tag="FTW_0431"
FT                   /note="contains frameshift"
FT   gene            428665..429300
FT                   /locus_tag="FTW_0433"
FT   CDS_pept        428665..429300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0433"
FT                   /product="amino acid transporter, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46359"
FT                   /protein_id="ABO46359.1"
FT                   /translation="MLIFLTILALQISCLILPGPDFFVTISNSIKFGHKSGIYTASGVA
FT                   SGIFLNTFIVYWFGSLLLYKQPLLFKMLILIGAAYLAYIAFSLYKSIFTIQQLNPNANQ
FT                   HIKNLDNFDKPSNTKFFLNGAFTNLANAKVLVFFSSMLSLVDELNSFGKVAIWIAIALT
FT                   TLVWFCIVATFFGNDKLRQVFFRNIKKIEFISAIFITIFVIVILVELF"
FT   gene            complement(429297..430187)
FT                   /locus_tag="FTW_0434"
FT   CDS_pept        complement(429297..430187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0434"
FT                   /product="NAD(+)/NADH kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="GO_function: GO:0016301 - kinase activity;
FT                   GO_process: GO:0019363 - pyridine nucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46360"
FT                   /db_xref="GOA:A4IWQ8"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWQ8"
FT                   /protein_id="ABO46360.1"
FT                   /translation="MAFKYHKVAIVGKHYKKEVSQMVETLYAYLQQQGLEIIIENDTAA
FT                   DTSLVNVAIASLKEIALRCDVAIVVGGDGNFLKASRLLALYSNIPVIGINKGKLGFLTT
FT                   LAADDNALKNDLYAILKGDSSVTKMSMLKYRVDNNLRAPLEASIALNEIAITASRGLMF
FT                   GLKVFIDGRYAFDQRGDGLIVSTPTGSTAHAMSAGGPILNPNQNSVVLVPICSHSLNSR
FT                   PLVISDESVIDIYITDYNDPESVLSIDGRHDTILKAHQKVTIQKARKKVTVLHTKDYNY
FT                   YDTLREKLGWSKVLF"
FT   gene            430376..431320
FT                   /locus_tag="FTW_0435"
FT   CDS_pept        430376..431320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0435"
FT                   /product="glucosyl transferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="GO_function: GO:0016757 - transferase activity,
FT                   transferring glycosyl groups; GO_process: GO:0005975 -
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46361"
FT                   /protein_id="ABO46361.1"
FT                   /translation="MDNKDKLTSIIIPVKDEAEGIEHLFARLMPILEKLPTKYELVFIN
FT                   DGSNDNTLELLLEKQKDIPEIAIVDLSRNFGKEAALFAGFANCNGDAAISIDADLQDPP
FT                   ELILEMVQHWLDGYEVVTAVRENRDTDTSTKKHTAGLFYKVMNKISDTKLTPNAGDYRL
FT                   LNRAAVNAFLELKEKIRFNKGLLTWIGFKEKIVYHAREERAAGQTKWNYWKLFKFSIDG
FT                   ITSFSRAPLEIWSCIGGVVALISFIYGSIIVLKSLLFGVDVPGYPSLVTFILFFSGLQM
FT                   IGIGMLGSYIGRIFIETKHRPLYIIRQVHRAKE"
FT   gene            complement(431324..432103)
FT                   /locus_tag="FTW_0436"
FT   CDS_pept        complement(431324..432103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0436"
FT                   /product="ABC-2 type transporter, membrane protein"
FT                   /note="GO_component: GO:0043192 - ATP-binding cassette
FT                   (ABC) transporter complex (sensu Bacteria and Archaea);
FT                   GO_component: GO:0005887 - integral to plasma membrane;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46362"
FT                   /protein_id="ABO46362.1"
FT                   /translation="MNLRDYWITYVTIFNRECKRVFRIWPQTLLPSVITIVLYFLIFGK
FT                   VVGSRIGSMGDGVTYMQYITPGLIIMAVIQNSYGNVVSSFFGIRFSKAIEELLVSPVSN
FT                   HLIVLGYISGGIFRGFIVGMFVSVAAFLLGGFATIHNVPLVLAGFIFCGALFSLGGLIN
FT                   AIFSQKFDDTTIFPTFILTPLIYLGGVFYNINNLTGFWHFISSCNPLFYIVDFVRYGFI
FT                   GVSTVNPYFAFAAIVIFTFVLYYLCWYLLEKGIRLKA"
FT   gene            complement(432112..433035)
FT                   /locus_tag="FTW_0437"
FT   CDS_pept        complement(432112..433035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0437"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="GO_component: GO:0043192 - ATP-binding cassette
FT                   (ABC) transporter complex (sensu Bacteria and Archaea);
FT                   GO_component: GO:0009898 - internal side of plasma
FT                   membrane; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46363"
FT                   /protein_id="ABO46363.1"
FT                   /translation="MDNQKALEIKNLTKVYKGGLKAVDDISFEVKKGDFFALLGPNGAG
FT                   KSTTLGMISSLVNKTSGQIKIFGHDIDTDYIQARKHLGVMTQEINLNIFEKPIDILITQ
FT                   AGFFGISKKDAIPYAEELLKKVDLYEKRNTQVRFLSGGMKRRLMVVRALIHKPKLLILD
FT                   EPTAGVDVELRNSLWEMISEFHREGLTIILTTHYLEEAESMCKHIALINKGKLSVNTDM
FT                   KTFLKSADKHTYIFDLKDKCQQEIKLDLGEVKRVDDYTIEVEVSKGVVLNQIFAELSSK
FT                   YDLDVLDVRSKAAKLEKLFIEVARNK"
FT   gene            433206..433949
FT                   /locus_tag="FTW_0438"
FT                   /note="transposase ISFtu2"
FT   misc_feature    433206..433949
FT                   /locus_tag="FTW_0438"
FT                   /note="Every ISFtu2 ORF in this genome has a premature stop
FT                   at the identical position resulting in disruption of the
FT                   ISFtu2 sequence in compariosn to Schu4 ISFtu2 elements."
FT   gene            complement(433999..434721)
FT                   /locus_tag="FTW_0440"
FT   CDS_pept        complement(433999..434721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0440"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46364"
FT                   /protein_id="ABO46364.1"
FT                   /translation="MGFLASFIDAIAGGGGLISIPALSLTGLPIVTVLGTNKFQASIGT
FT                   GMAVLKYYKSGLIDIKTVVRGLVAGFIGACCGTLLTLLIHNDFMNNIVPILLIAVFIFS
FT                   IVNKNLGVAQGKKRMSEVAFFTLFGFILGAYDGFFGPGTGNLWIIAIVYFLGYTFLQAS
FT                   GYAKMLNLKSNVFSLTVFALSGQVNIAFGLLMALGSFFGGIAGSRMVILKGSKLVRPIF
FT                   IIVVGASILLMIKTRYFS"
FT   gene            complement(434775..435101)
FT                   /locus_tag="FTW_0441"
FT   CDS_pept        complement(434775..435101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46365"
FT                   /protein_id="ABO46365.1"
FT                   /translation="MIKQTSTNIYDLEPKNSNQEVFTDLLKNHDIHIEKIISYGQVTPV
FT                   DQPYIQTHDEWVVVLSGQAQLKLEDQYYDLKQGQHLFIAKNTRHWVTFTTNPTIWLAIH
FT                   FGRL"
FT   gene            complement(435227..435994)
FT                   /locus_tag="FTW_0442"
FT   CDS_pept        complement(435227..435994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0442"
FT                   /product="hydrolase, TatD family"
FT                   /EC_number="3.-.-.-"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46366"
FT                   /protein_id="ABO46366.1"
FT                   /translation="MIIDSHCHLNYLKLEDITLEQVINNAKKADIDKIVSIAVAWHEIE
FT                   DIQKIAEDYSDVYFSVGVHPSELDTHQPSVDEIIVRSQHQKCVAIGETGLDYYYNSSDT
FT                   KKAQIDKFAKHIQAANQVNKPVVVHTRAAKQDTLDILKAENVEKCGGILHCFTEDYDMA
FT                   KKALDMGMYISFSGILTFKNAKDIQETAKKLPLDRILIETDAPYLTPVPLRGKPNYPEY
FT                   VKYIAQFLADLKGVSYQQVATQTYQNTCEIFKF"
FT   gene            complement(436077..437460)
FT                   /locus_tag="FTW_0443"
FT                   /note="major facilitator superfamily (MFS) transport
FT                   protein"
FT   misc_feature    complement(436077..437460)
FT                   /locus_tag="FTW_0443"
FT                   /note="contains frameshift"
FT   gene            437672..438145
FT                   /locus_tag="FTW_0445"
FT   CDS_pept        437672..438145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0445"
FT                   /product="ferritin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46367"
FT                   /protein_id="ABO46367.1"
FT                   /translation="MIRVLNNGDNNMELQLENKQEIIDQLNKILELEMSGVVRYTHYSL
FT                   MIIGHNRIPIVSWMQSQASESLTHATAAGEMITHFGEHPSLKIADLNETYQHNINDILI
FT                   ESLEHEKKAVSAYYELLKLVNGKSIILEEYARKLIVEEETHIGEVEKMLRKPA"
FT   gene            complement(438668..438754)
FT                   /locus_tag="FTW_2032"
FT   tRNA            complement(438668..438754)
FT                   /locus_tag="FTW_2032"
FT                   /product="tRNA-Leu"
FT   gene            complement(438763..439719)
FT                   /gene="rpoA1"
FT                   /locus_tag="FTW_0446"
FT   CDS_pept        complement(438763..439719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA1"
FT                   /locus_tag="FTW_0446"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="GO_component: GO:0000345 - cytosolic DNA-directed
FT                   RNA polymerase (sensu Bacteria); GO_function: GO:0003899 -
FT                   DNA-directed RNA polymerase activity; GO_process:
FT                   GO:0006351 - transcription, DNA-dependent; GO_process:
FT                   GO:0006350 - transcription"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46368"
FT                   /db_xref="GOA:A4IWR6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWR6"
FT                   /protein_id="ABO46368.1"
FT                   /translation="MALENLLHPTNIKIDEYAKNATKFSFEALERGVGYTLGFALKQTM
FT                   LYSIAGACVTSIKINDGKVTSLEDVIPCDETVADIILNVKSLPVTLAEGVETGTITFEL
FT                   SGSEEEIFSEEAKLSEGLAITEEVFICSYNGGKKLKIEAKVEKGVGFRPAQDNFKDGEF
FT                   LLDATFSPVVFCDFEIKDARVGRRTDLDKLELNIKTNGNVNCEEALRLAATKIQNQLRN
FT                   IVDIEEINKGIFVEDPTKDINPILLKHVEELNLTARSSNCLKAVNIRLIGELVQKTENE
FT                   LLKAPNFGKKSLTEIKDKLSELGLSLGTLIENWPQDL"
FT   gene            complement(439807..440709)
FT                   /locus_tag="FTW_0447"
FT   CDS_pept        complement(439807..440709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0447"
FT                   /product="putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46369"
FT                   /protein_id="ABO46369.1"
FT                   /translation="MPYVESGKIILIGATTENPTYYLNDALVSRLFILRLKRLSLVATQ
FT                   KLIEKALSQDEVLAKHKFKIDDGLYNAMHNYNEGDCCKILNLLERMFLISTRGDEIYLN
FT                   KELFDQAVGETLRDFHREGKDFYEQLSAFHKSVRGTDPDAAIFWLSVMLDNGVDPLVIA
FT                   RRMLCIASEDIGNADPQALRVAMDAWNAYEKLGMPEGRLVLAQAAIYLAVAPKSNACYK
FT                   ALAQAQQLVKSLGNIDVPQHLKNYKDSNYLYPHNYPNSYVIQQYLPDNIIQNFYQPTAS
FT                   GFEAKIKTKLDSINKIKKL"
FT   gene            complement(441135..441251)
FT                   /locus_tag="FTW_0448"
FT   CDS_pept        complement(441135..441251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46370"
FT                   /protein_id="ABO46370.1"
FT                   /translation="MLIVSQLALPVIATYFFHSRKSMQNCLALSYRFVANQW"
FT   gene            complement(441278..442204)
FT                   /locus_tag="FTW_0449"
FT   CDS_pept        complement(441278..442204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0449"
FT                   /product="exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /note="GO_function: GO:0016791 - phosphoric monoester
FT                   hydrolase activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46371"
FT                   /protein_id="ABO46371.1"
FT                   /translation="MSKIVATVDLGSNSFHMLISEIKPDGEVVTLSKQKHKVQLRAGLN
FT                   NNLTISKDAQERAIECLEFFAQEIQKYKVEYVRAVGTYTLRKAKNNIKGFKKKLDKALG
FT                   TKIKIISGLEEARLVYVGARDNHDIKQKTLVIDIGGGSTEFVIGRGNKILIARSLDMGC
FT                   VGMQKDFFANEKLDFANFHAAAAKAREIIAPILYRYKRIGWSTVLGSSGTIISVTNICQ
FT                   KLTGNSVITKDFLNDLITMMMDKREVEHICFEGLREDRESVLAGGVVILYAIFDCLGIS
FT                   EMRLSNGAVREGMLYELVKSKYKIIIN"
FT   gene            442402..442725
FT                   /gene="trx1"
FT                   /locus_tag="FTW_0450"
FT   CDS_pept        442402..442725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx1"
FT                   /locus_tag="FTW_0450"
FT                   /product="thioredoxin"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0030508 - thiol-disulfide exchange intermediate
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46372"
FT                   /protein_id="ABO46372.1"
FT                   /translation="MSKCIDISDSQFESEVVNSDIPVLLDFWAPWCGPCKMLAPILDQV
FT                   TEHYGDKIKVCKINIDNNEETAMKFGVRGVPTLMVFKDGENKETKVGVVQKTQLISIVD
FT                   KYL"
FT   gene            442768..444030
FT                   /gene="rho"
FT                   /locus_tag="FTW_0451"
FT   CDS_pept        442768..444030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="FTW_0451"
FT                   /product="transcription termination factor Rho"
FT                   /note="GO_function: GO:0003715 - transcription termination
FT                   factor activity; GO_function: GO:0003723 - RNA binding;
FT                   GO_process: GO:0006353 - transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46373"
FT                   /protein_id="ABO46373.1"
FT                   /translation="MNLNELKYKSVNELMDIVQSLDLESLRARKQELIFSILKYHADKG
FT                   EDIYGEGILEVLQDGYGFLRSSDSSYFASPDDIYVSPAFIRKLNLRTGDSIVGKIRPPR
FT                   ENEKYFAVKHIDSVNFDSPELARKKILFENLTPEYAKERLTMEIGNGSNEDITARVIDL
FT                   AAPFGKGQRGLIVAPPKTGKTIMMQNIATSIAKNHPECNLIMLLIDERPEEVTEMQRSV
FT                   RGEVVASTFDEPAARHVQLAEIVIEKAKRLVEHKQDVVILLDSITRLARAYNTVSPASG
FT                   RVLSGGVEANALQKPKRFFGAARNTAEGGSLTIIATALVETGSKMDEVIFEEFKGTGNM
FT                   ELHLDRKIAERRVFPAISFDRSGTRREELLTTPEELQKLWVLRKILGGMEDVQAMEFLT
FT                   EKMKGSLTNEEFFETMKRGAI"
FT   gene            complement(445142..446626)
FT                   /locus_tag="FTW_0452"
FT   CDS_pept        complement(445142..446626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0452"
FT                   /product="phosphoglucomutase/phosphomannomutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46374"
FT                   /protein_id="ABO46374.1"
FT                   /translation="MRQTIIKEIIKSSGVKFGTSGVRGLVSAMTDKICWLYTKAFIQFL
FT                   EQKYSIAKGTKIAIAHDLRESSPRITTVVIKAIIDSGHEPIYCGEIPSPAVMLYGISNQ
FT                   IPSVMVTGSHIPEDRNGIKFNTPYGEVLKEDEEMIVSQTISIDESIFDKNGMFLQKLEL
FT                   PEPSKQAYTQYIDRYVDFFPNNCLAGKTIGLYQHSSVGREIVKEILEKLGAKVILLEFS
FT                   EKFVSVDTEAIRQEDVKLAKQWASKYKVDSIVSTDGDADRPLVSDEYGNWLKGDILGVL
FT                   IAKYLQANVIVTPVSSNTVAEKIGYFSNVIRTKIGSPYVIAAMNELLSNNQNAVVGYEA
FT                   NGGFLLASDICKDDKTLKALPTRDAVIPMLAVMMLSINSNKTVSELLFDLPSRYTASSK
FT                   IDDFASEKSQEILKSILAGESDLLDKIISEHFDGKNSIENIDTTDGVRVTLTNQDIIHL
FT                   RPSGNAPELRCYTEAASDEQAKSLNQYCVDLINKNI"
FT   gene            complement(446657..448063)
FT                   /locus_tag="FTW_0453"
FT   CDS_pept        complement(446657..448063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0453"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.13"
FT                   /EC_number="5.3.1.8"
FT                   /note="GO_function: GO:0016779 - nucleotidyltransferase
FT                   activity; GO_function: GO:0008905 - mannose-phosphate
FT                   guanylyltransferase activity; GO_function: GO:0004476 -
FT                   mannose-6-phosphate isomerase activity; GO_process:
FT                   GO:0009103 - lipopolysaccharide biosynthesis; GO_process:
FT                   GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46375"
FT                   /protein_id="ABO46375.1"
FT                   /translation="MITPIILSGGFGSRLWPLSREASPKQFIGLVDEHSLLENTIKRLD
FT                   NVKDITSPVVVCNESHRFQVAEVLRKINKKGDILLEPLARNTAPAIALAALHLATNDPN
FT                   TIMLVLAADHHIENLEIFHQAIEKAQQKVIKDDSLVTFGITPTCPHEGYGYIKQGVQTT
FT                   VNGVYKVDKFVEKPSVVVAQEYLDSGKYYWNSGMFMFTARAYLEALEKLQPEIYRGCEK
FT                   TYQKSQQDLDFVRFDKQSFALVQSQSIDYAVMEKATNVAIVPMQQSGWSDVGSWDSLYD
FT                   IAAKDSCGNVVIGDVITSNVKNSYLRSHDRLLAAVGVNDLIIVETADAILVADKNKTQD
FT                   VKKIVEVLKIQQRSELLQHKQIYKPWGSATILEDKSGYKIQAIQLEPGKKLSLQQHYHR
FT                   SEHWIVISGTATVTIGTTKSIVRPNESVYIKIGESHRLENNGKIPVILIEVQVGEYISE
FT                   DDIVRLDTSS"
FT   gene            complement(448316..449196)
FT                   /locus_tag="FTW_0454"
FT   CDS_pept        complement(join(448316..448867,448867..449196))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0454"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46376"
FT                   /protein_id="ABO46376.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            449354..449653
FT                   /locus_tag="FTW_0456"
FT   CDS_pept        449354..449653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0456"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46377"
FT                   /protein_id="ABO46377.1"
FT                   /translation="MDLMQMKDNASKASSLLKAISHESRLLILCLLLRREMTVGELAEY
FT                   SSLSQSAFSQHLSVLRNNGLVKCRKEAQNVYYSINDPSVTKILEALYSIYCGDK"
FT   gene            449719..450237
FT                   /locus_tag="FTW_0457"
FT   CDS_pept        449719..450237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0457"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46378"
FT                   /protein_id="ABO46378.1"
FT                   /translation="MNKVEKISVKQFLDLQKKEKVKLIDIRTPAEHSRECIDCAENILV
FT                   DDIYDADIKPDEVVVLHCQSGNRTNQAASKVSGLNAKKVYLLDGGINDWKQHKQPTQKN
FT                   VKEPLPIMRQVQIIVGFLVLLGVVLSFTVSQYFAILSGFFGAGLLFASLTGTCGLAVML
FT                   EFLPYNRKK"
FT   gene            450259..451953
FT                   /locus_tag="FTW_0458"
FT                   /note="NADH oxidase"
FT   misc_feature    450259..451953
FT                   /locus_tag="FTW_0458"
FT                   /note="disruption due to premature stop"
FT   gene            451998..452684
FT                   /locus_tag="FTW_0460"
FT   CDS_pept        451998..452684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0460"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /EC_number="3.5.2.-"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46379"
FT                   /protein_id="ABO46379.1"
FT                   /translation="MIFRQLIDRDTYTYTYILACERTRQAVIIDSVRFNVNQYLKLLKE
FT                   LDLKLIYAIDTHVHADHVTAAGILRKETGCDIVIGGESKAECATKKVFDGDILEFGNYQ
FT                   LKALYTPGHTDDSYCFITENMLFTGDTLLIRGSGRTDFQNGDSYAAYDSIMNKLMTLPG
FT                   STIIYPGHDYNGITSSSVAEERQNNPRLKVKSPDEYAKLMADLKLPPPNYIDIAVPANL
FT                   KCGIEE"
FT   gene            452686..453435
FT                   /locus_tag="FTW_0461"
FT   CDS_pept        452686..453435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0461"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46380"
FT                   /protein_id="ABO46380.1"
FT                   /translation="MFLIIFGFICGIALGLTGGGGSILAVSLLTYGVGLDFHSAVTISL
FT                   LVVGFTAIFGLIVNYKQHDIHYIAVAVMICTGVVFAPIGSYISQDLSDKLLMLSFSILM
FT                   ILIGAWSLLKAKIMSSSQKSVCKSIGSRCIVALLISGAVVGTLTGFFGVGGGFLIVPAL
FT                   VFITAMPIKRAINTSLLVIFVVSISGFISHYDKANMSWYIASMFIVGSAIGMLLATKVK
FT                   KSLNDKVLQTIFAIMLVILGVVIYLIN"
FT   gene            complement(453428..454036)
FT                   /locus_tag="FTW_0462"
FT   CDS_pept        complement(453428..454036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0462"
FT                   /product="oxidoreductase, 2OG-Fe(II) oxygenase family"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46381"
FT                   /protein_id="ABO46381.1"
FT                   /translation="MSDLIAINPFYEKIINDYLNKDFCIIDNWLTTDETDKLRQQLEEL
FT                   YQANYFKKSAVGNRLNENLERSIRSDFIFWLDETKYAQVFFEKINSFIEYINKTCFAGI
FT                   VTKEFHYAVYPQGSFYKKHIDTFQNDDRRTISVVCYLNQDWQDCFGGQLKLYLKDQTLE
FT                   IFPTDGKIVLFDSKSIEHEVLPVLTENKRLSITGWLKTN"
FT   gene            complement(454088..454534)
FT                   /locus_tag="FTW_0463"
FT   CDS_pept        complement(454088..454534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46382"
FT                   /protein_id="ABO46382.1"
FT                   /translation="MSKWWQQIDLKDMSSEQWESICDRCGLCCLNKLQDDETDEVYYTR
FT                   VSCKLLDIGKCQCSMYQKRKQLVPECVNLTYKQLKNHAHKWLPNSCSYKLLFEGKDLPD
FT                   WHHLNTGSTEEMHKQKKSAKHFAISEYELDVDEYLEDFIIKIDN"
FT   gene            complement(454756..455223)
FT                   /locus_tag="FTW_0464"
FT   CDS_pept        complement(454756..455223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46383"
FT                   /protein_id="ABO46383.1"
FT                   /translation="MSGCASSGPQQPNLTPLQIQLMQTKVFNVDLRIAFDATVTVMQNL
FT                   GYIIQDANFNSGIITAKSTQTANFWGDSEYTEATAFIQPYRQSNKNSSIRINFVVYNSM
FT                   PNPNQGGTPINTSSAILNPQAYENAFAKIQQQIFVQTGISPVLTQPIQQVS"
FT   gene            complement(455284..455685)
FT                   /locus_tag="FTW_0465"
FT   CDS_pept        complement(455284..455685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46384"
FT                   /protein_id="ABO46384.1"
FT                   /translation="MKFNIICMLGLAFILSSCVSNTNPENVGFVKTPYTSGNVSLTLKK
FT                   GVTTKDQVINAFGSPNIVTQNADGESVWTYQTNATVENNAARDGFLTLLITGENTEESG
FT                   FMQSQKTMTIIITFKGNVVSDYKSLSTNF"
FT   gene            455872..456297
FT                   /gene="nusB"
FT                   /locus_tag="FTW_0466"
FT   CDS_pept        455872..456297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="FTW_0466"
FT                   /product="transcription antitermination factor NusB"
FT                   /note="GO_function: GO:0003715 - transcription termination
FT                   factor activity; GO_function: GO:0030401 - transcription
FT                   antiterminator activity; GO_process: GO:0006353 -
FT                   transcription termination; GO_process: GO:0006355 -
FT                   regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46385"
FT                   /protein_id="ABO46385.1"
FT                   /translation="MKTTARARNNARLYAVQALYQKKIADNTFSELKIQYYADNADRHY
FT                   TDWDLFYRLIDAVKTNQDTIDKYIKENSSNGVESINYVDYAVLQVAIAELIECLENPYQ
FT                   VIIKEYVEICYSMGTEEGYKFINAVLQNLAKSIRGEE"
FT   gene            complement(456281..457051)
FT                   /locus_tag="FTW_0467"
FT   CDS_pept        complement(456281..457051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0467"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /EC_number="3.5.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46386"
FT                   /protein_id="ABO46386.1"
FT                   /translation="MSKLKVSVIQSDIIWADKQANYNNLENSIANIDQDTDIIVMCEMF
FT                   NTGFIMNPTDQASTQQDIVNWMYRQVKGKNYAIVGSAATYSDDKIVNRLYFVTPEKQVY
FT                   TYDKNHLFIHAGEDKKYTAGNKRQIINYKGFNILVTVCFDLRFPVFNCNNNDYDILINV
FT                   ACWPESRRQHWQALLKARAIENQAFVVACNRVGNDPNFNYAGDSMIIDYNGDILAHQEF
FT                   KQATLSATLDKNKQLQHRSKFNFLASQDKFTLHL"
FT   gene            457220..457633
FT                   /locus_tag="FTW_0468"
FT   CDS_pept        457220..457633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0468"
FT                   /product="hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46387"
FT                   /protein_id="ABO46387.1"
FT                   /translation="MKGLKAKIYIIFLAAVLAVISGCATDKGTQYKDGYYITTLNYNFN
FT                   TVYNATLQAIQNGQTFDYKSNPYDISVNKNNGTDAEIVSASDSDSTDSLQVAMKKLPNN
FT                   ATRISIKYGSQGNSIRSSALIGIIEGNIRYANT"
FT   gene            complement(457669..458589)
FT                   /locus_tag="FTW_0469"
FT   CDS_pept        complement(457669..458589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46388"
FT                   /protein_id="ABO46388.1"
FT                   /translation="MKHYFDGVVAGETIFEAKYGVSGTSNFVADNYIKNLANIRGDRGI
FT                   YKPSENEVVIYSYKDGKRLSFRAKNYGQYMTIVENITKYANEYFDKKIIKILYGGTVIS
FT                   SNNASHAVLLEVTIDNYDKTITLNMVDSLISHAANNASFSVLQSLKQGLERVNSSIAYI
FT                   DTTKAKNDVHNIPKIANSTYKVEISLDNIHLQMPLQTDCGRYVAIWINAIINGIDYRKL
FT                   NSTDYNKTLTILNSAKKLALQDNSYASKSLNSAEQKPTDTKSSDIDGLGFDNIDDLDIL
FT                   NENLVEPKLIEREEMLRNIFEITKE"
FT   gene            complement(458697..459179)
FT                   /locus_tag="FTW_0470"
FT   CDS_pept        complement(458697..459179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46389"
FT                   /protein_id="ABO46389.1"
FT                   /translation="MQKNSKINHQYYLRFFGKFWVILVGNIKNRIFKLPIICTLYSLAL
FT                   MPVSCYANNLYCYINGELQGDKPINIKNIAIKQVKFFENGMQKDGYAVSLKDSQDLLNY
FT                   CKELDSEFSILEGVPIEARIDRNTWSSSITNLVGKQYGYPIVVKNKKTNMLDLHIL"
FT   gene            complement(459179..460312)
FT                   /locus_tag="FTW_0471"
FT   CDS_pept        complement(459179..460312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0471"
FT                   /product="aminotransferase, class I/II"
FT                   /EC_number="2.6.1.-"
FT                   /note="GO_function: GO:0008483 - transaminase activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46390"
FT                   /protein_id="ABO46390.1"
FT                   /translation="MIQAKSYIDTTPSVYGKFALMANEYKALNFTQGAPDFDTPEWLIE
FT                   RTNFYIQHGKNQYSPIPGAVALRNAIVQKTKRCYDTDITIDNVAITAGAQEGLFCIISA
FT                   YVGQGDEVIMFDPIFDTYAGVTKFNQGKCVRLKLLPNGKIDINAIANAITNRTKLIILN
FT                   SPHNPMGTVISKDEFKEIAKIVKDKDILVISDEVYEHIYAGESFISAIQIPELHHKLVV
FT                   FQSLGKTYNVTGWRQGVTIAPPQVIQNMLAIKQFATFSAVHPMQLALAEGILEYPEYYE
FT                   NLHKLYKKQNQLLREHLKGTRFKILDWQGSPFQILDYSNISNQDGDKFASNLIKEHGVG
FT                   LVPISSLFETPQDGLLRLCFAKKDHDIIKGAKILANI"
FT   gene            complement(460458..462155)
FT                   /gene="proS"
FT                   /locus_tag="FTW_0472"
FT   CDS_pept        complement(460458..462155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="FTW_0472"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004827 - proline-tRNA ligase activity; GO_process:
FT                   GO:0006433 - prolyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46391"
FT                   /db_xref="GOA:A4IWT9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWT9"
FT                   /protein_id="ABO46391.1"
FT                   /translation="MKATQTLIATTKELPKEAVLISHQYMLKAGLIKKLASGIYTWMPL
FT                   GLKVLQKIQNIVRDEMNKAGASELLLPSILPSELLQETHRWDKFGPELLKLHDRHNRDF
FT                   CYGPTHEEPIVDMARDTIKSYKQLPLNLYQIQTKFRDEIRPRFGVMRAREFIMKDAYSF
FT                   HENSQCLRNTYNTMYATYCNILDKIGLAYRPVKADTGAIGGDNSHEFQVLANAGEDIIC
FT                   YSNGSDYAANIELATYAKPDLSKRVNSQNTIEKIHTPNIKTIEKLCKEMSFDIKKTIKT
FT                   MVIKDAGGNFFALVIRGDHELNETKINKLDQIIAPYTLATKEEIFSIFNANPGSLGIYN
FT                   CPISIIADYSAIAITDLVCGANEDDYHFTNVNWDRDVTNYQIADIRNVVTGDISPDGKG
FT                   TLELTNGIEVGHIFELEDVYSKPMNANIIGQDGKSKPMLMGCYGFGVSRVMAAAIEQSH
FT                   DENGIIWPESIAPYQVAILPINYNKSDKIKEVADKLYQDLLGDGIDVLLDDRGARPGVM
FT                   FADADLIGYSHHVVIGDRLLEQGLIEYKNRKTQEKQEITIAELIKILK"
FT   gene            complement(462439..462609)
FT                   /locus_tag="FTW_0473"
FT   CDS_pept        complement(462439..462609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46392"
FT                   /protein_id="ABO46392.1"
FT                   /translation="MFIQKTCRKKHGRPQNSYFRYGLDMIANAINKISVSSYDFKLCLK
FT                   IFSKITKELKL"
FT   gene            complement(462761..462958)
FT                   /locus_tag="FTW_0474"
FT   CDS_pept        complement(462761..462958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46393"
FT                   /protein_id="ABO46393.1"
FT                   /translation="MDSNAGESKVSKLFYSTGIHEHKNLTKIQQLGDIDVYLVLELMMV
FT                   SYLLLLATIAMSSSLFPHMG"
FT   gene            complement(463009..463518)
FT                   /locus_tag="FTW_0475"
FT   CDS_pept        complement(463009..463518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46394"
FT                   /protein_id="ABO46394.1"
FT                   /translation="MEINEKYVNQLKRSLSKIFNWHKSSIDCFSNILLGLLSAQTINLS
FT                   KIAIHFKNNNKIASNYRRIQSFLKDMKIDFDAITEFNVRQPLSQKSKFNFILDRTNWQF
FT                   VKNNINILVFSAVYEVIAIPLYYKLDHRGNSDSQTRIDLVKKFVNKFGKECIGSILGDR
FT                   EFGLLG"
FT   gene            464255..464389
FT                   /locus_tag="FTW_0476"
FT   CDS_pept        464255..464389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46395"
FT                   /protein_id="ABO46395.1"
FT                   /translation="MSSLSIAISSSCRYMQPSTGDRGDDFDMPVDDIKSLLRTTTIFI"
FT   gene            complement(464744..465280)
FT                   /locus_tag="FTW_0477"
FT   CDS_pept        complement(464744..465280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0477"
FT                   /product="putative disulfide bond formation protein"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006457 - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46396"
FT                   /protein_id="ABO46396.1"
FT                   /translation="MKQDILDFFDSLAIIGISIILAMAFYYQLFLQELPCALCVFQRMA
FT                   LSLLTFGLLLNLTHGNNYKHYLLIILVALLNAAMAITQILLHIVPGTGNYGEAVFSLHM
FT                   YTWNFIVSIIFILYAAICGLITPNENKKKKLSILAKLAIILILILTVANTLNVFVECGP
FT                   HLCPSDPNSYWLFNR"
FT   gene            465358..465477
FT                   /locus_tag="FTW_0478"
FT   CDS_pept        465358..465477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46397"
FT                   /protein_id="ABO46397.1"
FT                   /translation="MKNSILAILYLFVIANIRLSRVVENINSIILIKTNGLFG"
FT   gene            complement(465685..465760)
FT                   /locus_tag="FTW_2036"
FT   tRNA            complement(465685..465760)
FT                   /locus_tag="FTW_2036"
FT                   /product="tRNA-Asn"
FT   gene            465987..466403
FT                   /locus_tag="FTW_0479"
FT   CDS_pept        465987..466403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0479"
FT                   /product="putative regulator of cysteine desulfurase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46398"
FT                   /protein_id="ABO46398.1"
FT                   /translation="MENQVVQKQQELVEELSFFEDWEDKYDYVISLAKQLPEFPEEKKT
FT                   EENLVKGCQSQVWFDSNIDQGKLNFIATSDALIVSGLIGMLLRVYNNATPAEILASNTD
FT                   FIKQIGFGNNLSTTRANGLKSMLDYIYATAKQNQ"
FT   gene            466404..467153
FT                   /locus_tag="FTW_0480"
FT   CDS_pept        466404..467153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0480"
FT                   /product="putative uroporphyrinogen III synthase"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004852 - uroporphyrinogen-III synthase activity;
FT                   GO_process: GO:0006779 - porphyrin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46399"
FT                   /protein_id="ABO46399.1"
FT                   /translation="MKILVCRPQNDAVNLTEKLCANGLLAVSLPTIKICYQKITESVLD
FT                   YTSLVFTSKYAVESLFSQYPIDLFKNKKIYSVGASTAAILEKYQLAAIYPVRHGSQELL
FT                   DIILNQDISKEKFAIISGVSGNDLLLEELSKLTHCHKFETYLRVFIDLDELLDTYNKLF
FT                   LHNQPDIIIATSLDVFKSLNRIFEKITTPKAATITITSLKMLKFVNQQGFKNTLKLEKL
FT                   DNSYICQRILEFTEAKDVSRKKHPATK"
FT   gene            467119..468204
FT                   /locus_tag="FTW_0481"
FT   CDS_pept        467119..468204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46400"
FT                   /protein_id="ABO46400.1"
FT                   /translation="MSVEKNTQQQSSTQDNPAKKTARVDNKSSIGGVFAKITLAVSIAA
FT                   LGLSSYALVNSISQTRNSNANFQTYTAFDKQLKAIKSNQDQQKDISNDLSTQNDALTQS
FT                   VKALQSQLITINNQIAVPAKDLYVQMSIINIQSAINYLILAKDVMVFDGDSQKASELVD
FT                   NAFDKIQASRVASVSASERQNIKSALEQYSSRDEIIKEFIAIEQQFAKLQYLTPENIST
FT                   TVKSQDSQNKYMKLLSAIVEIQDIPKNQTLVATKQAKEFVADSMYRSLISLQTAMYINN
FT                   QDAIDKAKNNLIDIVKKYFVQNDDAKKLISAIQGIKAQNLDSFNTSIDKLISQLSEQQN
FT                   QLLAQQPNLNKTNISAEGSQK"
FT   gene            468201..469358
FT                   /locus_tag="FTW_0482"
FT   CDS_pept        468201..469358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0482"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46401"
FT                   /protein_id="ABO46401.1"
FT                   /translation="MIKVFKLIIAVALATLVGIWATKYHGYIMLVLADKTIKMNLVAFV
FT                   FITFILLFILILGVRIIVSVFRFPYLLFSWVIGLFSVDKQERFADIVADITLENNRLVK
FT                   KFSIGHILRLTPKHLKEYVLFRKLNLIAVTQDIKELEKALKHIDSKTFTYKFFEVYKLY
FT                   LVQKFSEAQTKISIMLEKNDPRFMPNIVNLAGNIALADSDDAFALKILEKYDAYLKEDL
FT                   EENLIILALKSAKDVAKLNDIYNKSDTTKALSTVYLEQLIKFGEMVSAEKFAKKQLANL
FT                   NISAEMLKLYINAFNMPISRLCDKVLDRADHDYNSILTLLDFAMIKSDNYCFKIIYDYI
FT                   ERHLKDFLSAAELEKYFHILCKFFIKNGEVAGIDLSVARLVYTNN"
FT   gene            469372..470130
FT                   /locus_tag="FTW_0483"
FT   CDS_pept        469372..470130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0483"
FT                   /product="Metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46402"
FT                   /db_xref="GOA:A4IWV0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWV0"
FT                   /protein_id="ABO46402.1"
FT                   /translation="MQIKRWFLNNSLRNYQYLLYDKSHAIVIDPLKSDIFAEFIAKNKL
FT                   QLEAILITHKHGDHIAGVKKLLAIYLNAKVYAYTGNDLFKPDIYVKDGSFINLGFTSFR
FT                   VMYIPGHIDDHVCFLFEQERALFCGDTLFNAGVGGVQAESADINQLYDSLVKITKLDGD
FT                   IKPYPAHDYWLGNLDFALSILADDSYFNYYRNQVAELAAEDKPIVNLAEEAKLNIFIRA
FT                   MSDKALLKALPDYSLGREMFVKLRQLKNNF"
FT   gene            complement(470208..470915)
FT                   /locus_tag="FTW_0484"
FT   CDS_pept        complement(470208..470915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0484"
FT                   /product="putative cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46403"
FT                   /protein_id="ABO46403.1"
FT                   /translation="MKDLSRLDIPKKTAKDNSQEPQQPKNTKKKKILITIVVCLLVVAV
FT                   ASKLVNKHLKKIKAEQEKAKIELQAEKNQKSKTLDNKQSSEATNHQTADLSSKDNPSND
FT                   KMVFTFYNNLKHDSVEVDVVPEAQRAQYKYTYIYQIASFRNMDETSWYVKKMKEDGLNP
FT                   QFERVGNWIRMYIGPYDSKRAMAPDIIKLQRIGLNGGFPREVSRTKIEPKDNNKVSDSK
FT                   FSDKDLTNNNSKS"
FT   gene            471024..471248
FT                   /locus_tag="FTW_0485"
FT   CDS_pept        471024..471248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46404"
FT                   /protein_id="ABO46404.1"
FT                   /translation="MTYNKNDKFIVRGFHTNCPAAFKDKIIAMGVIEGQQMTVTNKSIL
FT                   GGPIAFETNCGAFSLRKKDLEFLKLEKIN"
FT   gene            471265..472899
FT                   /locus_tag="FTW_0486"
FT   CDS_pept        471265..472899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46405"
FT                   /protein_id="ABO46405.1"
FT                   /translation="MRLRKIFLLTSICTATLATVNLYATPTTTNIQQLSSQQQDRIRSM
FT                   LKSNLDSLFPYQTQITIGKIDQDNKGTVVASNILIMSNDSENPNLTINKLIFKGLHANQ
FT                   AINNNFTIKVEGLSIANLAAAVANSNLVSSEVDPKQLADNQGLFSIAMNSLGQTIYNLE
FT                   INYNYNNSTIDYSLDSTINNKPLLKAAAQLTDIDLSNTNVNTDFLATLLDESMSAKIKT
FT                   LEFDANFSEVLRDITNKYLGKDYKQTPILNIKAQLGKNPDQLMLNVDGKLGSQNYAKYN
FT                   IIINGINLASSTINDIVAGSSNALDNAYIQSSTSSSRIELNFARDFFPKGSPIIQVFSA
FT                   LDKNNISFTIVSQHQFEGTSYNTNFYLKADGLASLSANANAVVNGKLNLLPYLGTNAQN
FT                   QTNLYDCTNQLCLSNVDVKFANYGLLEKVARQTNNDPNTTPQQILGSYGALLQLFAVQQ
FT                   QDKFLQQTLSAFAIFLQNPKNIAIHAKANKPVNENALLNMLVADAKTLKKYKPVNSNGN
FT                   VDLRNNPNVKLINNIQNIFKISFDVNK"
FT   gene            473012..473086
FT                   /locus_tag="FTW_2050"
FT   tRNA            473012..473086
FT                   /locus_tag="FTW_2050"
FT                   /product="tRNA-Gly"
FT   gene            473102..473175
FT                   /locus_tag="FTW_2047"
FT   tRNA            473102..473175
FT                   /locus_tag="FTW_2047"
FT                   /product="tRNA-Cys"
FT   gene            473181..473269
FT                   /locus_tag="FTW_2030"
FT   tRNA            473181..473269
FT                   /locus_tag="FTW_2030"
FT                   /product="tRNA-Leu"
FT   gene            complement(473471..474124)
FT                   /locus_tag="FTW_0487"
FT   CDS_pept        complement(473471..474124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0487"
FT                   /product="Peptidase S24-like domain protein/prophage
FT                   repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46406"
FT                   /protein_id="ABO46406.1"
FT                   /translation="MFNYKTDLKPALKRIGMKQIELAKKLGKSDRTIKGWVAGTNCPSY
FT                   DGHIEVMRILGLKDNYCPSDTSIITVTNVPVLSYVQAGEFTESQENIDPIDYLQIPDTL
FT                   VPKNGFSLQVQGESMLYDFSESQLLNPKYSKYTIYEGENILVDPNQVNPQDLIDKVVVA
FT                   RNSDGATVKLLYKDNNRLYLMPLNSKLQNNDEIKSPADAVIIGRVVKSFNIRSF"
FT   gene            474293..474679
FT                   /locus_tag="FTW_0488"
FT   CDS_pept        474293..474679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46407"
FT                   /protein_id="ABO46407.1"
FT                   /translation="MIRKSILVENQEIKDLLSVIKQHYASDNRKTIQEVSLNHVVNNVY
FT                   KQNIKNYIIEKWYTLETKVGHQITLLENNYNKSIINKLYKKSRDLNFVIKTRPDDSSRE
FT                   LHDSIKSASNIDVVIKEFSFFCEK"
FT   gene            complement(474767..475450)
FT                   /locus_tag="FTW_0489"
FT   CDS_pept        complement(474767..475450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0489"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46408"
FT                   /protein_id="ABO46408.1"
FT                   /translation="MNRDFFIILFALSNLIVASVLIRYSEVGPIASFGYRLLLPCIFLY
FT                   SFLAITKDEEKLSKKSLYIAALTGFFLALDLAFYSISLIYTSIAEASLLTNLCPFITTF
FT                   IAIIFLKEKVSLKYYFVLLLAFLGLLLLMSQAGLSSRHLLGNWLAIVSAVFYALFIILS
FT                   KQLRNSCSTFRMMFIASLSGSIVLFILAFIFNEQIIPTTARGIAILLAIALFGHLLGNI
FT                   LYISL"
FT   gene            475627..477213
FT                   /locus_tag="FTW_0490"
FT   CDS_pept        475627..477213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0490"
FT                   /product="putative glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46409"
FT                   /protein_id="ABO46409.1"
FT                   /translation="MHISERRKWYIGFAVFVMVILLSLSLLHASIWFSIGFVAVLAVIA
FT                   IYDVSQTKHSILRNFPIVGHMRYILEFLRPEIQQYFIADNESEKPFGRELRSTIYRRAK
FT                   GINDTVAFGTEKDIYRVGYEWVTHSLMPKHLDEIETRVKIGGSDCKQPYMASHLNISAM
FT                   SFGALSANAVMALNKGAKLGGFYQCTGEGGLTKYHLQGGDLVFQIGTGYFGCRTDDGKF
FT                   SAEKFVEKANLDSVKMIEIKLSQGAKPSHGGVLPAAKITPEIAEIRGVSMGKDVLSPPA
FT                   HSAFSTPIEFCYFIKQLRDLSNGKPIGFKLCIGSHVEFLAICKAMLETGIRPDFITVDG
FT                   ADGGTGAAPLEFSNHIGMPLEDSLIFVHNALVGCGLRDEIRIIASSKVATGFDMVRLFA
FT                   MGADTCNSARAMMLAIGCIQSRQCNNNTCPVGVATQNPRLEKALVVEDKMYRVYNFHKA
FT                   TIQSCLEIIGAMGLISTDDVEPENLKKRISVNEIKSYADLYDFIPERCLVDGNIPASFA
FT                   RSWEKARADSF"
FT   gene            477290..480529
FT                   /gene="recC"
FT                   /locus_tag="FTW_0491"
FT   CDS_pept        477290..480529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recC"
FT                   /locus_tag="FTW_0491"
FT                   /product="exodeoxyribonuclease V, gamma subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="GO_component: GO:0009338 - exodeoxyribonuclease V
FT                   complex; GO_function: GO:0008854 - exodeoxyribonuclease V
FT                   activity; GO_process: GO:0006281 - DNA repair; GO_process:
FT                   GO:0006310 - DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46410"
FT                   /protein_id="ABO46410.1"
FT                   /translation="MALYTYPSNKLEYLVQVLSKLLDVEKKDLFTPTQLIVGSRGMQHW
FT                   LSMQLAEYRNIAMNLKYDMINGYILDICYELTAKQEYKKAYTKDILAWRVFRLLSSQNQ
FT                   EKNTHSHAGGNLIADGLSSKDTSLCGYDNRDGWSSKLKEYYQDSDLKKYQLSVKIAETF
FT                   SKYISYRSEWLQKWEKDEYINPSKLENDEDWQMLIWQNLVKDIAETPYKVQLEALQKLD
FT                   KQNLEKLNIPSDIYIFGVNTISPKNLKFIFELAKYINVHILYINPCSEYWYDLHKSKIS
FT                   AWLDSDDYEIQPLLANLGQQGKEFFNQLLENEQQQELEVFEKFDKESLAFEKLADNNQT
FT                   QLVSLQRNLLELDCQNHAKQKDLSISINSCHSPLREVQILHDKLLDMIKADPNIKPRDI
FT                   LVMCPNIEDYSPYIDSVFSRYPTDKKLPCSIADRTLLDSEPLAASFIELLQLPESNFEV
FT                   NKILDYLAVPAIQQKFKITDEQLEAIRYWLKESCIHHSNNDQTFSWSWGLRRLMLGFSY
FT                   SDSNYIIDDKLMTVPVIEGSEIAELGGLYELLELLERYSQNLLKPRSLANWQVYLLEMF
FT                   DDVFDVTNDEQYIAKKIKDIIAKTVTTAKNILLDQEIDLYTIRYCLISQLSEPIINNHF
FT                   LNGKVTFCSMMPMRSVPFRVIAMLGLNNGKFPRQESAISFDLIARLGRKKGDRTKSDDD
FT                   RYLFLEAILSARDYLYISYIGRSVKTNVEQQPSLILKELTSYLNLNYDWGKEDIKEYPL
FT                   HAFSSKCYSDSYRSYDKAWLKLLQSEPRGFYDSASLSNCANLPKNLSISKLVKVFDDPI
FT                   KAYANYALELYLEDDFEELEDSEPFDINSLDKHKLKQALLKTFEDEKDKDLTIKTAKLS
FT                   GKLPESVLTDTEIKEEVENIQKLLDKMSLASYESKYFHQEILGYELEANCYIKNNQIML
FT                   STPSSLNIGKKFELYLIALLVAYSEQRDISAVYYGIEKNQVEEFRVENIEYTTAKGILE
FT                   HYINQAEQIVVKPQLAHLSLAEAICDSKNNTDKKKQQAWQKVIKSSQHNFKALEDNSYF
FT                   KLFYNKFPTVDDFEGEKIYKKFFEVIYESQS"
FT   gene            480513..481043
FT                   /locus_tag="FTW_0492"
FT   CDS_pept        480513..481043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0492"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46411"
FT                   /protein_id="ABO46411.1"
FT                   /translation="MKVNHEHSNIPQLYKNIYISFEIALAACICFLLGFYMSNLLHRGQ
FT                   SIIGGFWCLITVSTILQLSIRDSYLAAFQILVGSVIGGITAFIFTSVLGYYYYVMILAV
FT                   AISVFITASIGLENAVKMSSANAGVIVALGLYQPSYSPFLNTGLRLIETFSGTAIALFF
FT                   IFISRIFRIRTDD"
FT   gene            481186..482616
FT                   /locus_tag="FTW_0493"
FT   CDS_pept        481186..482616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0493"
FT                   /product="Divergent AAA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46412"
FT                   /protein_id="ABO46412.1"
FT                   /translation="MNILQRIQNGEDSYTQFKQDINNADSLAQELVAFSNANGGILIIG
FT                   VADDGKIIGLSKDDIHRINQLISNVCSTNIKPPISVLTKIENIDDKEILIIEINNGVNK
FT                   PYSTNKGVYLTKVGSDKRKMSQEELGRLFRQAPKLYPDEEVLYKTSLENFDVSKFRKFL
FT                   KTDNYTTFSKLENGSLDLSTILENKDLAKDSKLTLAGNLIFGEEPQRFCPSFYIDCCYF
FT                   DGNDISVSKFISKKVIKGTFSELYEDTMRFLLSQLKSYQIDLDFNSNPQLEVNESALTE
FT                   IVVNALVHRDYYINSSIKVFIFHNRVEIISPGKLPDTLTVDKIKNGIAIQRNPILASIC
FT                   KTLLPYTGYGSGIKRAIELIPNIEFINDIDSEQFRCIIKRDESSPKEQESSPKEQESSP
FT                   KEQESSPINISYGVGSSPKTDKQILEMFRENPKITIKEIAERLSITDRAVKKHIEKLKY
FT                   QGLIAREGSPRNGYWRVI"
FT   gene            482688..486341
FT                   /gene="recB"
FT                   /locus_tag="FTW_0494"
FT   CDS_pept        482688..486341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /locus_tag="FTW_0494"
FT                   /product="exodeoxyribonuclease V, beta subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="GO_component: GO:0009338 - exodeoxyribonuclease V
FT                   complex; GO_function: GO:0008854 - exodeoxyribonuclease V
FT                   activity; GO_function: GO:0004003 - ATP-dependent DNA
FT                   helicase activity; GO_process: GO:0006310 - DNA
FT                   recombination; GO_process: GO:0006268 - DNA unwinding
FT                   during replication; GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46413"
FT                   /protein_id="ABO46413.1"
FT                   /translation="MDNLNANTITLQGRHIIEASAGTGKTFNITKLYIRLLLEKKLLPS
FT                   NILVMTFTKDATQEIIGRVEKEIRDVLASYTDEKKESDKENYKHLKRSLLEIDEAAIFT
FT                   IHGFCKKVLSEQAFASGIEMDVSMEVDTSDILQKVVEDFFRKHINKSETNFGYLQIYKL
FT                   HTPEKFLDDLENIIRSNYEILTKQAISLDEFKILKKQQLELFINNHDIVDDFLSKLGKG
FT                   ELQGKRVDEYHRVLEWLKLDNQTLFPENISIITDGRKISAKLIKPIFIGVKELRDLQQE
FT                   IKQAQAAQFIRKACLQIRQDFAKAKEQKGVLDFDDLITKLCQSVKKSPELVKTLQKQYP
FT                   VALIDEFQDTDAEQYEILDTIYPLKNSSSHSHEGRNLLTNGLNLKDTRLREYDSSSDQN
FT                   DSNLLLLMIGDPKQAIYGFRGGDIFTYLKAKDSCPEENQWSMDTNWRSTGEMIKAYNRL
FT                   FYKQDYQPEEEGQIGTNIFSDGIGYQLVKASPDADKKTKDFDDNFKPINYFYYEVAEDD
FT                   NKSDIDTNLSLWTVNEITRLLNTQKVAENDIAILVENGKQAKIIQQALQAKNLSSVYLS
FT                   QRDNVYHSQEAKEILALMEGINDLENKSMLKRALSTSLLGGRADKFISYIDENDVSAWD
FT                   DEIEKAKSLRQQWHKYGFMAFIMQIIHENFTQRADSKERIITNILHLAELIKVAENKYK
FT                   HPNQLIKWYRHQLNNTATSEGELRLESDDNLIKIITIHGSKGLEYSVVFIPFACYASTK
FT                   KFETSNFTKYYDGDLKQTVYKIGKDDSVKQQADKEVIEELMRLFYVAVTRAEHRCYIGV
FT                   AKYNNSEKSPLARFLGYQKDDDWLEKIQSITANPANQSLLINIADMREFSLKNLSSKDK
FT                   NSDYDTLKANYISKLENDSWEMLSFSKISKSKVQNTALEKEIDEAEDDKTQASDRKLAF
FT                   RFTASKGADMGNILHNVLEHTDFSLGEIDGNLLQEQMDRYKVVAAEDFDNLKLWLEECL
FT                   EAHIPYIDTSFSSSNESIQYGLFDIKDKGFCLKTIPNSKTLKEAEFYFPVKNENLYKTN
FT                   ILEILQEYRELTKLKTYSHSYVGGNLPTNYQDLRDTRLREYGNLTNVSNQKIFGMLHGF
FT                   IDLIFEYEGKFYVADYKSNYLGDTLEDYNQQAMQEKNQSSFYDLQYLIYSVALDKYLRQ
FT                   NIESYNYEKHFGGVYYFYLRGMKDGYGVYRARPNLEIINKLASLFNGDDNV"
FT   gene            486334..488175
FT                   /gene="recD"
FT                   /locus_tag="FTW_0495"
FT   CDS_pept        486334..488175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="FTW_0495"
FT                   /product="exodeoxyribonuclease V, alpha subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="GO_component: GO:0009338 - exodeoxyribonuclease V
FT                   complex; GO_function: GO:0008854 - exodeoxyribonuclease V
FT                   activity; GO_process: GO:0006310 - DNA recombination;
FT                   GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46414"
FT                   /protein_id="ABO46414.1"
FT                   /translation="MYKTFHKACEQLADIRAIDFFFAKEVFDLVKKTTPSMTTLSSESY
FT                   LPFHGAKGNDLEQKSNEILFHILMKLMHVYSHGHSCLKIADISNKTIFASEQSNQSDAK
FT                   VGFKMPSSDKIASILDNLNYDNLPIYFAKQYDSLYIKRLWNYENEMANFIKLKTIQNTQ
FT                   KDNRIEEVVDKLFEPAGEINWQKQAVIKSLNYNFSIISGGPGTGKTTTVAKLLLAIQML
FT                   NQNQQRIALLAPTGKAAQRMTESLKNTLATVIPSSLTTESTIQKNDIFKQVQDELNSVA
FT                   QYLNNLEAQTIHRFLGLRPNSTYVKYNQQSKAPFDVIIVDEASMLDMNIFIKLIRAVAD
FT                   NTKLILIGDTNQLPSVEAGSLLANFTHDKYGSITPYTTLLIKNYRSQQYINNLAASVLK
FT                   GDVNIDSQQNENIKFHSLRNLDIYLREYAKRYSQLEKCRDYKEALTELNKFRILVANKN
FT                   LEIGTDKLNQKIEKFMSKPIDSNYKGKPIMITQNSYSLGLFNGDVGIMWPDDTGKLRAY
FT                   FDGKDAKAFSLNMLPKYESVYAMTIHKTQGSEFDEIVIILPAEDNEALSKQLLYTAITR
FT                   AKYKLTIISEQSSLRDIAQKDIKRNSNISELVSLSTQ"
FT   gene            complement(488184..488954)
FT                   /locus_tag="FTW_0496"
FT   CDS_pept        complement(488184..488954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0496"
FT                   /product="Baf family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46415"
FT                   /protein_id="ABO46415.1"
FT                   /translation="MIVCIDIGNSHIFGGVFVGDQIKHNFRYPSTTPCTSDTLGIFLLS
FT                   FFERKKLDIEDIEAVVLSSVVLHLEYSVNSACKKYLGITPLELKPGVKTGLKLDIKNPL
FT                   DLGADRVANSVAAISLFPSRNIIVVDFGTATTICAISENKTYIGGAILPGINLSMESLS
FT                   QKTAKLSNVTISHPSSALGKTTISQIQSGLIYGQLGAIKEIINRISQENFIDKPPILIA
FT                   TGGYAHIFEKEQYFDVIISDLLLHGLRIIWQMNK"
FT   gene            complement(488958..489293)
FT                   /gene="panD"
FT                   /locus_tag="FTW_0497"
FT   CDS_pept        complement(488958..489293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="FTW_0497"
FT                   /product="aspartate 1-decarboxylase (Aspartate
FT                   alpha-decarboxylase)"
FT                   /EC_number="4.1.1.11"
FT                   /note="GO_function: GO:0004068 - aspartate 1-decarboxylase
FT                   activity; GO_process: GO:0015940 - pantothenate
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46416"
FT                   /db_xref="GOA:A4IWW4"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWW4"
FT                   /protein_id="ABO46416.1"
FT                   /translation="MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKVQ
FT                   VVNLNNGERLETYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYTQVDPTRENIKPKL
FT                   VDLKTGD"
FT   gene            complement(489287..490072)
FT                   /gene="panC"
FT                   /locus_tag="FTW_0498"
FT   CDS_pept        complement(489287..490072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="FTW_0498"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="GO_function: GO:0004592 - pantoate-beta-alanine
FT                   ligase activity; GO_process: GO:0015940 - pantothenate
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46417"
FT                   /db_xref="GOA:A4IWW5"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWW5"
FT                   /protein_id="ABO46417.1"
FT                   /translation="MIIADNIKQFHSIRNSLIKQQKIGFVPTMGALHNGHISLIKKAKS
FT                   ENDVVIVSIFVNPTQFNNPNDYQTYPNQLQQDIQILASLDVDVLFNPSEKDIYPDGNLL
FT                   RIEPKLEIANILEGKSRPGHFSGMLTVVLKLLQITKPNNLYLGEKDYQQVMLIKQLVKD
FT                   FFINTKIIVCPTQRQPSGLPLSSRNKNLTSTDIEIANKIYEILRQDDFSNLEELTNKIN
FT                   STGAKLQYIQKLNNRIFLAFYIGKVRLIDNFLKETGPSC"
FT   gene            complement(490059..490856)
FT                   /gene="panB"
FT                   /locus_tag="FTW_0499"
FT   CDS_pept        complement(490059..490856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="FTW_0499"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="GO_function: GO:0003864 - 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase activity; GO_process: GO:0015940 -
FT                   pantothenate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46418"
FT                   /db_xref="GOA:A4IWW6"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWW6"
FT                   /protein_id="ABO46418.1"
FT                   /translation="MKSVLGFKKAKVTQEKISMVTCYDYTLAKIINSTDIDCILVGDSG
FT                   GMVLLGKKNTTYTTLDDMQFMTQAVANGATDKFIVADLPFMSYRQSLETTMQAVMALIQ
FT                   SGAHAIKLEGSSGNLDIIKHIVDSGVPVMGHIGMTPQFINSFGGFKVQGRTEEAAKHLL
FT                   EEAKLLEQAGCFGIVLECIPANIAKDITQNLDIPTIGIGAGSNTDGQILVLQDMLGMNT
FT                   DFQPKFVKKYIDGSKLFSDAINTYVKETKANTFPTKEHCYDYC"
FT   gene            complement(490858..491574)
FT                   /locus_tag="FTW_0500"
FT   CDS_pept        complement(490858..491574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46419"
FT                   /protein_id="ABO46419.1"
FT                   /translation="MQQVPRYVIVGNGNVAAHMCYYFECLKLDFRQWSRNEPLDQLDKL
FT                   LDNATHVLVLIKDSEIQNFVDRHLTNKSKRLIIIHFSGLLDIKNAYSAHPLQSFPDKNL
FT                   YSLDEYKSIAFVTCDRSIAFSELLPKLPNANFCIDKSQKAYYHAMCVLANNVSTLIWQK
FT                   FYTEMQNRFGINQGYLIPFLETTFKNIKHNHHALSGPIARGDNLTLQKDLDALIGDDFY
FT                   DVFRAIANQFSNKEKR"
FT   gene            491882..493918
FT                   /gene="ligA"
FT                   /locus_tag="FTW_0501"
FT   CDS_pept        491882..493918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="FTW_0501"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="GO_function: GO:0003911 - DNA ligase (NAD+)
FT                   activity; GO_process: GO:0006310 - DNA recombination;
FT                   GO_process: GO:0006281 - DNA repair; GO_process: GO:0006260
FT                   - DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46420"
FT                   /db_xref="GOA:A4IWW8"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWW8"
FT                   /protein_id="ABO46420.1"
FT                   /translation="MTPNEFFSIKYHILAKAELKAYIDKLADYLSQQSYLYHTLDKPII
FT                   SDSDYDKLFRLLQDLVNDNPQFKPINSVLDRVGGEVLAGFETIKHKKKMTSLANVFSLE
FT                   ELRDFYDKIEYDIELECEPKMDGLAISIFYKNGKFDYAVTRGDGIQGEKVSENVKTIRN
FT                   VPLKLNTSNPPEELEVRGEIILDKQSFLSLNEYMQTHENKTFANPRNAAAGSIRMLDSK
FT                   VVAKRPLKLYSYGIGYFSKDFVYPETQFELMQLLQSFGFTISDNMFLAKNFSEVEEYHH
FT                   KMSHQRADLAYDIDGLVFKVNNIKLQDTIGYTARGPKWAIAYKFPAEEVESEVLNVEFQ
FT                   VGRTGAITPVARLKPVAVGGVIVSNATLHNINEIKRKDIRVGDRVIVRRAGDVIPEVVK
FT                   SLPQYRKSDAQMVEMPTNCPVCDSKIENVNDQAIYRCTGGWHCQAQTTERLKHFVSRKA
FT                   MDIDKLGAKLIEQLVAANLIKYPADIYKLNFEQLTGLERMAAKSSQNVLDSITKSKEPS
FT                   LARFIFAIGIKDIGEVSSDALANHFGSLESFRDAKFEELIEINDIGEIMANNIVSFWHD
FT                   SLNIKIVEEFLAIGIKIQNPVKVEHAYNESFTGKTVVITGSFENYGRTELTQLLKSIGA
FT                   KVTSSVSKKTDMVICGDNAGSKLTKAQELGVEVILEDNLKDLL"
FT   gene            complement(494268..495148)
FT                   /locus_tag="FTW_0502"
FT   CDS_pept        complement(join(494268..494819,494819..495148))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0502"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46421"
FT                   /protein_id="ABO46421.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            495142..495408
FT                   /locus_tag="FTW_0504"
FT   CDS_pept        495142..495408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46422"
FT                   /protein_id="ABO46422.1"
FT                   /translation="MAFLLDIITFLQISFSTNIFRINYNCASNSKYFTQHNLNYIAAEN
FT                   HAVSQYWLDFYSEYGLKVPQGQPGSHPNNLSLDDKFTYKAFLK"
FT   gene            495501..495992
FT                   /locus_tag="FTW_0505"
FT   CDS_pept        495501..495992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46423"
FT                   /protein_id="ABO46423.1"
FT                   /translation="MKIREATAKDFDDVVYIWSEHLLNNCQFFTTNEINNQGKLVVEKY
FT                   LNNPAFKSFVLTVEDQVIGFSCIKDNEILFSTVEQRFLGKGFRSFMLKYLLENYAVDTT
FT                   YVYSANIQTLAFYTSIGFIIEDKIDDIIFSSQYHINKLKLSATPQEIIEKIAAKNKDFF
FT                   "
FT   gene            complement(495970..497250)
FT                   /gene="sun"
FT                   /locus_tag="FTW_0506"
FT   CDS_pept        complement(495970..497250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="FTW_0506"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="GO_function: GO:0016434 - rRNA (cytosine)
FT                   methyltransferase activity; GO_process: GO:0000154 - rRNA
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46424"
FT                   /protein_id="ABO46424.1"
FT                   /translation="MNTRAIAAKTILDILDNKYSLLTIEQKLVKLNLLEQDKSFIKLLC
FT                   YEFFRHYYSLEKIIALYLTQKTKVKAKVLIMLGALQIFEIKQPYYATINETVAACKVLK
FT                   IIWAKKLVNRILREMTRNIEYITSIYTQNKAIDMPEWLCDTLKKQYPNDHLVIAQAINA
FT                   KADMFIRLNQNKDNKKVLDYFDKNNIGYSFTNLKDCIKLDQAIDVKYNQLFQQGYFTIQ
FT                   DISAQYAGHIIRAANNDKILDACAAPGGKTSHILECAPQADITAIDIIDKRLELLRENL
FT                   ERLSENHNVNVFKHDLTLPLAGKFNKIILDAPCSALGTIRRNPDIKVLRTPNDIQAIKS
FT                   LQSKILANLWNNNLTDNGYLLYITCSILAEENQQQIKEFLAKNNNAEIIEIDILEKYKT
FT                   SYGYQLLPSQQDGDGFYYCLLKKNPYF"
FT   gene            complement(497250..498038)
FT                   /locus_tag="FTW_0507"
FT   CDS_pept        complement(497250..498038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0507"
FT                   /product="inositol monophosphatase family protein"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46425"
FT                   /protein_id="ABO46425.1"
FT                   /translation="MKPILNSVTTIARKAGKIILQAQNDLSSIKISQKLDNTTVSNIDI
FT                   AVENFIIDNIKKSGFNDYFITEENGEFGNKDSRFTWIIDPIDGTNNFVHGLPHCCISIA
FT                   AKKDDDIVLGVIYNPFLDLMFCAYKGQGALLNGKKIRVAQNQDLKNTLISASLKYSRRI
FT                   FNDSYVAELIKLQQTISGYRYSGSIAMDMAYLAAGYIDGLWACGNVKIWDLAAGYIIMK
FT                   EAGAVVTNIHGTSDLDSGLIVAGNKKIQPKLIKILAKHIK"
FT   gene            complement(498125..499177)
FT                   /locus_tag="FTW_0508"
FT   CDS_pept        complement(498125..499177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0508"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46426"
FT                   /protein_id="ABO46426.1"
FT                   /translation="MKKHFTQPMILGVLLVAVLAGIAYFIAKIPTIKDLGISPLIIGIV
FT                   LGMALTHTPASKIIHKWKEGVIFSAKKILRFAIIFYGFNLTFQLIASVGLAGLSVSVIM
FT                   LVSTLILGIVLGTKIFGLDRDSSILVAAGSAVCGAAAVLATEGTLKSEPYKAAMAVGTV
FT                   VLFGTAAMFLYPILMKAGLLGHMTDAQYGIFAGGSIHEVAQVVAAGSGVSAHAEEVAVT
FT                   VKMIRVMMLAPMLIVIGIWIAKSATTVTGANGSKPEKGSIKKIIPWFAIGFIIVAGFNS
FT                   LDLLPVATVNSIRVADQFLLAMAMTALGLETHVSKFIQAGIKPLILALILFAWLFFGSI
FT                   AITYAITSII"
FT   gene            complement(499291..500489)
FT                   /locus_tag="FTW_0509"
FT                   /note="putative MFS familt permease"
FT   misc_feature    complement(499291..500489)
FT                   /locus_tag="FTW_0509"
FT                   /note="contains frameshifts"
FT   gene            500611..501297
FT                   /locus_tag="FTW_0512"
FT   CDS_pept        500611..501297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46427"
FT                   /protein_id="ABO46427.1"
FT                   /translation="MEFAKIIWEKNTPKSVSFDDFYFSTTSGIQESIYNFLVHNDLQQR
FT                   FSQLQNKQYFRICETGFGSGLNFILTKNLWHKYVINDSQLEFISFEKFPITINDLRKIL
FT                   NSFAELDGYQSFVEQYNPIDGLNIYKFDNITLKLIIDDVNNINHYNLPVIDAWFLDGFS
FT                   PTKNSLMWSDNLFDNISKLCHNHSSFATFTASSKVRKALQKYGFKVKKDKGFGNKREMM
FT                   YGVFMS"
FT   gene            complement(501287..501601)
FT                   /locus_tag="FTW_0513"
FT   CDS_pept        complement(501287..501601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0513"
FT                   /product="YCII-related domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46428"
FT                   /protein_id="ABO46428.1"
FT                   /translation="MAFFIYQGENMQIHIIDIHYLATQEEIAKVRPLHRDFLDIGYNKG
FT                   IFIASGPKTSKTGGIIIARGDIQEIKEFIKDDPFHTNKVVEYHFTSFDAVKHIPELANS
FT                   "
FT   gene            complement(501652..502911)
FT                   /gene="fabF"
FT                   /locus_tag="FTW_0514"
FT   CDS_pept        complement(501652..502911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="FTW_0514"
FT                   /product="beta-ketoacyl-acyl carrier protein synthase II"
FT                   /EC_number="2.3.1.179"
FT                   /note="component of fatty acid biosynthesis gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46429"
FT                   /protein_id="ABO46429.1"
FT                   /translation="MKSNRRVVVTGLGMVTPLGNDVPTTWANILAGKSGVETITGFDTP
FT                   APDISEFKVRFAARIKNFDVDALVGKKDAKRVDPFCYYGIAAANEALKDAGIDKVSEED
FT                   SYKFGVCVSSGIGGIETLETTKAVIDTKGPSKISPFCIPSSIVNMLSGIISINHGLRGP
FT                   NIPIVTACTTGTHNIGMAARLIASGDADAMLAGGSEKASNAIGMGGFAAARALSTRNDD
FT                   PQGASRPWDKDRDGFVLGDGAGVVVLEEYERAKARGAKIYAEVVGFGMSADGYHMTMPY
FT                   APGQERCIQNALADAGLENNPDAIDYVNAHGTSTPLGDVQESQVVEKVIGQYRKDLVMS
FT                   STKSMTGHLLGAAGAIESIFSVLAIRDQVAPPTINLHNLDDGCNLDYAANAAKKMKIDY
FT                   VLNNSFGFGGTNGSVIFKKI"
FT   gene            complement(502991..503275)
FT                   /gene="acpP"
FT                   /locus_tag="FTW_0515"
FT   CDS_pept        complement(502991..503275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="FTW_0515"
FT                   /product="acyl carrier protein"
FT                   /note="component of fatty acid biosynthesis gene cluster;
FT                   GO_function: GO:0000036 - acyl carrier activity;
FT                   GO_process: GO:0006633 - fatty acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46430"
FT                   /protein_id="ABO46430.1"
FT                   /translation="MSTHNEDSKKNNADEKAKIFSRVNHIIVEQLGVKEEDLKPEASFI
FT                   DDLGADSLDTVELVMALEEEFDTEIPDEDAEKIRTVKDVYDYIESKDVG"
FT   gene            complement(503371..504114)
FT                   /gene="fabG"
FT                   /locus_tag="FTW_0516"
FT   CDS_pept        complement(503371..504114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="FTW_0516"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="component of fatty acid biosynthesis gene cluster;
FT                   GO_function: GO:0004316 - 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase activity; GO_function: GO:0016491 -
FT                   oxidoreductase activity; GO_process: GO:0006633 - fatty
FT                   acid biosynthesis; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46431"
FT                   /protein_id="ABO46431.1"
FT                   /translation="MSLNEKVALVTGASRGIGFEVAHALASKGATVVGTATSQASAEKF
FT                   ENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSED
FT                   EWQSVINTNLSSIFRMSKECVRGMMKKRWGRIISIGSVVGSAGNPGQTNYCAAKAGVIG
FT                   FSKSLAYEVASRNITVNVVAPGFIATDMTDKLTDEQKSFIATKIPSGQIGEPKDIAAAV
FT                   AFLASEEAKYITGQTLHVNGGMYMA"
FT   gene            complement(504128..505048)
FT                   /gene="fabD"
FT                   /locus_tag="FTW_0517"
FT   CDS_pept        complement(504128..505048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="FTW_0517"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="component of fatty acid biosynthesis gene cluster;
FT                   GO_function: GO:0004314 - [acyl-carrier-protein]
FT                   S-malonyltransferase activity; GO_process: GO:0006633 -
FT                   fatty acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46432"
FT                   /protein_id="ABO46432.1"
FT                   /translation="MSKTAVVFPGQGSQKLGMLQDYYENFETFRNIVDEAKEHLGYDLW
FT                   NIIQNDEETLNKTEFTQPALLATSYAIYEVLKEQKPDLKIAYFAGHSLGEYTALLAAGC
FT                   ISYKDALQLVSTRGKLMQNAVTDKECAMSAILGLSNEDVIKSCQEASDAGIVEAANFNS
FT                   TGQVVISGEKAAVEKANTIAKEKGAKRAQILAVSVPSHCSLMKDAADKFEAELNKVEFK
FT                   EPTTAVVQNFDAKSHANPAEIKTAVIKQLYKPVLWTQSIEELVKLGVTEVIECGPNKVL
FT                   SGLIKRIDKSIDIKDTNSIDSLENI"
FT   gene            complement(505096..506067)
FT                   /gene="fabH"
FT                   /locus_tag="FTW_0518"
FT   CDS_pept        complement(505096..506067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="FTW_0518"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="component of fatty acid biosynthesis gene cluster;
FT                   GO_function: GO:0004315 - 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase activity; GO_process: GO:0006633 - fatty acid
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46433"
FT                   /protein_id="ABO46433.1"
FT                   /translation="MFAQILGTGSYLPEKILTNEDISKFVDTSDEWIKQRVGIERRHCA
FT                   SEAETTSYMATHAAKKALEAAQLTANDIDMIIVATSTPDFIMPSTASMVHQNLQIDNFK
FT                   VRCFDISAACSGFVYALDIAKQYIETGVSKNILVIGAEKMTRVLDWNDRSTCVLFGDGA
FT                   GAVVISTSQEKKILSSLLFTDGSCLDMLNVPNNLPTSRGQAINIDPYLIMEGNKVFKFA
FT                   VSRLSSLADELIQEAGIKASDIDWLVPHQANYRILNSTAKKIDMPMSKVVTTLQDHGNT
FT                   SAASIPLALDHAVRTNQIKPGDTIISEAFGAGFVWGGFIAKI"
FT   gene            complement(506164..507210)
FT                   /gene="plsX"
FT                   /locus_tag="FTW_0519"
FT   CDS_pept        complement(506164..507210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="FTW_0519"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="component of fatty acid biosynthesis gene cluster;
FT                   GO_function: GO:0003824 - catalytic activity; GO_process:
FT                   GO:0008610 - lipid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46434"
FT                   /db_xref="GOA:A4IWY2"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWY2"
FT                   /protein_id="ABO46434.1"
FT                   /translation="MGYKISIDAMGGDHGLNTTIPAALEAVKKDSNLQIVLVGDHHKIK
FT                   RALDRYSKVKKIKLPVLQRIAIHHASETVGMDESPSIAVRKKKDSSMRVAINLVKDRTV
FT                   DACVSAGNTGALMATSKFVLKTINGVDRPAIVYALPAFNRETKQLSKTYMLDLGANVVC
FT                   TSEQLFQFAIMGSILAASSKGIAEPRVSLLNIGEEEMKGLDNIKNAAKLLQGCDFINYN
FT                   GYIEGKYIFDDTTDVIVCDGFVGNVSLKTMEGSLRLIESLIKKTIQESSLLMKIPIVMA
FT                   LPIFKKMKKGMNLDSFNGASLLGLTGIVVKSHGGASANAFETAIYEAIKEIKYNIPKTI
FT                   QESLEKVL"
FT   gene            complement(507309..507491)
FT                   /gene="rpmF"
FT                   /locus_tag="FTW_0520"
FT   CDS_pept        complement(507309..507491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="FTW_0520"
FT                   /product="ribosomal protein L32"
FT                   /note="GO_component: GO:0009282 - cytosolic large ribosomal
FT                   subunit (sensu Bacteria); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46435"
FT                   /db_xref="GOA:A4IWY3"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWY3"
FT                   /protein_id="ABO46435.1"
FT                   /translation="MAVQQVKKSRSKRDIRRSHDSLTNPTLSTDKSTGELHLRHHVSPN
FT                   GFYKGRKVVDTKSED"
FT   gene            complement(507535..508038)
FT                   /locus_tag="FTW_0521"
FT   CDS_pept        complement(507535..508038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46436"
FT                   /protein_id="ABO46436.1"
FT                   /translation="MKGKHSQINYSIYAKQKRELEDIEITIEQLNQISDFITANPHTFV
FT                   CSFSFFEEKNHTCIKYSIKAKLQLICQDSLEVFEHDFNITNTIIITEDDRLVEDSLYEP
FT                   FICNSAIIDLKDIIKEEILLDLPLIPKKDTSTCKNTKKHSYYSEQESVIQEKKNPFEIL
FT                   KTLK"
FT   gene            508178..510169
FT                   /gene="tktA"
FT                   /locus_tag="FTW_0522"
FT   CDS_pept        508178..510169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="FTW_0522"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004802 - transketolase activity; GO_function:
FT                   GO:0005488 - binding; GO_process: GO:0006098 -
FT                   pentose-phosphate shunt"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46437"
FT                   /protein_id="ABO46437.1"
FT                   /translation="MSLSIPREFSNAIRFLSIDATLKAKSGHPGMPMGMADIATVLWTK
FT                   FLKHNPNNPHWINRDRFVLSNGHGSMLLYSLLHLTGYDLSIEDIKNFRQLHSKTPGHPE
FT                   YGYTPGVETTTGPLGQGVANAVGMALGEKLLSDRYNTPDLKVIDHHTYVFLGDGCLMEG
FT                   VSHEACSLAGTLGLNKLVAFWDDNNISIDGDTKGWFSDNTPERFRAYGWHVIENVDGHD
FT                   FVAIEKAINEAHSQQQKPTLICCKTVIGFGSPEKAGTASVHGSPLSDQERASAAKELNW
FT                   DYQAFEIPQDVYKYWDAREKGQALEANWQGQWNLFKDSPKFDEFERVLSKELPVGLESA
FT                   INDYIASQLSNPVKVATRKASQMVLEVLCKNMPEMFGGSADLTGSNNTNWSGSVWLNNT
FT                   QEGANYLSYGVREFGMAAIMNGLSLYGGIKPYGGTFLVFSDYSRNAIRMSALMKQPVVH
FT                   VMSHDSIGLGEDGSTHQPIEHVPSLRLIPNLSVWRPADTIETMIAWKEAVKSKDTPSVM
FT                   VLTRQNLMPVVQTQHQVANIARGGYLVKDNPDAKLTIVATGSEVELAVKVANEFEKKGI
FT                   KLNVASIPCVEVFATQAHEYKKTVIKDDIPAVFVEMAQPDMWYKYMPKAGGEVKGIYSF
FT                   GESAPAEDLFKRFGFTVENISNIVAKYV"
FT   gene            510162..511208
FT                   /gene="gapA"
FT                   /locus_tag="FTW_0523"
FT   CDS_pept        510162..511208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapA"
FT                   /locus_tag="FTW_0523"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.-"
FT                   /note="GO_function: GO:0008943 - glyceraldehyde-3-phosphate
FT                   dehydrogenase activity; GO_process: GO:0006096 -
FT                   glycolysis; GO_process: GO:0006094 - gluconeogenesis;
FT                   GO_process: GO:0019682 - glyceraldehyde-3-phosphate
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46438"
FT                   /protein_id="ABO46438.1"
FT                   /translation="MFNKLSQDNILRRLKMRVAINGFGRIGRLAFRQMFGKDNIEIVAI
FT                   NDLTNPEMLAHLLKYDSAQGRFSKAAVTVAKESSIVVDGKEIKIYAEKDAANLPWGELN
FT                   VDVVLECTGFYVSKAKSQAHIDAGAKKVVISAPAGNDLPTVVFGVNHDILSADDKIISA
FT                   ASCTTNCLAPMAKALHDLATIESGFMTTIHAYTGDQNTLDAPHAKNDFRRARAAAVNIV
FT                   PNSTGAAKAIGLVIPELAGKLDGAAQRVPVATGSLTELVAVVSKKVTAEDVNAAMKAAA
FT                   NKSFGYTEEELVSSDIIGISEGSLFDATQTKVTSLGDKSLVKVVSWYDNEMSYTNQMVR
FT                   VVEYFGAL"
FT   gene            511227..512405
FT                   /gene="pgk"
FT                   /locus_tag="FTW_0524"
FT   CDS_pept        511227..512405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="FTW_0524"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="GO_function: GO:0004618 - phosphoglycerate kinase
FT                   activity; GO_process: GO:0006096 - glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46439"
FT                   /db_xref="GOA:A4IWY7"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IWY7"
FT                   /protein_id="ABO46439.1"
FT                   /translation="MSFLTLKDVDLKDKKVLVRVDFNVPVKDGKVTSKVRIEAAIPTIQ
FT                   YILDQGGAVILMSHLGRPTEGEYDSQFSLEPVAKALSEIINKPVKFAKDWLDGVDVKAG
FT                   EIVMCENVRFNSGEKKSTDDLSKKIASLGDVFVMDAFATAHRAQASTYGVAKYIPVACA
FT                   GILLTNEIQALEKALKSPKKPMAAIVGGSKVSTKLSVLNNLLDKVEILIVGGGIANTFI
FT                   KAEGFDVGNSLYEQDLVAEATEILAKAKALGVNIPVPVDVRVAKEFSENAQAIIKKVSD
FT                   VVADEMILDIGPESQKIIAELLKSANTILWNGPVGVFEFDNFAEGTKALSLAIAQSHAF
FT                   SVAGGGDTIAAIEKFGIKDQVSYISTAGGAFLEFLEGKKLPAIEILKEKAIR"
FT   gene            512421..513857
FT                   /gene="pyk"
FT                   /locus_tag="FTW_0525"
FT   CDS_pept        512421..513857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="FTW_0525"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004743 - pyruvate kinase activity; GO_process:
FT                   GO:0006094 - gluconeogenesis; GO_process: GO:0006096 -
FT                   glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46440"
FT                   /protein_id="ABO46440.1"
FT                   /translation="MRRTKILATLGPASESREALTEMIKAGVNAVRCNFSHGSAEDHRK
FT                   RVDLIRQIAKEQDTHVGILADLQGPKIRLSKFKNGSVEIKKGQKFTLDADLGINDGDEN
FT                   TVGIDYKELIQDVKKGDILLVDDGKIVLEVDSVKGNKAVTKVVVGGKVSNNKGINKKGG
FT                   GLTAPALTEKDKEDIKIAAMLQVDFLAVSFVRDGKDMEYARQLVHEAGWRPAMVAKIER
FT                   AEAVLEDNLKSIVDASDLVMVARGDLAVEIGDENVPTVQKLIISTARRNEKGSITATQM
FT                   MESMIENSSPTRAEASDVANAVFDGTDAVMLSAETAVGKYPVETVSAMSRICKSAEKSK
FT                   YTHISKKQKIADCDRIDHAVSVAAVKIANDIGAKGLIVLTEGGNTSRWMSRINTDLPIY
FT                   ALSRNATTLGAMTLFRGVVPIYFDSTRMSKLYVNRSACMELESRNLAKDGDIFVLTSGD
FT                   SMGVHGSTNKIKVIIAGQVR"
FT   gene            513873..514937
FT                   /gene="fba"
FT                   /locus_tag="FTW_0526"
FT   CDS_pept        513873..514937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="FTW_0526"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="GO_function: GO:0004332 - fructose-bisphosphate
FT                   aldolase activity; GO_process: GO:0006096 - glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46441"
FT                   /protein_id="ABO46441.1"
FT                   /translation="MALVSLRQLLDHAAEHGYGLPAFNVNNLEQVRAVMEAADKVNSPV
FT                   ILQGSAGARKYAGASFIRHLVLAAIEEYPHIPVCMHQDHGTSPSVCQRSIQLGFSSVMM
FT                   DGSLKSDGKTPADYEYNVNVTKTVSDMAHACGVSVEGELGCLGSLETGQAGEEDGIGAE
FT                   GTLSMDQLLTDPEEAADFVRRTKVDALAIAIGTSHGAYKFTKPPTGDVLSIKRVKEIHA
FT                   RIPDTHLVMHGSSSVPQDWLEVINTYGGAMGETYGVPVEEIVEAIKYSVRKINIDTDLR
FT                   MAATGAIRRFLAENPAEFDPRKYNAVAKAAMSEICAARYEAFGSAGMASKIKPISLEIM
FT                   FQRYESGELDPIVK"
FT   gene            complement(515105..516573)
FT                   /locus_tag="FTW_0527"
FT                   /note="trehalase"
FT   misc_feature    complement(515105..516573)
FT                   /locus_tag="FTW_0527"
FT                   /note="contains frameshift"
FT   gene            complement(516560..516955)
FT                   /locus_tag="FTW_0529"
FT                   /note="major facilitator family transporter"
FT   misc_feature    complement(516560..516955)
FT                   /locus_tag="FTW_0529"
FT                   /note="disruption due to transposon insertion"
FT   gene            516949..517829
FT                   /locus_tag="FTW_0530"
FT   CDS_pept        join(516949..517278,517278..517829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0530"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46442"
FT                   /protein_id="ABO46442.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            complement(517830..518708)
FT                   /locus_tag="FTW_0532"
FT                   /note="major facilitator family transporter"
FT   misc_feature    complement(517830..518708)
FT                   /locus_tag="FTW_0532"
FT                   /note="disruption due to transposon insertion"
FT   gene            518843..519856
FT                   /locus_tag="FTW_0533"
FT   CDS_pept        518843..519856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0533"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46443"
FT                   /protein_id="ABO46443.1"
FT                   /translation="MSEYKYCVGIMSGTSLDGIDVALCKIRGSGLDTDVKLIDCQTYPY
FT                   PTNLLCDIKKSLDLSTSNAQLLCSLNFKLGIEYANAVKKLVAANNLNLKDIAFIASHGQ
FT                   TIYHQANNEQGFIKSSLQLGDAATIAYECQTTVVSNFRAGDIAAGGDGAPLVPYVDYLL
FT                   YRDKDKSRALHNIGGIANTTIIPKNANIDDIYAFDTGPGNMMINRAMEVLFNQDYDKGG
FT                   DTAATGIVIVDMLQELLDNPYLKQKPPKSTGRELFGINYTDKIIAKYKQNKPEDIVHTL
FT                   TIFTAQSIVRAYKDFVFNKNKLDQIIFTGGGAYNKFLIKTISDLLDVEVLTFEDIG"
FT   gene            520088..523675
FT                   /gene="pdpD2"
FT                   /locus_tag="FTW_0534"
FT   CDS_pept        520088..523675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdpD2"
FT                   /locus_tag="FTW_0534"
FT                   /product="pathogenicity determinant protein D, pdpD"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46444"
FT                   /protein_id="ABO46444.1"
FT                   /translation="MDQDINDLLYDTNDLKKEKVCGGFFDFIKAWFYNDVERHMFFEDE
FT                   IIVAQKLKTMDVMANTYALERKKYFEKFLKDSHKQKGFFTRIKDRDFAFYKDPTRVKLW
FT                   SSITDTDVYSFFIKSSVNQVLGGGNIAQLTSLPKFKFNAIASVNNENISAAANLAATGA
FT                   KSFFGSSCINIWSNLPVFDSERGDVKSFIPLYLRISGKASSALFNYNIDISASTNRLKF
FT                   TESKCMELLNNFKGNVNLRLVAAKSSREAKSFIYTPKFKEDSNKHLNDLGFILNTQQGS
FT                   YRYLVPEIRDGLDLIREYTYPEIEQIYFGRSALSGYSKSNYDKQSLGIEKNGEGLMTLR
FT                   VSSKDYENPLIQVKTSVNVTSFDLLSGQIKGKILADDLIGFSDAKGAINKFRNEVDTII
FT                   KNNISESFKSPFKIPNLSEFSDMEIRVRFGLYSKQSASKLRTIRISIPMTTKMLDFNQT
FT                   SGSYNTKSGMGYSMAQRHQLKEAIPYNEGLLENSAQQDFDLVKPTGNSTLGAVQDNLSN
FT                   IYDKSSTFDSVIGSLRELYKLKGEDLTNIDSHDILNVLSQNSSLSGLSSSIAADLNELN
FT                   SKFKDITSINKKTSEAILSTNYQQYNPSFNKAKIFDNPDSFYVQDTLINYSQTLKKEEF
FT                   RDQMSTINIIEFGSDGDLPILFNLCKMMTSESAKDGAKNFLSQKENVNKTKEFFDALEN
FT                   TTSVISPESNISYTSINVLCSKNAGGVITENNKASSVSLGSTISLADFNRMYSLDSRVS
FT                   VLGVSPLEELSSFSAKKNEYKITFEEYFTKLAIQRYMEVIMIDDEADFIKSFVLPMMEC
FT                   QKKLLDNLVILNKDAKWKSSSSFKRAFSNRGSFSFTGWLKERLPGFDFELSQEYAYFTG
FT                   LVINFAFEEDNSSSETVIKLCKIIKSLDRLVRGFYFLLRRMVKNRNTKVGSHNVSESHI
FT                   NMVKQILTSLCEPYQILTQKVSDNAELLSALVNMLSFMDSLVEVQRLCASICIPTSAFF
FT                   TLVNENKNLLKDICYTVEKSGVTGIVVESTFSYSPELFKENQQDIKLNIKNTSVRVRDG
FT                   KVKRVTSIDRNANTEAILQSIYDNIIAFDEQDLERLFTGFRILKQENSTNTNKAVFNIG
FT                   LTYHPITNNAFVEFNKDQQSLLYSYNNLSKDAYVTKIKSIVDAKVALNLSFEHEEIRSS
FT                   QGFSVLATVPARGYSIDDLNRKYRPMIWV"
FT   gene            523756..524310
FT                   /gene="iglA2"
FT                   /locus_tag="FTW_0535"
FT   CDS_pept        523756..524310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iglA2"
FT                   /locus_tag="FTW_0535"
FT                   /product="intracellular growth locus, iglA"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46445"
FT                   /protein_id="ABO46445.1"
FT                   /translation="MAKNKIPNSRLMINYETNVDGVLKKKELPYRVLVVGDLSKGRSVD
FT                   AKKEFADREVRRVNNGVDRVLEEMNISFDFEAPNFVSKDRSNLKVNYRIESVKDFRPDA
FT                   VAKKVPEIRALLEMKEILASFAKDIENNRNLKKTIDMIFSDSNELESLKSKIPALTNYT
FT                   IKDSCDAAESQDLSNQQVDGK"
FT   gene            524324..525844
FT                   /gene="iglB2"
FT                   /locus_tag="FTW_0536"
FT   CDS_pept        524324..525844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iglB2"
FT                   /locus_tag="FTW_0536"
FT                   /product="intracellular growth locus iglB"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46446"
FT                   /protein_id="ABO46446.1"
FT                   /translation="MTINKLSLTDELLNNFGGSTEVDSVLKNIDFDVSDDASKVLSLST
FT                   DYNARNLMALSLVLANNDNINNYNQKYIQKVITVIDKLIDLQVNSIISNDEFRALEQEW
FT                   LKVQEVCQEDYDNVEVSILDVKKEELQYDFERNLYDISSSDFFKKVYVSEFDQYGGEPY
FT                   GAILGLYNFENTTNDIIWLTGMGMVAKNSHAPFIASIDKSFFGVKDLSEITHIKSFEAL
FT                   LEHPRYKEWNDFRNLDVAAYIGLTVGDFMLRQPYNPENNPVQYKLMEGFNEFVDYDKNE
FT                   SYLWGPASIHLVKNMMRSYDKTRWFQYIRGVESGGYVKNLVACVYDNKGILETKSPLNV
FT                   LFADYMELSLANIGLIPFVSEKGTSNACFFSVNSAKKVEEFVDGFDSANSRLIANLSYT
FT                   MCISRISHYIKCVIRDKIGSIVDVESIQKILSDWISEFVTTVYQPTPLEMARYPFRNVS
FT                   IEVKTIPGKPGWYSCKINVIPHIQFEGMNTTMTIDTRLEPELFGTNNN"
FT   gene            525855..526490
FT                   /gene="iglC2"
FT                   /locus_tag="FTW_0537"
FT   CDS_pept        525855..526490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iglC2"
FT                   /locus_tag="FTW_0537"
FT                   /product="Intracellular growth locus iglC"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46447"
FT                   /protein_id="ABO46447.1"
FT                   /translation="MIMSEMITRQQVTSGETIHVRTDPTACIGSHPNCRLFIDSLTIAG
FT                   EKLDKNIVAIEGGEDVTKADSATAAASVIRLSITPGSINPTISITLGVLIKSNVRTKIE
FT                   EKVSSILQASATDMKIKLGNSNKKQEYKTDEAWGIMIDLSNLELYPISAKAFSISIEPT
FT                   ELMGVSKDGMSYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIAAA"
FT   gene            526511..527707
FT                   /gene="iglD2"
FT                   /locus_tag="FTW_0538"
FT   CDS_pept        526511..527707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iglD2"
FT                   /locus_tag="FTW_0538"
FT                   /product="intracellular growth locus iglD"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46448"
FT                   /protein_id="ABO46448.1"
FT                   /translation="MFLERIYWEDGLRLDSDILDKSNLSVLERLSTASYLPANLNKGIV
FT                   SFDLDVESLQTGLILIKDLKLYLDEKNFVFYDKSYPLSLQIMTDKLSDEIPLFLNIREK
FT                   VIEKNGIKYIYNQLSLSLEHSYGFKHSIQIALFRLDRGRLVPEIYDFPLLTLNHYYLGD
FT                   IFVKLNRTVSELKSFNRFVFSASRSYASILLVFLINKLERELKFAESNRANSSPKQIFD
FT                   LIDDIYSLIQLNLDKVEELDSIEFDFQKPLTKLNLLADRLLTLCEYRKINNFIRFELHG
FT                   KKYICESFPEEFFVATRYYLFLKRKATAPANVRFENKNALRITSISRNKNIVALSLSGV
FT                   KLVDVECSMINFTTRFDNIDAIYEIQKGSEWDFILADSSAVFTAFEGSENFDFFIAFS"
FT   gene            complement(527714..528289)
FT                   /locus_tag="FTW_0539"
FT   CDS_pept        complement(527714..528289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46449"
FT                   /protein_id="ABO46449.1"
FT                   /translation="MSKKIFKLLSISIIFSIYQQTFSNTITASTFELKNSSKKNATIFL
FT                   NLNEFCPTNIAACKDENDNNCIYITELVREPLSRIYYYLAVPITSKSVKDLTILYKHDK
FT                   EESPPEAINICLSLFKNNKHETYYSQVIYNWFVSSELYLSFSEGSIFINKDINNSNNYD
FT                   KGNFLSVNLERIADGWAPPHYEKKITII"
FT   gene            complement(528307..532293)
FT                   /gene="pdpC2"
FT                   /locus_tag="FTW_0540"
FT   CDS_pept        complement(528307..532293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdpC2"
FT                   /locus_tag="FTW_0540"
FT                   /product="pathogenicity determinant protein pdpC2"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46450"
FT                   /protein_id="ABO46450.1"
FT                   /translation="MNDKYELNIYFEKIELPKTADFNMISKHDIKELRVDANLKKKIHL
FT                   LQFDEDYLAYMRRLRSIHPSKIAMQKIKSIRNKKNSFIIAILSLDKIIHKTKFITFGHK
FT                   TVIFDFKKLWGLVDFVIVHTSNKTWVNHKLTSFMPSITYCNQNIIHLAYHSDFLYIYHT
FT                   PEFMDDINVDRENRRELVAKIPDPYWVRADTKENKINITSEKKNLEKDLKKITKLKNFE
FT                   ISANDIFFSKAIKAAPRLQHKNKSKLFNSLAIENNEKIKRDIIDYAISNAWYKNEGLLE
FT                   NLMTFLDALIVRHLYLIAVYSVYEIEIGIKSVKPEYSKLLKAGLLNKDIQNQLIYDQKK
FT                   ISNIIWLGETFHGLDIEEAQALCEFLDEENINPKINPINSKKLYKTYKENYKSDSEKIL
FT                   SFTKYKEKYNFLNNDKLREEHANKLSSILEDPKFRVLSYINAFLCSTKNYLVPYGYLGS
FT                   NPLTYYNCMLETGKRRTSKEAYFADIRNKLFIVCYLPGFLSSVIADDDFIDWYSNKKEN
FT                   QELLKNSYLNNLYNSKQKYIKDFIDLDIIKLLKQTSSQIKPSYIPVAFRYGAFASTTAL
FT                   IRSNANVSNRMEFELYDSPERLHNQYSEKEEMIMPKSVNNPKDHSIDNGMSLFSLNLTN
FT                   EKEDGLRKVMLKVAQLYNLDFKVGISGNLDQAMTQALILGMATTKKNGDIVIDEDQVLY
FT                   MTYLYCIFMAHSVDHTVDEILMSSNTYMLNSKEEKYPIANIANFFARPVFKLSKDKEFK
FT                   ALVEKYENSIKPNSKVLKENYISRVTTLSEVYEDIYNLNCLYSSLSEGSLYNLLSTHSE
FT                   RNCTLLEQYSRKKKAETGLVQDGEKIKVVNNYNSYAAINQYQRFVSLGIMYDSGAKYSS
FT                   SHKKQIEKDFNLYSPDKEQINYLKYNFKDNKFDAVYKNKKSKEKTQSHIVYAKKQNTRY
FT                   CYGYFNDFFVKNRITTFYKIKDKSGNYLVNLHNEKYSFATPNSDSKIYRVSPELLNNRD
FT                   DFKRVSKDIIKSYKYISFDKQKEDIVKNFGKNLYHTNYEIWVGLSHQAISCFSVLDNID
FT                   TQEAANTFIDALYYIRLMQLYYGKTIPFLWISSEIVRYSSSETHYYIPTEENFENILKI
FT                   ALNRASKPVIERFLIILNIYNNTIDDNTLILIRCRLTIILFEHEEQKLKLKALQKYADA
FT                   YKKNNYKNEINFRAWFESIFHVQNLSLSPNYIGNNILILSLVEELKTKCSEYKKNMINQ
FT                   QIIAKANELNFYQLLIRLIEISTYHRILTKSIITNTTSLLYDILNKPEFQTINKLINKL
FT                   FIYKNKDLNTDKYKAFHTKLITIEKTYKKINSLYKSDFFKKISS"
FT   gene            complement(532333..533049)
FT                   /locus_tag="FTW_0541"
FT   CDS_pept        complement(532333..533049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46451"
FT                   /protein_id="ABO46451.1"
FT                   /translation="MQHINNINKNISLNNFVSLLKSQKYSLKRINFIPVMINKTSSPTI
FT                   LDIYDNKETLNVKINIFKIKPFTKLQSIYQEYIQNNNDLAIEILGYGLKVLLKLYILDT
FT                   KALHKFTTKNSYYIQCAPKYTIDNIINNIYKLLSEDYCTVIDYKEKLINIKRKQIVVGD
FT                   SYVGKSFLGAYIPSYVYIINIKIYLISKNQYVINKIKTQIKKIEEKITNLPFKIELEIS
FT                   IENNKKNQIYLGYFNL"
FT   gene            complement(533072..534223)
FT                   /locus_tag="FTW_0542"
FT   CDS_pept        complement(533072..534223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46452"
FT                   /protein_id="ABO46452.1"
FT                   /translation="MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLID
FT                   NLNTTRSIDIYNLFLSLNSEICLNLDTVDNISKIISSYLSILNTNFTRISPSESKQKNQ
FT                   LAEKGINKFLVTMDANFAQMQNQDKLLPNNIDSIIKIVQEVIIFFEKNNLNYNSDFKIQ
FT                   LNKTLRKIKSSLILKDQKNDTYSDKESINQVEATITDQKTIQGSEKWKTLIEKIEVLKA
FT                   LVESERIFETSIVYNDIQNLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSSI
FT                   QWSIAQKMYNIDYKSFLDTLEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIA
FT                   DTDAIKEEIVIKQRTNNKKNQNDPVEKISNKIDEDYFEDLFDI"
FT   gene            complement(534245..534868)
FT                   /locus_tag="FTW_0543"
FT   CDS_pept        complement(534245..534868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46453"
FT                   /protein_id="ABO46453.1"
FT                   /translation="MKDFKEIEIILDIIKTTREIIEDNDNDNEKISYHRNNIRKSIFFL
FT                   QEELLEKYSETVCKYIVFPLLAYVDEKLMLLREKSASNISWSLLQLEYYDRKDGGEYVF
FT                   EITDNILSENIYPEICYQTISLILHNDFYGKYYDNIYNHSFLAYKKEIDKHIENSTIDS
FT                   VNFIDIPVNSPPLSRKYSKTLKFLLRIGVPLGLFLLSLLILLSW"
FT   gene            complement(534881..536311)
FT                   /locus_tag="FTW_0544"
FT   CDS_pept        complement(534881..536311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46454"
FT                   /protein_id="ABO46454.1"
FT                   /translation="MDEKRKDLSTNDASILKKTFDKLSNDIRDDFDKRIFDYSNTLLFK
FT                   YYSNLYYFVPKSCLLEINDKGHNGYYIPPQEYFFIEDKRTGKTLTYTTKSENIILPIRD
FT                   ITTIKQSDTSINISLEFANNFDYDYVTIWIDPTLCKEDPSFATYIFNQVLEDNGSAKIK
FT                   FSNHSYTTKNVQIEPIKFQLKPTEKLVLNIHSPSLLYGFNIKIKDLFKYKNNDLNKIDF
FT                   FLEVKTENYNDEKLSSLFRVNLIPVFNSFDDYSSTSFASMNLSESKLKHHQKDDAQAIE
FT                   VLSVYENNKQCDFNSFLFVGQNEYYFNRSTQSLNYSSVLPQFSNKIIGTKIHTYTTWTQ
FT                   ITEISDLIEINSNAIASISCNISPIVINKALNNYNSNAKEMFNIIDMIISKNMYSKTTF
FT                   LAIAKLLKINTNDLTLLSMLLQDVEMDSTINELILTLSDKYNPKYKHFLNFHIGIICKF
FT                   INQNTFSFIKKIVLNNSI"
FT   gene            complement(536324..536845)
FT                   /locus_tag="FTW_0545"
FT   CDS_pept        complement(536324..536845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46455"
FT                   /protein_id="ABO46455.1"
FT                   /translation="MLNIINDSLKRLEEITTNDESISSSVSDLVADLNNIKILLAQSKL
FT                   HLSSNASILTTSMGAQIKCSYSLGSGIYLSTRIKTLTNNLPASNITDSKLGANILPFAG
FT                   CTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLENAPITTINSKAMCMFAPGGIVDFI
FT                   SSGQINVKTS"
FT   gene            complement(536846..538576)
FT                   /locus_tag="FTW_0546"
FT   CDS_pept        complement(536846..538576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46456"
FT                   /protein_id="ABO46456.1"
FT                   /translation="MNNNIDKWFENLFSNIHLYYKQEQSYKISKLNECITNVIKFINIK
FT                   DYRKADIYNLTYVIEDVRYSTNLILSDSAIKFNDLILKKLDNLLDCTDINYFTSLMKNL
FT                   KVLLEKYKLVIEKDISNRIELIKTKQIDKLESIFLDYINNHSISAYDDSLVKLYVKTIQ
FT                   NPNSIEAIDEYKSYFDTLKIFIKDHKNIVSFIPFRKNPILSLLKLAYLIRTGLYKTDRL
FT                   LASDIILLRALYSINKDTYKLSLINEKTDTNLSIVSLTSLQAKPSENLKKTIDFIDLQI
FT                   FAISQYFDDFPLQDIFFQKKSQIDIFKSESLEQLIFSLKSISNIMFDEETLYKKIHIKN
FT                   QLYKNLFLNNHNSLIEDIIEKSPANLLTKLANKYFQILLDIATIINIQLVSNNLKLIYP
FT                   FLEFEKYFNQVTLEVSKKSQFNQEKLEKNILNIIRIYPLLNQNYQLLKDMEQKIIDDKN
FT                   SIESNDIYKLSVFVNSKSFSTYKEIRTLTSNDHKDINIHKSLAKLNKNICNAKHKNAAE
FT                   TAKELTMVLLSKSYYMNPTLIGVYNLPPISNSFFLVLKEITNNPIIDSIKSKQEAYWKI
FT                   "
FT   gene            complement(538581..539075)
FT                   /locus_tag="FTW_0547"
FT   CDS_pept        complement(538581..539075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46457"
FT                   /protein_id="ABO46457.1"
FT                   /translation="MSKADHIFNLEEQGLLIDIKDDSKGCTTKLESSGKIKHYATESIE
FT                   SSADKQIIENVKDSKISITEKEILLATKKSSIMLSEDKIVIKIGNSLIILDDSNISLES
FT                   ATINIKSSANINIQASQNIDIKSLNNSIKADVNLNAEGLDVNIKGSVTASIKGSTATMV
FT                   G"
FT   gene            complement(539088..539465)
FT                   /locus_tag="FTW_0548"
FT   CDS_pept        complement(539088..539465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0548"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46458"
FT                   /protein_id="ABO46458.1"
FT                   /translation="MYNKLLKNFCLVLSTIIGLSSCISDGLYINNNIPKTKIVLESKPD
FT                   KNIFYSDNYQSISQRIYDDNVKVLNLKTGKNEFPLDKDIKDYALYFILPENKKTENWKY
FT                   IISSDSVNKFTIKNDSSIEKD"
FT   gene            complement(539455..542736)
FT                   /gene="pdpB2"
FT                   /locus_tag="FTW_0549"
FT   CDS_pept        complement(539455..542736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdpB2"
FT                   /locus_tag="FTW_0549"
FT                   /product="pathogenicity determinant protein pdpB2"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46459"
FT                   /protein_id="ABO46459.1"
FT                   /translation="MNFIKNHQILIISLTIAIIVLSVLGIFMIKKWLKTSRNPNKKSAS
FT                   KTIKNAKSLIKKNKVKNNLSELYIFYGDYLAAKDYITKIKPQAQIIDNNELPLIAIDKN
FT                   NTSLVFANNEFSYLYKLKKKLNLQFYKLNFCFDISDDYYHENIKISEIYKELLKLRLKN
FT                   FIISFYTLSEHTRSYNNAIDKKSIFKLTSDADTNHKAEEEILSKILSSKDDVNNKYNNV
FT                   KILNQIRRLLKNIHPQLKSINKETFFNFGLNTPDNIIAKKDTIFFSSSPKSIIINLISL
FT                   LFSFIFIVNIFQEINIKEKFSIQELNQLHESDSNKIIEETRKKIDEAILLDILYPKSIK
FT                   YHFIYEQYADTLLKNVILPKYNDTYDLSMITSFLIFFEYLDNKIINQHTNRILKIISSI
FT                   TNLSEKQLDIVINYTTPSIRTEMIKSAINRANKLYTNRLIVVGEDSESYLSTKGFNAEY
FT                   LGISNTKRAKVINNIYIQYLYKCATDNAILDLNDNYIIPIEVNNIFKMYQEQFDTSSKK
FT                   LCNSSYINSITKSVSLILNQEENKRKFESFSDMLDHIYYLVKSLEKNAKDVADDGKKQT
FT                   SSITVSLINYVINSVVNPTYNKNELPLISPVSKNLYMEFAPNFYSKRILISPIYSKEYI
FT                   KDNIDPTNKKFNRLVNNLKNNFNIEPDFMIAIYKSSINNYIEKYIGSYNKMIDSLNNDS
FT                   EFNKNISNKGALKLYLLAMSSKDSSFNSLIEFYSTNTDLITNESETNSSKKINKLQHFY
FT                   GEITKLNKQNNTNDQNDKSLWAPIDNYFKENDKYLESKSYADYKNIFKQLNNLIIEQGY
FT                   SSTYKNIKQGYEPLQKVYSELSKINNHQGNNNLYKLLKKHLDIAINTIKTIAIQDAITK
FT                   LDNTVNIEYEYINNQFPFNKDSNSAATNEAITKDFDNNGYIYSGFIEQLSPLLSYNKTD
FT                   DRWESKDFSKPEEIDYLNKFNKVYLLNKLLWDDKRNPKAIKFDITPIPNKDNDYTFFSI
FT                   ILDKQNYVNSLNIKYSDSIEVLYNWNSLESTTITIKFEDGSNEQISYQGKWSILKAIKD
FT                   ANCDQNNICTWVIKHKGKKYPLSFKIESKFLQVLGWQKQGEVNVQ"
FT   gene            complement(542741..545203)
FT                   /gene="pdpA2"
FT                   /locus_tag="FTW_0550"
FT   CDS_pept        complement(542741..545203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdpA2"
FT                   /locus_tag="FTW_0550"
FT                   /product="pathogenicity determinant protein, pdpA"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46460"
FT                   /protein_id="ABO46460.1"
FT                   /translation="MIAVKDITDLNIQDIISQLTSEVINGDTTSSSAKFACEINSYIIN
FT                   YKLLNINLINTQLKNTKILYRKGLISKLDYEKYKRYCVICRLKNNIDEFILYFSTNYKD
FT                   SQSLKIAIKELQNSCSSSLILELPHDYIRKIDVLLTSIDSAIQRSSDLNKTIIKQLNKL
FT                   KSSLSRYIGYNNVLQKQEITINIKPINKNFELEDISFVSTRNKQYFKHNSLTLKNPHIE
FT                   KLEVCENIYGINGWLTFDLAYINNHKDFNFLLSPNQPILLDIQINDSFNFYKKESKKDH
FT                   HKRTTRFMAIGFNSNSIDIHENFEYSIYSYTKNVSSGVKKFKIQFHDPLKALWTKHKPS
FT                   YIALNKSLDDIFKENFFFDNLVSLDTNKSNNLKIRIPQAFISTVNRNFYDFFIQQLEQN
FT                   KCYLKYFCDKKSGKVSYHVVDQVDNDLQRNIVNSDEDLKDKLSPYDISCFKKQILISNK
FT                   SNFYVKEKNICPDVTLNTQKKEDRKISDTLIKPFSSILKDNLQSIEYIQSNNDDIQEII
FT                   TTGFEILLTSRNTLPFLDTEITLSKLDNDQNYLLGATDIKSLYISQRKLLFKRSKYCSK
FT                   QLYENLHNFHYKSDSESDVYEKIAFTKYPSLTHDNLITYKIKDYSNLTPEYPKYKSFSN
FT                   FYINGRVTIGENVNNDSKKAYKFFKNYKPEESSIAEFQENGEKGTSAILNSKADILYAI
FT                   EIAKEMLSDKSSDKPIIYLPLKVNINSANNQFIPLRNDDIILIEMQSFTKGEIIELISN
FT                   SAISTKKAQQQLLQRQLLGSKENCEMAYTQTSDSETFSLTQVNEDCENSFLINDKKGIF
FT                   LRYKSKGN"
FT   gene            545573..547101
FT                   /locus_tag="FTW_2070"
FT   rRNA            545573..547101
FT                   /locus_tag="FTW_2070"
FT                   /product="16S ribosomal RNA"
FT   gene            547197..547273
FT                   /locus_tag="FTW_2064"
FT   tRNA            547197..547273
FT                   /locus_tag="FTW_2064"
FT                   /product="tRNA-Ile"
FT   gene            547288..547363
FT                   /locus_tag="FTW_2044"
FT   tRNA            547288..547363
FT                   /locus_tag="FTW_2044"
FT                   /product="tRNA-Ala"
FT   gene            547415..550304
FT                   /locus_tag="FTW_2067"
FT   rRNA            547415..550304
FT                   /locus_tag="FTW_2067"
FT                   /product="23S ribosomal RNA"
FT   gene            550349..550463
FT                   /locus_tag="FTW_2074"
FT   rRNA            550349..550463
FT                   /locus_tag="FTW_2074"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(550843..551427)
FT                   /locus_tag="FTW_0552"
FT   CDS_pept        complement(550843..551427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46461"
FT                   /protein_id="ABO46461.1"
FT                   /translation="MKEQNMKTFIENDLIKALSAIKLMGIAITIIAAFYFQFAMDELPC
FT                   PLCLLQRLGLLAIGFGFLLNMRFNIRPSHYALSLLAAVFTSFVSLRQIALHVTDPVGFG
FT                   SKVLGMHMYSWVFVISMIAIIYIAIVMSYPRQYELRRQPQQISEAKNNIIRLFIQIIFI
FT                   IFLLVVFANVVSTFFECGLHECPDDPTRYLF"
FT   gene            complement(551674..552597)
FT                   /locus_tag="FTW_0553"
FT   CDS_pept        complement(551674..552597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0553"
FT                   /product="putative cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46462"
FT                   /protein_id="ABO46462.1"
FT                   /translation="MLSLIGKTPIIKLKNTINNHNLYAKCEWLNPTGSIKDRVAKYILE
FT                   NLIKNKKIKPQQAIIEASSGNMGTSLAAIGKLYKHPVYITCPEKTGQIKREMIKSFGAN
FT                   LTICKNTSDHTDPDFYVNKAKQLTEDLNGILVNQYDNLLNTECHYKTTGQEIVDYFLTQ
FT                   NVDIDYFITVGGSGGTITGCAKKIKEFFPKTQVIMPDPYGSVYYDIFYHGAPIKENIHS
FT                   YKVEGPGNPVFCKSMDFAYIDEIIQFSDNQAIQACHELASEQGIYAGHSSGANYFIAKK
FT                   LLEKLPQHQSYNILIMVLDSGMKYAF"
FT   gene            complement(553024..553869)
FT                   /locus_tag="FTW_0554"
FT   CDS_pept        complement(553024..553869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0554"
FT                   /product="choloylglycine hydrolase family protein"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46463"
FT                   /protein_id="ABO46463.1"
FT                   /translation="MNKIISRVVLTGCIFSIASATFACSEFNHNFGGDLGVYTTRTMDL
FT                   FIDLKPNLTIYPRGTKETGGLKNNSLTWTDKYGYVSIDETNLANLTGEGLNEKGLVAHL
FT                   LYLGDTIQPKRDTSKPGVNGLYWIRYVLGNFATVKEVLDNLDSYQIYNPPIEINGKESN
FT                   IPVHYMVEDKTGDSALIEYINGKLTVHRNVKAISNEPSYDEQQKILRQAKELGFYNIDK
FT                   LPGGANSAYRFVRTTFISENLPKAKSMNQAVNYMFAAADSVSVPFIKGYRNESLNNPSL
FT                   "
FT   gene            554004..554894
FT                   /locus_tag="FTW_0555"
FT   CDS_pept        554004..554894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0555"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46464"
FT                   /protein_id="ABO46464.1"
FT                   /translation="MNFDDIFLFVKLVNIGTFTELAKQLNVSQSTVSRRIQSLEESINT
FT                   KLIKRNSRGVIEVTTEGQSLYNNFSYIEEQAVVTFQKWINNSKQIKGILRVGVPKLFFD
FT                   NLVAPKLDTFYTRYPNVQLVFSYTAGIVDLVKDNIDIAITTKKPTTNNCTIKTLLKSKN
FT                   KLYASKKYIQEKGVPETIKELENHSIVGFIDNDKCQNALVGFSELDNSSLEVNISPDLF
FT                   LNNAIYDINLATKCNRIINVLDIFANDKADIEPVLNEYYFGKTSFYLVRATGVRSNLER
FT                   EFVKFIDVCLQDKSF"
FT   gene            554926..555120
FT                   /locus_tag="FTW_0556"
FT   CDS_pept        554926..555120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46465"
FT                   /protein_id="ABO46465.1"
FT                   /translation="MSMRKILIILVVLIYTNSYAIVAGYSINPRGEKFVNNTSKARNNE
FT                   QQESSRVQQLEDKIAVANK"
FT   gene            complement(555130..556482)
FT                   /gene="trmE"
FT                   /locus_tag="FTW_0557"
FT   CDS_pept        complement(555130..556482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="FTW_0557"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="GO_function: GO:0003924 - GTPase activity;
FT                   GO_function: GO:0005525 - GTP binding; GO_process:
FT                   GO:0006400 - tRNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46466"
FT                   /db_xref="GOA:A4IX14"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IX14"
FT                   /protein_id="ABO46466.1"
FT                   /translation="MYTKDTIVAIATPQGNGGIGIIRISGIDALAIAEKLTKKQLKPRY
FT                   ATFCNVYNDNEIIDHGIVIFFKAPLSYTGEDVVEIQAHGNPFILNLIIKAALNCGARMA
FT                   KAGEFTERAFLNNKLDLAQAEAVADIINASSEIAAKSAAKSLQGDFSKEINNLLEKLIY
FT                   LRMYVEASIDFPEEEINFLEDQKIHSSLEEIYKVILAVKNSCKQGVILAEGITLILVGK
FT                   PNAGKSSLLNALAGKESAIVTSIAGTTRDIVKEHIQINGVPMHIIDTAGLRNSDDIIES
FT                   EGIKRAIKKIQEADQVLFVTDDYTNSQVKFSDIKEIIPEFYDQIPKDIDITYVHNKIDL
FT                   LKEVPHNHANHIYISAENNIGIDKLKEHILNKVGYTNQNESIYTARERHVTAINNAFEH
FT                   IKLAREQLELGNGELLAEELLIVQEYLNSITGEFSSDDLLGEIFSSFCIGK"
FT   gene            complement(556488..556733)
FT                   /locus_tag="FTW_0558"
FT   CDS_pept        complement(556488..556733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46467"
FT                   /protein_id="ABO46467.1"
FT                   /translation="MNNNVKQILTSLTLIAIAILSFIIFAPLFVFLIIFLMVSSFFIRR
FT                   KIIKENPEFFRQYKSKKGRVIDQENNDFDSSNQKLR"
FT   gene            556852..557148
FT                   /gene="yfiA"
FT                   /locus_tag="FTW_0559"
FT   CDS_pept        556852..557148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiA"
FT                   /locus_tag="FTW_0559"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="GO_component: GO:0005840 - ribosome; GO_process:
FT                   GO:0006412 - protein biosynthesis; GO_process: GO:0045449 -
FT                   regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46468"
FT                   /protein_id="ABO46468.1"
FT                   /translation="MNIQITGRHVEVTDSIKNYVNEKVGKVEHYFDNITSTKVILDVEK
FT                   DHQVAEAIVTVPGSEFVAKAEDKDLYAAIDMLEDKLARQLKKHKDKMRCNHGE"
FT   gene            557185..557640
FT                   /locus_tag="FTW_0560"
FT   CDS_pept        557185..557640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0560"
FT                   /product="PEP-dependent sugar phosphotransferase system
FT                   (PTS) family protein"
FT                   /EC_number="2.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46469"
FT                   /protein_id="ABO46469.1"
FT                   /translation="MNLKALIDKKNIILNLNIESKKRLIEFFANRIADTYPDVSEDLVL
FT                   KNIYKRERIGNTYIGKNIYIPHCRVENLMTTRLIIVTLKNSYYDDSVNDDIKIAVGVFF
FT                   PDNISTIHMELLKQLALYLKQDKTQQYFQQAENSEDLYNLIINTSNE"
FT   gene            557633..558376
FT                   /locus_tag="FTW_0561"
FT   CDS_pept        557633..558376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0561"
FT                   /product="RNA methyltransferase, TrmH/SpoU family, group 1"
FT                   /EC_number="2.1.1.-"
FT                   /note="GO_function: GO:0008173 - RNA methyltransferase
FT                   activity; GO_process: GO:0009451 - RNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46470"
FT                   /protein_id="ABO46470.1"
FT                   /translation="MNNLFNNIRIVLVEPSHSGNVGSTARAMLNMGLTNLWLVNPKKGI
FT                   DDEALALSCHATEVVNNATIVANLEEALEGVDYVVGTSARVRRVSLPIEPISKVATSIL
FT                   NKIQKSDEKIAILFGRERTGLLNEELLMSNVHAYIPSNEEYTSLNLAQAVQLVAYEIYK
FT                   QAIEISKLKQVPEYNHLHKKASVKELQGLYQHFEDSMIKSGFLDKDKPGHVMDKVRRLF
FT                   QRSELESQEVNILRGFLTSLENQDK"
FT   gene            558378..558941
FT                   /gene="rnhB"
FT                   /locus_tag="FTW_0562"
FT   CDS_pept        558378..558941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="FTW_0562"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="GO_function: GO:0004523 - ribonuclease H activity;
FT                   GO_process: GO:0006401 - RNA catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46471"
FT                   /db_xref="GOA:A4IX19"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IX19"
FT                   /protein_id="ABO46471.1"
FT                   /translation="MIILGIDEAGRGPLSGPVVAAGVILDQDKIIDGLADSKKLTEKKR
FT                   QSLYQQIITHAKAYTIVEISPQQIDELNILQATLKAMHQVANNLERQFDKVLVDGNKLP
FT                   NWDYNSEAIVKGDSKIIEISAASILAKVHRDNICLEHDRLYPQYGFAKHKGYPTKEHLE
FT                   NIKKYGVLDIHRKSYKPVQVLLNE"
FT   gene            558934..560205
FT                   /locus_tag="FTW_0563"
FT   CDS_pept        558934..560205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0563"
FT                   /product="sodium-solute symporter family protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0015370 - solute:sodium symporter
FT                   activity; GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46472"
FT                   /protein_id="ABO46472.1"
FT                   /translation="MNNSENYYTAGKSLGLFALTATLVMTELNISTLVGFSSLGYLYGF
FT                   SELFLGIVFLVGLLFYSFSVAKKWKNFDAICVSEFFSQRYNRAFGLMVALCLLIAMTGF
FT                   GANFIYSTTIYLQEIFPNYNHWLISGVACSLMLLFTIRDGLIRIVKIDKLSFILSLILF
FT                   VYLGYLVYKAGISSFKHISSQEVTLPFSFPISLAFLTAFTYILSPWYGQKIFAAKSKKT
FT                   AFYAVMIAAFIVSLIYLIAVYTTAKYAGMINLSNPDKAFTSIVTTLFSRPILVTFYIVM
FT                   FLIALTTIAALWNTMASMCFVHFQRNKSEKKNIITVIIIAILSYTLANTFIDQVLDKML
FT                   LFNIPIAALAFSLLYGFYGSRTNFLGAILSTIVGIVSALYCYLLFKQEEFVFYWAFICI
FT                   PLSFIVGYLPVITDKYRRLLRVKN"
FT   gene            complement(560202..560609)
FT                   /gene="mglB"
FT                   /locus_tag="FTW_0564"
FT   CDS_pept        complement(560202..560609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglB"
FT                   /locus_tag="FTW_0564"
FT                   /product="macrophage growth locus subunit B"
FT                   /note="inferred from sequence similarity with MglB protein
FT                   from F. novicida, function derived from mutation phenotype.
FT                   PMID: 9701818"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46473"
FT                   /protein_id="ABO46473.1"
FT                   /translation="MAMLRAYVVKATYNWLVDHGFTPYVLVDTEYEGVIVPANYIDEDK
FT                   KILLDLSPQAIQDLVIDDNHISFAATFDSEPMSINIPIEAVLEVFSKETEQGMYAREFG
FT                   YGININEGEDDETANPKKLGETNSDNVLSLD"
FT   gene            complement(560611..561228)
FT                   /gene="mglA"
FT                   /locus_tag="FTW_0565"
FT   CDS_pept        complement(560611..561228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglA"
FT                   /locus_tag="FTW_0565"
FT                   /product="macrophage growth locus, subunit A"
FT                   /note="inferred from sequence similarity with MglB protein
FT                   from F. novicida, function derived from mutation phenotype.
FT                   PMID: 9701818"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46474"
FT                   /protein_id="ABO46474.1"
FT                   /translation="MLLYTKKDDIYSDIVRMILLIKGANAKIVDVSKEENSKHLEELNI
FT                   ITPNGNIPTLSTDDFAVYRLSVIIEAIEDLYPFPPMFPVFPKQRANARILLEYVNKTFL
FT                   QNIIKLQSPDLDEKQANEIKMLMQRDIISTYKKIVSEREVNAESNPDAQNINVLTLIIT
FT                   FVFYYFIKLKISIPTKDKNIIKEIKELLSEPNFIKTIKAKGA"
FT   gene            complement(561288..561686)
FT                   /gene="rpsI"
FT                   /locus_tag="FTW_0566"
FT   CDS_pept        complement(561288..561686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="FTW_0566"
FT                   /product="ribosomal protein S9"
FT                   /note="GO_component: GO:0009283 - cytosolic small ribosomal
FT                   subunit (sensu Bacteria); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46475"
FT                   /protein_id="ABO46475.1"
FT                   /translation="MVKMSEYNYGTGRRKSSVARVFMKKGTGQFIVNGLPLEQYLCRET
FT                   DCMVVKQPLELTNNTDNFDFKVTVKGGGTTGQAGAIRLGVTRALIEYDEELKPALREAG
FT                   FVTRDPRKVERKKFGLRKARRRRQFSKR"
FT   gene            complement(561693..562121)
FT                   /gene="rplM"
FT                   /locus_tag="FTW_0567"
FT   CDS_pept        complement(561693..562121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="FTW_0567"
FT                   /product="ribosomal protein L13"
FT                   /note="GO_component: GO:0009282 - cytosolic large ribosomal
FT                   subunit (sensu Bacteria); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0042255
FT                   - ribosome assembly; GO_process: GO:0006412 - protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46476"
FT                   /db_xref="GOA:A4IX24"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IX24"
FT                   /protein_id="ABO46476.1"
FT                   /translation="MKTFTAKPSNIKREWLLIDATDKTLGRLATEVAMILRGKNKPEYT
FT                   PHMDTGDYVVIVNAEKVAVTGNKRKAKTYYHHTGYIGGIKSVSFEKLIATHPERAIEKA
FT                   VRGMLPRTPLGRTMFKKLKVYAGEAHPHTAQQPKAHNI"
FT   gene            complement(562260..563444)
FT                   /locus_tag="FTW_0568"
FT   CDS_pept        complement(562260..563444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46477"
FT                   /protein_id="ABO46477.1"
FT                   /translation="MTDTKHFDTIIIGAGISGISLAQRLTAASVKNCVFEANKVGGCID
FT                   SQQYENFWFEMGAHTIYNSYNKTIEYIHSNSLGKDIQPRKKLPFLFVQPNNKIQSIFIN
FT                   INPFTAALSFLKNRKVSKQDKTVSEYATKLFGKKNYSKTLKYCFDAVLSQDSQEFPMEY
FT                   LFKKYDRDTTLPRSFTLKNGLAELFKNHNENVIKETVIKITKQQKWHIHTKHGEYTCEN
FT                   LCLATPWNVTELLLEKILPNIAKHQYRPTMSNLISVGIVTNKSSLKHIKNLAGLIGKEQ
FT                   FFYSTVSRDVIDNPNYRAIVFHCRDEFSQEELLDKIIELLKIKPDHIIYTYTKNNTLPC
FT                   YHRKHSAFIADLEKELQNQPNLYISGNFFDRLAIENCIRRSNEQAGKIIQNKIP"
FT   gene            complement(563437..564588)
FT                   /locus_tag="FTW_0569"
FT   CDS_pept        complement(563437..564588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0569"
FT                   /product="membrane-bound lytic murein transglycosylase A
FT                   (MLT) family protein"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46478"
FT                   /protein_id="ABO46478.1"
FT                   /translation="MDIKKVKETLKKIVIIVSLILITGCANITAQQYLSKKYSKNIDYK
FT                   KSSFEDLANWDSADQLESFNTFKKSCEKILEENKLEYSNWINICHKVINTDLKTKQQAK
FT                   LFFEQNFTPYQIIYKGKDTGLFTGYYEPSMKGSLVKTMEYTVPIYRTPDNLVKKPKDDD
FT                   SFSFGMYQDGKFVPYYSREEISKGDLLPKKDVLVWVKSKVDRTFLQIQGSGRIETDSGD
FT                   ILIGYDSQNGHEYKPIGKYLLDHGYMSATQMSMQAIKAWLDENKDKIDDVLNYDPSFVF
FT                   FRYIDRKNAVGAQDVELTPGYSLAVDNKYYLYGVPLWLETDYFADNHDDTKPLDRLMIA
FT                   QDTGGAIKGAIRSDVFWGHGKQAEFNAGHMNNRGKLWILLPND"
FT   gene            564692..565279
FT                   /gene="grpE"
FT                   /locus_tag="FTW_0570"
FT   CDS_pept        564692..565279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="FTW_0570"
FT                   /product="co-chaperone GrpE"
FT                   /note="GO_function: GO:0005515 - protein binding;
FT                   GO_function: GO:0030192 - Hsp70/Hsc70 protein regulator
FT                   activity; GO_function: GO:0000774 - adenyl-nucleotide
FT                   exchange factor activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46479"
FT                   /db_xref="GOA:A4IX27"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IX27"
FT                   /protein_id="ABO46479.1"
FT                   /translation="MSKQEKSNVEDKSLDIETAAQVETAQESASGALEELSVEEQLERA
FT                   KDTIKELEDSCDQFKDEALRAKAEMENIRKRAERDVSNARKFGIEKFSKELLPVIDSIE
FT                   QALKHEVKLEEAIAMKEGIELTAKMLVDILKKNGVEELDPKGEKFDPNLHEAMAMIPNP
FT                   EFEDNTIFDVFQKGYMLNGRIVRAAKVVIVKN"
FT   gene            565380..567308
FT                   /gene="dnaK"
FT                   /locus_tag="FTW_0571"
FT   CDS_pept        565380..567308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="FTW_0571"
FT                   /product="chaperone protein DnaK"
FT                   /note="GO_function: GO:0005515 - protein binding;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0016887 - ATPase activity; GO_function: GO:0051082 -
FT                   unfolded protein binding; GO_process: GO:0006457 - protein
FT                   folding; GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46480"
FT                   /db_xref="GOA:A4IX28"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IX28"
FT                   /protein_id="ABO46480.1"
FT                   /translation="MGKIIGIDLGTTNSCLAIMDGKTAKVIENAEGHRTTPSVVAYTDS
FT                   GEILVGQAAKRQAVTNPDNTFFAIKRLIGRKYDDKAVQEDIKKKVPYAVIKADNGDAWV
FT                   ATKEGKKMAPPQVSAEVLRKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGKIA
FT                   GLEVKRIINEPTAAALAYGVDSKKGEQTVAVYDLGGGTFDISIIEIADVDGDNQIEVLS
FT                   TNGDTFLGGEDFDLALMNYLIDEFKKEQGIDLHNDKLALQRVREAAEKAKVELSSAQQT
FT                   DVNLPYITADATGPKHLNIKVTRAKFESLVSDLVMRSLEPCKKALEDAGLSKSDITEVL
FT                   LVGGQTRMPLVQEKVKEFFGKEPRKDVNPDEAVAVGAAIQGGVLSGDVKDILLLDVTPL
FT                   SLGIETMGGVMTKLIERNTTIPTKKSQVFSTAEDNQPAVTIHVLQGEREMASANKSLGR
FT                   FDLADIPPAPRGMPQIEVTFDIDANGILNVSAKDKATGKEQNIVIKSSSGLSEEDIEKM
FT                   VQDAEANAEADKKFHDLVTARNTADNLIHSSRKAIQELGDKVTAAEKEKIEEACKELEA
FT                   ATKGDDKQAIEAKTKALEEAFAPIAQKAYAEQAQAAVAQGGAKAEEPKKEEDVVDADFE
FT                   DVEDDKK"
FT   gene            567397..568512
FT                   /gene="dnaJ"
FT                   /locus_tag="FTW_0572"
FT   CDS_pept        567397..568512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="FTW_0572"
FT                   /product="chaperone protein DnaJ"
FT                   /note="GO_function: GO:0005515 - protein binding;
FT                   GO_process: GO:0006457 - protein folding; GO_process:
FT                   GO:0009408 - response to heat"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46481"
FT                   /db_xref="GOA:A4IX29"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IX29"
FT                   /protein_id="ABO46481.1"
FT                   /translation="MQQKCYYEILNVSKTASGVEIKRAYRKLAMEYHPDRNPGDKEAEI
FT                   KFKEISEAYEILSDDSKRSRYDQFGHAGVNQQSGFGGTGGFEDIFDTFFGGGTSRGSNR
FT                   SRASRGSDLEYTLEITLEEAFFGVEKEITIPRMESCDSCDGTGSKSRSKTTCHACHGQG
FT                   TIRRQQGFFAFEQTCPVCNGTGYSITDPCDACYGNGKVKKQKTLKVKIPEGVDNGDRIR
FT                   LQGEGDSGSNGAMNGDLYVQIIIKEHKIFERRDINLYCEMPISFTKACIGGDIKVPTLD
FT                   GEVVLKVVPETQTGKVFRLREKGMKSLRGHRRGDLLCKVVVETPVNLSAEQKELLEKFA
FT                   DSLGEDYQSKHAPKSKTWFDNVKDYAKKFFE"
FT   gene            complement(568526..569422)
FT                   /locus_tag="FTW_0573"
FT   CDS_pept        complement(568526..569422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0573"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46482"
FT                   /protein_id="ABO46482.1"
FT                   /translation="MGHLERLKIFIKAAHLKSFSKAAKAIGISPPVVSKQIQILETKYR
FT                   KSLFNRNTRTVHLTEYGKLLYEKASLILNELEATKEKIFAEDILIDSELKISAPNSFGI
FT                   KYLCNIFSKFAIDYPKYKLNINLSDSYINIIDEDFDLVIRIGALDDSNLITKKLMPMPS
FT                   LLCASEQYLKNYGIPKTIKDLENHLFIQYNNHSSSNRIILESVNKTEIINVRQRIVTNS
FT                   AGMMLQSCLDGLGIAKLPLFEIIDKLHDKKLVHLLPNTRNPIEKNLYLISSRDKYRLKK
FT                   VRLLSAYIEKNLPQIEL"
FT   gene            569522..570235
FT                   /locus_tag="FTW_0574"
FT   CDS_pept        569522..570235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46483"
FT                   /protein_id="ABO46483.1"
FT                   /translation="MIKTIRYTDLGISSFYWLDTKHHFSFDGYYDPERMGFGHLRVINY
FT                   DIVMPHYGFDTHPHRNMEIITYVTKGTITHRDSYGNYGKITPGNIQVMSAGKGIFHSEY
FT                   NLENEVLLFYQIWIEPRQKNTQPRYQNLEIDYKLNNLIHISSGSGDVDDRKVLYIDQDA
FT                   DVYTGKFSKNSSCKYNILRQLYMIVVSGEIKIGLNTAKTGDAMEVIDESEIIIEFIEDS
FT                   EVIVNPKDICRKRYL"
FT   gene            570259..571139
FT                   /locus_tag="FTW_0575"
FT   CDS_pept        join(570259..570588,570588..571139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0575"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46484"
FT                   /protein_id="ABO46484.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            complement(571319..571564)
FT                   /locus_tag="FTW_0577"
FT   CDS_pept        complement(571319..571564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46485"
FT                   /protein_id="ABO46485.1"
FT                   /translation="MDINTISATLINNSLPIIAAFNLLIHIFCGLGIAKDIPKVLDRRL
FT                   TTILLPKNIWILVGLVFGIWGLLIYWLFHHSTFSRG"
FT   gene            complement(571578..572291)
FT                   /locus_tag="FTW_0578"
FT   CDS_pept        complement(571578..572291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46486"
FT                   /protein_id="ABO46486.1"
FT                   /translation="MLWKERKIVSAPSSDMGFDKAKASWDIMKISLELVEGYERLGKIA
FT                   PAISIFGSARISKDDRYYKDTVELAKSLSDHGFAVITGGGPGIMEAGNKGAQQGSCSSI
FT                   GLNITLPHEQRPNQYQDIFLIYRYFFTRKAMFIKHSMSYIVMPGGFGTLDELFDITTLI
FT                   QTGKKVKMPIILYGKDFWGGLMEWIKTTLVGKGVISEEEVNLLTLVDSIDETIEIIAEH
FT                   YMSTYSSKAHAKIVF"
FT   gene            572577..573359
FT                   /gene="fabI"
FT                   /locus_tag="FTW_0579"
FT   CDS_pept        572577..573359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="FTW_0579"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.3.1.9"
FT                   /note="more than 60% identity to characterized protein from
FT                   P. aeruginosa PMID: 10464225"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46487"
FT                   /protein_id="ABO46487.1"
FT                   /translation="MGFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKD
FT                   RVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFI
FT                   DCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAK
FT                   ASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDI
FT                   MEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNVL"
FT   gene            573506..574468
FT                   /locus_tag="FTW_0580"
FT   CDS_pept        573506..574468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0580"
FT                   /product="Metal-dependent hydrolase, beta-lactamase
FT                   superfamily III"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46488"
FT                   /protein_id="ABO46488.1"
FT                   /translation="MKKRAFNFVFASMCAFGVSQGVVQTNPQCLDKSFTLQLLGSGGPI
FT                   TDDARASAGELIWINGKSKILIDAGGGTYLRFGQSGARLEDLDSINMTHFHADHSADIP
FT                   AILKGAYFSKRTENLPFSGPTHSGLFPSATDFLQRVFGKDHGAFAYLHGILTGTDGFPF
FT                   KLDPVINIDYTKLEPTKVFSNDEFTVWALGIPKGDVPTLAYKIVSKKGTIVVTGAGGSN
FT                   EHDKFRDAFIKFAKNADILMMPMPIDESADAAGSFLHAKPSVIGQVAAAVNPKALVLSH
FT                   FLGKGLVLKDESTKIVKKYYKGPVYEGRDLACFPVNGVR"
FT   gene            574480..574809
FT                   /locus_tag="FTW_0581"
FT   CDS_pept        574480..574809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46489"
FT                   /protein_id="ABO46489.1"
FT                   /translation="MKKIPLTIALTASMSFGIALAAESKAPVTQVQDSSESSPIAQGEG
FT                   KCASGKCGSLKKFGVVDVDADEQDGKLVRARDGNCGTKVCKAYGKQDKKEIAQLGKCSN
FT                   GVCGQ"
FT   gene            574806..575618
FT                   /locus_tag="FTW_0582"
FT   CDS_pept        574806..575618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46490"
FT                   /protein_id="ABO46490.1"
FT                   /translation="MIGKCQGIGLRSGHQSILSTQKVDGIDFLELSPENWMGLGGFKQV
FT                   YLDKVASIYPLIAHGLSLSIGGFQPLNKKFLNEIRAFLDDYNIEIYSDHLCFSDDDKGY
FT                   LYDLLPVPREKENISYICNRIEQVQEIIKRPLSLENISYYYQYDNDMNELDFINAILQR
FT                   SGAKMLLDINNVYVNGHNHNYNAYEFIKGINKGSVSYYHIAGHYKKDDFILDTHGKDVI
FT                   QEVKELAKFAVEQHGWHPMLLERDHFVPKLDDLVNELNSITNVIEGKI"
FT   gene            575615..576313
FT                   /locus_tag="FTW_0583"
FT   CDS_pept        575615..576313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46491"
FT                   /protein_id="ABO46491.1"
FT                   /translation="MNISESIKTKMQNFTHAIRYDDSSDDRVQMYREFIVGNVLSVLEN
FT                   TFPYFNKYASQELKDKILKVFFEDNISSEPAFHQIATEILKSSKSVEMNEKLSKLIEFE
FT                   WLLFSIEIDESKVFENIKITKNLSFKDIRNIKENPTLTFILLPFDINDLDEEISTDQNI
FT                   MYALYRNIKHRISYQRISALEYAVLSSVLEKGIDIFESEDFKQIKNEQQEYLINRLVSW
FT                   HNQNMITLSI"
FT   gene            576324..576914
FT                   /locus_tag="FTW_0584"
FT   CDS_pept        576324..576914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0584"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46492"
FT                   /protein_id="ABO46492.1"
FT                   /translation="MINRIYDIYYKIIQKFQSIDFLLLLGIRLYLVPTMFVGARSKIEG
FT                   FSTTVAWFGAPASQGGLGMPMPEVMAFLATSAEVIGCIGIALGLFTRLVSIPMMFVMGV
FT                   AGAAVHWAHRWPAIADKTAESTQRLNDLFVWLSQNFPDRYNYVTALGDPVMLNGGMEFS
FT                   VTYFIMLFTLFLYGGGRYVSVDHWLKKIFIKQL"
FT   gene            complement(576918..577889)
FT                   /locus_tag="FTW_0585"
FT   CDS_pept        complement(576918..577889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0585"
FT                   /product="sugar isomerase, KpsF/GutQ family"
FT                   /EC_number="5.3.1.-"
FT                   /note="GO_function: GO:0016853 - isomerase activity;
FT                   GO_process: GO:0005975 - carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46493"
FT                   /protein_id="ABO46493.1"
FT                   /translation="MTSHINNAIETFRLEIETLEKLKNSIDENFEKACEIILENNRDKS
FT                   RVIITGMGKSGHIGKKMAATFASTGTPAFFVHPGEAGHGDFGMITKNDVLIAISNSGTS
FT                   SEIMGLLPMIKHLDIPIIAITSNPKSILARNSNVTLNLHVDKEACPLNLAPTSSTTATL
FT                   VLGDALAIALLKAKNFSEKDFAFSHPNGALGRKLILKVENIMRKGNEIPIVKPTDNIRK
FT                   AILEISDKGVGNTLVAENNTLLGIFTDGDLRRMFEAESFNSQRAISEVMTKNPKSISKE
FT                   EMAITALEKMEKYEITSLAVVDNGHNILGIVTMHDLIKLELR"
FT   gene            578026..578694
FT                   /gene="rpe"
FT                   /locus_tag="FTW_0586"
FT   CDS_pept        578026..578694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="FTW_0586"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="GO_function: GO:0004750 - ribulose-phosphate
FT                   3-epimerase activity; GO_process: GO:0006098 -
FT                   pentose-phosphate shunt"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46494"
FT                   /protein_id="ABO46494.1"
FT                   /translation="MKHIQINPSILSADLARLGDDVKAVLAAGADNIHFDVMDNHYVPN
FT                   LTFGPMVLKALRDYGITAGMDVHLMVKPVDALIESFAKAGATSIVFHPEASEHIDRSLQ
FT                   LIKSFGIQAGLALNPATGIDCLKYVESNIDRVLIMSVNPGFGGQKFIPAMLDKAKEISK
FT                   WISSTDRDILLEIDGGVNPYNIAEIAVCGVNAFVAGSAIFNSDSYKQTIDKMRDELNKV
FT                   "
FT   gene            578699..580069
FT                   /locus_tag="FTW_0587"
FT   CDS_pept        578699..580069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0587"
FT                   /product="bacterial sugar transferase family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="GO_function: GO:0016757 - transferase activity,
FT                   transferring glycosyl groups; GO_process: GO:0005975 -
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46495"
FT                   /protein_id="ABO46495.1"
FT                   /translation="MIILKTIELVISVILVLLSYSIPLHLLNYDTSNFSSFDFMATFIV
FT                   LTSLTTFLIAEYTNGEKVSKSKNVLKVLLCGLAIAIIITSLAFFLRGFSFPRSLIILGF
FT                   LLQLVMLSVSRNIFRWLIRNTSYSRILIVGLDQEREWLFAKAEAAKLPREIIAGYLSIN
FT                   IDGFSLADVAYSYKKAFISDKALKLLADNDLSTLSKYNLEVVLIPRKYEISIWGAALVP
FT                   LGDSLAMSVKNFGISYEAKIIKRIFDVLFSLIIIVLTAPIMLIVALAIYLEDRESPFFI
FT                   QERVTRNAKRFNLIKFRSMKVNAEVQTGAVWAVDGDTRITKVGKIIRPIWLDELPQFFN
FT                   VLKGDMSIVGPRPERPELIDKFSQQIPEFSYRTKVKAGITGYAQVLTSYATLPENKLKL
FT                   DLVYIRRWSFVFDLLIIIETVRVIAMKILRLFIKTKEQSQASFVEKKHKNYTEYIYE"
FT   gene            580062..581081
FT                   /gene="galE"
FT                   /locus_tag="FTW_0588"
FT   CDS_pept        580062..581081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="FTW_0588"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0003978 - UDP-glucose 4-epimerase activity;
FT                   GO_process: GO:0009225 - nucleotide-sugar metabolism;
FT                   GO_process: GO:0006012 - galactose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46496"
FT                   /protein_id="ABO46496.1"
FT                   /translation="MNKKILVTGGVGYIGSHTVVELLDRDYQVVVVDNLSNSKVSVIDR
FT                   VKKITNKDFDFYQLDLLGKAKLTKVFQEHDIYAVIHFAGFKAVGESVEKPLEYYHNNIQ
FT                   GTLNLLELMQEYKVYNFVFSSSATVYGMNNKPPFTEDMPLSTTNPYGATKLMLEDILRD
FT                   LQNANNNFNITCLRYFNPVGAHSSGMIGEDPQGIPNNLMPYVAQVGAGKLAKLSIFGGD
FT                   YETIDGTGVRDYIHVVDLAIGHILALEKLSQDKPSWRAYNLGSGNGYSVLEIVKAYQKA
FT                   LGKEIPYQIVARRAGDIAASFADVAKAKRELGFETQKTIDDICDDMLKWQKYAKENNI"
FT   gene            581085..582314
FT                   /locus_tag="FTW_0589"
FT   CDS_pept        581085..582314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0589"
FT                   /product="glycosyl transferase group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="GO_function: GO:0016757 - transferase activity,
FT                   transferring glycosyl groups; GO_process: GO:0000271 -
FT                   polysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46497"
FT                   /protein_id="ABO46497.1"
FT                   /translation="MKILHVFKSFYPYTYGGIEKFIHELSIATAKKYNVEIHILAMGKE
FT                   NQTIDKDFYTLHFAKTNLNIASTTFSFSAIKKFKELAKQVDIIHYHFPYPYADLLQTIC
FT                   RLKKPYIVTYHSDIIKQKRLMMLYKPLMKRFLNGAKYILPTSPNYLETSETLREIKVPK
FT                   KVIPMSLNKSDYNIDEENYKYWQQKLNFRDTRLREYDNSIVITNSDPESPLYNQNYSHW
FT                   KNNIGFEKFFIYIGALRYYKGLDVLIDAMQGQDYPLVIVSDGNQKELLEQKVKQNNLQN
FT                   VKFVGALDDKDKISLLKLSYALVLPSNIRTEAFGLVLLEASMFAKPMITCEIGTGTTFV
FT                   NINKQTGLVAKPNDSQDLAKKLKELWQDEQKAQEYGANAKARFDDIFSLDKMVVSYKSV
FT                   YDEVIDSGVK"
FT   gene            582311..583993
FT                   /locus_tag="FTW_0590"
FT   CDS_pept        582311..583993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0590"
FT                   /product="ABC transporter, ATP-binding and membrane
FT                   protein"
FT                   /note="GO_component: GO:0043192 - ATP-binding cassette
FT                   (ABC) transporter complex (sensu Bacteria and Archaea);
FT                   GO_component: GO:0005887 - integral to plasma membrane;
FT                   GO_function: GO:0015646 - permease activity; GO_function:
FT                   GO:0005524 - ATP binding; GO_function: GO:0042626 - ATPase
FT                   activity, coupled to transmembrane movement of substances;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46498"
FT                   /protein_id="ABO46498.1"
FT                   /translation="MKQFFKYFIGILDTTQKKRFFLYLVLLFLGSTSSMLGVGAVIPFV
FT                   NALINPKYFDNIVILRSFSNFQIILISIVLLILAFWIKNIIGVILFWFQTKFLNSIVLD
FT                   IQKKLFRLYILMDYESHLTRSTPTLIRNINSETNQLSSGIINPLGILMTDLFSCVFIVA
FT                   LLLYINFLFSFFTLLILGVSLFIFMLKIKGILDKYGKQRAEAWKSMTQTTMNGLSGIKE
FT                   IKLYNKEKVFMSEFDEKAAMLNRSMQFNQIFQILPRFFIEAIAITFVLVTLLVLIVFSE
FT                   SINSIFILLSVFGVAATQLLPALNRIMQAITNIKYSIPALKVIYEELSKYQNYSDSIEN
FT                   SHQLDISFEKNIRLENISYSYPDGTQALKNISLTIEKGKKTAFIGPSGSGKSTLVDLLM
FT                   GFYTAQSGSIYIDDKQINNTWIVQRLFAYIPQQIILYDTSIKQNIAFGEPKTLIDEAKV
FT                   WKCLKMAQLDDFVSKLNKGLDTFVGENGVRLSGGQRQRLGIARALYQNPQILVMDEATS
FT                   ALDNEIEKEVTNVIKELKDITIITIAHRLSTIEGYDMVYSLNN"
FT   gene            584007..585293
FT                   /locus_tag="FTW_0591"
FT   CDS_pept        584007..585293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0591"
FT                   /product="hydrolase/phosphatase, HAD family"
FT                   /EC_number="3.1.3.-"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46499"
FT                   /protein_id="ABO46499.1"
FT                   /translation="MVKSIKDDCYDFDNNIVFVFDLDGTLTKNETLPVIARYFGIEDEI
FT                   SKLTAETVKGNIPFIESFIKRVNILKDFSISEINNLLRGVDLFSKIVDFIKLYKSNCYI
FT                   ATGNFDGWVSGLIEKIGCKYFASEGFVKDDQLLSLKLILNKKKVVEMLQASGKKVVFIG
FT                   DGNNDAEAMRVADISIACGLVHYPSKSIMNFADYAIFEEEALCRLLKQIHILKSLGKSI
FT                   ILSCAGIGSRLGLGKTKALIEINSKSLIDYQLSNFKNIEDIRIVIGYQANEVISAALSI
FT                   RKDIIFVFNHDYFHTKTGASFYLGARHANEYLIAWDGDLLVHPEDIGKCLNYDGEYIGC
FT                   SDIVSDEPVYVIVNENNECIAFSRDNGDFEWVGPACFKKEKLRFVTNNVYNLFESELPI
FT                   PILRVRARDIDTYDDYIRAKNFVGEWSNE"
FT   gene            585286..585915
FT                   /locus_tag="FTW_0592"
FT   CDS_pept        585286..585915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46500"
FT                   /protein_id="ABO46500.1"
FT                   /translation="MNKKIEAYYDILSRKIKSPYETRNKSKDFSQYDIFLVKKLADRSK
FT                   NLLDLGSGTGLLINSIHNCFKKIVAVEKYKEFSDFIIRKPNIDIINEDITNFKTHEKFD
FT                   IITTFGVMNFFNAQEAKYVYKKVLSMMHTNGVLIIKNQFGLNDNVVIDGYSEELKSNYY
FT                   SEYRYIDGEINLLQKIGFNSIEKIDIYPKEYNRWSNTHFYALVCKR"
FT   gene            585919..586680
FT                   /locus_tag="FTW_0593"
FT   CDS_pept        585919..586680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46501"
FT                   /protein_id="ABO46501.1"
FT                   /translation="MSLIRKIKLSLRNIIHTILENKRNKFLKRNGLEVLKYTTNLLRDE
FT                   NIKHWIDGGTLLGIIRDKDFIVRDTDIDIGILIDRPDFLYEVLEKNNYHIVYYYVDQNN
FT                   KKFLIRAEIYNVGIDFEIFFETKEFYYYDSPRQLTKLASRKKDNQYSRLRFKFDKSCIN
FT                   NLSYYQFNDINLPIPSDLEKYFSVYYKSWNIPVNKKKYLKGYFHVDISNYKHHNNTVIY
FT                   IKDDFCYFIKVAPSLINLKILELLRYFINRK"
FT   gene            586689..587648
FT                   /locus_tag="FTW_0594"
FT   CDS_pept        586689..587648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0594"
FT                   /product="glycosyl transferase group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="GO_function: GO:0016757 - transferase activity,
FT                   transferring glycosyl groups; GO_process: GO:0005975 -
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46502"
FT                   /protein_id="ABO46502.1"
FT                   /translation="MKYCELITLVIPIYNIENYLGRCLDSVINQTYKDLEIILVNDAST
FT                   DNSLEICESYAKEDSRIKIINKNNGGLSSARNVGLDACKGDYVTFIDSDDWVSLDYIEI
FT                   LYKNIIDNNADISIINAIKVKSQNNDFTLKEQKNLLHTYFSSIEFALDNTLPVMACAKL
FT                   YKTKLFENLRFTNSIVFEDEDIMYRLLYHANKIVCTDYIGYFYFQRPTSITSSKKKRQN
FT                   IIKSSDSLIFVLTKKEQFFKGKTTIPYRFYIDSAGLLSRYYAKSFLYPFDKEMIKQRKK
FT                   IKLFINKLLQNTKSIETFRYKIKRNFIKYFVFFFLFKD"
FT   gene            587665..588672
FT                   /locus_tag="FTW_0595"
FT   CDS_pept        587665..588672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0595"
FT                   /product="glycosyl transferase group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46503"
FT                   /protein_id="ABO46503.1"
FT                   /translation="MYNLNYKQLISIIIPIYNTQQYLSRCLESVINQTYKNLEIILIND
FT                   GSTDNSLSICQKYKSKDSRIVLLNQQNSGQALARNNALDIAKGDYIAFIDSDDWVSLDY
FT                   IQALYNHVFSYSADIAISATVGCNKQIKAAEIIPSNINIFDNNDAIIKAFLSKQLSSMA
FT                   CGSLIKRKLLDKQRFRNFIAYEDLDFFYKIYSQAQIIVKDNNVRYFYYQRDDGIMGANR
FT                   LNFSLQHLQALKSVTTYYERFFIEKYPQHGSLIYMNILRHLVDNFSEAAVRKNVLAKDV
FT                   LLLYKTLYLNCISRGFKLSLPYKLFFYFPNLVAKCYLKAKKIKLSLKEKRITKS"
FT   gene            588675..589688
FT                   /locus_tag="FTW_0596"
FT   CDS_pept        588675..589688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0596"
FT                   /product="glycosyl transferases group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="GO_function: GO:0016757 - transferase activity,
FT                   transferring glycosyl groups; GO_process: GO:0000271 -
FT                   polysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46504"
FT                   /protein_id="ABO46504.1"
FT                   /translation="MSKLLIDTRWQGKHGIGRYACEIIKYLPQNFITTSKHIKPFSLKD
FT                   LFYLSFLIRKKDVLGYYTFAANVPLPIFLRANKPIIITIHDLIPIISKYESNFIKKLYF
FT                   EKILKPLIKRENVKIMTVSNFSKNQILEWSGIDSSKVIVAYNGISTAFDYKPTTVKQKF
FT                   FLYIGNRRPHKNIEIIFKAFKNFKYYDEYNLVFSGEMDHQLLNYAQKYNVCLSKIQTIG
FT                   LDANDELLAKYYQSATATILPSFEEGFGLPLVESMACGTPVLASKIEVLQEIAAQAGLY
FT                   FDPYSADELYSNIQKLIDDKELYNQKVELSLVRAKQFNWDQTANIVQDELKKLNLL"
FT   gene            589707..590369
FT                   /locus_tag="FTW_0597"
FT   CDS_pept        589707..590369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0597"
FT                   /product="haloacid dehalogenase (HAD) family hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46505"
FT                   /protein_id="ABO46505.1"
FT                   /translation="MKTYIFDLDNTLYSYKNGLFDSQMARMSEYIKLKLNISDIEKANA
FT                   IRDELYYEFGSTMLGMMRYHNIEPKEFLDYIDNIEISHFEPNQKLNKYINDLRKNNRTY
FT                   IFTNASDFHASRVLKQLGLDNSFDGVLTIEDTGLVSKPKTKYFEIGRDKFDIDFTSAIF
FT                   FEDSSHNLVPAKHLGMQTVLVHADDHKSEANFYDNQEIDYYVADVESFFEGKYLARR"
FT   gene            complement(590651..591757)
FT                   /locus_tag="FTW_0598"
FT   CDS_pept        complement(590651..591757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0598"
FT                   /product="PfkB family kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="GO_function: GO:0016301 - kinase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46506"
FT                   /protein_id="ABO46506.1"
FT                   /translation="MKNFKALTIGGATLDTIIEYEEMFTMNMQKKDTIQSFMLLEEGAK
FT                   IEVTDQKSFSGGGATNAAVSFKKQGIDVSFFGKIGKDIAGEQITQELENHGIDTSNIRY
FT                   SNKYGTATSYVVPTLSGDRTIFAYRGANKDILKDDLPSQAIIASDFIYITSLSKSSAAR
FT                   LPEIVKLAADNNTKVAINPGSSQLSVGESFIKDSMFGIDILVLNFQEAQKLMLSLLSSD
FT                   DKDIVESKDRLETPLCEEKSDFLNSTFRLKDFFRICLDLGVRIIVVTDGANGVYAATKE
FT                   RIYHSESLRIKNVINTLGAGDAFSSTFCANIYKGCSIEDSIKFALINASHVIQHSDAKS
FT                   GLQTSKSLERIKSKMNCGLDKKITVTSW"
FT   gene            591960..592778
FT                   /locus_tag="FTW_0599"
FT   CDS_pept        591960..592778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0599"
FT                   /product="S51 peptidase family protein"
FT                   /EC_number="3.4.-.-"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0044265 - cellular macromolecule catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46507"
FT                   /protein_id="ABO46507.1"
FT                   /translation="MPSKPVKKDHRGYIMPIGGGEDKFASPTVLEKFVQLSGGTEAKIA
FT                   VIPTASKLPDTGDIYVDIFTKMGVKEVHNLKIETRLDATTNKEYQDIPSQCTGIFMTGG
FT                   NQLLLSTTLGGTPVAQLIRRLNAKGVNVAGTSAGAAFISGFMIAGGQAGLMPRCNMVNL
FT                   APGLGLTNKLLVDQHFSQRDRLGRLLAALSYNPYMVGVGIDEDTSALLNFENVIEVVGS
FT                   GMVTIIDFSHLKHSSLHNARNNAPISLVDIRMHMLLEGQKFDLNTCLVEF"
FT   gene            592994..593857
FT                   /locus_tag="FTW_0600"
FT   CDS_pept        592994..593857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0600"
FT                   /product="putative asparaginase"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46508"
FT                   /protein_id="ABO46508.1"
FT                   /translation="MQKIIIHGGCGAREDKNTSFGDYHQHLLPIVEKAYNYLKEVDDAN
FT                   EAAIFAAKLLEDDEIFNAGTGSRVQQDGQIRMSASIIDSQKQKFAGVINIQNIKNPIEV
FT                   ANRLMQQHHSILAGDQATTFAHDVMGLPIYNPMTEKRYQEYLQLKKGYTGTIGVVALDS
FT                   KGKICAVTSTGGAGFEYPGRVGDSPTVAGNFANECMGISCTGIGEHIINQAVAAKIATR
FT                   VKDGMSLLAAVDKSIAESDSLGDYVGLIAIDKHGNICSGSTSIAQTLYAYADGEQIKTF
FT                   YQEKML"
FT   gene            593915..593990
FT                   /locus_tag="FTW_2052"
FT   tRNA            593915..593990
FT                   /locus_tag="FTW_2052"
FT                   /product="tRNA-Phe"
FT   gene            594008..594084
FT                   /locus_tag="FTW_2062"
FT   tRNA            594008..594084
FT                   /locus_tag="FTW_2062"
FT                   /product="tRNA-Pro"
FT   gene            594093..594169
FT                   /locus_tag="FTW_2041"
FT   tRNA            594093..594169
FT                   /locus_tag="FTW_2041"
FT                   /product="tRNA-Arg"
FT   gene            594197..594272
FT                   /locus_tag="FTW_2035"
FT   tRNA            594197..594272
FT                   /locus_tag="FTW_2035"
FT                   /product="tRNA-His"
FT   gene            594279..594361
FT                   /locus_tag="FTW_2031"
FT   tRNA            594279..594361
FT                   /locus_tag="FTW_2031"
FT                   /product="tRNA-Leu"
FT   gene            594529..595785
FT                   /locus_tag="FTW_0601"
FT   CDS_pept        594529..595785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0601"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46509"
FT                   /protein_id="ABO46509.1"
FT                   /translation="MKRFSKRHVFFASASTIVEWYDFMLFAYLTPVIASIFFPDFSKYT
FT                   AILMTFGVFAAGFLMGPIGSVVMGSFGDRFGRKKALVISIIMMILPMLVIAILPTYSSI
FT                   GVLAPIILVVMRLLQGFSIGGSYGGVMVFMIESTKPNRRGFIASFATMSSGTGVFLASL
FT                   VAMLLFGLFSREILDLWGWRIGYIMGLILALMALGMRLIIPESYSFEELEAQGDISVKP
FT                   VREMFKKQTKPLLLAIALSAYANIMYYLVLSYLSNHFIELHYSEFFSLAVVTVFSLIFS
FT                   FSAPLWGLLSDYLGRKPLIKFSIWIYLIFAYPSFMLMNMGVVYLVLAMIILSVPLMAIW
FT                   GAYGAAAPELFDTKYRYSGNGLSYNIGNSFFGGTIPFIATSLVVTSGSMLAPAWLLIVA
FT                   SIIMIPVLYYMPETRFVDI"
FT   gene            595870..597078
FT                   /gene="capB"
FT                   /locus_tag="FTW_0602"
FT   CDS_pept        595870..597078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capB"
FT                   /locus_tag="FTW_0602"
FT                   /product="capsule biosynthesis protein capB"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46510"
FT                   /protein_id="ABO46510.1"
FT                   /translation="MDFWLIVVVFVILCVYLIIENIVHNNSIKSIPIRIHVNGTRGKSS
FT                   VARLIAAGVRAGGYRTVAKTTGTLARYIDVDGSETPVFRIGFSNIAEQVKIMFKARRAK
FT                   ADAIVIECMALQPLLQSLCELKLIKATHGVLTNARPDHLDVMGPTERDVAKALAATVPV
FT                   GAKYFTAEDIHLDFFEYACKDRGSELIAATAQDAEKISDEEINKFVYSEFKINVALALK
FT                   VTDDLGIPREIAIKGMWEATPDPGAMTEYNFNIKNAEINFANAFAANDPVSTKMLWDKL
FT                   CAKYSGCDKKVLVVNCRDDREDRSKQMAEAALGWQKQDLIVLIGTGTEVFTSFYKKYAK
FT                   SLNKPMTKVIVCEEMTPIQILEKTVDSNPANSYILVGVGNIKDIGMELVDYCDTSHKKK
FT                   HNL"
FT   gene            597103..597567
FT                   /locus_tag="FTW_0603"
FT   CDS_pept        597103..597567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0603"
FT                   /product="putative capsule biosynthesis protein CapC"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46511"
FT                   /protein_id="ABO46511.1"
FT                   /translation="MDPLTLSIGIGLVVGLVFVSLLGLSTGGMVVPGYFALEMGAPDRV
FT                   IVTIIISIIIFGIVRFMSKFMIIYGRRRIAITVLLSFILGTVCNMLFSQYLTTSFYSNQ
FT                   VQVIGYIIPGLITLSIDRQGLIETIGSLLIASIIIRLLLIVLIGPEIVGI"
FT   gene            597569..598780
FT                   /locus_tag="FTW_0604"
FT   CDS_pept        597569..598780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0604"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46512"
FT                   /protein_id="ABO46512.1"
FT                   /translation="MKTMYWHRKFLSRYIIVFLSAFMIISLYIVEKNLVVETKGYTQKL
FT                   KAAELTNDAFAFTQRFFMSNGYLCKTMGDVSCTGLIGLSMTEITTDSGDLYAKRSSVNP
FT                   NMAAIFVEWLSELNLKEGDTVAVQATGSYPALDIAMLAAIKTLKLKPLIIFSAGASQFG
FT                   ANRPRFTWPDIYHNLVEKGVFDYDILGITLGGSHDNGYGMTPGAILKLNDAIKRNGYNV
FT                   INIPYTDATNTSITTRMKMYKEAAGDDNKIKAYINVGGNMASIGLKQPQIKSSDIDNVN
FT                   DNKKSKKSSTSSADESVIKLPSFPTGVTKSLPPEYKTVNSVAVDFLKEGIPVINVRDIN
FT                   SSIIKKYGMVYNPSTVTPPGHGAVFAQKKYNTILAAILLVIDISLVVFMAIISRKYLIS
FT                   FKTK"
FT   gene            598849..600963
FT                   /locus_tag="FTW_0605"
FT   CDS_pept        598849..600963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0605"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase ((ppGpp)ase)"
FT                   /EC_number="3.1.7.2"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_function: GO:0003824 - catalytic activity; GO_process:
FT                   GO:0008152 - metabolism; GO_process: GO:0015969 - guanosine
FT                   tetraphosphate metabolism; GO_process: GO:0015968 -
FT                   stringent response"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46513"
FT                   /protein_id="ABO46513.1"
FT                   /translation="MFCFYDLNQLISQYLPHRERLKIAQAFIFGADAHETQVRSSGEPY
FT                   FTHPVAVACILAELRMDVDTIIAALLHDVVEDTEYTVDDISNIFGKKVAQLVEGVTKLT
FT                   QIRHKNRAEQQAENFRKMLLSVTKDVRVIFIKLADRLHNMRTLAPLKPEKKRRISKETL
FT                   DVFAPLAHRLGINTLKEQLETLAFEGMYPYRYHILEEKVKKVEKNKEKVFYEVKEALAE
FT                   KLNDLVSLEDIKARKKTLYSIYNKMRKKGISFDEIMDMYAYKIIVPNRIDCYVALGKVH
FT                   ELYKPIPQKFKDYIATPKANGYRSLHTVVLGPYNIPLEIQIKTEQMDRQAEYGIAAHWS
FT                   YKIGEKTDKALQRWLKKISDINVYTASSVEFLENVKTDIFNNDVFVFTPQGEIVELPMN
FT                   STCIDFAYYIHTDIGNKCISAKVNRKSVPLNYRLKQGDNVEIITSAIADPNPAWLKFVE
FT                   TNRAKSAIKDFLKQQYRNIDYIRGKDIVEGELRLLGVELRDVPSEIIDGALFNYEGIDT
FT                   INRFYLDTGLGLIDPNNFIDFVVKHFEDMRNAYKKSSLSKLQIRYGDDPRIADCCLPLP
FT                   NDEIVGIVNEHGKVEVHRKSCNELYTKIKDNQTKEIQADWFTNSDDDPSFKARLAVTLK
FT                   NIPGSIAKITATLAREGVDIRSFDMISVDNKQAKLSCVVVVRNRRELYLLVRLVRKLDV
FT                   CLNIERILNK"
FT   gene            complement(600971..601573)
FT                   /gene="recR"
FT                   /locus_tag="FTW_0606"
FT   CDS_pept        complement(600971..601573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="FTW_0606"
FT                   /product="recombination protein RecR"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0006310 - DNA recombination; GO_process:
FT                   GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46514"
FT                   /db_xref="GOA:A4IX62"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IX62"
FT                   /protein_id="ABO46514.1"
FT                   /translation="MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETAIA
FT                   IANSLLDATANIKKCVYCQALTEDDVCNICSNTNRDDTKLCIIESMLDMIAIEEAGIYR
FT                   GKYFVLNGRISPLDGIGPSELKLDILQQIIADRKIDEVILAISPTVEGETTAHFISQMI
FT                   AKDIKISRIGFGVPFGGELEYLDQQTLLHAFNARTNI"
FT   gene            complement(601573..601911)
FT                   /locus_tag="FTW_0607"
FT   CDS_pept        complement(601573..601911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0607"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46515"
FT                   /db_xref="GOA:A4IX63"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IX63"
FT                   /protein_id="ABO46515.1"
FT                   /translation="MNFDMSKLMQQAQKMQEQMKKAQQERENMEVIGESGAGLVTVTMT
FT                   GKYDVKSVSIDNSLMSEDKEILEDLIAAAVNNAVKKVEENSTASSDIYKMAKDAGIDLP
FT                   SGINFPFK"
FT   gene            complement(601921..603036)
FT                   /gene="murG"
FT                   /locus_tag="FTW_0608"
FT   CDS_pept        complement(601921..603036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="FTW_0608"
FT                   /product="undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="GO_function: GO:0050511 -
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase activity; GO_process:
FT                   GO:0009252 - peptidoglycan biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46516"
FT                   /db_xref="GOA:A4IX64"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IX64"
FT                   /protein_id="ABO46516.1"
FT                   /translation="MSLENKNIIITAGGTGGHIYPALAIAELLRQNKANVTWVGTPNSM
FT                   EASIVPEYFNIQFIKSSGVRRKGIIKKITFPLKLAYNTLKSRSLLKKLKADLVIGFGGY
FT                   VSGPICLAAAQINIPVIIHEQNAKIGLTNRILAKFATTICLAFEIENLHKQFSSKQLAK
FT                   TKIVGNPVRKDIVALNDKARIYTDSSTLKILVLGGSQGAKAINEIIPKLIQKSNEQGIN
FT                   IKVWHQTGKLSLEETKDAYKDISQNHIKDIAAFIDDMAIAYNWADLVICRAGALTVSEC
FT                   AIAGLPAIFIPLPSAVDDHQFFNAQNIVNNNAGFCLRQQQMTLENLLAIIKPLNQDRSK
FT                   LEQMSKMAKKTLIKNSSEQILDCVKKILNNK"
FT   gene            603140..603520
FT                   /gene="gcvH1"
FT                   /locus_tag="FTW_0609"
FT   CDS_pept        603140..603520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH1"
FT                   /locus_tag="FTW_0609"
FT                   /product="glycine cleavage system H protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0019464 - glycine decarboxylation via
FT                   glycine cleavage system"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46517"
FT                   /protein_id="ABO46517.1"
FT                   /translation="MAEINQNYLYTDSNLWVEVKGNIARVGIDDYSQDEFGEIVYVDLP
FT                   KLEQEYAKDDEICVIESVKTASDIYTPLSGKVVKINQQLLDNPKLINESCYDKGWLFEI
FT                   EIADLDELKSLINPQDYQSYVS"
FT   gene            603510..603806
FT                   /locus_tag="FTW_0610"
FT   CDS_pept        603510..603806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46518"
FT                   /protein_id="ABO46518.1"
FT                   /translation="MLARVLLIHSLIFLSSSAFALEQYLNYCKIYNPKKGIEYETHTKI
FT                   SVDFCKYYLEKCNKEYDNRCVAKMNAYQGLYNTNNALATMHVLYNDDFDRLNN"
FT   gene            complement(603892..605682)
FT                   /locus_tag="FTW_0611"
FT   CDS_pept        complement(603892..605682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0611"
FT                   /product="chitin binding domain protein"
FT                   /note="GO_function: GO:0030246 - carbohydrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46519"
FT                   /protein_id="ABO46519.1"
FT                   /translation="MKLNKITLLTGLALLVSSEAYSHGYVESPASRALLCKEGKNKDCG
FT                   ERAQYEPQSIEQADELFNLGALDNNIGSADVAGFESLDEQEQSRWAKTVVQPGQPLKIK
FT                   WQFTANHKSKHFKFYITKPNWDPNKLLTRESFEEKPLNCYDPQPTWVAPNQPPKDGLTF
FT                   TCTMPNRSGYQIIMAEWDVDDTRMSFYNLLDLDFTTSKPAGTVILSDGSSSNNNGSQPS
FT                   ATSTYDPSKSYPTPGTEVVFDGKVYQNKWYVNPGQQPGAEQWGPWAFVRDHQQQNNPSD
FT                   KFPLEATKFTINPLNIKEGDKITLQVFKDGTMTDYPLLTVPKAISTNDLFLELTEKINK
FT                   ISTEQLNNQIIAGVKDSNNAVIPNGNAVYIYQTADKPYDQISFYYHQANQNLKNELHLM
FT                   DFKDQYNISSDGKLYINAKIMSHSSATANVTVVLQDQNGNQVYRKTDIQISPMDTYDLA
FT                   LAIDNIKAGDYKLIISSELAGAEAWQKDMNIKAVSSETSDDNNNPPPANQDINVNIESN
FT                   TPYYQVNPNDSVTARAWASSLGNINLANNQVTIIAWNKTLQASGNDSSAYVKCPLPKNN
FT                   QTSITYLVSGDLNNVNCTIK"
FT   gene            606122..608026
FT                   /gene="thrS"
FT                   /locus_tag="FTW_0612"
FT   CDS_pept        606122..608026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="FTW_0612"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004829 - threonine-tRNA ligase activity; GO_process:
FT                   GO:0006435 - threonyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46520"
FT                   /db_xref="GOA:A4IX68"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IX68"
FT                   /protein_id="ABO46520.1"
FT                   /translation="MINIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLK
FT                   DAKDAINSNCELRLITVKDPEGLEILRHSCAHLLAHAVKELYPNTEVTIGPVVDNGFYY
FT                   DFSFKESIGEADLPTIEKKMKELAKKSAPVSYRVVPKAEAIEFFKAQGENYKVEIIDSI
FT                   ADEQMKIYTQDNFSDLCRGPHIPNTSVLKAFKLTKLAGAYWRGNSDNEMLTRIYGTCWA
FT                   TKEDLEQYLNMLEEAEKRDHRKIGKVLDLFHFQEDSPGIAFWHDNGVRIWRQVEDYMRA
FT                   SNNKYGCSEIRTPLIADFSLWQKSGHASKYAENMFATKSENRDFAIRPMNCPTCVQVYN
FT                   TKLHSYRDLPIRMAEFGIVHRNEPSGSLHGLLRVRSFTQDDGHIFCTPEQVEEEVILMV
FT                   QQCFEVYKDFGFNDFAIKIALRPENRIGDDETWDKSEQMLKNALDANNVSYELLPGEGA
FT                   FYGPKIEFHLKDAIGRSWQCGTIQLDFSMPQRLGATYIDKNGEKQVPVMLHRAIVGSLE
FT                   RFIGMLIEHYAGNLPLWLAPVQVAVMGISNNQDDYCKEVFIMLEKNGIRAKLDLRNEKI
FT                   GFKIREHTLLRVPYLVILGKNEQEQKIITIRKHSGEDLGQMSVDDFCAFLDKQIQAKE"
FT   gene            608033..608569
FT                   /gene="infC"
FT                   /locus_tag="FTW_0613"
FT   CDS_pept        608033..608569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="FTW_0613"
FT                   /product="translation initiation factor IF-3"
FT                   /note="GO_function: GO:0003743 - translation initiation
FT                   factor activity; GO_process: GO:0006413 - translational
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46521"
FT                   /protein_id="ABO46521.1"
FT                   /translation="MRRKKIIKTDKKAPINEQIKAKEVRLVGVDGQQIGVVSINEALAL
FT                   AEEADVDLVEMVANANPPVCRLMDYGKYLFEQGKKKAQAKKNQKQTQVKEVKLRPVTDV
FT                   GDYQVKLRNLIKFLEKGDKVKVTLRFRGREMSHKELGMEMLQRMANDAAEYGVVEHQPK
FT                   LEGRQMIMVLGPKKK"
FT   gene            608612..608809
FT                   /gene="rpmI"
FT                   /locus_tag="FTW_0614"
FT   CDS_pept        608612..608809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="FTW_0614"
FT                   /product="ribosomal protein L35"
FT                   /note="GO_component: GO:0009282 - cytosolic large ribosomal
FT                   subunit (sensu Bacteria); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46522"
FT                   /db_xref="GOA:A4IX70"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IX70"
FT                   /protein_id="ABO46522.1"
FT                   /translation="MPKLKTKSGAAKRFKKTGKGGFKHRCANRAHINTKMTTKRKRHLR
FT                   GMNQVAKVDTTSLVQQMPYA"
FT   gene            608845..609201
FT                   /gene="rplT"
FT                   /locus_tag="FTW_0615"
FT   CDS_pept        608845..609201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="FTW_0615"
FT                   /product="ribosomal protein L20"
FT                   /note="GO_component: GO:0009282 - cytosolic large ribosomal
FT                   subunit (sensu Bacteria); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46523"
FT                   /db_xref="GOA:A4IX71"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IX71"
FT                   /protein_id="ABO46523.1"
FT                   /translation="MSRVKRGVTARARHKKVLNQAKGYYGARSRVYRVAKQAVIKAGQY
FT                   AYRDRKVKKRTFRSLWIVRINAAARQHDISYSQLINGLNKAGVELDRKALAELAVYNKD
FT                   AFAAVVEKAKAALA"
FT   gene            609243..609947
FT                   /locus_tag="FTW_0616"
FT   CDS_pept        609243..609947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46524"
FT                   /protein_id="ABO46524.1"
FT                   /translation="MKHLNFLLIKRIFLIFFLSFGVLLFLIFNGYKYFDVDKLNLAYIK
FT                   VSAYVDSHIILACLSYVCVYILTVFFSVPVKPFLKILAGILFGFVLGFIVCLFAATIGA
FT                   MLAFLFIKYNWGEASTNPKYKIISKFKSLVENHPITILFVARLLPIPFFVPNILAGILK
FT                   VKNSIFFTTTLFGIIPVTSIYVWFGVHFKEAVIQGNKENFIDTKFVVALSILGLLTLLA
FT                   LYVANKYTNRKI"
FT   gene            610239..611119
FT                   /locus_tag="FTW_0617"
FT   CDS_pept        join(610239..610568,610568..611119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0617"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46525"
FT                   /protein_id="ABO46525.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVDCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            611748..611936
FT                   /locus_tag="FTW_0619"
FT   CDS_pept        611748..611936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0619"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46526"
FT                   /protein_id="ABO46526.1"
FT                   /translation="MDHSVLNVLVCPICKANLYYDKENQVLVCKADKLAYPIRENIPVM
FT                   LVEEAKKMTLEEVKKYG"
FT   gene            611929..612681
FT                   /gene="kdsB"
FT                   /locus_tag="FTW_0620"
FT   CDS_pept        611929..612681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="FTW_0620"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="GO_function: GO:0008690 - 3-deoxy-manno-octulosonate
FT                   cytidylyltransferase activity; GO_process: GO:0009244 -
FT                   lipopolysaccharide core region biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46527"
FT                   /db_xref="GOA:A4IX75"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IX75"
FT                   /protein_id="ABO46527.1"
FT                   /translation="MANIHIVIPARLKSTRLPNKMLADIAGKPMIQRVYEQVTKSKFDS
FT                   IIIATDSQKIKDIAESFGAKVVLTRDDHQSGTDRIAEAVTKLGFADEDIVVNVQGDEPL
FT                   IPIENIEQAAQLLIDKSEAVVSTLCEKITDVEDIYNPNNVKVVFDKNNYALYFSRASIP
FT                   FERGFSEKEQINISEFFRHIGIYAYRVAFLKHYAELTVSPIEKYEALEQLRVLYNGYKI
FT                   AIEQSAKSTPAGVDTLQDLEKVRKLFNV"
FT   gene            612674..613069
FT                   /locus_tag="FTW_0621"
FT   CDS_pept        612674..613069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0621"
FT                   /product="histidine triad family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46528"
FT                   /protein_id="ABO46528.1"
FT                   /translation="MFKLDSRLAADTFEVCEHLDCKILVMNNSIVPWFIVVPFTDRTEW
FT                   YQLDDSQQYNINKIINKLSDFIVKEYNADKLNVATIGNVVRQMHIHVVGRFESDPVWPA
FT                   PVWGNIEPKAYTDQEKNKLREKVRSIF"
FT   gene            complement(613066..614214)
FT                   /gene="galK"
FT                   /locus_tag="FTW_0622"
FT   CDS_pept        complement(613066..614214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="FTW_0622"
FT                   /product="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /note="GO_function: GO:0004335 - galactokinase activity;
FT                   GO_process: GO:0006012 - galactose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46529"
FT                   /protein_id="ABO46529.1"
FT                   /translation="MMDCIKHNLINRFVELYGRKPQLFFSPGRVNLIGEHTDYNNGFVM
FT                   PFAINKGTFIAIAKRDDNIVNVYSENLDDSSSFDITKIKQEISNTWQNYIKGVINIINQ
FT                   DFSSDIKGADIYIFSDLPFGAGLSSSASLNTALAYAYNDIYQLNISKIDVAKIAQKVEH
FT                   EYIGTKCGLMDQMACLFSQQNAATMIDCNDNHYDNIPFELDNLSVLICDTNIKHNLADS
FT                   AYNKRRQVCENIARFHSIKSLRELDSQKLEDTKLNFSEEDHKLALHVFTENQRVIEATK
FT                   AMVAKDWQKLGKLMYQSHNSLKNDYKVSCDELDYLVELSQNFAGIYGARMTGGGFGGST
FT                   IHLLPTKLLKEYASYLEKNYFEKFNIKPSFYISKACQGTCKL"
FT   gene            complement(614217..615242)
FT                   /gene="galT"
FT                   /locus_tag="FTW_0623"
FT   CDS_pept        complement(614217..615242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galT"
FT                   /locus_tag="FTW_0623"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.10"
FT                   /note="GO_process: GO:0006012 - galactose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46530"
FT                   /protein_id="ABO46530.1"
FT                   /translation="MNISATISQLKSSHRRKNILTNEWVLVSPHRLNRPWQGQSEETQK
FT                   NTLPEYDDKCYLCPTNIRANGEVNPDFKETFVFENDFSALSKEKIDKKLEINDDLFQLS
FT                   GATGIAKVICFSAKHNLTMASMQQKDIVKVVDLWASEVTELSKKYQWVQVFENKGSIMG
FT                   CSNPHPHGQIWACDFLPTEAQKEYKSQQQYFEKNKSSMLIDYANREIKEEDRIVYQNDD
FT                   WLIVVPFWATWPYETLLLPKFKCSHLNHLSNSQRKTLANALKILLVKYDKLFDTSFPYS
FT                   MGWHGSINATESDYWQLHAHFYPPLLRSATVKKFMVGFEMLGESQRDITPELAAQVLRD
FT                   L"
FT   gene            615333..616715
FT                   /gene="galP1"
FT                   /locus_tag="FTW_0624"
FT   CDS_pept        615333..616715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galP1"
FT                   /locus_tag="FTW_0624"
FT                   /product="galactose-proton symporter, major facilitator
FT                   superfamily (MFS) transport protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_function: GO:0051119 - sugar transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46531"
FT                   /protein_id="ABO46531.1"
FT                   /translation="MQTEKKINFVVVRVAIIAALAGLLFGMDIGYVNGSLHFISETFGL
FT                   SVEQSGHVSSVLLLGAACGALFSGFLSKRYGRRKVLLIAAAIFSIFTIVGILAPNYQIF
FT                   ISSRFILGIAVGIASFIAPLYLSEIAPKEFRGALIALYQLMITIGLFLVFLTNSALERT
FT                   GSWRVMLAVLAIPSVIMFFGCLTLPRSPRWLILKGNDNEAALVLKKIRSSEAEALEEHN
FT                   EIKQTTHRGVSVFSLLKQKFFIKVVLLGIALQAFQQFTGMNAFMYYSTDIFKLAGFTNP
FT                   STSTIVIGLLNMLTTFLAIKYVDKFGRKPILYFGLSLLIISCIIVGFIFKTHFVYGQAM
FT                   VLSQTLQWTALIFCLLFIFGFAISMGPVIWILCSEIQPIEGRDFGVTASTMSNWICNAI
FT                   IGNFALTWLTFHPDSTFFGFAISCIICILFVKFFVPETKDVSLEEIENNLRSGKSLAKI
FT                   GR"
FT   gene            616747..618141
FT                   /gene="galP2"
FT                   /locus_tag="FTW_0625"
FT   CDS_pept        616747..618141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galP2"
FT                   /locus_tag="FTW_0625"
FT                   /product="galactose-proton symporter, major facilitator
FT                   superfamily (MFS) transport protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_function: GO:0051119 - sugar transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46532"
FT                   /protein_id="ABO46532.1"
FT                   /translation="MEAQKEYKRIVYIIATIAALGGLLFGLDQGFIGNAGDTLNKLYGL
FT                   DAKAAGSFNAILVTGGILGTICSGFFTKFFGRKNTLMIAGFAFLAGALVSSFLPPINIL
FT                   TFCRFLLGFGVGLASFATPLYLAETAPTKIRGSISTLFQLMITFGIFLISLTNIIIVMC
FT                   LCHQKISLALMFSVIAFFAFLMFVGCFFLPKSPRWLLSKGKDQEAHKVLTRLRAAHEID
FT                   TEIAETKKVLKTDHGSVVESLAKKYFWKILLVGVIIQMFQQLVGINMMIYYAPHFLSNV
FT                   GLNVLIAALAVYLVNFLSTFPAIKWVEKWGRKKLLTVGAVVMMSSLVVSAVCFYFIKHT
FT                   QDPADFIKYVLLISCLVYIFGFACSWGPVAWIICSEIFPINTREIGMTVTTVVNWTFAG
FT                   FVIANSNVIMTKVAFGDVIIFLVYAAFCLAAIFFLKMFVPETKGVSLEKIEDNLISGKK
FT                   LRDLGQ"
FT   gene            618236..618514
FT                   /gene="ppiC"
FT                   /locus_tag="FTW_0626"
FT   CDS_pept        618236..618514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiC"
FT                   /locus_tag="FTW_0626"
FT                   /product="peptidyl-prolyl cis-trans isomerase C"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46533"
FT                   /protein_id="ABO46533.1"
FT                   /translation="MKASARHLLVQSESECQQIKKDITEGKITFEEAARKHSLCPSGAR
FT                   GGDLGTFSQGQMVPEFDRVVFNDELHKVHGPVQTQFGYHLLEITSRG"
FT   gene            618579..620288
FT                   /gene="deaD"
FT                   /locus_tag="FTW_0627"
FT   CDS_pept        618579..620288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="FTW_0627"
FT                   /product="cold-shock DEAD/DEAH box helicase"
FT                   /EC_number="3.-.-.-"
FT                   /note="GO_function: GO:0008026 - ATP-dependent helicase
FT                   activity; GO_function: GO:0004386 - helicase activity;
FT                   GO_process: GO:0006139 - nucleobase, nucleoside, nucleotide
FT                   and nucleic acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46534"
FT                   /protein_id="ABO46534.1"
FT                   /translation="MNSETKKDFSQLGLNQDIVDTVIKLGYENPTPIQQYAIPYILSGR
FT                   DVLGQAQTGTGKTAAFALPLINNMDLASRDRAPQVLVLAPTRELAIQVAEQFEAFAKNV
FT                   PNLDVACIYGGQEYGSQIRALKQGVKVVVGTTGRVMDHIEKGTLQLDNLRALVLDEADE
FT                   MLRMGFIDDVKFVLSHVSEQSQRLLFSATIPTDIADIIEEYLRNPCKIQVKAKTKTANT
FT                   VTQKFIVIKGFRKIDALDRLLETEETDGVIIFVKTKTSTIEVADNLKALGYKVAAINGD
FT                   MQQSQREYIVDQFRSAKSDILVATDVVARGIDLERISHVINYDMPNDTDTYVHRIGRTG
FT                   RAGREGTSISLVPLKEMRFLRTLERFTGSPMQEVFMPSAKDLAQSRVEHFKARIISALD
FT                   KNKSLDKYKEIITSIRDELQLDSEELLAGLTLLAQGKKTFFPREIQAKEEKPARDNRNS
FT                   RDGRRNERFERRNDQGDRTKRFDKADRKPRRAVNIDLTTYKLDVGRDNDVQARNIVGAI
FT                   ANEGNIDSKHICNISIQKDYTLVDLPANLSPKVINHLKKVWVAGKKLNLTAQ"
FT   gene            620405..620977
FT                   /gene="gmk"
FT                   /locus_tag="FTW_0628"
FT   CDS_pept        620405..620977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="FTW_0628"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="GO_function: GO:0004385 - guanylate kinase activity;
FT                   GO_process: GO:0015949 - nucleobase, nucleoside and
FT                   nucleotide interconversion"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46535"
FT                   /protein_id="ABO46535.1"
FT                   /translation="MNNYIFIVSAPSGAGKSSLLKAFLATDIGKDNYAVAISHTTREPR
FT                   VGEINSREYYFVTVAEFEQLLSQDGFIEYAKVFKNYYGTSKAELDRLLALGKNIILEID
FT                   WQGAQQTRAIYGDRAKSIFILPPSLDELRKRLEKRNTDSKETIDYRMEQAQSEISHADE
FT                   YDYLLVNDDFSQSLEQLCKYFEQNIQS"
FT   gene            620998..622023
FT                   /gene="nadA"
FT                   /locus_tag="FTW_0629"
FT   CDS_pept        620998..622023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="FTW_0629"
FT                   /product="quinolinate synthetase complex, subunit A"
FT                   /EC_number="1.4.3.-"
FT                   /note="GO_component: GO:0019804 - quinolinate synthetase
FT                   complex; GO_function: GO:0008987 - quinolinate synthetase A
FT                   activity; GO_process: GO:0019363 - pyridine nucleotide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46536"
FT                   /protein_id="ABO46536.1"
FT                   /translation="MLNKKLIKDKISQARQELPSLKIKDTEKQQYMREIQELLEQNNAC
FT                   LVAHYYVDAEIQELAEKTGGFVGDSLAMAKFGLESSCDTLVVAGVRFMGDSAKILSPEK
FT                   KILMPTLEAECSLDLSCSNDEFKKFIEANPDREVVVYVNTAAEIKALADWTVTSSNALE
FT                   ICSHLHKQGKKLLWGPDRFLGDWIAKQIGADMLLYDGSCIVHEEFKAQALDDLILEHPD
FT                   AAVLVHPESPAEIIKRADAVGSTSQLIAASQRLSNTKFIVATDTGVFYKMKQLSPHKEF
FT                   IPAPTAGRGATCQSCAKCPWMKLNQLKNLKDCLINQTNEIFIDEEVRQKALIPLNRMIN
FT                   F"
FT   gene            622032..622895
FT                   /gene="nadC"
FT                   /locus_tag="FTW_0630"
FT   CDS_pept        622032..622895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="FTW_0630"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="GO_function: GO:0004514 - nicotinate-nucleotide
FT                   diphosphorylase (carboxylating) activity; GO_process:
FT                   GO:0019363 - pyridine nucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46537"
FT                   /protein_id="ABO46537.1"
FT                   /translation="MADVMLNTDQINKVPNDIVTRLVRESLAEDIATGDITAQLAEDID
FT                   TTAFCITREEMILCGQDFANEVINQLDKNIQITWLYSDAQKVPANARIFELKGNARSIL
FT                   TAERTILNFIQMLSGTATVTNKQVKLISQYKTKLLDTRKTIPGFRLAQKYAVRCGGGFN
FT                   HRIGLFDAYLIKENHIRSAGGIAKAVTKAKKLDSNKVVEVEVTNLDELNQAIAAKADIV
FT                   MLDNFSGEDIDIAVSIARGKVALEVSGNIDRNSIVAIAKTGVDFISVGAITKHIKAIDL
FT                   SLQVQL"
FT   gene            622898..624385
FT                   /gene="nadB"
FT                   /locus_tag="FTW_0631"
FT   CDS_pept        622898..624385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="FTW_0631"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="GO_component: GO:0019804 - quinolinate synthetase
FT                   complex; GO_function: GO:0008734 - L-aspartate oxidase
FT                   activity; GO_function: GO:0050662 - coenzyme binding;
FT                   GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_function: GO:0050660 - FAD binding; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0008152 -
FT                   metabolism; GO_process: GO:0019363 - pyridine nucleotide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46538"
FT                   /protein_id="ABO46538.1"
FT                   /translation="MIIKKHDVAIIGGGLAGVVAAIELAENNLDVAIIYDQKINHCASA
FT                   YAQGGIAAIVSSDDSIEAHINDTYIASGKLAKLESITQVVTNSNAAIAWLEKHGVEFDK
FT                   KENGQYSLHLEGGHSQARILHIKDYTGRAVITSLYKNLDSFKNISTYPEHNVIELIKKD
FT                   YKCVGLYSHDNKYQVTKFITKKVILAAGGASGLYKYVTNATAGNGSAMIMAYDIGCQLE
FT                   NLEFTQFHPTCFFARNGAPLLISEAIRGSGAVLETVKGVRIMKSIHEKQDLAPRDIVAR
FT                   EIYINIQAGRDVYLNATHLNTSQWQQKFPYIYEKLLENNINPVNDRIPVSPAAHYSCGG
FT                   ISVANNSQTNIANLYAVGEVACTGLHGANRLASNSLLECVVYALAASQDILANINDSFT
FT                   ECDQKLELFNSNNNYIQQINQIRQLMWDNVGLVRRQAELSKAYQQLQLLAQSISTDTRL
FT                   ANYDYKLEAYRKILKLATLILEQAIKRKDSVGSHFLI"
FT   gene            624404..625347
FT                   /locus_tag="FTW_0633"
FT                   /note="adenosine deaminase"
FT   misc_feature    624404..625347
FT                   /locus_tag="FTW_0633"
FT                   /note="contains frameshift"
FT   gene            625497..626240
FT                   /locus_tag="FTW_0634"
FT                   /note="transposase ISFtu2"
FT   misc_feature    625497..626240
FT                   /locus_tag="FTW_0634"
FT                   /note="Every ISFtu2 ORF in this genome has a premature stop
FT                   at the identical position resulting in disruption of the
FT                   ISFtu2 sequence in compariosn to Schu4 ISFtu2 elements."
FT   gene            complement(626480..626926)
FT                   /locus_tag="FTW_0636"
FT   CDS_pept        complement(626480..626926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0636"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46539"
FT                   /protein_id="ABO46539.1"
FT                   /translation="MLFKNKKPTDTFELENNDQETISNIIKPKLWKLFKWLIFCAFVLV
FT                   LSSYLNARIFLLAFIFVILVVLAIKLYLLNKLPPLNFRIYIVVFLLIFILCEYNHLEIV
FT                   YFKSFEISNIDYQNLLTNPGIFIGALCNIVFTTKIQVAPQLFFS"
FT   gene            627080..627370
FT                   /locus_tag="FTW_0637"
FT   CDS_pept        627080..627370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0637"
FT                   /product="chorismate mutase family protein"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46540"
FT                   /protein_id="ABO46540.1"
FT                   /translation="MAQNNVAKPSVENYKTKIMNIDQQIIQLIAERRGWRDKMLKLEKK
FT                   QNLPSYDPFKDQSLANTRTSFAIQYDVSPKLVAEVFDILNNKNLQPADQSF"
FT   gene            627399..627869
FT                   /locus_tag="FTW_0638"
FT   CDS_pept        627399..627869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0638"
FT                   /product="putative glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46541"
FT                   /protein_id="ABO46541.1"
FT                   /translation="MSIYDFKLTANDGSEYHLPKNKVLLIVNVASKCGFTKQYRGLQHL
FT                   HKIYPDLEIVAFPCNSFGGQEPGSDEEIKNFCETNYNVTFPIMKKTKVNGKDAEPLFEY
FT                   LKERAKGVLGTEAIKWNFTKFLVSKDGETIVRYAPKTIPEDLIPDIDNFLKD"
FT   gene            627911..629077
FT                   /locus_tag="FTW_0639"
FT                   /note="conserved hypothetical protein"
FT   misc_feature    627911..629077
FT                   /locus_tag="FTW_0639"
FT                   /note="disruption due to premature stop"
FT   gene            629074..630051
FT                   /locus_tag="FTW_0641"
FT   CDS_pept        629074..630051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0641"
FT                   /product="Mandelate racemase / muconate lactonizing enzyme"
FT                   /EC_number="5.1.2.2"
FT                   /EC_number="5.5.1.1"
FT                   /note="GO_function: GO:0016853 - isomerase activity;
FT                   GO_process: GO:0019439 - aromatic compound catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46542"
FT                   /protein_id="ABO46542.1"
FT                   /translation="MNKIIDIKTSIVTIPLKGTFVTAVRSTNHIDAVVVELSLDNGNKG
FT                   YGVAPATTAITGDTLQGMQYIISEIFAPVILSSNLSDYKQTLELAFKKVMFNSAAKMAL
FT                   DLAFHDLLAKQKNISVAKLLGVKNNIIETDVSISCGSVAETIQNIQNGVEANFTTIKVK
FT                   TGADFDRDIQLLKALDNEFSKNIKFRFDANQGWNISQTKQFIEELNKYSLNVEIIEQPV
FT                   KYYDISAMREITKFSNIPIVADESVFDAKDAERVIDEQACNMINIKLVKSGGILEAQKI
FT                   KKLADRAGISCMVGCMMESPAGILATASFALAEGITVADLDPLD"
FT   gene            630157..630804
FT                   /locus_tag="FTW_0642"
FT   CDS_pept        630157..630804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46543"
FT                   /protein_id="ABO46543.1"
FT                   /translation="MKTDKVIVLVHGFIKNAKDMRSLVSYLKQDYDDIVAVDLPTTFVS
FT                   MDVAVSKLCQIIQNIPKTKSITFIAHSMGGILVCKCIDKLQLDNIDKCVFIATPFAGSK
FT                   VADFGDRIPFYSRILKPNKELKVTDDYLEICNKVAAMVPIGLIAGNKHSKFNLLAKFCL
FT                   KNDHDGLVEVASVFAVNSADRIVLYKNHCKIHHDDETLSKIACFLQTGKFKI"
FT   gene            complement(630815..630943)
FT                   /locus_tag="FTW_0643"
FT   CDS_pept        complement(630815..630943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46544"
FT                   /protein_id="ABO46544.1"
FT                   /translation="MKKLTIAATFIISIISTSFAALAHQINSRNSTSFPTQEFILA"
FT   gene            630903..631082
FT                   /locus_tag="FTW_0644"
FT   CDS_pept        630903..631082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46545"
FT                   /protein_id="ABO46545.1"
FT                   /translation="MLIIKVAAIVNFFILLPFGFLPLSLCEYYYIGFYICKTNDFYNVY
FT                   QLNLYKDGFIADLY"
FT   gene            631141..632604
FT                   /locus_tag="FTW_0645"
FT   CDS_pept        631141..632604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0645"
FT                   /product="YjeF-like protein/carbohydrate kinase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46546"
FT                   /protein_id="ABO46546.1"
FT                   /translation="MDFLTEKQNREIEEYAVSQGLNLIENASDEIVKLICNKFDKQSKV
FT                   LVIAGSGNNGSDGIAAAIKLFNKGYDVDIYRVFPKGNRDNQNYYAKFSNLKDPLRELTN
FT                   ISDYDVVIDAIFGIGLDRNIDGYILEIINAINQNSKYTLAIDVPSGLGAFNAKVYGQAI
FT                   QANETITFLADKQGLHTGDGLDYAGKVTVKELIDSSNIKLSQSEYQVYKNHIQDINLAN
FT                   ILRKKKNTNKGTYGNLAIIGGNVGMNGALQLAGKSALYSGCGKVSMISLDRGFRADISI
FT                   PELMTKPLEIISKNLAIFSALAIGVGFDTTDESQQILELIIGNITQPIIFDADALNIIA
FT                   TNQQIREKFIQLENKIITPHPAEAARLLGCTIQKIQNDRFDAVRALAKKYNAIVVLKGA
FT                   GSLICKDDEIYINTTGNQGMAVAGQGDVLSGIIGAFLAQGLDILSASRLAVYIHGLAGD
FT                   NLAKKLGGYIGIFPSGVAEEVCEVLNLFI"
FT   gene            complement(632639..633007)
FT                   /locus_tag="FTW_0646"
FT   CDS_pept        complement(632639..633007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0646"
FT                   /product="S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46547"
FT                   /protein_id="ABO46547.1"
FT                   /translation="MSVRLDKWLWATRFYKTRALAKKAIEGGKVHFQGQKTKVSKIVNI
FT                   GDTYQIQQGYIKKTVIVEALDEVRKSASEAQKLYRETAESIEKREQETILRKTANLISP
FT                   EKPTKKQRRQIIDFKRND"
FT   gene            complement(633234..635830)
FT                   /locus_tag="FTW_0647"
FT                   /note="organic solvent tolerance protein"
FT   misc_feature    complement(633234..635830)
FT                   /locus_tag="FTW_0647"
FT                   /note="contains frameshift and premature stop"
FT   gene            636167..638437
FT                   /locus_tag="FTW_0649"
FT   CDS_pept        636167..638437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0649"
FT                   /product="hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46548"
FT                   /protein_id="ABO46548.1"
FT                   /translation="MMIFKFILGALPIALVGCGREDKMEFEVAHECVGHSCAVYVEPLS
FT                   QTYVDQLVKKVMISEVRHDVRQVNHSLKWYGLEGGNYIDSDILTELDLKQCGDSVCDDT
FT                   KNPVAYQFQQGQEYVSLDVLGKMTVNNKEYDINKKYNFVIELISAPVISGKCDDGNVCV
FT                   FSVTKDSEGGAKPYNYYWYDGYQNVAITKSTVDNGDFKYELKDNLKHNIVMSTGDKFGR
FT                   NYSEDSNEVVVYADMYKAPTVEILSEDAVDEGKQALLAAEAVAYGNKTIQKDGYNWTVP
FT                   EGWEIVSGQGTNLLVVKVPGYSKDMPKGKFSVVATDSEGIESNVATKEVAVLFDSSLKP
FT                   TKPSLVAADLNGQKDVVEKKQYKVTASTTANGDRKIVKYIWKVNGEESETTTSVFTDVA
FT                   PIYDPNGENKIKVTVIAVDSANQRSEESAELQIDVKTDTTIKPTRPSLSATDLNGQKDV
FT                   VEKKEYKVTATVQASAGRKIVGYEWKVNGTKVETTTNVLQQTAPAFNTTAGAENKIKVT
FT                   VVAIDNAGVRSDESAELGIAVKADMSIKPSTPSLSAPNSANEKTTIKLSAESSPNGDRQ
FT                   IREYEWKLDGVVISGMTAKEIEVTLPETNPSKRKNVFSVVAIDTAGVRSDPQSRDVTNV
FT                   PVLDTSKKVSGKGITSSQLYQPLLDLLNAQKEKTHATFRYVDQQLGNRYEMVCEPGYSS
FT                   SNRPGIVGPAFIAAAQYIPHTANGGDWVYAHDHGIMGAPDFKYEKDFTTFGLKFSGGCG
FT                   PIL"
FT   gene            639118..639933
FT                   /locus_tag="FTW_0650"
FT   CDS_pept        639118..639933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46549"
FT                   /protein_id="ABO46549.1"
FT                   /translation="MNKTINLHKMKTSLDPANNARYELEDICLNDYIGQQLKLEFLDEI
FT                   NCVACGAKTKKSYSQGYCFMCMRRLPECDICIVKPELCHFAAGTCRDSSWGEENCMKTH
FT                   IVYLANTGDIKVGITKLKNIPSRWIDQGASQAIPIFAVESRLISGLVEVAIKEHISDKT
FT                   NWRKMLQGEPDNNIDFVTLRDQLIEKSSQKITEIRTKYGQNSVEPVEAEIQNINYPILK
FT                   YPTKLKSFNLDKDRLIDAKLIGIKGQYLIFDSGVINIRKFSGYKCILSA"
FT   gene            complement(640032..640451)
FT                   /locus_tag="FTW_0652"
FT   CDS_pept        complement(640032..640451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46551"
FT                   /protein_id="ABO46551.1"
FT                   /translation="MILVLLGTLSLGIAILALPKYQTYSLGFCIGFISIVQPSNHMDFE
FT                   VAKSITIGMSTIVGSIGLWLAFKLYPQSPYTISRKIAIKSIVKDIQKLKRQEISKEHYQ
FT                   AGLIKKILSVYRNRKDDPSSEKDIEFALKSLLQTM"
FT   gene            640327..640464
FT                   /locus_tag="FTW_0651"
FT   CDS_pept        640327..640464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46550"
FT                   /protein_id="ABO46550.1"
FT                   /translation="MWLLGCTIEIKPIQNPRLYVWYLGNAKIAIPNDKVPSKTNINSSK
FT                   "
FT   gene            complement(640473..641728)
FT                   /locus_tag="FTW_0653"
FT                   /note="hypothetical protein"
FT   misc_feature    complement(640473..641728)
FT                   /locus_tag="FTW_0653"
FT                   /note="contains frameshift"
FT   gene            complement(641725..642570)
FT                   /locus_tag="FTW_0655"
FT   CDS_pept        complement(641725..642570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0655"
FT                   /product="putative efflux transporter of RND family,
FT                   membrane fusion protein"
FT                   /note="GO_function: GO:0008565 - protein transporter
FT                   activity; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0009306 - protein secretion; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46552"
FT                   /protein_id="ABO46552.1"
FT                   /translation="MSNKNTKSIISIIIILFALFSLYAMWQYYLYSPWTRDGRIRAKII
FT                   TIAPDVSNMYVSDNQKVKKGQLIFTIDDQRYAATLEGKEAELKHAMIEWQLAEKQYLRR
FT                   IRLGRDDSISREELDDYAMQEKLRKADLEKAKAEAELAKINLDRTKIYAPADGTINNID
FT                   LRQGNYVVSSKPVMSLVKAGSFYVTGYFEETKLPHIKIGDKAKIILMSGGEPLYGHVIS
FT                   IGKAVADNNTDVNNQLLPKVQETYDWVRLSKRIPVDIALDKVPINTELVSGMNATVTIK
FT                   "
FT   gene            642699..642818
FT                   /locus_tag="FTW_0656"
FT   CDS_pept        642699..642818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46553"
FT                   /protein_id="ABO46553.1"
FT                   /translation="MVNISAIATNNNNGENSKPSKVSIGIFCSLVSNKKINNY"
FT   gene            642962..643681
FT                   /locus_tag="FTW_0657"
FT   CDS_pept        642962..643681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0657"
FT                   /product="putative transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46554"
FT                   /protein_id="ABO46554.1"
FT                   /translation="MSEDKRIQVISRAVNVLKSIGSKPDGMSLGEIAKQIYLPRSTVQR
FT                   IVAALEEEGFIKSEGAGKILLGPGIFKLISSSYADIISLTQDSLSKLSAKIQETVVITQ
FT                   PYDSDLLIVHRFIINRELQVLPRVGALIPIYNSSSGRAILALHTDDKIIEILGEQIPDD
FT                   KELFEKIAKIRADGIEFDYGKVIKGIVSIGVAINTFLGTFGISILTPQHRFDKYKEFYV
FT                   NELLKTKSKIIDEIGIK"
FT   gene            complement(643741..644727)
FT                   /locus_tag="FTW_0658"
FT   CDS_pept        complement(643741..644727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46555"
FT                   /protein_id="ABO46555.1"
FT                   /translation="MFKNNNIMSFFIIIVLIITGIFLYIKNKANNQYQILPDNSGSSLT
FT                   DTSWVKNKYLNIPYASSSNAQKLDIYLPNDKSFAKPYPVIIAIHGSAFLGGDKADYQLK
FT                   PMLEGIKHGYAVVSVNYRLANEAKFPAQIQDIKAAIRFIKANANKYNLNPNAIAVWGDS
FT                   AGANLAALAATSGNKITKLDDLSLGNKDYSANVQACVDWFGPTDFSKMDDQFRQSGLGK
FT                   PIHSQNDSPESLYIGSNVANSPQKVKMANPETYISKDTPPFLIEHGSVDNVVPVQQSIN
FT                   FYKKLVKTIGKDKLELVIIDDAKHGGEKFESKSNLELVFKFLDKYLK"
FT   gene            644933..645919
FT                   /locus_tag="FTW_0659"
FT   CDS_pept        644933..645919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0659"
FT                   /product="putative lysine 2,3-aminomutase, YodO family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46556"
FT                   /protein_id="ABO46556.1"
FT                   /translation="MSTNDWKKVLKESFSSPLELLEFLEIDSEEAKVSLNIAKKFKMIV
FT                   PRSFADRMQKGNINDPLLKQVLPTADEEVIDQAYSSDPLDEKNYNKVPGLLHKYHGRVL
FT                   LIAQTSCAVHCRYCFRKEFDYKENIPGRKDWLQAFEYIANDQSIEEVILSGGDPLLNND
FT                   EILEFFIENIQRISHIKRLRIHSRIPVVLPERITTKLLKILSEHRLDTVLVIHVNHPNE
FT                   LDGNVSKVLKEIHKHGIIILNQSTLLKDINDDANVLYALSTKLINAKVIPYYIHSLDTV
FT                   SGTKHYNVDNDKDIMKKLSEISSGFMVPVLTKEIPGYPSKKWLSFHS"
FT   gene            complement(645990..646193)
FT                   /locus_tag="FTW_0660"
FT   CDS_pept        complement(645990..646193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0660"
FT                   /product="cold shock DNA-binding domain protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent;
FT                   GO_process: GO:0009409 - response to cold"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46557"
FT                   /protein_id="ABO46557.1"
FT                   /translation="MRQGTVKFFNTSKGFGFIEPQDGGKDVFVHISAVENAGLSSLREG
FT                   EKVSFEVEENRGKMAAVNIKSI"
FT   gene            complement(646392..646719)
FT                   /locus_tag="FTW_0661"
FT                   /note="hypothetical protein"
FT   misc_feature    complement(646392..646719)
FT                   /locus_tag="FTW_0661"
FT                   /note="contains frameshift"
FT   gene            646965..647165
FT                   /gene="rpsU1"
FT                   /locus_tag="FTW_0663"
FT   CDS_pept        646965..647165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU1"
FT                   /locus_tag="FTW_0663"
FT                   /product="ribosomal protein S21"
FT                   /note="GO_component: GO:0009283 - cytosolic small ribosomal
FT                   subunit (sensu Bacteria); GO_function: GO:0003735 -
FT                   structural constituent of ribosome; GO_process: GO:0006412
FT                   - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46558"
FT                   /protein_id="ABO46558.1"
FT                   /translation="MPRIIVDPKKPFDISLRNFKRACEKAGIKQELRDRQHYVKPTQKR
FT                   KIAKKAAISKAKKEARRSYSY"
FT   gene            complement(647223..647390)
FT                   /locus_tag="FTW_0664"
FT   CDS_pept        complement(647223..647390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46559"
FT                   /protein_id="ABO46559.1"
FT                   /translation="MSLANIITFLVFFMCLVILLSTNVEVSHLTAFTTCFLSILSAGFV
FT                   PTLLIILRDY"
FT   gene            complement(647802..647889)
FT                   /locus_tag="FTW_2039"
FT   tRNA            complement(647802..647889)
FT                   /locus_tag="FTW_2039"
FT                   /product="tRNA-Ser"
FT   gene            648036..648527
FT                   /locus_tag="FTW_0665"
FT   CDS_pept        648036..648527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0665"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46560"
FT                   /protein_id="ABO46560.1"
FT                   /translation="MIDSLARNQNWAKVAPWAGIFFTVLLFANFFVYDPHFWGLINIPL
FT                   YLFHQTEEHYVPGGFKDFMNRTVMALPQGQEKLTDIKIFWINILMVWLAFAVFGALSFK
FT                   HKSWNLGLVMASIQFVISLFAAYYVTVHGLDNPIAWWLGTIIFSIVAHILLFKLVMTRD
FT                   "
FT   gene            648618..649757
FT                   /locus_tag="FTW_0666"
FT   CDS_pept        648618..649757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0666"
FT                   /product="cation-efflux family protein"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0015562 - efflux permease activity; GO_function:
FT                   GO:0008324 - cation transporter activity; GO_process:
FT                   GO:0006812 - cation transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46561"
FT                   /protein_id="ABO46561.1"
FT                   /translation="MSDNRYQITKKVTLVGMFINALLAISKTLIGVIGRSPALFADGIH
FT                   SFSDLLSDFMVLFAAKYANKGEDHNHPYGHERLETLATLVLSGLLITIGFMIVYHSLVS
FT                   LLGGEYVIPDKFTVYAAIFSIFGNEFIYQYTMRAANKIDSDLLRANAWHSRSDMWSSVV
FT                   VLVGLFGAFWGFAWMDAIAAFIVCFMIVKMGVKWGYSAVAELIDEGVDDQTRQDIKAII
FT                   AKTQGVEDFHYLRTRKMAGKIVLDVHILVDKFSTASEGHYIAEIVKSNIYHNIDNIKDI
FT                   TVHVDVTNHESGVIKQENFEPSRAEILTKIKEFFAENNIDENVILDKKMSIYYFDDEIL
FT                   VDLYVKRSNDLKRLSDKLSKLSYRGYNICVTLYCNLANS"
FT   gene            649774..650637
FT                   /gene="galU"
FT                   /locus_tag="FTW_0667"
FT   CDS_pept        649774..650637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="FTW_0667"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="GO_function: GO:0003983 - UTP:glucose-1-phosphate
FT                   uridylyltransferase activity; GO_function: GO:0016779 -
FT                   nucleotidyltransferase activity; GO_process: GO:0008152 -
FT                   metabolism; GO_process: GO:0009225 - nucleotide-sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46562"
FT                   /protein_id="ABO46562.1"
FT                   /translation="MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAI
FT                   EAGCKEIIFVTSSNKKSLEDHFDRNFELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQ
FT                   PEALGLGHAVLCAKPLVGIEDFAVILPDDLIYNHDCGTGTLKQMVKAVEGTDIRGCIAT
FT                   QQVKREKTNSYGIVAKDNDNLIKAIVEKPAPEKAPSTNAVVGRYLLPNKIFRCLESTSE
FT                   GAGGEIQLTDAIAKLLDQDEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKFK
FT                   EYLQNR"
FT   gene            650759..652098
FT                   /locus_tag="FTW_0668"
FT                   /note="acetyl-coenzyme A synthetase"
FT   misc_feature    650759..652098
FT                   /locus_tag="FTW_0668"
FT                   /note="contains frameshift"
FT   gene            652110..653027
FT                   /locus_tag="FTW_0670"
FT   CDS_pept        652110..653027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0670"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46563"
FT                   /protein_id="ABO46563.1"
FT                   /translation="MNSSLTKGYAKIVLALVFWASLYHIAPLPLSYVDIYLVGFIRYAF
FT                   ASLIFIVVHYYFTKTFFPRLNLKQWAYVIAVGFFGVFLYNITFLWAEKLISGNIVAIIY
FT                   AFTPCLITILSSYIFNLKVNQQAKIGILVALLGTIGVVMFSNGAAECLNGVQINLGEVL
FT                   SVLAVVCFAAYAILGKCCVREGVHMITINTYGAIVGMILFAIISLFKADFSQLAYTDFK
FT                   FWGSMFYIAAFATVVAYVWYLGALEEIGVYKTAVFQNTLPFLVIFIGFLFYGETISTLS
FT                   LLFGGVVFLGVYLTNAAVNRKSGN"
FT   gene            complement(653030..653236)
FT                   /locus_tag="FTW_0671"
FT   CDS_pept        complement(653030..653236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0671"
FT                   /product="hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46564"
FT                   /protein_id="ABO46564.1"
FT                   /translation="MLKKIIILSNITIILTGCADSYEKNLWNNYHRKTSTSSELHSKLV
FT                   KVHNRDSLGFTYSPYQADFRNRL"
FT   gene            complement(653321..653614)
FT                   /locus_tag="FTW_0672"
FT   CDS_pept        complement(653321..653614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46565"
FT                   /protein_id="ABO46565.1"
FT                   /translation="MKKLIIMTLTILPTLVAADKVCDGNTYEINACLKSQMQIYDTKLN
FT                   DVQNHDIKNFKKYRDNICYDISSTYKGGTYQAIKYGNCVISLDKWYLQQLKP"
FT   gene            complement(653636..654685)
FT                   /locus_tag="FTW_0673"
FT   CDS_pept        complement(653636..654685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0673"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="GO_function: GO:0003697 - single-stranded DNA
FT                   binding; GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0006310 - DNA recombination; GO_process: GO:0006281 -
FT                   DNA repair; GO_process: GO:0006260 - DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46566"
FT                   /db_xref="GOA:A4IXB4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXB4"
FT                   /protein_id="ABO46566.1"
FT                   /translation="MYISNLRLQNFRNIPAKSFDFKNSINFIVGKNGSGKTSILESIYF
FT                   LSHSRSFRSSQLNRIINHNADEFIIYTKAYNPDEITISLSRKKNSNNISKLNLEIQKNH
FT                   TEITRNLPIQLINPESFNIINSGAQQRCKVLDWGAFYLDKTFLKIWQQTKFLVKQRNSA
FT                   LKQNYPYSYILSIDKKLCEFAEILDYKRQAYFTKLKPKIYEILSHFNPNLQLDIDYFRG
FT                   WNLHKSLAQVLEESFNYDNKYKVTNHGPHKADIVLSVSHKPIQDIFSRGQQKLLICALK
FT                   LAQGEIHNSENDNKCIYLIDDITSELDSIHTLTLFNYLKQLKSQVFITTTEKNKINEFI
FT                   DTNSYILEI"
FT   gene            complement(654689..655435)
FT                   /locus_tag="FTW_0674"
FT   CDS_pept        complement(654689..655435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0674"
FT                   /product="tatD family hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46567"
FT                   /protein_id="ABO46567.1"
FT                   /translation="MFIDTHCHLDFDIFDKTRQNILQNCNKLGVNYFINPATQRNNWDK
FT                   LIQINREFSKIVICFGLHPIFIDKHIHTDLKDLELYSQKHPTKLIGEIGLDKRFKNFNK
FT                   QLEFFSAQINIAKNLDKQVIIHAVKSHNEVIKVIKDLKFQNGGIIHAFNANYDIAQKYI
FT                   DLGFKLGIGAIISQPQAKLKQALAKIKPENIVLETDSPDMLLYNSTDNINTPENIPKIF
FT                   ELLSNIYQLNPDILKQQIYNTSLEFI"
FT   gene            655628..657712
FT                   /gene="glyS"
FT                   /locus_tag="FTW_0675"
FT   CDS_pept        655628..657712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="FTW_0675"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="GO_component: GO:0009345 - glycine-tRNA ligase
FT                   complex; GO_function: GO:0004820 - glycine-tRNA ligase
FT                   activity; GO_process: GO:0006426 - glycyl-tRNA
FT                   aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46568"
FT                   /protein_id="ABO46568.1"
FT                   /translation="MSKITKDFLFELGTEELPPKALRNLAQSLLVSVESQLKEAEVSFG
FT                   DTKWFASPRRLSFIIKGLAESQQDVVIEKQGPLVSIAYKEGEPTQVGLGFAKSCGVELD
FT                   ELERVATPKGDKLFYKTVQSGQATVNLLQEIITKALKQLPISKMMRWGSSSVEFVRPVH
FT                   WVLALYGNDVVDIEILGHKAANITYGHRFHHPQAIVIDNISDYIKLLADAMVIVDWQQS
FT                   KQMLVEQAENIAKENDYQVVLDDDLVEEVCAIVEYPNAMLCSFNKDFLRVPQEALISAM
FT                   EEHQKCFALLDNQGDLVANFITISNIQSKKPELVTSGNQKVMNARLADAAFFYDTDLKT
FT                   SLEQLLPKLEHVTFQSKLGNMYQKAQRIANIAQQLAELGNFDSQQAHRAGLLAKADLIS
FT                   NMVFEFTDLQGIIGKYYAKAHGETDTVAEAIEQQYWPKYSGAELPRTNVAACVALAEKL
FT                   DTLVGIFAIGQKPTGNKDPFALRRSAIGILRILRDTSVDISLEKIIDITLESYKKINNL
FT                   EFNTDVKTEVISFCLDRLKNLYKEEGIAVDIFEAINNTNYDSIKDFAARVEAVTKFYNS
FT                   DKAQSLIASNKRVANILSKNATDKDYYYNIELAKAAANEYELALAYSIEEVAADLHKYL
FT                   NNREYSYALELLTCLDKVISKFFENVMVIDEDIKIRENRLALLVNLHKMFIGIADISKL
FT                   "
FT   gene            657852..658732
FT                   /locus_tag="FTW_0676"
FT   CDS_pept        join(657852..658181,658181..658732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0676"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46569"
FT                   /protein_id="ABO46569.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPNIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            complement(658928..659923)
FT                   /locus_tag="FTW_0678"
FT   CDS_pept        complement(658928..659923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46570"
FT                   /protein_id="ABO46570.1"
FT                   /translation="MYLNKVHYIWMGSLIPDKYINNIFYLLSQSDHYINIWTDRPEETR
FT                   LKFLDKIGGYSHLQINKITNRLEFKQIFELENWCQINLSNYLTLIQMKTLLETFMFEYP
FT                   NYSDRYNKYSLEVLYKLGNLATLSDILRLVILYKEGGIYIDCDNTFKGQHIKYNIKYSK
FT                   NPNQYNICANCKFSLYSFHNIAGNSVLVANSGAQGCVEILKLSLDTIYKQQTGRELIDN
FT                   IEKMKRILFTEKSYLKNVFDYFMSNSYIEKDKDLRRHGKDPNGYKLQILKDYGGVNQSM
FT                   YHCGYPYAYLAMQIGPEVLKEFERNKAFSKRITEISIFHTITINSDQAWL"
FT   gene            660312..660698
FT                   /locus_tag="FTW_0679"
FT                   /note="transposase ISFtu2"
FT   misc_feature    660312..660698
FT                   /locus_tag="FTW_0679"
FT                   /note="ISFtu2 fragment resulting from frameshift and
FT                   premature stop"
FT   gene            complement(660831..661711)
FT                   /locus_tag="FTW_0680"
FT   CDS_pept        complement(join(660831..661382,661382..661711))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0680"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46571"
FT                   /protein_id="ABO46571.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPNIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            661790..662366
FT                   /locus_tag="FTW_0683"
FT                   /note="tryptophan repressor binding protein"
FT   misc_feature    661790..662366
FT                   /locus_tag="FTW_0683"
FT                   /note="contains frameshift"
FT   gene            complement(662465..662887)
FT                   /locus_tag="FTW_0684"
FT   CDS_pept        complement(662465..662887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0684"
FT                   /product="hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46572"
FT                   /protein_id="ABO46572.1"
FT                   /translation="MKNLLLLLALVSMLTSCAYIEGYNKPQEELYINITSPHTKDINFN
FT                   EKGELPKDIKDQNYYDVEVSGSALQNCDAIDYGDVKIKRSGMNKIFIGNARDWDIVRID
FT                   CRQGIGNGKTGEKHDLEIKVFSDEKTYHTKTQVEHQ"
FT   gene            complement(662991..663740)
FT                   /gene="nadE"
FT                   /locus_tag="FTW_0685"
FT   CDS_pept        complement(662991..663740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="FTW_0685"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0008795 - NAD+ synthase activity; GO_process: GO:0009435
FT                   - NAD biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46573"
FT                   /protein_id="ABO46573.1"
FT                   /translation="MKIVKDFSPKEYSQKLVNWLSDSCMNYPAEGFVIGLSGGIDSAVA
FT                   ASLAVKTGLPTTALILPSDNNQHQDMQDALELIEMLNIEHYTISIQLAYEAFLASTQSF
FT                   TNLQNNRQLVIKGNAQARLRMMYLYAYAQQYNRIVIGTDNACEWYMGYFTKFGDGAADI
FT                   LPLVNLKKSQVFELGKYLDVPKNILDKAPSAGLWQGQTDEDEMGVTYQEIDDFLDGKQV
FT                   SAKALEIINFWHNRSHHKRKLALTPNF"
FT   gene            complement(663851..665323)
FT                   /locus_tag="FTW_0686"
FT   CDS_pept        complement(663851..665323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0686"
FT                   /product="outer membrane efflux protein"
FT                   /note="GO_component: GO:0009279 - outer membrane (sensu
FT                   Proteobacteria); GO_function: GO:0015288 - porin activity;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46574"
FT                   /protein_id="ABO46574.1"
FT                   /translation="MIRNKILPLALISATLITSSCSFFSPEYERPKIKAPALWNNQDKN
FT                   IEVTKNWDLTKVAWWREFNDPVLNNLITTALKDNNKLQVSIGNILQANAEINKANYGWL
FT                   PTASVGGGGFVAQAFDVNSNSNIPQLNNIGTQTTAGSLVGIIPSYTINIARQFKLGEIS
FT                   RLSKKMQTNLKDTTRLSIISQVSAAYFSLITAKEQLKLQTLMVNQLNLMFKYAQNQHKL
FT                   GATSPMLEEVIRQQLEVQKGKIAMIKNDIVHFQNTLKILMGRNPGKIVTSRTLNEINAN
FT                   IKVPINMPSQVLENRPDIGIAEYKLETANANIGLARSQFFPSIDLTGTFGNATLALGEL
FT                   ATMNAWAWAAEAVAAVPVFNLSILADSDKAKAQFYQAYYDYINTLQQAFQDVDDSLSER
FT                   AANAKNLKKQTISLESTQRQEKIFFKKYSSGAISKAQYTGITLNVLYQQMQVNQAKLKS
FT                   LISVVNLYQALGSGYNVDNYVDPHYDNPAFDK"
FT   gene            complement(665333..666355)
FT                   /locus_tag="FTW_0687"
FT   CDS_pept        complement(665333..666355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0687"
FT                   /product="efflux pump protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46575"
FT                   /protein_id="ABO46575.1"
FT                   /translation="MSEEKLQQSTITRNKKSSRFSPKKIIIGSSIITITALGIYGYYKY
FT                   NKIFPSTDNAYVNADIISISPKVGGYIEKVYIHNNQFVHKDDKLVQIDPKDYQLKVAQA
FT                   NSKIIQTKGQLAIAQEQVNVAKSNLTKAQSSLDTATSMADRYIKLYKDDAGSLQDAQKY
FT                   INQKIQAQKAKDEAYSSLKQALLQVEIAKAQIGAAKLSYDNANLNLGYTTLIAPDDGYV
FT                   SNLKLYKGQLVSPGQALFGFIDNKKWWIDANFKETDLDRIKPGQKVEIELDMYSHSYAG
FT                   KVDSISYATGSVFSLLPPENATGNWVKVTQRFPVKIILKNDPKYPLRVGASATVKVDTL
FT                   "
FT   gene            complement(666377..667906)
FT                   /locus_tag="FTW_0688"
FT   CDS_pept        complement(666377..667906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0688"
FT                   /product="drug:H+ antiporter-1 (DHA2) family"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0015307 - drug:hydrogen
FT                   antiporter activity; GO_function: GO:0005215 - transporter
FT                   activity; GO_process: GO:0006810 - transport; GO_process:
FT                   GO:0006855 - multidrug transport; GO_process: GO:0042493 -
FT                   response to drug"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46576"
FT                   /protein_id="ABO46576.1"
FT                   /translation="MQASNTITVGFWSQKRTIVALAISLLALAEIVDLTIVAVAIPQIM
FT                   GAIGANVETIADVTTVYIVTAAIFILLSGLIIEKYGIKRVALVSSVIFGISSIMCGLST
FT                   SLAEMIVFRAFQGMGGAFLPSVAQTYISTSFKNEEYNKMMTIYSMVIVMGPIIGPVLGG
FT                   AICENMSWEWIFYVNVPLCIVAFIIIAFMMEATQIKKIKIDYISFGFMAIGVGCLELFI
FT                   DNGNTNGWFSSIKMIILLAISLVSIGFFIWRGLIYSSVVKFKIFKNFNFVLACFLCFMF
FT                   VLLFSAAMAYLPTMLQQVYGYPVDLAGYITAPRGVAAIIGAMLTQSILVKKLGVRKTIS
FT                   LGMITFGVSCLMQANFSPTANEFDIILTTAIQGLGMMMFFVPFMSVLVVGVADEDMGDM
FT                   SGSFNFFRNFGSSVGTAFVATFISRNQQTTYLELSQNISSLNNNFQSWSHSLPMPDLAT
FT                   VALAKQQVLHQSSLLSYINSFYVVGILSLILAIVPFLLKEPPTGAPVAVMH"
FT   gene            668050..668898
FT                   /locus_tag="FTW_0689"
FT   CDS_pept        668050..668898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0689"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46577"
FT                   /protein_id="ABO46577.1"
FT                   /translation="MVKKGQSMIREEITYLSDWLDGPEIIAIKGGNAPTSENKINNQES
FT                   DWHHHRRGKIFCIESGLVHVSTPNGSWVLPSNRAGWIPPNTSHKIRISGIVEGWVIFIH
FT                   PNMCDDLPKSSRVIPMSEVLRALALRATEWDKYNNLSLEQEHIAKIICNEIRLAPEEAL
FT                   HLPMPKTDRVIKVANAIIDNPSISKSLEQWAAFAAMSPRTLRRAFLSETGLSFSRWRQQ
FT                   AQLARGLDMLAKDISVTEVSDSLGYASPSNFIAMFRKAFGKTPKQYFSSERVQIKNIYK
FT                   N"
FT   gene            complement(668886..670577)
FT                   /locus_tag="FTW_0690"
FT   CDS_pept        complement(668886..670577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0690"
FT                   /product="amino acid adenylase"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46578"
FT                   /protein_id="ABO46578.1"
FT                   /translation="MSTFSNKTWIANYPDYTPENITENHATILDLYEKTIIQFPYREAV
FT                   SCHDVNLTFIELDKLATKMASFLQNNLGINKGDRVAIVLPNCLQFTVSLFACVKIGAVF
FT                   VNTNPLYTADEIEAIFNNCNVKAAIVMDMFAHHIQKARVNIDSLENVIVTNIADLYPFP
FT                   KKQIIGFVSKYLIENKPKYTKSNFIAFSKVIKADISLYKKPVLTKQDILCLQYSSGTTG
FT                   RPKGAILTHDNLASNIQQVWAWIKHDMDMSDQVIITALPLYHIFSLSANLLCFFFAGAK
FT                   NVLIPNARDIKNLIKTMSKNEFTIFNGLNTLYMAMLEHPDFEKINKTRYLYSLSGGMPI
FT                   SRKIYLEWLDRTGVELKEGYGMTEMSPAIALNKFNESEDDYFGTCGYPIPSTELSIRDI
FT                   HTHQEITECFKEGEIWLKGPQRCQGFWNDKENNELHFTADGWLKTGDIGYIDKKGRLTI
FT                   SDRIKNMIIVSGFNVYPREIELCILKLDYVREVAVTGIKSKTSGERPIAFISLEKDSNA
FT                   TEEDIIKHCKDKLASYKVPRSCIFVETLPKNNTSKIDIKKLKNQFL"
FT   gene            complement(670685..672172)
FT                   /locus_tag="FTW_0691"
FT   CDS_pept        complement(670685..672172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0691"
FT                   /product="amino acid/peptide transporter (Peptide:H+
FT                   symporter)"
FT                   /note="GO_component: GO:0016020 - membrane; GO_component:
FT                   GO:0005887 - integral to plasma membrane; GO_function:
FT                   GO:0015333 - peptide:hydrogen symporter activity;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0015833 - peptide transport; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46579"
FT                   /protein_id="ABO46579.1"
FT                   /translation="MPMQKNYNTLSAPFWIVWGIELWERFGFYGFQAIIALYFTQKLGL
FT                   SERETIYLMGSFFAFTYGFIWVGGLIGDKVLGAKRTILFGAVILCLSYLSFIFADKQNV
FT                   YYIFSGIIIGNAIFKANPSSLISKMFDKGDGRLNSAMTLYYLAINMGGLICMALTPVIS
FT                   QIYGYTHAFILCGIGLFVGILGFILFYKKLEGLDTEAGKHPINKTHLTYIIAGVIAAFL
FT                   IVANILPNTTLCIELTAVVVTIATLYFLYVAFSLESYERNRMLVALVLIIEAIIFYSLY
FT                   FQMPTTLTFFAQHNVELSVFGWHVPAAQYQFLNPLWILILSPILAAVYKKSKLTHATKF
FT                   CIGTALMFISYATLYSTRYFATNAVVSGNWLILSYATSSLGELLISGLGLAMVAELCPA
FT                   FISGFVMGFWFLATMIASYVASYIGSFIALPQSGDTISKQQSLDTYTAVFGYVAIGILV
FT                   TTIIMVILTPILNKYINRIRVIDDHKADIDNITYPQN"
FT   gene            complement(672402..673130)
FT                   /locus_tag="FTW_0692"
FT   CDS_pept        complement(672402..673130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46580"
FT                   /protein_id="ABO46580.1"
FT                   /translation="MRTIRGFFSDISTKTTIFNISGEYYNYFKNVLRLKKSDLIELFNN
FT                   TDSLQYKTKIITIDNKNITLEVIDKKHISNENNYITNLYQAIIKSENFELVIQKATELG
FT                   VNNIYPIITEFTNHKFDKNGFDKKLERWHKIAIAGSEQCGRVFIPKIHTPIDINDLQMP
FT                   QNDLNLVLCPYTQAKQDFVQKVKSSTNFNIFIGPEGGFSDKEMSKFHSNNFYTINLGKR
FT                   ILKAETAPINILSIINFLKQ"
FT   gene            673201..673887
FT                   /locus_tag="FTW_0693"
FT   CDS_pept        673201..673887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0693"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46581"
FT                   /protein_id="ABO46581.1"
FT                   /translation="MGIFNKSFVTNLVAAILAIIGWYFAEVHIKNIGFYALSGALTNWI
FT                   AIYMLFEKIPFLYGSGIIPNKFESFKRAIKKMIMEQFFSPQNINNFLKSDDIKRYLADN
FT                   IAAKIDYNKIFDSFIDMLMSSKYGSMIDMFLGGRSALEGLREPFTKKLDSKVIELLSSI
FT                   DINTNNVSQKAAEKIERLIDSRLDELTPQMVKEIIQKIIREHLGWLVVWGGVFGGLIGL
FT                   AASFIS"
FT   gene            complement(673877..674575)
FT                   /locus_tag="FTW_0694"
FT   CDS_pept        complement(673877..674575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0694"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46582"
FT                   /protein_id="ABO46582.1"
FT                   /translation="MKKYLLLTILFLPLQLFAFSFFGDPVKVPEQKEYVIYSKQIESKP
FT                   LPDTENADISTTLLVYNIQTQASTSTQMFYLKGNRLYTFKNSSWAMPVSKMLTVATFEY
FT                   ILDHNIVNNLAFQDINIRQDFTLSGTTTYGPILDLDNKQFYFYITFYLKNEKTGFTKIT
FT                   TIKYHQKIPDDNIDANLYAEMTNTALTNIFSQLKPWLIENLKIQKHRNKEIQANHKNTQ
FT                   NFFKPLLAKK"
FT   gene            complement(674580..675305)
FT                   /locus_tag="FTW_0695"
FT   CDS_pept        complement(674580..675305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0695"
FT                   /product="mammalian cell entry (mce) related protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46583"
FT                   /protein_id="ABO46583.1"
FT                   /translation="MNENSIKNLIAGLFVIFMVFVMIFIGFFLSGGFKDQHTTTFVTNF
FT                   KSISGLNVGSDVSYKGFSIGKVSDISINKNNPKLVSVYMKINSQIPIYKQTVATLQSMG
FT                   ITGQSKVELSLDIDAKNTSLDLIHIKKGQIPEITSKPSQLESIMNKVSAIASSLEEISG
FT                   KFNKMMSPENLDRFNQFTDSVNILLYNLSNSSIYFNKTLMNLNETMTESQETITRLNNV
FT                   IRILEYDPSTIVRGVDHKE"
FT   gene            complement(675315..676076)
FT                   /locus_tag="FTW_0696"
FT   CDS_pept        complement(675315..676076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0696"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="GO_component: GO:0009898 - internal side of plasma
FT                   membrane; GO_component: GO:0043192 - ATP-binding cassette
FT                   (ABC) transporter complex (sensu Bacteria and Archaea);
FT                   GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46584"
FT                   /protein_id="ABO46584.1"
FT                   /translation="MSESLIQVRDLSTKFGKEWIHKDLNLDIPFEKISCIIGASGCGKT
FT                   TLMREILMLQPIYSGKIFLLGQEISKLADNPIKRKAISSKMSMMFQHCALFSSLTNLQN
FT                   VIFPLRQHTKLPIDILTDIAIIKLKMVGLKEEAFNKYPSEISGGMLKRVALARTIALDP
FT                   KVVFLDEPNAGLDPYSARAMDDLILYLKEELKMSVVMITHDLSTIWHIVDDIIYMDEKR
FT                   IMLHDSVEFVSQQTQYESIRKFFDSHNDGKY"
FT   gene            complement(676091..677191)
FT                   /locus_tag="FTW_0697"
FT   CDS_pept        complement(676091..677191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0697"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46585"
FT                   /protein_id="ABO46585.1"
FT                   /translation="MEINIDQNTVYFAGLLTLKQINPKLVEKKVSRSKVKLNRIDITKI
FT                   QALDTAGAYFILKVLKDLELTKEDLVFDNHKDKNLIELVANNFPTRVDKENSHKSNIVF
FT                   TSIYTLGKNTNNLLQEIKASIGFLGAILLGYLTLIRKPYRSFFSIVLNIAYDSTIKALS
FT                   IVMLLSLIIGLVLTYLPLNLMMQYGTQIFVVDMLGISSFREFAPLFTAIIIAGRSSSAF
FT                   TSEIGIMKVNEEIDALQTIGEDPIQRLVLPRITALIISLPVLTVIAMIANIISGIIIAD
FT                   VIAGITPLQFIERLFSNVNVNHFYIGLLKTPFFALVIAGIGCHQGLAVRRDSQSVGKAT
FT                   TTSVVYSIFLIIVVDAIFAVALNGVA"
FT   gene            complement(677266..678078)
FT                   /locus_tag="FTW_0698"
FT   CDS_pept        complement(677266..678078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0698"
FT                   /product="putative mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46586"
FT                   /protein_id="ABO46586.1"
FT                   /translation="MTITSMTNNRSLLKYFFVLLILFISAAILSTNEGTRHTKSNYFLE
FT                   SRTPKITKKPDFSEIKNFKERKDDFIKYMLAAIKIANKEICLQQQQIQKLKNALDKKGS
FT                   LNSQQDKKLSAYLEYYKIKTNHSPAEELDYLSIKAGMIPTSFVLAQAALESGWGTSRFA
FT                   KDYNNYFGLHCFYTGCGVKAQASDTYLEIFNNAAESVLGYYHRLNTGSKFVDFRITRDK
FT                   IINQQLPPKTLLDTLENYSELDGSEYKDRLISVIQHNNLRQYDSIKYC"
FT   gene            complement(678056..679009)
FT                   /locus_tag="FTW_0699"
FT   CDS_pept        complement(678056..679009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0699"
FT                   /product="pseudouridine synthase, RluA family protein"
FT                   /EC_number="5.4.99.-"
FT                   /note="GO_function: GO:0009982 - pseudouridine synthase
FT                   activity; GO_process: GO:0009451 - RNA modification;
FT                   GO_process: GO:0001522 - pseudouridine synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46587"
FT                   /protein_id="ABO46587.1"
FT                   /translation="MHPKDAGKRIDVAINEQFEQFSRAQIQKWLKEGSITVNGRATKPK
FT                   HIVLGDEEVEINIELLPTNEWIAEDINLKIIFEDDDIIVIDKPVNMIVHPGAGNPTGTV
FT                   SNTLLHRYKDQDKLPRAGIVHRLDKDTSGLMVAAKSSIAYHNLVQQLAERKVSRKYLAI
FT                   VEGEIYKQGTINQPIGRDPTNRTKMAINYRGKEAITHYTPIEVYDGFTLIECQLETGRT
FT                   HQIRVHMKSIKHPLVGDQTYNKSSTKLEKLAITIPTRQALHAYKLSFIHPTTAKMVKFK
FT                   SKLPEDMLNLKAQLEQTVEMLDEDFEEDYYDYYEYD"
FT   gene            679143..679967
FT                   /locus_tag="FTW_0700"
FT   CDS_pept        679143..679967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0700"
FT                   /product="hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46588"
FT                   /protein_id="ABO46588.1"
FT                   /translation="MKRFLYLIIITFMLLLLSSCGPKKDSELPQVYTGYTASFIYAKAH
FT                   EQMQNQKYFDAIRSYKSLVAQYPFTPLAEKGMVDLIYVYYMDDESTMALALGQQFIKMH
FT                   PYSIYKGYVYYMIGVVGFEDGRGMLQTYAPYDMNYHDPTGYQDAYTNFEKAIQLDPTGS
FT                   FVPDAKRRMIFINNIIARHYDDIAHFYFKRGAYNAAIDRASQVIRNYPQSTSTEDALVL
FT                   TIRAYNKLGLYDQAKANIRVLKKNYPKNKFIKNLRPDGTEEPSWYQRWFGWL"
FT   gene            680105..681898
FT                   /locus_tag="FTW_0701"
FT                   /note="FAD binding family protein"
FT   misc_feature    680105..681898
FT                   /locus_tag="FTW_0701"
FT                   /note="disruption due to premature stop"
FT   gene            complement(683322..684575)
FT                   /gene="glyA"
FT                   /locus_tag="FTW_0703"
FT   CDS_pept        complement(683322..684575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="FTW_0703"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="GO_function: GO:0004372 - glycine
FT                   hydroxymethyltransferase activity; GO_process: GO:0006563 -
FT                   L-serine metabolism; GO_process: GO:0006730 - one-carbon
FT                   compound metabolism; GO_process: GO:0015947 - methane
FT                   metabolism; GO_process: GO:0006760 - folic acid and
FT                   derivative metabolism; GO_process: GO:0006566 - threonine
FT                   metabolism; GO_process: GO:0006544 - glycine metabolism;
FT                   GO_process: GO:0006553 - lysine metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46589"
FT                   /db_xref="GOA:A4IXD7"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXD7"
FT                   /protein_id="ABO46589.1"
FT                   /translation="MFSFEKNSLKNTDKEIFDAIELEVKRQHEHVELIASENYASPAVM
FT                   EAQGSQLTNKYAEGYHGKRYYGGCEFVDIAEKLAIERAQQLFGVDYANVQPHSGSQANA
FT                   AVYNAVLKPGDTVLGMDLGAGGHLTHGSKVNFSGKIYNSIQYGLDENGDIDYKQVAQLA
FT                   KEHKPKMIIAGFSAFSGIINWQKFREIADSVDAVLMADIAHVAGLVAAGVYPNPFPYVY
FT                   VATTTTHKTLRGPRGGLILCNNNPELAKKFQSAIFPGIQGGPLMHVIAAKAVAFKEALE
FT                   PSFVDYQKQVLKNAKAMEKVLKQRGINIISGGTSNHLLLLDITNTGFSGKEAEAALGRA
FT                   NITVNKNSIPNDPRSPFVTSGLRIGSPAITTRGFKEKECELVANLLADVVFNCGDEKVE
FT                   NETAAKVLDLCDKFPVYK"
FT   gene            684679..685227
FT                   /locus_tag="FTW_0704"
FT   CDS_pept        684679..685227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0704"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46590"
FT                   /protein_id="ABO46590.1"
FT                   /translation="MGKVIDLDEIDRLEREEENSYYKTVKSKTSVKKDALEITDFGRSL
FT                   TELSKEQLEKIPIDDNLKNNIITAKSLHKIALKRQTQFIGKLLRKTDNLDEIYKAYDVL
FT                   VNKDKQANLMFQRLENIRNNLLDPLKMNNTLDKLIQEFPDLDIQKLRQLIRNHHKEVEK
FT                   NTTNKSFREIFKLLRGLYV"
FT   gene            complement(685242..686513)
FT                   /locus_tag="FTW_0705"
FT   CDS_pept        complement(685242..686513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46591"
FT                   /protein_id="ABO46591.1"
FT                   /translation="MKVTFGRTIFILLIFLFFLYLNIFQPMSGDDLLRFNMDSLYNKSI
FT                   LNQLRLDYNSLTGRISAQILVHVFLNKSYPFLLYIFNLINSLIMTLFIIILYKIISIDK
FT                   GEIFSKKFIVFFSIFMILFGLNNSISQILSKTIALQYFLGIALLIYFYYKCFTKNKFAP
FT                   ILSFITGLVIGLYNEAIFLVCFSIIFSYIIYQLIQHQRINKNIYFFLVPFILGGIVMFS
FT                   APGSYHITETRLHDSPFELLIKNFWKYIFMIFTEFELSPLFILAVLTVIKFENSKPKKI
FT                   ITILCLFLVWLTIYPICFQFTRRVALIYMFFYFSIISYYIYNYSSKINGILTKNYKIFC
FT                   FGGLIIVGLFLYIFGKYHYYQIARLHKIQYYRNLGQQNISLEPIKFTGIQLIKVEDIHE
FT                   DPNEYANTVFAKAYGFNKVTVSKS"
FT   gene            686721..688052
FT                   /locus_tag="FTW_0706"
FT   CDS_pept        686721..688052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0706"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46592"
FT                   /protein_id="ABO46592.1"
FT                   /translation="MKQDIFPKVVLLAAIAIFISIFLFARVIISISFIIVILLCFFNKD
FT                   VLTILKQNISLKFLLFAAFLINLGFGYAAFFRNDQIIHQFFGFSNPLLIVLYILSASYF
FT                   LSKNKKYPDYLLNIFVYIVVFISFIALFRFSYKYLMGDYFIISDFYTEIDGGSTIQSIV
FT                   ALTFPFAAVFIVGKAIHKQSKLLKLVMIFVGILIVFIDLFVNRSKAGYIIEFVVLIYYF
FT                   FVIIKHYSLNDEKELNILKFFSTILICIISLSAILFTVYKTSNIFHDRVNEAIKESQLY
FT                   FSKDFDNKTAEELALTSTGLRLMYYDSAIKVFEKYPKLLLLGCSPVTNISDVAECTSFL
FT                   INKNDVLKNDPHITKEGIMPHNEFINYTFKGGILAGLSLLIFFIMLLYEARGLDYRDKV
FT                   YFRVLIIAMFIGCLFDYFFTVQILVILFSTLLAIFFAKLKIKQG"
FT   gene            complement(688078..688968)
FT                   /locus_tag="FTW_0707"
FT   CDS_pept        complement(688078..688968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0707"
FT                   /product="glycosyl transferase, family 8"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46593"
FT                   /protein_id="ABO46593.1"
FT                   /translation="MNKIPIVFTFDKNIILGGAVTIKSLIDHANPDTCYDIYVYHPNIN
FT                   KKSISAFNSMIEKTKHSISFHNVDESIFKDVPIDTRRGWIITFYRLLIPKLLPQYDKVI
FT                   YSDVDVLFQSDMSEVYNTDLTSYEWAGVIAEKHQQNMVQHKYFKENNNSYIYWPGFMVM
FT                   NTKLMRENNFISRCFDTMHEFNTRLKFRDLDVLNLTCRKIKSLPFKYVTLQSIYYLNTI
FT                   QEAPEYIFLKEIYSDNELLDAKNNPAIIHYAGSPGKPWRMKRPYKNYLEYISKIPKELR
FT                   KYTFRDIKKKLLSKY"
FT   gene            complement(688976..690064)
FT                   /locus_tag="FTW_0708"
FT   CDS_pept        complement(688976..690064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0708"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46594"
FT                   /protein_id="ABO46594.1"
FT                   /translation="MLFFMIVLKKLKNLFCYKKPIIKENTFLIWEPCSHSHAEIVPGFT
FT                   KYLLDLGYHVSILMNPERYKEGLFRRFDNQNISYNKLSKRQIRKYFKRDSLEDIEGVLI
FT                   TTIGKLYDGKNLNQAYDSFHNQVDKRKLFFVEHEIDSYIDNNSNPREDIITLRAMDYKN
FT                   AITVPINPHYFGKIKLNDKNQFTKFITIGALSKKRKSTKLLINAAKELLDKGVTNFKIT
FT                   VIGKGNIKDLPSQLQGFFDIKGRLDFDQMYDEIENANFILSAYEDNPEHRKYITSKTSG
FT                   TFQLVYGFLKPIIIREDFAPINGFNSNNAILYSQDSQYSNAMIKAINMSAGEYKQIQQN
FT                   LKDYTNQLYLNSKINLQRLIKG"
FT   gene            690234..691298
FT                   /locus_tag="FTW_0709"
FT   CDS_pept        690234..691298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0709"
FT                   /product="glycosyl transferase, group 1 family"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46595"
FT                   /protein_id="ABO46595.1"
FT                   /translation="METKNIKDVDVIALSLGRRFSGINASMLAVIPEQNKLVDIVAMGF
FT                   NIDSKEIRKIRFRDFLFGCWRDKWRIWHARRNIDMLIGIILKYLFRYKIILVFTSVAQR
FT                   HHKKLTKFYINRMEAVICPSEISAKYLEKKSYIVPHGVDTQVFYPAENRQQQWQDKKIP
FT                   GKYGIGIFGRIRKTKGTQEFIEAAIVTLKKYPDWTAVVIGEATPRDLDFKKELEQKVKQ
FT                   AGLDKQIIFIGFIADSNEIPSWYRALDIVVCASHKEGFGLPALEAMASKCAVIATKAGA
FT                   WPEIIVDDENGYLVEPKSSQQIADKLDMLISDSKLRYKIAQNGYDLVTTKYKIQNEAEG
FT                   IQQVYDRLLAKKRS"
FT   gene            complement(691299..692396)
FT                   /locus_tag="FTW_0710"
FT   CDS_pept        complement(691299..692396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0710"
FT                   /product="choloylglycine hydrolase family protein"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46596"
FT                   /protein_id="ABO46596.1"
FT                   /translation="MLISQSLACTALTLVKNGQTVSGRTMEWGFNWSWQLIYIPKGTKH
FT                   YLSAPSNLNLAKISYASKYSIIATGLVNANQEFLVDGQNDQGLSISANYMPGFAEYQKV
FT                   TNTDKKYASINQISILILSEYANVEQVKQALQQYKVWSDKSTMINGVAPQLHFLITDRN
FT                   GKGLVVEYIKGEVKLYDVNSNVKVMTNAPTYDWHLINLRNYLNLSNQTTTRVKISDAID
FT                   PSQNKDIQDINSLGQGNGFLGLPGDYSPPSRFIKTAILGYYANNKGDNNENLVTKVTHI
FT                   LNNVDITKGTVTEKLGNQTMFDHTAFTVIKDLNNNKLYIKSYNSPNNAMEIDLNTLDQN
FT                   NSKQFAIDIDKLPYPNNNISANLIT"
FT   gene            692643..693846
FT                   /locus_tag="FTW_0711"
FT                   /note="proton-dependent oligopeptide transport (POT) family
FT                   protein"
FT   misc_feature    692643..693846
FT                   /locus_tag="FTW_0711"
FT                   /note="contains frameshift and deletion"
FT   gene            complement(693824..694704)
FT                   /locus_tag="FTW_0713"
FT   CDS_pept        complement(join(693824..694375,694375..694704))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0713"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46597"
FT                   /protein_id="ABO46597.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            complement(694833..696029)
FT                   /locus_tag="FTW_0715"
FT   CDS_pept        complement(694833..696029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0715"
FT                   /product="tRNA(Ile)-lysidine synthase"
FT                   /EC_number="6.3.4.-"
FT                   /note="GO_function: GO:0016879 - ligase activity, forming
FT                   carbon-nitrogen bonds; GO_process: GO:0006400 - tRNA
FT                   modification"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46598"
FT                   /db_xref="GOA:A4IXE6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXE6"
FT                   /protein_id="ABO46598.1"
FT                   /translation="MSISKSLVLNEIKKFSPSHIIIGYSGGVDSSVLLNISKELDIPLI
FT                   AIYINHNLHRDSLKWQIHCQQTCQKYNLQFISHSLDKVPKGESFEAWASKQRMAFFQKI
FT                   MQQYSKPLLLLGHHQDDQAETFLIQAIRGSGLAGLAGIPHYKELHHGGVLRPLLKYSKI
FT                   EIEGFAKLNNISYIYDDSNEDIKYRRNLIRNQIIPILQQVNPNISQTLSRSANICAESN
FT                   NILQKLLTERLQSISQDTNLIISELIKLDDDIQKNLLHLWFKQNTQQSLKSKQIKELHL
FT                   AVNNPSTGWQIDISNYYQIHIQYNQLIIKYPTTINDISKEDIISWLSKNLNEEIDLTKI
FT                   VIRDRKPDDKCKYRGRNKPNKLKILFQELQIPTTERSKAKIILKDQQIIAVYPFFICG"
FT   gene            complement(696030..697265)
FT                   /locus_tag="FTW_0716"
FT   CDS_pept        complement(696030..697265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0716"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0004617 - phosphoglycerate dehydrogenase
FT                   activity; GO_function: GO:0051287 - NAD binding;
FT                   GO_process: GO:0008152 - metabolism; GO_process: GO:0006564
FT                   - L-serine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46599"
FT                   /protein_id="ABO46599.1"
FT                   /translation="MSQLSLNKKKIPILLLEGIHSNAVESFKAAGYENIELLNTALEGQ
FT                   ELIDKLKDFKIVGLRSRTQLTKEVLEQSDHLIAIGCFCIGTNQVDLKTAQSLGIPVFNA
FT                   PFSNTRSVAELVLAEAILLIRNVIDKNAKAHRGEWLKSADNANEVRGKTLGIVGYGHIG
FT                   MQLGVLAENIGLNVIFYDIEEKLPLGNACQVDSLATLLQQSDVVSLHVPQLPTTANMIS
FT                   TKEFALMKQNAVLINASRGNVIDIDALVDALTSSKLKGAAIDVFPKEPSSKGEIFESPL
FT                   TGLDNVFLTLHIGGSTIEAQENIATEVSAKLIKYSDNGSTLNAVNFPELSLPSHRETHR
FT                   ILHIHQNIPGIINELNRILASKNINVEGQYLRTLENIGYVVMDIKSSSDEAKELIDEFK
FT                   KVKATIKARYLV"
FT   gene            complement(697277..698101)
FT                   /gene="thyA"
FT                   /locus_tag="FTW_0717"
FT   CDS_pept        complement(697277..698101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="FTW_0717"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="GO_function: GO:0004799 - thymidylate synthase
FT                   activity; GO_process: GO:0009265 - 2'-deoxyribonucleotide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46600"
FT                   /db_xref="GOA:A4IXE8"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXE8"
FT                   /protein_id="ABO46600.1"
FT                   /translation="MREYLNFLKYIKENGVLKGDRTGTGTRSIFGYQMRFDLQKGFPLV
FT                   TTKKIHIPSVVHELLWFLSGSTNIKYLNDNNVRIWNEWATVDGELGPIYGKQWRDFNGQ
FT                   GIDQIADVIQMLKTNPNSRRILVSAWNPCVVPSEKISPQENVVKGNSALPPCHAMFQFY
FT                   VANNKLSCMLTQRSADAFLGVPFNIASYSLLTHMVAQQCNLDVGEFIWSGGDCHIYNNH
FT                   IEQVNEQLSREPLALPTLKILRKPNSIFDYKYEDFEFENYNHHPAIKAKISV"
FT   gene            complement(698086..698892)
FT                   /gene="lgt"
FT                   /locus_tag="FTW_0718"
FT   CDS_pept        complement(698086..698892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="FTW_0718"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="GO_function: GO:0008961 -
FT                   phosphatidylglycerol-prolipoprotein diacylglyceryl
FT                   transferase activity; GO_process: GO:0009249 -
FT                   protein-lipoylation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46601"
FT                   /db_xref="GOA:A4IXE9"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXE9"
FT                   /protein_id="ABO46601.1"
FT                   /translation="MLQYPHINPVALQLGPIKIHWYGLMYLLGIFAGWYLTRYRAKVKP
FT                   WAPIKPEQVGDLTFYVALGVILGGRIGYIIFYNLPYYFHNPSQMFFLWDGGMSFHGGFI
FT                   GVLIAFALFARKIGANFFDLGEFVAPVIPIGLGAGRIGNFINGELWGKVTDSPLGMVFP
FT                   TGGPLPRYPSQLFEFFFEGVVLFSVLWLVTIKKRPRYLVLGLFMFLYGCARFICEFFRQ
FT                   PDPQYGYIFFNWMTMGQILSIPMILLGAVILIAVFIKTRKNKCENI"
FT   gene            complement(698907..701564)
FT                   /locus_tag="FTW_0719"
FT   CDS_pept        complement(698907..701564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0719"
FT                   /product="ribonuclease, rne/rng family"
FT                   /EC_number="3.1.-.-"
FT                   /note="GO_function: GO:0003723 - RNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46602"
FT                   /protein_id="ABO46602.1"
FT                   /translation="MKRILINSKSGEETRIATLDNGKLIDLDIESVDREQKKANIYKGY
FT                   ISRIEPSLNAIFVNYGEEKNGFLPFKEVSEYYLKDVPNGENIAPLLSEGQELIVQIDKE
FT                   ERGDKGAALTTFITLAGSYMVLLPNNPEGGGISRRVEGEDRERLKKYLKELNIPKNMSV
FT                   IARTACVECSFEELKHDFDTLVELWGSISQAYHRIKKPALLHKESDIIVRTVRDHLKED
FT                   VKEIIVDSKECFEDVKRQLSLLRQSFDINKVKLYNEELPLFAQFGIDQQIENAYKREIR
FT                   LPSGGSIVIDTTEALVAIDVNSSRANKAEDVETTAFKTNLEAAEEVARQLRIRDLGGLV
FT                   IVDFIDMSFYPNRKQVEEKLMEALQQDRARIQMSRISKLGLVEISRQRLSSSINESVMQ
FT                   KCPRCEGHGFIKTTQATALTILRKIRAEAIKEDTNEIRVQVPVDIAAYILNEKRDSIVE
FT                   IERISQVKVMIIPNFNMESPKFQMQRIWGTSYKSNRTSSELIEDVYNIEIPKAGKKKIA
FT                   AVDLNQAIENQAASNTQEQKPQTDAQVDIVTQNDKKQDDVTQQAKKKGFFARLFSGIFA
FT                   TDSKAAQQANNSAQKQQNKEQNFQRQQQHNKAQKDNNQRNERNNSNNKNERNKNRNNKG
FT                   AKPQIAQENKPQKDNSQRSDLNANGNSNNDKNERNKNKSNNDKFDKKSNNRNSRSNNLN
FT                   LNNAEEVIDIMQLKYQNQTAIAKTDNIKKVISKNPDEFISVMVKDVLENYDSLKDDGAT
FT                   KIATQEKIKTNKYLKFDTVSVDTEIALLNEVAKSNQTVGVEQITAETEESLSIVDKVDD
FT                   ITIPEVVVEQEKPAKVVKETNQTSEAKPKKEKQTTTKNNKKEKPAEKEMKQNQAKPEYI
FT                   NYSPAIDFESQALI"
FT   gene            701814..702989
FT                   /locus_tag="FTW_0720"
FT   CDS_pept        701814..702989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0720"
FT                   /product="Aminotransferase, class V"
FT                   /EC_number="2.6.1.-"
FT                   /note="GO_function: GO:0008483 - transaminase activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46603"
FT                   /protein_id="ABO46603.1"
FT                   /translation="MSLIYLDYAATTPLSQSVKNSMLNSITSDDDFFNSGSLTYQQAEI
FT                   VSNKIEQARATIAQTLEVLPREVIFTSGATESNNLAIKGVAYAYKDRGRHIITSKAEHK
FT                   AVLDVCKFLETQGFDVTYLDVNQFGEVDLEQLKKAITPQTILVSLMAVNNELGTKNNLI
FT                   EIGKITKQKGVMLHVDAAQGYGKVDIDIKAMNIDLLSVSGHKLYAPKGVGFLYLRSKRP
FT                   KVRLVKQIHGGAQEFNLRAGTLATYQIFALAIAVKEMFAKKQQNFEYVLEMRRVFLDII
FT                   QDLASIKINTDLENSYPGILSVTFLGVKGETLLALVDGVCMSMGSACNSQAVEPSHVLS
FT                   AIGLTATQAESTLRISFGLQTNKKQVIQAANLLKEKVQLLRALSPQGEVNV"
FT   gene            702982..703311
FT                   /locus_tag="FTW_0721"
FT   CDS_pept        702982..703311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46604"
FT                   /protein_id="ABO46604.1"
FT                   /translation="MYNDLTRELLRQVKFEDGIILAEQTKYSVSDSFLTVEIYICDKRV
FT                   SYRVYGDAYILAMLKWLQLSLLNKQNLSQISLEKLIADFDLPQVKYRDALQIIKLIEKI
FT                   NAAAI"
FT   gene            703295..703993
FT                   /gene="recO"
FT                   /locus_tag="FTW_0722"
FT   CDS_pept        703295..703993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="FTW_0722"
FT                   /product="DNA repair protein RecO"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006310 - DNA recombination; GO_process: GO:0006281 -
FT                   DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46605"
FT                   /protein_id="ABO46605.1"
FT                   /translation="MQQLYDFYILHQRKYRENSLLVSVFTREFGKLSALIAINKKTTNL
FT                   YQPLVKLRGQINLAKKADGLSKIYNIEFVESFYQKTYINLLSLQYINELIYLLLNYSHE
FT                   EDVLFDKYDFILRNIDEANYRHLLRMFELELLNSLGQGIYVDSDIDGMLIQNDCNYIIL
FT                   PNGFRKDFSFAVNSISGSSLKKINQPLSSWSNDDLKAISRVTRVCVDYVLAGKQLKSRK
FT                   LLVDYLNLKK"
FT   gene            complement(704069..704716)
FT                   /locus_tag="FTW_0723"
FT   CDS_pept        complement(704069..704716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0723"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46606"
FT                   /protein_id="ABO46606.1"
FT                   /translation="MDTISALLNIVLHLDQFISTYINILGDWTYLLLFLVIFCETGLVI
FT                   TPFLPGDSLLFAIGLTGAATTLNVHLVAPILVAAAVCGDSCNYFLGRMIGKRIFKDNAK
FT                   ILKTAHLLKAQEFFNKYGPAAIILARFTPLVRTFMPFTAGMARMRYTKFVAMGIIGAFI
FT                   WVYSIVYLAFFFSNNAFVKKYFGLFIILIVVVSLIPSTISFIKAFKNKLLDR"
FT   gene            complement(704772..705398)
FT                   /locus_tag="FTW_0724"
FT   CDS_pept        complement(704772..705398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0724"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46607"
FT                   /protein_id="ABO46607.1"
FT                   /translation="MFDFIIHFNEYINYFIDLLGVWFYILLFFIVFCETGIVLGIFFPG
FT                   DSLLFTIGITAAATTINIHLAVLAICLGAIIGDSCNYITGKFIGEKLFSTHARILKKAY
FT                   LIKTKEFLEKYGTKAIIFSRFIAFVRTITPFVAGVTRMNYAKFVTLGTISAIIWSFSIT
FT                   YTVYFFSDNQFVKQNLSLLIAIVVVAVIIQILIKGIINKIKAKRT"
FT   gene            complement(705405..705671)
FT                   /locus_tag="FTW_0725"
FT   CDS_pept        complement(705405..705671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0725"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46608"
FT                   /protein_id="ABO46608.1"
FT                   /translation="MDSTTVAQQIKNQILSKVEPQAIIEIIDETHKHVKHRGYTQGKYH
FT                   FILNITSQKLSTITKIQAHKQIFKAVEDLMPYIHALSIKIKPE"
FT   gene            complement(705674..706222)
FT                   /locus_tag="FTW_0726"
FT   CDS_pept        complement(705674..706222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0726"
FT                   /product="5,10-methenyltetrahydrofolate synthetase"
FT                   /EC_number="6.3.3.2"
FT                   /note="GO_function: GO:0030272 - 5-formyltetrahydrofolate
FT                   cyclo-ligase activity; GO_process: GO:0046653 -
FT                   tetrahydrofolate metabolism; GO_process: GO:0006730 -
FT                   one-carbon compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46609"
FT                   /protein_id="ABO46609.1"
FT                   /translation="MDKNQIRRELLNIRDSLINKTYLSEQISSKLISYIQANFTNPKIG
FT                   SFASLKNEIDTQTINNHFENIYLPIVHPFIKHGLWFARDSKKYYLNKYKIKEPVYCVKD
FT                   VVTAWELDIIIIPMVGFTSDKFRMGMGGGFYDYNLSFKKIHKWPLTIGIAFDEQQNNAI
FT                   IIDKHDIKLDLIITPTRIL"
FT   gene            706662..707198
FT                   /locus_tag="FTW_0727"
FT   CDS_pept        706662..707198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0727"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46610"
FT                   /protein_id="ABO46610.1"
FT                   /translation="MKNEKPSFEDVAEALKVMQALSSASEAHGLLCALFSFGAEVKFTA
FT                   WSDSLMTKPIEEGDLVASSALKTMKKLYDYTKSQFDEKGLSFDLFIPADDEPLSYRAEA
FT                   LTYWIRGFLSGVGLFGLDFENSKDKEIKEAISDLMKISYMDYEALGEDESCEEDFIELL
FT                   EYTKVAVLLIDSEKI"
FT   gene            707207..708418
FT                   /locus_tag="FTW_0728"
FT   CDS_pept        707207..708418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0728"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /EC_number="1.14.13.-"
FT                   /note="GO_function: GO:0050660 - FAD binding; GO_function:
FT                   GO:0016491 - oxidoreductase activity; GO_function:
FT                   GO:0016701 - oxidoreductase activity, acting on single
FT                   donors with incorporation of molecular oxygen; GO_process:
FT                   GO:0006744 - ubiquinone biosynthesis; GO_process:
FT                   GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46611"
FT                   /protein_id="ABO46611.1"
FT                   /translation="MNAKYDVAIVGGGIVGLFTSLALAKTGCKIIHIEKDQLQVKNDNR
FT                   SIAVSYSSIAFLNTLGLWDKVASKTQAIKKVHVSDKGRYGRAEIFAKDENLPFLGAIAP
FT                   MQELLTVALQSVAANPNIIKSFETNVIDLAKHDDKYSLVVKQQEQTKTIRAQLIIACDG
FT                   ANSSLRKMLNITAKTTDYQQDALVFDIQTELDNNNTAFERFMTDGVLAMLPKVKTTMGC
FT                   VWTIDRDNSKAKLTLDNKEFEQLVQDRFGYRLGQIKLTSKPAVFPLYLVQAEQVYKNNV
FT                   LFFGNALHFLHPVSGQGMNLSIRDIGFLYDLLVESDFSQNSITAVLAEFAKVRKPDHDR
FT                   TIFVTHGFVKWFVSNDTKFVASRNAGLHLLQRSKLAKKVLSRVMMGKLSKGSTLMRKVV
FT                   EDER"
FT   gene            708408..709643
FT                   /locus_tag="FTW_0729"
FT   CDS_pept        708408..709643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0729"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /EC_number="1.14.13.-"
FT                   /note="GO_function: GO:0050660 - FAD binding; GO_function:
FT                   GO:0016701 - oxidoreductase activity, acting on single
FT                   donors with incorporation of molecular oxygen; GO_function:
FT                   GO:0016491 - oxidoreductase activity; GO_process:
FT                   GO:0006744 - ubiquinone biosynthesis; GO_process:
FT                   GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46612"
FT                   /protein_id="ABO46612.1"
FT                   /translation="MSVRNIQKDAVIVGGGMVGLSLALALHQNGLQVALVEAKEINYKS
FT                   LSADRVETRVSAINHTSKSFLQRLGVWHSIKNKRISPYYQMRVWDDIPSESINITAEEI
FT                   AEHSLGCIVENDVIVEALLEKIRDTGIEIFANQKIHKIQRNGNTEKLFLQAVIPDSCSD
FT                   GSSQNSDDKYLSIETSLIIGADGANSFIRDYFNFETKVKPYKHTAIVATIKLERNHLQT
FT                   AYQRFYDKGVLAFLPLENSNKASIVWSVKSDYANFLMSLTDEKFELELTKAIDNSFGSL
FT                   NLLSKRFSFELIERHAKSYIQNNVVLVGDAAHTIHPLAGQGVNIGFKDAIALTEILTEA
FT                   FTKGRLIGHISTLDKYQRERKLDNTKMLALMKTFKEVFASDNQYLKNARRAGFEFVDKN
FT                   RIVKSIVVKQAL"
FT   gene            709665..710126
FT                   /locus_tag="FTW_0730"
FT   CDS_pept        709665..710126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46613"
FT                   /protein_id="ABO46613.1"
FT                   /translation="MENEILDIKELFLEFDKHDGLEEIVKNISTIVTKFNKDKKVTMPD
FT                   LLKINILTSKLLADQIIQMNMMIDENFDPENDESELLSKCFEYASFCLSLKNRSSLIYG
FT                   KDLNDLSDKDLLKKMFDIDDDQFLNEILNDYESQKILKEIKANFKGTKK"
FT   gene            710152..711168
FT                   /gene="queA"
FT                   /locus_tag="FTW_0731"
FT   CDS_pept        710152..711168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="FTW_0731"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0051075 - S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase activity; GO_process:
FT                   GO:0008616 - queuosine biosynthesis; GO_process: GO:0006400
FT                   - tRNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46614"
FT                   /db_xref="GOA:A4IXG2"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXG2"
FT                   /protein_id="ABO46614.1"
FT                   /translation="MKTDDFDYKLPEELIASYPLENRDASRLLKLNKQTGEIADYKFTD
FT                   FIDFINPGDLLVFNNSKVMLARLYGSKTTGAKLEYLIERIKNPKLFETHIKANRSPAIG
FT                   SEIYVEDTLAKVLDKDGGMYLLEIQGDKDIYQLMEEFGHIPLPPYMKRDDEEFDAERYQ
FT                   TVYAQDLGSVAAPTAGLHFSKELMQQIKDKGVDIAYITLHVGSGTFKPVQVDDVESHKM
FT                   HAEVISVPVEVCQKIRQTKENGGRVIAIGTTSVRSLETAGQNGQIEPYQGETDIFLYPG
FT                   KKFNVVDAMITNFHLPKSTLIMLVSAFADKEKIIKAYEHAIAERYRFFSYGDAMFIF"
FT   gene            711804..712595
FT                   /locus_tag="FTW_0732"
FT   CDS_pept        711804..712595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0732"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /EC_number="3.-.-.-"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46615"
FT                   /protein_id="ABO46615.1"
FT                   /translation="MKKAFFFDIDGTLVYENQGKLFVSERNIQAIKNLRKQGYKTFIAT
FT                   GRTQGFIPSAVLELPMDGFITANGSVVRIGDKLVYEKLFPQSAIDSVLEFCEKHNHDWL
FT                   FEGEYAYVNNLESEDLSYFYDNVIVNKDKIITTHNLYNVTIYNALVLGRNVDVVALQHT
FT                   LGNDYVTAPHNEHGYVDCYLAGHTKADGIDKVVEYLGLEEYETYAFGDGNNDLEMFDRV
FT                   DVAIAMENASSQLKEKADLITKTNYNDGIYYALVKLGLIKS"
FT   gene            complement(712849..713562)
FT                   /locus_tag="FTW_0733"
FT   CDS_pept        complement(712849..713562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0733"
FT                   /product="membrane protein, YhhQ family"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46616"
FT                   /protein_id="ABO46616.1"
FT                   /translation="MTNFELLILFTLIDFSILFLSFKLFSKKGIYIFIVISVIAANIQV
FT                   NKGVAYDIAGFHIIATLGNVMFGGIFTANDLLNEKYGRQEARKAVLKSIFFGISFMIFM
FT                   FISTLFTSLNDPFYNDTNKALNLFFSIDGGALKAVIIGNMVYLISQLFDVLIYSKIKSY
FT                   SSDIKWLWLRNTGSTLISQILDTTLITYGFGFAGVLPLDYAFEIIISTLVIKYTVALIN
FT                   APLFYILAFTKPREV"
FT   gene            713678..714061
FT                   /gene="gloA"
FT                   /locus_tag="FTW_0734"
FT   CDS_pept        713678..714061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="FTW_0734"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="GO_function: GO:0004462 - lactoylglutathione lyase
FT                   activity; GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008152 - metabolism; GO_process: GO:0005975
FT                   - carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46617"
FT                   /protein_id="ABO46617.1"
FT                   /translation="MRFAHVMLRVKDLDKSIDFYTNVLWMTVQKKIDNTEYKYTLAFLG
FT                   YGDISSHTVLELTYNWGEHEYDHSNAFGHLCMQVEDVYKACDDVKAKGGVVTREAGPVK
FT                   GGTQIIAFIKDPDGYQIELIEKA"
FT   gene            714061..714453
FT                   /locus_tag="FTW_0735"
FT   CDS_pept        714061..714453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46618"
FT                   /protein_id="ABO46618.1"
FT                   /translation="MNKDRLNILVIRGYYSKGDSVEHIDVDGIKVKVTTVALGRPVFVR
FT                   RKLKRIIDKYKVSADNYDLIYAISMSAGISSLIDEALYQRLHLITPFFIHHKTMRVLSK
FT                   VKVRKMLGAYLLLLFNGKLGKFHEAI"
FT   gene            714515..715395
FT                   /locus_tag="FTW_0736"
FT   CDS_pept        join(714515..714844,714844..715395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0736"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46619"
FT                   /protein_id="ABO46619.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPNIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            715832..716440
FT                   /locus_tag="FTW_0738"
FT   CDS_pept        715832..716440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0738"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46620"
FT                   /protein_id="ABO46620.1"
FT                   /translation="MTGSINVGLAYPDNKFNFIDKTSGTITNFKFTRNDLIISDQKGAG
FT                   ELIYLDQDEVTGNIFKYNQPAERHKTEDVFTKLTSHPYAFRSTDFTFNIDKEEKDALNF
FT                   AIVGDISFDYKPEDDKQKLKVEINDVAIAQGSNNHGNNGWFAIKSNNYDSDRNVGGNKI
FT                   EYMYKKSRGSNKDQCFFFKRGENTNNEIIITSGNCVNNW"
FT   gene            716485..717036
FT                   /locus_tag="FTW_0739"
FT   CDS_pept        716485..717036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0739"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46621"
FT                   /protein_id="ABO46621.1"
FT                   /translation="MFAVTSNMYATQVSAQLKIQNNSNAMMHVEMSKELSSKATFEGNT
FT                   VYDIQPGKVQKVIVLIDYGATGDVQVKVDAQCKFNASIGAGVWELISSGGKHLANFKTE
FT                   VGCNFAANASAFATLGISQLTSLVANVSFTKSDGLHECSLSEGYINIYPRSSNQVGIDY
FT                   HIPDTLGGLSMDAKQVKIIH"
FT   gene            717239..718636
FT                   /locus_tag="FTW_0740"
FT   CDS_pept        717239..718636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0740"
FT                   /product="GTP-binding protein"
FT                   /note="GO_function: GO:0005525 - GTP binding"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46622"
FT                   /db_xref="GOA:A4IXH0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXH0"
FT                   /protein_id="ABO46622.1"
FT                   /translation="MSFLVAIVGRANVGKSTLFNVLTNSHDALVFDFEGVTRDRQYGQA
FT                   KYDDLDYLVVDTGGISDKDVGFDEFMAKQSQIAIDEANLVFFVVDGRSGLTTGDEYVAS
FT                   LLRQKDKKVVVVVNKVDGTDEEAAMAEFYSFGFDKVFAISAAHRRNTQKLVDKFLKKPL
FT                   NEYYQDYTQTQEHKEQQRHGIHFSLIGRPNVGKSTLTNRMLGEDRVVVFDMPGTTIDSV
FT                   SIPFERHGQKYTIVDTAGVRKRGKVKQTLEKFSVIKTLQAIQDSNVVVAVVDARQGISD
FT                   QDLSLIHFAIKNGRALVLAVNKWDGMTEEDRIQVKQDLKRKLFFLQDYVDIHFISALHG
FT                   TNVGHVFESIDTAYACANKKITTADATRLMQLAVEAHSPPMVGKFRIKLKYAHVGGHNP
FT                   PVIVIHGNQVSRLPNSYKRYLENFFREALDFRGTPIVFEFKQSENPFADRKNKRSKDEG
FT                   SKSKKVK"
FT   gene            718605..719909
FT                   /gene="murA"
FT                   /locus_tag="FTW_0741"
FT   CDS_pept        718605..719909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="FTW_0741"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46623"
FT                   /protein_id="ABO46623.1"
FT                   /translation="MKAVRVKKLSKLADEITINISGAKNALLHLIFASLIPDTKTKFTN
FT                   VPTTLLDYKGAKEILENVGAKVIEKDEEVTIDTAAISNETLELCGEMTSKTRCSLMLLG
FT                   SLLKKKGRVKIGFPGGCSFSEKRPFDIHLNGLEALGAEVKLADDHIEVIYKEEKNAEFK
FT                   MPFPSVGATMNLLMYAVTGNSEVVLENVALEPEVVTLIDYLNQCGANIDFDADSRKIKI
FT                   LGVMRLNGCEFEIIFDRIQAMTYAAMAYLYKTNVTITNINTQDTYSIKKPLEKLTNAGA
FT                   KWEYNQANRSIKFFGKDSCIKGVDIIAAPFPHFPTDLQPIYAVMLFMANSSSTIQDTVY
FT                   PERINYVYQIRKMGFNISIDNTLIKINPLKNLNDIRPAVMSVKDLRAGMACLMAGSLLD
FT                   EFSTINNAHQIFRGYNNLIENMSHFMRIEILNDNV"
FT   gene            719917..720765
FT                   /gene="murB"
FT                   /locus_tag="FTW_0742"
FT   CDS_pept        719917..720765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="FTW_0742"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="GO_function: GO:0050660 - FAD binding; GO_function:
FT                   GO:0008762 - UDP-N-acetylmuramate dehydrogenase activity;
FT                   GO_process: GO:0009252 - peptidoglycan biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46624"
FT                   /protein_id="ABO46624.1"
FT                   /translation="MSEYISLEQYNTYRIKSFAKYVYFPTNNQELLDIVNNHNKLFFLG
FT                   NGSNVIFSKEYYDDVAFVIFTKKFNSFNIIDNYASVQAGVLLQDLAFATYNASLSGIET
FT                   FYDVPASVGGALIMNAGAYGDEIYTCVKSVTILDLNTKQIKKYLKKDIEYGYRYSMFKY
FT                   MKDICILSAEFEFEYKSKQEIKAKLDDIYSRRLSNLPQKPTAGSVFKRPQANMPVGIMV
FT                   EQLGLKGKQIGDAQISPKHGGIIVNNGNATGQNILDLIEFIKQQILEHYNIELHEEQIV
FT                   I"
FT   gene            720844..721719
FT                   /locus_tag="FTW_0743"
FT   CDS_pept        720844..721719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46625"
FT                   /protein_id="ABO46625.1"
FT                   /translation="MKKKVLTSFIIISLCYCSAIADTITAKAQQAVKIDVKDNPLRQYA
FT                   AKSSIKSDSALVSENEVVSGSTIKQDQAPKANDYGDALSSLVDTSDDGYEKLLTEAEEI
FT                   LKDNSPSETKKKIDVFNHELEAKAEKEKQKIKESATTVLDEAHNIIKENHNINQDYKKS
FT                   QNYYKSKSAKDYIDENVKKYNSEYKIKNYKNLLDNISTPEEIDKSFEQIDDDDEDSQGF
FT                   KYKLSDDYPIEQITTVGLLSGEQKRFDKCLIMKTYGGATWRTYCQPLKKPTQCSDYDWQ
FT                   QLSTMPVMYC"
FT   gene            complement(721721..722548)
FT                   /locus_tag="FTW_0744"
FT   CDS_pept        complement(721721..722548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46626"
FT                   /protein_id="ABO46626.1"
FT                   /translation="MIFVIIFIPNYIKTDSYMFNYNLFLNRLSKRKLYPKSFIKNEIAQ
FT                   RLLKRLEFIKLDPKDILVTGYSDSDYLERLQKRFPNADIHTSQNLKQHFDIIFSNSIIH
FT                   ITDNLSQELDDYYQLLNDNGILLFSTFGDKSFATLKEAFTSVSNYKHTNTMIDLLTWGN
FT                   TLQASQYKTPAIESDLITFTYENINTLFEDIRYLNEPLADTNMQFGLTGKNMWLRFVEK
FT                   FKQNLQLEIEALYGYAVRKAQDNTLKSRANPNRITLEELKKQIADFKKNSQNN"
FT   gene            722526..723180
FT                   /locus_tag="FTW_0746"
FT                   /note="hypothetical protein"
FT   misc_feature    722526..723180
FT                   /locus_tag="FTW_0746"
FT                   /note="contains frameshift and premature stop"
FT   gene            723547..723678
FT                   /locus_tag="FTW_0747"
FT   CDS_pept        723547..723678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0747"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46627"
FT                   /protein_id="ABO46627.1"
FT                   /translation="MRKIILSAIVVFGLSTMSFAQGLHQINSFSNSSFPPPVLSLAS"
FT   gene            complement(723695..724033)
FT                   /locus_tag="FTW_0748"
FT   CDS_pept        complement(723695..724033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0748"
FT                   /product="histidine triad (HIT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46628"
FT                   /protein_id="ABO46628.1"
FT                   /translation="MSDCIFCKIITGEIPSKKVYEDENIFAFHDINPAADVHILVIPKK
FT                   HIASLNDLTEQDQELMGKFILSIPKVAKLMGLKGFKTIFNTGKEGGQMVFHLHAHILGG
FT                   KIRSKLPE"
FT   gene            complement(724039..725697)
FT                   /gene="ubiB"
FT                   /locus_tag="FTW_0749"
FT   CDS_pept        complement(724039..725697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="FTW_0749"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="GO_function: GO:0016709 - oxidoreductase activity,
FT                   acting on paired donors, with incorporation or reduction of
FT                   molecular oxygen, NADH or NADPH as one donor, and
FT                   incorporation of one atom of oxygen; GO_process: GO:0006744
FT                   - ubiquinone biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46629"
FT                   /protein_id="ABO46629.1"
FT                   /translation="MIKKFLRLIYIFYVINKYCLLNEPIRATKIKTLRALLLLNPFYYS
FT                   RRVRRLEHGVRIREALEKLGPIFIKFGQALSVRADLLPPDVIKEVSKLQDNVPLFDNKI
FT                   AAEQIEKAAKKPINEIFKSFESSPLASASVAQVHAAILQNDDKVVVKVLRPGIEKILKL
FT                   DTSLMLFFATLLSKLKEIRRFKPVEIVKEINQSFFDELDLVREASNASQIRRNFEDSAI
FT                   HYVPKIYWEYTSSTVMVMERVGGVRVSDIETLDALGVDRRLLAQRGVEIFYSQVFDDCF
FT                   FHADMHPGNMFIDVSNPADPKYISIDFGIVGTLNRDDQRYLAGNFLAFFKRDYRKVAEL
FT                   HIESGWVPSDTRVDVLESAIRTVCEPIFEKPMKEISLGYTLMQLFAVARRFNMNIQPQL
FT                   TLLQKTLFHVEGLGQKLCPELNIWETSRPILEKWMKEQMGLRGFYHRSMENMPRVSDKL
FT                   PELPRMVFDILQQTQINLKNTTTSTQFNNLKEPKKKYRFALGCGLVLTTIGVIYTLNKD
FT                   TTPLIKLQNFISNYSTSFIIVGVACLIYYSFKKEK"
FT   gene            complement(725690..726277)
FT                   /locus_tag="FTW_0750"
FT   CDS_pept        complement(725690..726277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46630"
FT                   /protein_id="ABO46630.1"
FT                   /translation="MLKLVNTALSLLPKFDPQVSALLLPINGKALSVNITDIDLIITLE
FT                   VEDSKIYASNELTKNILKGKLAYILELIFNKNLQELIIAEKLDYQGSLKDLNAFNKFLN
FT                   AIDIDLVYRISELTSPEFAVIVAKPFQKAKQYLKTSRQETIVDIKDFLTEEKKTLISQN
FT                   EINIFYRQVQELKQATDRIEAKLKLLEGLNND"
FT   gene            complement(726279..727031)
FT                   /gene="ubiE"
FT                   /locus_tag="FTW_0751"
FT   CDS_pept        complement(726279..727031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="FTW_0751"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="GO_function: GO:0008168 - methyltransferase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46631"
FT                   /db_xref="GOA:A4IXH9"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXH9"
FT                   /protein_id="ABO46631.1"
FT                   /translation="MSKENKTTDFGFTQVPWEEKQKKVAGVFHSVAAKYDLMNDLMSFG
FT                   IHRIWKKQTIAKSGVHKGDNVLDLAGGTGDLAYKFCQMVGQQGKVILSDINSSMLEVGK
FT                   EKLTNKGCVGNIEYVQANAECLPFPDNYFDCITISFGLRNVTDKDKALASMCRVLKPGG
FT                   RLLVLEFSKPIIPLLSKVYDEYSFKALPFLGKIITQDAESYKYLAESIRKHPDQQTLKQ
FT                   MMYDAGFDNVEYQNMTGGIVALHIGYKY"
FT   gene            727125..728141
FT                   /gene="glk"
FT                   /locus_tag="FTW_0752"
FT   CDS_pept        727125..728141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="FTW_0752"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="GO_function: GO:0004340 - glucokinase activity;
FT                   GO_process: GO:0005975 - carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46632"
FT                   /protein_id="ABO46632.1"
FT                   /translation="MYILSGDIGGTNTRLEVSLLENGATQSIAIRKYKGANFNCLSDII
FT                   DKFLSEVDLVGQIDSVCLAVAGFVSNGEVEVTNLPWMVSEQYISEGLGIDKTKVKVIND
FT                   FEAIGYGIESLDREKDIITIQEGKKDDDNLCAVVGAGTGLGMCLVSYDKDDKPRVYKTE
FT                   GGHVDFSPVDDEQVELFKFMRKTFHRISPERFCSGYGIYNIYKYVVRHPLYDQPECMEL
FT                   RRALFSVSDSDKAAVIVKYAIEHREPSALRTIDIFLSIYGSVAGNLALTSLPFRGLYIA
FT                   GGIAPRLIKQIKESKFLEKFRDKGRMSNMMKDFPVHIIMNTDVGLIGARTYAAGLVK"
FT   gene            complement(728143..728406)
FT                   /locus_tag="FTW_0753"
FT   CDS_pept        complement(728143..728406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0753"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46633"
FT                   /protein_id="ABO46633.1"
FT                   /translation="MSEEILNIDKTPLTKNKACSYKNILGCICLVIILAIFCISELAIL
FT                   LGIFMLFAIFYIIITGICAIYILLVGIKKISKYYRQKNIHNN"
FT   gene            complement(728480..729010)
FT                   /locus_tag="FTW_0754"
FT   CDS_pept        complement(728480..729010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0754"
FT                   /product="intracellular septation protein A family protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane
FT                   [Evidence ISS] [PMID 11152613]; GO_process: GO:0000910 -
FT                   cytokinesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46634"
FT                   /protein_id="ABO46634.1"
FT                   /translation="MNKMINDLLPAIVFFGIYKIYDIFFATAALIIVTIAQVIWEYIAH
FT                   RKVAKTQIFIAILVAIFGGATIYFHNEEFIKWKVSIINWLMGIGLIITTYTMKETPMQK
FT                   ILKDAIDLKEHKWKEINNMWGAYFTVLGTLNLFVAYFFSTDIWMDFKLFGLLGITFVFL
FT                   IIQSIYLSKHIKR"
FT   gene            729071..729685
FT                   /locus_tag="FTW_0755"
FT   CDS_pept        729071..729685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0755"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46635"
FT                   /protein_id="ABO46635.1"
FT                   /translation="MKSLIELYSYGNNLSELKELANILDNDGVIAIPTDSGYALACRMK
FT                   SKKGIDKIIKIRNLDSSHNFTLCCKDLSEISEYAKVDNNAYRLLKRYTPGPYTFILNAT
FT                   KKVSSLLVTKSKNTVGIRVSEHYVPRAISAEIGEPLVISSFIVPGHQHVVTDCDEVDSQ
FT                   IMNYLDAVVESDYCGYDPTTVVELLELPYQILRQGAGEIDL"
FT   gene            729735..730337
FT                   /locus_tag="FTW_0756"
FT   CDS_pept        729735..730337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0756"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46636"
FT                   /protein_id="ABO46636.1"
FT                   /translation="MNGYKTISENIEFEIAPIKKSRFIVCIYKVANHIEVLNSLDAIKN
FT                   SYPNANHYCWAYSLADNNQFRFNDDGEPGGSAGKPILSHIQGFEVTNVLVVVVRYFGGT
FT                   KLGVGGLIRAYGQAAKEGLTLAKITCVEVQNEISLEYDYSETVNVENLANRYGIQIIKE
FT                   NYSDNISKIIKIVASDKDMFLEEIKNITKGKIKITVH"
FT   gene            complement(730334..731557)
FT                   /locus_tag="FTW_0757"
FT   CDS_pept        complement(730334..731557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0757"
FT                   /product="major facilitator superfamily (MFS) transport
FT                   protein"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46637"
FT                   /protein_id="ABO46637.1"
FT                   /translation="MKKYYYNTLIILLLFFLALLNYVDRSTLSIANTEIANAFNITPTE
FT                   MGILLSAFMWSYAIASLPAGYMVDRLGVNKVMLISMIAWSVACILGGFVIGFYSILLTR
FT                   ILLGLAEAPFFIVATRIIQHRFPSSQRGLMSSIIALGPRLANILAPLILVGLMLLIDWR
FT                   GMFIILGVVGLIAAIGWKLLHTKETLEHTTTIIKKSQKISISETLRNKNVVYLCIGNLC
FT                   SSYAYWLFLTWLPFYFIKVKHLTLSQMSIATSASFISGVASVMLGGIISDFMIKKGYTA
FT                   VFARLTPIIAGCLVASIAILALPFIDNIFVIVCVIGVTIFCLGLRISPTWALVADISPY
FT                   SLVGTIGGLQNFANFVGAGLAPLITGIILQSTNDNFMIIFIFSGIICLFGSIIYMLIRD
FT                   KRAQNETI"
FT   gene            complement(731574..733598)
FT                   /gene="metG"
FT                   /locus_tag="FTW_0758"
FT   CDS_pept        complement(731574..733598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="FTW_0758"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004825 - methionine-tRNA ligase activity; GO_process:
FT                   GO:0006431 - methionyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46638"
FT                   /db_xref="GOA:A4IXI6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXI6"
FT                   /protein_id="ABO46638.1"
FT                   /translation="MRKILVTNALPYANGDLHLGHMLGYIQSDIWVRFQKLQGNQCIFV
FT                   CGSDTHGTPIMLKAKSLGITPEELVTKYSNRHLQDFTDFEINFDNYHSTHNSLNKEIVE
FT                   DIYNKLNNKNLISKKAIAQAYDPEAKMFLPDRFVKGTCPKCKAEDQYGDSCEVCGATYD
FT                   PTELINPRSVISGQSPIQKNSEHFFFDLPALEKNIKDWIESNTLLQPEVANKLAEWFEQ
FT                   GLQSWDISRDAPYFGFAIPGTNEQKFFYVWLDAPMGYIASFKDYCNKNNINFGDFWGDS
FT                   SSESELYHFIGKDIIYFHTLFWPAILSSTGYKTPTSVFANGFLTVNGKKMSKSRGTFIQ
FT                   ARTYLDNLEPSYLRYYFASRLTSRIDDIDLNLEEFVTKSNSDIVGKVVNIASRCAGFIY
FT                   KKFDATLSGEIFDPELESEFSKNHDAITQAFEKREFAHAVRLIMALADKANQFIDYHKP
FT                   WQLAKEEGQEQKVHQVCSQGINMFKVLIVYLKPIIPSIVAEAERFLNIQFISWADAPKF
FT                   LINHKIDKFKPLATRIEKEKVDKILEDTKKMLENEQAPQSKKEEPKLDIAAECTFDDFM
FT                   KVDLRIAKITEASHVEGADKLLKLILDLGGVTKQVFAGIKSAYKPEDLIGKHTIMVANL
FT                   APRKMKFGMSEGMVLAAGDGKGIYILEPHEGAQPGMRVK"
FT   gene            733777..733868
FT                   /locus_tag="FTW_2037"
FT   tRNA            733777..733868
FT                   /locus_tag="FTW_2037"
FT                   /product="tRNA-Ser"
FT   gene            733896..733971
FT                   /locus_tag="FTW_2057"
FT   tRNA            733896..733971
FT                   /locus_tag="FTW_2057"
FT                   /product="tRNA-Val"
FT   gene            complement(734168..734704)
FT                   /locus_tag="FTW_0759"
FT   CDS_pept        complement(734168..734704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0759"
FT                   /product="fmn reductase, NADPH-dependent"
FT                   /note="GO_function: GO:0008752 - FMN reductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46639"
FT                   /protein_id="ABO46639.1"
FT                   /translation="MKKILVFSTSNSKNSINQKFAKYVANLIPNIKTTLLDINDFEMPI
FT                   YSIDRENTYGIHPLAHDFKKNVKGHDALIISLAEHNGAYTAAFKNIFDWISRINDGSIW
FT                   YDKPILLLSTSPGPRGAKTVLNTAKVTFGLMSKGEVTPFSLPEFNKNFDTNTGITDTLL
FT                   KNELDKCITNFTNSI"
FT   gene            735188..736716
FT                   /locus_tag="FTW_2071"
FT   rRNA            735188..736716
FT                   /locus_tag="FTW_2071"
FT                   /product="16S ribosomal RNA"
FT   gene            736812..736888
FT                   /locus_tag="FTW_2065"
FT   tRNA            736812..736888
FT                   /locus_tag="FTW_2065"
FT                   /product="tRNA-Ile"
FT   gene            736903..736978
FT                   /locus_tag="FTW_2045"
FT   tRNA            736903..736978
FT                   /locus_tag="FTW_2045"
FT                   /product="tRNA-Ala"
FT   gene            737030..739919
FT                   /locus_tag="FTW_2068"
FT   rRNA            737030..739919
FT                   /locus_tag="FTW_2068"
FT                   /product="23S ribosomal RNA"
FT   gene            739964..740078
FT                   /locus_tag="FTW_2075"
FT   rRNA            739964..740078
FT                   /locus_tag="FTW_2075"
FT                   /product="5S ribosomal RNA"
FT   gene            740426..741235
FT                   /locus_tag="FTW_0761"
FT   CDS_pept        740426..741235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0761"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46640"
FT                   /protein_id="ABO46640.1"
FT                   /translation="MNDQQQAICTLDLSTQLQTDYRATSPICLVSFINLKKGQSLEISA
FT                   NASSHVFVVMQGSGESRQGDIVFRWTKGDVFSFPTDKTIRHLCSDETTLYYVNDEPLLN
FT                   YLGVKPSVATFVAAHYPYKTILENVANFISEFEATKRNRNGVLLANTVCRLTETITPTL
FT                   WSLYDVLPKNSVQLPHRHNSVALDLCLSAPTSGCYTLMSEKIDSQGNHINPVRMDWSTN
FT                   GAFITPPGWWHSHHNETDENAVVLPMQDAGLQTYLRTLFIKFFGSNG"
FT   gene            complement(741530..742585)
FT                   /locus_tag="FTW_0762"
FT   CDS_pept        complement(741530..742585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0762"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46641"
FT                   /protein_id="ABO46641.1"
FT                   /translation="MRNIYKIILVLSIVAIFYSDIFGYGDIPPQKPTLVKTSAFITDIQ
FT                   ILDEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYDEVFEGWKPQISIIN
FT                   EIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQTLKAYIIPFGYNSKE
FT                   VQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGKPQIISMLEFSIS
FT                   LERKPTNILLKVLIPLTLLVLAMWAIFWMDTKALSDRLNIAFIGILSVIAYQFLIEGEM
FT                   PDIDYLTFTDGFLLLSFSILFSTVLESLAVYWLIKLNKDKLARKMDIFSRFAFPISYLV
FT                   LITSLYFIYLH"
FT   gene            complement(742699..743334)
FT                   /locus_tag="FTW_0763"
FT   CDS_pept        complement(742699..743334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0763"
FT                   /product="putative peptidase, M50 family"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_function: GO:0004222 - metalloendopeptidase
FT                   activity; GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46642"
FT                   /protein_id="ABO46642.1"
FT                   /translation="MVALMAAIPLIFAITIHEAAHAFVAKIRGDDSAYRLGRVTLNPVS
FT                   HIDPIGTIVFPGLMLISSISFGFPFIFGWAKPVPIDYTKLKRPKIDTILVAIAGPLANL
FT                   AMAFIWAIVAKYITLHPYIQGMAFYGIMINVVLMILNLLPIPPLDGSRIISSLLPINLA
FT                   YKYNSIEKYGFLIILALVIIPFNGSNLLFFIMQPFITTIINLIQFIIF"
FT   gene            743556..744299
FT                   /locus_tag="FTW_0764"
FT                   /note="transposase ISFtu2"
FT   misc_feature    743556..744299
FT                   /locus_tag="FTW_0764"
FT                   /note="Every ISFtu2 ORF in this genome has a premature stop
FT                   at the identical position resulting in disruption of the
FT                   ISFtu2 sequence in compariosn to Schu4 ISFtu2 elements."
FT   gene            complement(744509..745858)
FT                   /locus_tag="FTW_0766"
FT   CDS_pept        complement(744509..745858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0766"
FT                   /product="Glutamate/Leucine/Phenylalanine/Valine
FT                   dehydrogenase"
FT                   /EC_number="1.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46643"
FT                   /protein_id="ABO46643.1"
FT                   /translation="MNAQKYIDSVIAQVEKRDGHEKEFIQAVKEVFSTLKPALEHNPKY
FT                   IEENILARMVEPERGISFRVPWVDKDGNIQVNRGYRYQFNGAIGPFKGGIRFHPSVYSG
FT                   IIKFLGFEQVFKNSLTTLPMGGGKGGADFDPKGKTDAEIMNFCQSFMMELQRHIGPDID
FT                   VPAGDIGVGGKEIGYMYGQYRRIRACFENGVLTGKSLESGGSLIRPEATGYGAVFFLDE
FT                   MLKHDGETLQGKTVVTSGYGNVAWGVCKKVAQLGGKVVTISGSKGFVHDPEGITTDEKI
FT                   EFLLKIRNGEKTMQDYAKEFNASWHAGQKPWGIKADIAIPAATQNEIDVEDAQKLIDSG
FT                   VKYVVEASNMPTTNEAIEFLMKKGIILAPGKAANAGGVAVSGLEMSQNSARLSWSAEEV
FT                   ESKLQQIMANIFHACKFASSKYNLGYNLVAGANLAGFEKVAEAMIQQGRY"
FT   gene            746197..746940
FT                   /locus_tag="FTW_0767"
FT                   /note="transposase ISFtu2"
FT   misc_feature    746197..746940
FT                   /locus_tag="FTW_0767"
FT                   /note="Every ISFtu2 ORF in this genome has a premature stop
FT                   at the identical position resulting in disruption of the
FT                   ISFtu2 sequence in compariosn to Schu4 ISFtu2 elements."
FT   gene            747210..747899
FT                   /locus_tag="FTW_0769"
FT   CDS_pept        747210..747899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0769"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46644"
FT                   /protein_id="ABO46644.1"
FT                   /translation="MFMNSQQHALDKIAQARQLIVVVTDSWQTKLARLFYFGRKNLSNW
FT                   IVIKPATAVVIGKNGLAWADSSYLNLAKAPLKQEGDSRSPAGVFSLGKIFGFANKTFTD
FT                   YIHIKTGIECIDDSNSKYYNRIVNSQQINDKDWHSAENMSEISLYKYGIEVLYNTNPIV
FT                   PRKGSCIFMHIWKSATIGTEGCTAMAEEDISDIQSLLDSNKNPVLVQLPQHIYHQVKDD
FT                   WQLPDLL"
FT   gene            747912..749096
FT                   /gene="lysA"
FT                   /locus_tag="FTW_0770"
FT   CDS_pept        747912..749096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="FTW_0770"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="GO_function: GO:0008836 - diaminopimelate
FT                   decarboxylase activity; GO_process: GO:0009089 - lysine
FT                   biosynthesis via diaminopimelate"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46645"
FT                   /protein_id="ABO46645.1"
FT                   /translation="MNKYIIFDNTKLLEYIGKNSLITPCYIYDLELLEDTFLNAKKSLD
FT                   KNFKNAEIHYAIKANHNPKIVGIAKKYGMGIDCVSGGEIKRALEQKVDSQHIVFAGVGK
FT                   ADWEIELAIDNDIFAFNSESLEEIQVINQIAQRKNKQVNICLRVNPNIDAQTHHYISTG
FT                   QFDDKFGIAFVNILNWLKDEYRNFANINIIGLHYHVGSQILNYQVFQSLAITTNEHIKL
FT                   LRQNDINIKHINFGGGLGIDYQNPQQNPIVDFDGYFARFREFFEYCDELTLHFELGRSL
FT                   VGQSGVLVSQVLFNKVTQGTHFVIIDAGMTELIRPALYQAQHKIAALIDENINQKQHYH
FT                   IVGPICESSDVFAKYYQLPKLKRGDLLAIYSAGAYGKVLASEYNLRPSVQEYFI"
FT   gene            749108..750487
FT                   /locus_tag="FTW_0771"
FT   CDS_pept        749108..750487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0771"
FT                   /product="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46646"
FT                   /protein_id="ABO46646.1"
FT                   /translation="MHISNKKISTLSLTMLNISAIISLSSIAYMATIGLQSVFFYLIAA
FT                   VTFLLPTSLICAELSSMITQNNGGVFSWVKAGLGEKAGVLAMWLEWFNNVVGFPSSVTA
FT                   LIATFSYIGFRNFAENTHTSTTFWLIMVTVFVGISLFNCLPLRKVVILNIIGAVFGMII
FT                   PGVLLVSGAIYFVVTGQSNLEYHGLSDLLPVFSIGTYALLVKTLSSYSGIQSVAFHMTN
FT                   IENPEKNIPKSILIATLVIVSLTILTTIGLTVIIPVKDVNVLNGLIQGISQVLNIIGLG
FT                   DVKPVVVIMISLGMLAALSTWILGPARGMQTAAEQEFFPKVMAGKNRFGMPVNMLLIQI
FT                   LIVLVLSSVFLVMPSVYAAFALLIAITSQFTVVMWIMVFIAAIRLRFIRPDTHRVFHVG
FT                   RRNSNWLLITMSLVAIFMCMLGFILGLFPPSFSHVKNVFQYTMILVVADIIIIAIPLIW
FT                   I"
FT   gene            complement(750529..750768)
FT                   /locus_tag="FTW_0772"
FT   CDS_pept        complement(750529..750768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0772"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46647"
FT                   /protein_id="ABO46647.1"
FT                   /translation="MYPEGGYNFKPSVYHGGIITRDEAEKDSEIAFAFSNLPNNVYYAV
FT                   EVHSNKEPEGRISFERGTTVRCAFDKDGKQVEIK"
FT   gene            complement(750971..751543)
FT                   /locus_tag="FTW_0773"
FT   CDS_pept        complement(750971..751543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0773"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase family protein"
FT                   /EC_number="2.1.1.63"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0003908 - methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase activity; GO_process: GO:0006281 - DNA
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46648"
FT                   /protein_id="ABO46648.1"
FT                   /translation="MLKETHQIYLAAINKKSYKTVFYAQEIQTPIGNLIAVADDDYLYA
FT                   CFFISDSNIYSIEKLLKIYNAKISFNADNITNQTKDQLNKYFKRELKSFSVPLRLTGTD
FT                   FQKQVWRELIKIPYGETISYRKEATNIGKPTAFRAVANANGKNLLPIIIPCHRVINTNG
FT                   KLGGYTGGLYKKEFLLNLEHSILIHKN"
FT   gene            751573..753713
FT                   /locus_tag="FTW_0775"
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase family
FT                   protein"
FT   misc_feature    751573..753713
FT                   /locus_tag="FTW_0775"
FT                   /note="contains frameshift"
FT   gene            753710..754309
FT                   /locus_tag="FTW_0776"
FT   CDS_pept        753710..754309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0776"
FT                   /product="CDP-alcohol phosphatidyltransferase family
FT                   protein"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46649"
FT                   /protein_id="ABO46649.1"
FT                   /translation="MIEQKIRPVFQRIFVDGIAKFIAPVIAPNLITLISLIVGLVAAIA
FT                   FFINQYLCIFLLLLSGYFDILDGSVARLQGSSSSFGTILDILSDRFVESFIIIAIFINQ
FT                   LDIAWVGLLMMMSIIVCISSFLLVGIFSQKESSKSFYYTPGLIERAETFIFFIVMILFP
FT                   NIVVVLGLIYTLLVLWTTLYRCYEFYVYDKQRSKFK"
FT   gene            754281..754688
FT                   /locus_tag="FTW_0777"
FT   CDS_pept        754281..754688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0777"
FT                   /product="hypothetical membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46650"
FT                   /protein_id="ABO46650.1"
FT                   /translation="MISKGVNLNEKFLNNTFIGFMAGLISACILYFIFTLIRQHGVELN
FT                   DQFKYALYRLMVWGGVWAILFALPLSKNIFIKSSIIALAVILFNFLVKMPLAGQGFFAV
FT                   NAGTEVFIMNIVFNYIWAILAGFIYKAVAGK"
FT   gene            complement(754703..755398)
FT                   /locus_tag="FTW_0778"
FT   CDS_pept        complement(754703..755398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0778"
FT                   /product="amino acid permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46651"
FT                   /protein_id="ABO46651.1"
FT                   /translation="MRINRAVTPYKQELAKKLNLFHLIAFGLNYMIPFAPAIIFGIIAK
FT                   TSGTTVSLPYLFAMIIIMSFTAFSYVYMVKRNPVAGSLYSYVESIFGKRLGFLAGWILF
FT                   LDYILVPTVVAMSATIYLQHYIPEIPYYVILCSYVLITGLFNLLGISIVANVGLILLII
FT                   MEILLIICLFVLGSSAISTSQELLSLRPFEFNSISGLFTATTLCVLSYLGYDAISTLAE
FT                   EAKNPIARM"
FT   gene            755618..756544
FT                   /locus_tag="FTW_0779"
FT   CDS_pept        755618..756544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0779"
FT                   /product="chaperone protein Dna J"
FT                   /note="GO_function: GO:0005515 - protein binding;
FT                   GO_process: GO:0006457 - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46652"
FT                   /protein_id="ABO46652.1"
FT                   /translation="MADYYSLLGVSRDASEADIKKAYRRLAKKYHPDVNKEKGAEDKFK
FT                   EIQTAYDVLGDKEKKKLYDTYGENWDKVQQGGFGGAGGGFGGFSQSGRSQSFNFEDLGD
FT                   IFGDLFGGGAGARGFGGGQPRARKGEDINISLRLNVEDAIKGGSRTVSYNYQEVGANGM
FT                   PTMQHQSVDVKIPPAMGNGKKLRVKGKGGAGIGANAPAGDLYIKIEVVDHKNYKVDGND
FT                   IYEHINIAPWEAALGTSLEIDTPYGKKKMKVPEGSQSGRKMRIKGKGLGDGDFYIVYDV
FT                   KLPLADTDEKKEFYKQMQEKMNFNPRA"
FT   gene            complement(756534..757418)
FT                   /locus_tag="FTW_0780"
FT   CDS_pept        complement(756534..757418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0780"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46653"
FT                   /protein_id="ABO46653.1"
FT                   /translation="MSIQRKAILALFIVTIFWGITFPLIKISLAYISPGLFVAIRLSLS
FT                   CLLFLPLILRAKFNNKLYLLKVGAIFGSLEGLSFYFQTHGLYTVSSSQSAFLTALSVVM
FT                   IPFIGSLFKVDRLTIYGIIASCVSLIGIYALSGASFDNFTIGYLWSVLCALMYAISVVY
FT                   LSYETRKDHRSEAFRDLRLLIILQIAFGIPLPLITDISSFIYLHFNYILIIALTFCAIS
FT                   TITCYYLQNTYQKHLSMSQVAVIFSFEPIFATIFGKLINNEKIYLSTIIGGTLILTSYF
FT                   IIEIGNRKRQSKP"
FT   gene            757609..758805
FT                   /locus_tag="FTW_0781"
FT   CDS_pept        757609..758805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0781"
FT                   /product="putative Tryptophan/tyrosine permease family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46654"
FT                   /protein_id="ABO46654.1"
FT                   /translation="MKRVSKVKQIGAIAIIAGTAIGAGMLGIPFAVAAVGFNYAVAALF
FT                   LVWIIMYATALLIIEANISQPLGTDMDSITHNILGKPGRVLNLLFYLLLLYSLLTAYIF
FT                   MGGQLFQTYILCWLNLENASLAKLLFCLIFGFFIYKGIKVVFSVNELFLSLKVLAFILF
FT                   IAFVAPQISTSLLENKVLGVEYVWFAIPILVTSFGFHIVIPAIRNYFENDIVFKRTVAI
FT                   GALAPLLVYLVWVVATLGTVSLYGNNGFIALSKAGETLAEAYQGLGQNGPLVFIRLFEN
FT                   FAIITSFLGVALALFSFNRDLYGLDIRKKLLTLVITLLPPLIFAIYFVNSFIAALGYAS
FT                   IFVSVLLIVQPAMMVWAIRTKQGKNDILSKLYLSLILFSGLGIIALQLLVAFGRLPHI"
FT   gene            758839..759195
FT                   /locus_tag="FTW_0782"
FT   CDS_pept        758839..759195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0782"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46655"
FT                   /protein_id="ABO46655.1"
FT                   /translation="MKKPNFDINKKSFPNDDLVGDEYSKSPSVEEFSIDKLKQFPNDMI
FT                   ELFKLIQAVRYDRTCLQEEYNSYRLKLNNDRMDLESEVIKIKKQYNAKICALQEEYNSV
FT                   KSNNNIELAKIREN"
FT   gene            759236..759525
FT                   /locus_tag="FTW_2079"
FT   misc_RNA        759236..759525
FT                   /locus_tag="FTW_2079"
FT                   /product="RNaseP_bact_a"
FT   gene            759564..761507
FT                   /locus_tag="FTW_0783"
FT   CDS_pept        759564..761507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0783"
FT                   /product="putative GTP pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46656"
FT                   /protein_id="ABO46656.1"
FT                   /translation="MQVIDSKLLDSDGQIKDELLISELKSFYTSDKFEIIAAALELLKN
FT                   KSAESVRHPTGISSFLYAIEMAYVLFKIRADEESVSAGILYELYNFGDISDEDIEQATN
FT                   QTVLKILQGTRKMSAIRMYRSDNISLEQIDIFRKMLLTIIEDVRIVLVKIVDKLCTIRH
FT                   LKSLSSNTQRVIARETLDIYAPLANRLGLGAIKWELEDRAFFFLQQDEYKRIAKSLGVT
FT                   RKQREDFLHQVIQELKSTLKKYNLHAGIQGRVKHIYSIYKKFKNKGYQELDDLYDITAV
FT                   RVITNNVDECYKVLAEVNNLYSPIPEEFSDYIAHPKPNGYKSIHTVVKVGEQNIEVQIR
FT                   TQQMHEESELGFAAHWRYKEGVKFDASYEARVAWLRSLLEWEKEINEDDSQITKELNKK
FT                   LYVFTPANELIDLAEGSTVLDFAYSVHTMVGHRTKGAKLNGKIVPLTTKLKTGDKVEIL
FT                   TGKEPNPSKDWASENLGYLTSARNRSRVTKWFNEQNKEDNIALGKDRLLKELRGYDLKE
FT                   VDFVEVAAKFNMKTSDSLFAAIEGGSLKTNSVVNYIIDTYSAEEKLIKKKHKVTNLKAK
FT                   APKVLVSGFDGMKYEMAKCCHPVYPDQIQGYMSVSKGVVIHTTNCPNLNHLKEKSPEKF
FT                   IEVNWDDNEEVS"
FT   gene            complement(761623..762255)
FT                   /locus_tag="FTW_0784"
FT   CDS_pept        complement(761623..762255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0784"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46657"
FT                   /protein_id="ABO46657.1"
FT                   /translation="MSKFHKNIFSVICILSFLSLAKAADTKVYSWRAENGNVVFSEEKP
FT                   NDDVDYRIIEVGQPTVIDTKAPQNLGNDKPIKINQSDVAKLASSELAEKNKEVLEDGQN
FT                   ADLSVQITSPANDANIFTKEDKIAISTNPQIASNDSPTFLINGSAIPATYEDGQWKIAR
FT                   PTPGENKLSISGRTAQGNEIKSTNEVTFYIKNGWLQQAKNTGNYSGN"
FT   gene            complement(762332..762910)
FT                   /locus_tag="FTW_0785"
FT   CDS_pept        complement(762332..762910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46658"
FT                   /protein_id="ABO46658.1"
FT                   /translation="MSYLKRLYLLTFIAALANTAYANEDDNVYTWRATNGTVVFSQTAP
FT                   IFDQEYQRIGVYHKNQIEQKIPVEQQLTYLKHNDLYLDNENPQATTTQATNQSETVKVK
FT                   IISPANGESRFVHNEKLTIILEPTLTAEDHPIFIINGIPNPAHFENDIWKVNRPNPGPV
FT                   TIAVRGRTKDHKIINSDDSEFYRRQVLGR"
FT   gene            762998..763611
FT                   /locus_tag="FTW_0786"
FT                   /note="hypothetical membrane protein"
FT   misc_feature    762998..763611
FT                   /locus_tag="FTW_0786"
FT                   /note="contains frameshift"
FT   gene            complement(763618..764343)
FT                   /locus_tag="FTW_0787"
FT   CDS_pept        complement(763618..764343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0787"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46659"
FT                   /db_xref="GOA:A4IXK7"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXK7"
FT                   /protein_id="ABO46659.1"
FT                   /translation="MQINISNLDVKNHLDKFIEDRLEYEFCKQDKYLYLENDNLKLHYN
FT                   NKELFIDFNDSEILNRINPKTKKCSVVQAIEGRSKAKLTILDTTAGLGRDTFTLAARGH
FT                   TLLTLEKDSYLYLLLKDALQRAQQINYLKEIANRITLINIDSNEYILTTDKSFDCVYVD
FT                   PMFPPRKKSAKVKQGMQILHQVGFNDEVSNSNLLDNIIQTQISPKAVVKRPINAEFLSN
FT                   KKPSSQLKGKTNRFDIYSL"
FT   gene            complement(764343..765221)
FT                   /locus_tag="FTW_0788"
FT   CDS_pept        complement(764343..765221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0788"
FT                   /product="phage integrase family protein"
FT                   /note="GO_function: GO:0003690 - double-stranded DNA
FT                   binding; GO_function: GO:0009009 - site-specific
FT                   recombinase activity; GO_function: GO:0003677 - DNA
FT                   binding; GO_process: GO:0006310 - DNA recombination;
FT                   GO_process: GO:0015074 - DNA integration"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46660"
FT                   /protein_id="ABO46660.1"
FT                   /translation="MTNLEHINNFLDNLLYLKNYSQETINNYQRDLLQLNQALSDKNII
FT                   SLTHSDILIWIKKLHAQGNSPKTLQRKLSSVRSFFNFLINSEIISQNPANGIKAPKDSK
FT                   RLPKVVNTDELAYLLDINPSNDIEARDIACFDLLYSCGIRLSELSSVELKDISISQKNI
FT                   RVTGKGNKQRIVYFGTKTLSNLNRWLKIRDSLKPSSDYLFISRDGKHLTNRSIQKRLEI
FT                   FAQKYASRHIHPHMLRHSFASHVLDSSKDLLAVKDLLGHADISSTQIYTHLNFQQLASV
FT                   FDKAHPRAKKK"
FT   gene            complement(765231..766442)
FT                   /locus_tag="FTW_0789"
FT   CDS_pept        complement(765231..766442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0789"
FT                   /product="aromatic amino acid transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46661"
FT                   /protein_id="ABO46661.1"
FT                   /translation="MNSNSKIKILGSIMIIVGTMIGGGILALPIITAKLGFVIGSILIF
FT                   VVWSIMTYTAVVISDISCSMPYGSSFKTIAEKYLGKSGGVVASIAFLILMYFISTAYIS
FT                   AAASSLSTTFPSLDEKLSSLIFVIIFGSIVVLGTRFVDYANRFFIILKILVLVILCVVF
FT                   NRYIDIPNLFVAPVDLGISLVIAIPVFTTSFTSHIIVPALSDYLGKNSKDMKRIVIIGS
FT                   IIPLILYLVWVVTILGVLPLHGPVSFMDSIFNHIPVDKANIGDILKTLGTKVRTPTTDA
FT                   VLHIFTYVAIMTSFLSVNLSLFHFNLDTYKLYKTKKVIGYSIAAVLTFAIPLIINQMDP
FT                   DIFIYAMTCVGLSIAILLMIMPALMAFKINNLGENFNYKISTYKSLWLISLVSGVIVIL
FT                   CVVA"
FT   gene            complement(766658..767689)
FT                   /locus_tag="FTW_0790"
FT   CDS_pept        complement(766658..767689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46662"
FT                   /protein_id="ABO46662.1"
FT                   /translation="MLTLLENKPRVLIVDPVASADYLIAELNKFAIEIFILFTLDRSKI
FT                   SSNFCLQSELVNQKNIFICEKTAIDVTKLTQLNIDYVICGYEDSVAIADYLMQQITNYS
FT                   NDITTSEYRNNKYLMHQVLKDNQLNHLKQEIINFKNIKISHFNYPCFIKPLDGSASVGV
FT                   AILNSQAELVDYIKKDFYSPVGRNYSEFIISEYIKGVEYAVGTFSKDGEHYVSSVQKYV
FT                   TKIHHGVPVILSFELENNKEIIAKVTEYAKIVLTKLAIRNGFAHTEIFLTAENNPVLIE
FT                   VNPRISGASGALNTLASYSGLDTQIEIFAQKIFNKEIAKKEKTFSKVLCLYNFANKPLP
FT                   DLS"
FT   gene            complement(767883..768326)
FT                   /gene="secB1"
FT                   /locus_tag="FTW_0791"
FT   CDS_pept        complement(767883..768326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB1"
FT                   /locus_tag="FTW_0791"
FT                   /product="protein-export chaperone SecB"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0051082 - unfolded protein binding; GO_process:
FT                   GO:0009306 - protein secretion; GO_process: GO:0050821 -
FT                   protein stabilization"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46663"
FT                   /db_xref="GOA:A4IXL1"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXL1"
FT                   /protein_id="ABO46663.1"
FT                   /translation="MQNNEIQPSFLIQKVYTKDVSFETINSPACFKEQWNPSSDFNIDI
FT                   NTTKINDENFELDLTITVTTKNNETNAYIAEVTQSGIFTITSMSEEQIDSVLNTYCANT
FT                   LFPYAKRIIDSSIIKGGFLPLNLAPINFDAIYLQKKSSPKREH"
FT   gene            complement(768403..770937)
FT                   /gene="mutS"
FT                   /locus_tag="FTW_0792"
FT   CDS_pept        complement(768403..770937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="FTW_0792"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0006281 - DNA repair; GO_process: GO:0006298 - mismatch
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46664"
FT                   /db_xref="GOA:A4IXL2"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXL2"
FT                   /protein_id="ABO46664.1"
FT                   /translation="MQDISNHTPMIQQYLKIKSQYQDILLFYRMGDFYELFFDDAKKAA
FT                   ELLDITLTARGKSNGESIPMAGVPYHAAEAYIAKIVKKGLSIAICEQTGDPNTSKGPVE
FT                   RQVTRIITPATVSEEAFLDNNQDSILVSIFEKNNKYYLAYTSYTQGKIYLVKTLTSLNE
FT                   LKNTVLKLSPQEIITNSHELAQQNPFKKPIKALEEWYYSNFEAKKYINDSLDTNIANNI
FT                   LNLYKNDQLTTIGSILSYLTNILKDTPRHITDISYEQEQDTLNIDINSRINLELDNNSK
FT                   SSLLSIIGKCKTSLGSRLLKRYFSNPTRNLNILATRHSIINSLGENQHFLKIQDVLSYI
FT                   SDIERIISRVALGTVKPKDLVALRDSLEQLPILKKLLSEKNTPEITNINNRIHQLDELV
FT                   TLLDKAIIENPPTTIRDGGVIKEGFDKELDELKSIKDNSYDFLIKFEELQKQKTGISTL
FT                   KVGYNRVHGYYIELSKQHADKIPTEYVRRQTLKASERYITEELKNFEDKVLSSKEKALA
FT                   REKLIYDTLLKKVIEYYKQIQETAASIAEIDVLANFAERAIKLKLSQPKFNNLAKLELK
FT                   EVRHLAIEHNIDEPFIPNDTLLSKDTNTLQIITGPNMGGKSTYMRQVAQLIFLAYIGSF
FT                   VPASYADICDIDTIYTRIGASDDISSGRSTFMVEMTETAYILNNASAKSLVIMDEIGRG
FT                   TSTFDGLALAKACAEKFAQIGAFTLFATHYFELTELAKQYPNVCNIHFEAKEYKDNIYF
FT                   MHKAVTGAAKKSYGIQVAKLAGISQDVLESAKQNLYNLEKKQQLTESTQVQAQFQLEPT
FT                   TQNPLQQKLDAIDINTITPLEALNILFELKKR"
FT   gene            771104..772051
FT                   /gene="accA"
FT                   /locus_tag="FTW_0793"
FT   CDS_pept        771104..772051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="FTW_0793"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="GO_component: GO:0009317 - acetyl-CoA carboxylase
FT                   complex; GO_function: GO:0003989 - acetyl-CoA carboxylase
FT                   activity; GO_process: GO:0006633 - fatty acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46665"
FT                   /db_xref="GOA:A4IXL3"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXL3"
FT                   /protein_id="ABO46665.1"
FT                   /translation="MNYLDFESKIKEIEDKITSLSHVFEDEKTEAEIKKLSKKRLELME
FT                   STYSKLTDWQVVQLSRHPDRPYFKDLLPLIFTDFQELHGDRTFGDDLAVIGGLAKLNNK
FT                   PVMVIGQEKGRDTKSKIKHNFGMMHPEGYRKALRLMKLAEKFNMPVVTFIDTPGAYPGI
FT                   KAEERGQSEAIARNLLEMSALKVPVVCIVIGEGCSGGALGIGVGDRLLMLQYSYFATIS
FT                   PEGCASILHKTAEKASEVTQMMNITSGRLKELKIVDEVIPEPLGGAHRDYETTATNIRK
FT                   AVAAELKILSEMTVEQRNSRRYDKLMSFGRFKEA"
FT   gene            772071..772574
FT                   /locus_tag="FTW_0794"
FT   CDS_pept        772071..772574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0794"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46666"
FT                   /protein_id="ABO46666.1"
FT                   /translation="MLLQQIKSQAGFGIVESMLAALILLFVLSSGFLLLNSVLVNITLE
FT                   NKKDEIATILDERVSIYRLTGVFDDTKTKDGIEFIKTVVLEKQNEAKPEENLETVNRFK
FT                   PLSVADIRKMAEKADKKNQKAAANDVDIIYKVVNIAAIDNQLGVADCVKIIEREVKQDD
FT                   NQAQ"
FT   gene            772555..773568
FT                   /locus_tag="FTW_0795"
FT   CDS_pept        772555..773568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0795"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46667"
FT                   /protein_id="ABO46667.1"
FT                   /translation="MITKRNNKAAGFTLPELMVSMVIAAIVMAMAIGIYIDMKKQYIKL
FT                   SDKHKINTNQLLIKQIFYNAIGHSGFTTKYGDIYQQLVDNSGDNFGDIFGNMGVITIGK
FT                   APIQNLEGLPKGLSLSVEACKERMLQDEDLKNMNINESIHCVQPDTDFLIIQRSSLDST
FT                   LKTNSSNNIFKINEFQKGTPPEKDLKANDYLVLCNAFECELVKVGAVTLDFISTTKLVE
FT                   DKFKIGDYVGKYILEVFFIAASGKKDKDGQEIYSLYEYVKQNSADSEIYELIDNVSDLK
FT                   IEYVLNSDIHQGSAKLKWQSPQQQPIKVKSSTIAALKISFKVSDQPTSKIFLLSQV"
FT   gene            773577..775541
FT                   /locus_tag="FTW_0796"
FT   CDS_pept        773577..775541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46668"
FT                   /protein_id="ABO46668.1"
FT                   /translation="MYKSLNTKVSGSALLMALIFSFVIMVMLTGLLYTFKMGLLTTKSI
FT                   IKNNNEKVLGETYISKVRDDINFTKSAELEIGDSKFQIIVNKDDVSSFFPNNTNAELFQ
FT                   SQQYNSYDVIYKAFNLGTHVDLTERIIYNALVANSYQNFDGDFIPINVPMINPDAMTDY
FT                   QERIYRLKSDGTIDDMPKGFIELIQKQNRQLSIFTKNAKIGVPIPEKMATDYKVKVGWN
FT                   LEKGKWRLYLLLYDTDKLFTTDILLDDLLDEEKVKGLEADNEALGNQIGKWQAVISGGG
FT                   REMSSAGEQFIKNGIIDVVWYFDKNDAPPELMMVRSVRQNQTGSDTKKKTSKFKKITRQ
FT                   QLEIYYSEYSSGNKNYVVKLADRLEFKEELNEDTVKLLVPDMASNLEANMVLIFHPNEQ
FT                   SKTLMGISDFNYNGDHRVGKSLDTYIDGESFGKPVIVSKSNDSMYIITFEPNKLHRYEY
FT                   KKGFGSFISLEFGSNGLEKEFDFDSENNGDMVVVGLSNSKKEDDKKDAGIQLVVPKFGY
FT                   LFVFTPDKVMQLNYDFEILQEIDLGVSNPQILADFDAVKNTINKIYIQSEALEVKAQEI
FT                   SDELGDEAKPQDSSEINDKNKSSSQNKSKPKSITERKKQELAKNNAKAKDEEDNQPAER
FT                   IYLDTKYLYPLGIVKEVKL"
FT   gene            775538..776422
FT                   /locus_tag="FTW_0797"
FT   CDS_pept        775538..776422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0797"
FT                   /product="sugar isomerase (SIS) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46669"
FT                   /protein_id="ABO46669.1"
FT                   /translation="MNILENINTEKRNPRSLNLDSMSIAEAVSLMIDEEYGVIEALKEQ
FT                   HRNITEVILATSYSLRNGGRIIYIGAGTSGRLGILDAVECPPTFSVDYNTIVGLIAGGE
FT                   KAFIQAQEGAEDDANFGKEDLQSINLTAKDIVIGIAASGRTPYVIGALEYANSIGATTV
FT                   AISCTKQAKISKYAKYSIEAVPGPEVLTGSTRLKAGTTQKLILNMISTLSMVSVGKVYQ
FT                   NLMVDVKPTNQKLIERSKNIICEATGVDYTTAEKFYLKANKSVKVAIVMILNNCDYEKA
FT                   LAILKNNNNFIKS"
FT   gene            776424..776819
FT                   /locus_tag="FTW_0798"
FT   CDS_pept        776424..776819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46670"
FT                   /protein_id="ABO46670.1"
FT                   /translation="MRLLILFIAVMFSFDSYATIYEKYQNGVPEFSNQQSQGAKQLNLS
FT                   DDPVSVIDMNSIPHTIVWGRAQQQQYLPYSQPQEDTLQGAFPEEFTDNYFDFYGRNYQY
FT                   HSLMSSTMGVSMYAPFGANNMRLQRNY"
FT   gene            complement(777113..777241)
FT                   /locus_tag="FTW_0799"
FT   CDS_pept        complement(777113..777241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0799"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46671"
FT                   /protein_id="ABO46671.1"
FT                   /translation="MIPQQKIENDKTKFVYLIIYRYHSHNEFTPGRNHINPFESFW"
FT   gene            777310..777936
FT                   /locus_tag="FTW_0800"
FT   CDS_pept        777310..777936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0800"
FT                   /product="hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46672"
FT                   /protein_id="ABO46672.1"
FT                   /translation="MQKSCKKCILSLAIAVIILILIACSPVFASKMTLKCTTSLPTFGY
FT                   KYREDNAIFEQLPSDLPNNLDCDLSPNEIESIYNLVLKSLQFSNVRSSSKQKVVLLVGQ
FT                   PGAGKSSVSNLIHQRMGSDGIININFDELMTFHPKYYHLTSHHIPRIYATIEMKKIISF
FT                   ASILREKLIKYCVEKRYNILFENGFTEHAATQEIPNIVNKFNIKK"
FT   gene            778032..778346
FT                   /locus_tag="FTW_0801"
FT   CDS_pept        778032..778346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46673"
FT                   /protein_id="ABO46673.1"
FT                   /translation="MFESQHYDGPRRLSDVNSSNRADQFRHSVISLEQNKNLFSLISKI
FT                   TLLDRYANIYFETEDTKNIENFYVKFQELFDKDVRQQLLKEFEDFVSLFSKVYPIWLIS
FT                   "
FT   gene            complement(778733..780031)
FT                   /locus_tag="FTW_0803"
FT   CDS_pept        complement(778733..780031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0803"
FT                   /product="monovalent cation:proton antiporter family
FT                   protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane
FT                   [Evidence ISS] [PMID 11152613]; GO_function: GO:0005451 -
FT                   monovalent cation:proton antiporter activity; GO_process:
FT                   GO:0015992 - proton transport; GO_process: GO:0006812 -
FT                   cation transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46675"
FT                   /protein_id="ABO46675.1"
FT                   /translation="MSEYFLFSLLTVVAALMSYINTKFLKLPKAIGLTILSITFSALCA
FT                   SFLSPSNFLVVALSSFDFKKTVLDGMLSFLLFANALHFNMIDLKKELKAIFGLASIGLL
FT                   LSALTTAILIYGFCLLVGFEISLGYCLVFGALISPTDPIAVISTLAGNKSIPKHIKTRV
FT                   VGESLFNDATGIVLFVVLSNIVFFGSGGEFGQAINGHGIEYIWIIAKQIGSEAGGGILL
FT                   GYIFARVALIFLKTNQDSETSIFVTLAVASMGYVIAHSLNVSGPIAMVVAGLFIGNNLS
FT                   DRKKTSPDQVEKLDNFWMVIDNMLNSFLFILIGLELTSIPFNHGAFWVGAAGIFIVTFA
FT                   RLVSISIPITVIDKKLTRASAKDNLLVAWSGVRGGISLALALSLPDEGNVIVSITYTVV
FT                   ILSILAQGSTLKIVLNIIYPHNITKKAANTVDN"
FT   gene            779841..779978
FT                   /locus_tag="FTW_0802"
FT   CDS_pept        779841..779978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0802"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46674"
FT                   /protein_id="ABO46674.1"
FT                   /translation="MKSKLDKATTKKFDGLKNEAHSAEKVIERIVKPIALGNFRNLVLM
FT                   "
FT   gene            complement(780041..780766)
FT                   /locus_tag="FTW_0804"
FT   CDS_pept        complement(780041..780766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0804"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46676"
FT                   /protein_id="ABO46676.1"
FT                   /translation="MQKLDNIIIANYSIHSLALICWAKQNLSGNFCILSVDTGFAAANW
FT                   NSYLEAVFDWLTKENISYFHLKSENTFQELVLARKQFPSQQFSWCASFLKGITLLNKID
FT                   ELDANGNATILLSHRSDMSSISRLLKNLDEEERYDYRPLAYPLLNHSYDDILDLTKELP
FT                   FKAAKYSLECQPCIHLTQQQFKILTKEDIEKVTDLEVKTNSFMFGDMPFDKLDDGFFTQ
FT                   KDLLEELSKACSWEYSCGL"
FT   gene            complement(780768..781772)
FT                   /gene="trpS"
FT                   /locus_tag="FTW_0805"
FT   CDS_pept        complement(780768..781772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="FTW_0805"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004830 - tryptophan-tRNA ligase activity; GO_process:
FT                   GO:0006436 - tryptophanyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46677"
FT                   /protein_id="ABO46677.1"
FT                   /translation="MSQKITLTGVTPSGTPHLGNYIGAIKPAIEMIKNDQYKCMYFIAD
FT                   QHSLIKLWDKKLRQQYIYEIAASWLALGLDPDKAYFYRQSDIPEIMELTWIISTTTAKG
FT                   LLNRAHAYKALVDQNLQEENADPDKGITMGLFNYPVLMAADILIFDADLVPVGKDQIQH
FT                   IEIARDIANRFNHIYQKPVLKAPQALTSEDSQTILGLDGRKMSKSYDNTIAIFSTEKKL
FT                   RKQVMKIITNSQMPEEKKDPNNCTIFAIYKSIASQTEIAALEEKYLAGGLGWGDAKQIL
FT                   FEKINEYLRDAREKYDYYINNPKIVDDILNQGAVKVRPLAKDKLKEVKDIIGM"
FT   gene            complement(781872..781946)
FT                   /locus_tag="FTW_2051"
FT   tRNA            complement(781872..781946)
FT                   /locus_tag="FTW_2051"
FT                   /product="tRNA-Gly"
FT   gene            complement(781961..782037)
FT                   /locus_tag="FTW_2042"
FT   tRNA            complement(781961..782037)
FT                   /locus_tag="FTW_2042"
FT                   /product="tRNA-Arg"
FT   gene            complement(782069..782683)
FT                   /gene="coaE"
FT                   /locus_tag="FTW_0806"
FT   CDS_pept        complement(782069..782683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="FTW_0806"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004140 - dephospho-CoA kinase activity; GO_process:
FT                   GO:0015937 - coenzyme A biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46678"
FT                   /protein_id="ABO46678.1"
FT                   /translation="MSFINTYPIGITGGIASGKSTATRILKEKLNLNVVCADTISREIT
FT                   KKPSVIKKIAEKFGDEIVMNKQINRAMLRAIITESKEAKKWLEDYLHPVINKEIKKQVK
FT                   ESDTVMTIVDIPLLGPYNFRHYDYLKKVIVIKADLETRIRRLMERDGKNRQQAVAFINL
FT                   QISDKEREKIADFVIDNTELTDQELESKLITTINEITNLTN"
FT   gene            782812..783948
FT                   /locus_tag="FTW_0807"
FT   CDS_pept        782812..783948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0807"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46679"
FT                   /protein_id="ABO46679.1"
FT                   /translation="MSLKNIILERIKSSKQPLLFRDFMQMALYYPQLGYYSRAKEKISS
FT                   QGDFITATSQTSLFARTFARQFATIISQLGNDCSVIEFGAGNGKFAADCVDELESLAIL
FT                   PKRYIIVELSNDLRLRQQQYIKENLSHLYDRFIWLDKLPAEKIKAIVFANELLDAMPVD
FT                   IFRSENNKLIQQGVIRKGDTFEFSDMPKNDVRFEYESTKILNDGITFNDGYTSEINTWI
FT                   RPWVKSLREVLSQGIVFLCDYGYHRSLYYSKDRYMGTLACYHQHHVNFEPFINIGEQDI
FT                   TAHVDFTTVAEAAIEEGFQLDGFMTQANFLKRANIAEVFSNISQRLSTNQLLKYSNDIK
FT                   DLLLNYKLAEVFKVMAFSLDFDFVLEVFDNQDNIDYLL"
FT   gene            784248..786929
FT                   /gene="aceE"
FT                   /locus_tag="FTW_0808"
FT   CDS_pept        784248..786929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="FTW_0808"
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46680"
FT                   /protein_id="ABO46680.1"
FT                   /translation="MSDFTKDIDVLETQEWLEAFEDVIKREGADRAKFLFEQLLAKGSE
FT                   LGIKSAYSTAKVKNYVNSIDVSEQPSYPGDIELEQKIEAINRWNSTVIVAAANKKDGSI
FT                   GGHIGTGAGAMTLYEVGFNHFWKAPNDEHAGDLIFYQGHLSPIVYARSFLEGRITAEQL
FT                   ENFRKQAFNGQNAVSSYPHPYLQPTYWQFPTVSMGLGPLQAIYQARFMKYLEARGLAKT
FT                   SDRKVWAFCGDGEMDEPESIGSITRAGREGLDNLIFVVNCNLQRLDGLVNGNGNIVEEL
FT                   ADVFAGAGWNVIKVLWSSDWDKLLQDPRGGKKLAQRLSELNDGQFHTIKAHGGAECRRV
FT                   VFSGDEDLEALAKDMTDDDIQALRRGGHDPLKIYAAYKKAVENPNGRPTLILPMTVKGY
FT                   GLGEWGESKNIAHNVKKLDTDALEHIKNRFNVPASKEDIENYRLIKLDENSPEMKYLHS
FT                   KRKDLGGYIPKRLENKQALEIPSYKDFAKSLLDDSGDREFSTTTAFVRILSHLAKDKNL
FT                   GKHIVPITVDESRTFGMEGLFRQLGIYNPHGQQYVPEDKQQVMFYKESVDGQILQEGIN
FT                   EQGGFCSWIAAATSYSVHKVPMIPFMIYYSMFGFQRFGDLAWAAGDSMAKGFVIGGTSG
FT                   RTTLNGEGLQHEDGHSHIQAGLIPNCISYDPTYAYELAVILGEGMKRMYVDGDHVYYYI
FT                   TVMNENYSHRAMPEGCEEGIIKGLYKLDEEKKPASKHVQLLGSGSILREVEAAAKMLKE
FT                   EYGITSNVWSMTSANELYREAKDVARANMLHPTAEKKESYIEKCFKNEQGPVIASTDYI
FT                   KLYTDQLREFIPHAFVNLGTDGFGRSDTRAALRSFFEVDRYHVVVASLYALYLDGKVEA
FT                   SEVKAAIEKYNIDPERMAPFYS"
FT   gene            786947..788842
FT                   /gene="aceF"
FT                   /locus_tag="FTW_0809"
FT   CDS_pept        786947..788842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="FTW_0809"
FT                   /product="dihydrolipoamide acetyltransferase component,
FT                   pyruvate dehydrogenase complex"
FT                   /EC_number="2.3.1.12"
FT                   /note="GO_component: GO:0045254 - pyruvate dehydrogenase
FT                   complex; GO_function: GO:0004742 -
FT                   dihydrolipoyllysine-residue acetyltransferase activity;
FT                   GO_process: GO:0006086 - acetyl-CoA biosynthesis from
FT                   pyruvate"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46681"
FT                   /protein_id="ABO46681.1"
FT                   /translation="MSIEIVKVPDIGDYDNVDVIEVNVAVGDVIAEEDSLITLETDKAS
FT                   MEVPSPFAGKITKLTVKVGDKVSQGTAIMEVEVESAADQAATTQSQPQTTSSAPVAATT
FT                   NQIVDVEVPDIGDYDSVDVIEVSVKVGDEIAEEDSLITLETDKASMEVPSPVAGKVVEV
FT                   ITKVGDKVSQGSLILKVETGSSAQAPAQEQSQQSAPVKSAAEEIIDVKVPDIGDYDSVD
FT                   VIEVSVAVGDKIEEEDSLITLETDKASMEVPSPVAGEVVEIITKVGDKVSQGSLILKVK
FT                   TQGSAPVELTSSQPASAKQEQAKQQAATPAAPTPASSSVNEYAVDNSNAHASPAVRKLA
FT                   RILNIDLSKVKATGRKGRVTKEDCYNYIKHAVTQVQTGKVAASGSGLDLLDDPVVDFAK
FT                   FGEIETQPLSRINKISAKNLHRNWVKIPHVTFYDDADVTDLEEFRNAKKAFAEKKGIKI
FT                   TPLSFLVKAAAVALQEFPRFNSSLSNDGENLIIKKYYNIGFAADTPAGLMVPVVKDADK
FT                   KGIIEISKDIMELAGKARDGKLGAKDMTGATFTISSLGVLGTTSFTPIINMPEVAIMGV
FT                   SKTAVKPIWNGKEFIPRTMLPLSLSTDHRVIDGALAAKFLTRYCQILSDLREIIM"
FT   gene            788856..790268
FT                   /gene="lpdA"
FT                   /locus_tag="FTW_0810"
FT   CDS_pept        788856..790268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="FTW_0810"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="GO_function: GO:0050662 - coenzyme binding;
FT                   GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_function: GO:0004148 - dihydrolipoyl dehydrogenase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46682"
FT                   /protein_id="ABO46682.1"
FT                   /translation="MSDIKTQVVVLGSGPGGYSAAFRAADLGLEVVLVERYAEIGGVCL
FT                   NVGCIPSKAMLHIAKVINEARHLESLGIIEMGGLKINRENLLKYKDGVIGKLTGGLKGM
FT                   AQMRKVKIVQGYGKFTSDKELAVEAADGKVTKIAFDNCIIAAGSSVIKLPFVPEDDRII
FT                   DSTGALEMKEIPETMLVVGGGIIGLEMAQVYSELGTKITVVEFADQLMNGVDKDLVKAY
FT                   QKVNSRYDVRLKTAVTAMEAKEDGIYVTMEGDHPAKDERFDRVLMAIGRKPNGKLIDAE
FT                   KAGVKVDERGFIPVDKQLRTNVPHIFAIGDIVGQPMLAHKAVPEGRTAAEVISGLNHSF
FT                   DPLVIPSVAYTDPEVAWVGETETSAKAKGIKYEKGVFPWAASGRSLSIDRSEGMTKILF
FT                   DENHKIIGASIVGTHAGELISEAALAIEMGCDAEDIALTVHPHPTLSESLMMATEVYEG
FT                   TATDLPPQKKKK"
FT   gene            790622..791502
FT                   /locus_tag="FTW_0811"
FT   CDS_pept        join(790622..790951,790951..791502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="FTW_0811"
FT                   /product="transposase ISFtu1"
FT                   /note="programmed frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46683"
FT                   /protein_id="ABO46683.1"
FT                   /translation="MPSYSQYFRDIVINKYEEGMTEFELSKFFNIDKRTVVSWIEFYKR
FT                   TGDYSSKQGVGCGRVASFTDKTLIEQYLIDHPDASALDIKEALAPNIPRSTFYDCLNRL
FT                   GFSFKKKTPKYKQRKEHERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPS
FT                   YGEVLAYQTQRRSIVAGYNYADKKIIAPLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIV
FT                   MDNASFHKSSKLIEIANKFDVQILYLPPYSPDLNPIEKVWANFKKIFRKVNNSFEKFCD
FT                   AISYVFNKILSD"
FT   gene            791719..791907
FT                   /locus_tag="FTW_0813"
FT   CDS_pept        791719..791907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0813"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46684"
FT                   /protein_id="ABO46684.1"
FT                   /translation="MRKQKKKNISSDAWLSKKIKFTIVGFVFTIPFITVTFKEINFSIN
FT                   VTINGSINTPSSLIKKI"
FT   gene            791904..792765
FT                   /locus_tag="FTW_0814"
FT                   /note="putaitve retron reverse transcriptase"
FT   misc_feature    791904..792765
FT                   /locus_tag="FTW_0814"
FT                   /note="contains frameshift"
FT   gene            complement(793525..793601)
FT                   /locus_tag="FTW_2059"
FT   tRNA            complement(793525..793601)
FT                   /locus_tag="FTW_2059"
FT                   /product="tRNA-Val"
FT   gene            793733..794287
FT                   /locus_tag="FTW_0815"
FT   CDS_pept        793733..794287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0815"
FT                   /product="fatty acid hydroxylase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46685"
FT                   /protein_id="ABO46685.1"
FT                   /translation="MNITKVKKLLSTGYWSDFYIYPLAAIIFLIYGSKLLNFNLKSIIV
FT                   LFLIGIILGSFLEYFIHRVIFHHCHIFKELHQLHHDKPIELIGSPTYVSLPVYTICVFV
FT                   PLCFISNLAYACVIFSAFLFDLLFYFIIHHITHHVRTKKGSILHWYKKYHATHHKNPNV
FT                   NFSVAFPIWDIVFRTKGKQKD"
FT   gene            794362..796515
FT                   /locus_tag="FTW_0816"
FT   CDS_pept        794362..796515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0816"
FT                   /product="Putative RNA methylase family"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46686"
FT                   /db_xref="GOA:A4IXN4"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR017244"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXN4"
FT                   /protein_id="ABO46686.1"
FT                   /translation="MQKFTFFVSCAKGIELLLKDELERLGISSQEKLAGVEFEGSIKDA
FT                   YKVCIYSYLASQVMLKVATDKVINQQDLYEFISSINWMDYFAVDKTFKIIISGKHYDFN
FT                   NTMFVSQKTKDAIVDQFRNVTNQRPNIDTENPDNVIKLHLHKQFVNVFLCLNIDSLHKR
FT                   SYRQFQGQAPLKESLAAAILIKAGWLEELKKHQPILIDPMCGSGTILIEAALMAKNIAP
FT                   VLLNKEFKIFNSKFHNQELWDNLLEIAKNSQKVTNAIICGFDIDNNVLDKAQRNIYQAG
FT                   VEDVVTVKRQDIRDLENEFESEGLIVTNPPYGERLYGDQLDELLDIFNGFGDRLSQDFY
FT                   GWKVAVLTSFADSIKEMQLRTTERNKFYNGAIETILYQFEINEHAKFKHETQLEKNIRI
FT                   AEASAQKSDEHIDFANKLKKNLKSLKPWLKQTGLECYRLYDADIPTFAVAVDVYSEHIF
FT                   LQEYRADATIDQNIAKQRFYQAIYQIHKTLDIKYENIHTRVRQRQKGKEQYQKENDKNK
FT                   FHIINEFDAKFYVNFDDYLDTGIFLDHRKIRQLVAKAAKNKTLLNLFSYTCTASVHAAL
FT                   KGAKTTSVDMSNTYLEWGKNNFTLNNIDAKKHSFIQADCISWLKTNKDKFDVIFLDPPT
FT                   FSNSKRMDDILDIQRDHELLINLAMDSLKKDGILYFSNNYRRFKMSPQILEKFNCENID
FT                   KICLSRDFLSNKNIHNCWEIKYK"
FT   gene            796641..797015
FT                   /locus_tag="FTW_0817"
FT   CDS_pept        796641..797015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0817"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0817"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46687"
FT                   /protein_id="ABO46687.1"
FT                   /translation="MYAVILVIIFAVCVYFFTSNNEAETKGVYLPKYSAELPPTDPSQV
FT                   RVYNLQYQSDTQGNIGQVRTSTHVSNEKDFQKLCDKNLKEAIKLAAQHGAHEIKYICLY
FT                   PEGQINELSSVQLRGYAFRD"
FT   gene            797020..797961
FT                   /gene="fmt"
FT                   /locus_tag="FTW_0818"
FT   CDS_pept        797020..797961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="FTW_0818"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004479 - methionyl-tRNA formyltransferase activity;
FT                   GO_process: GO:0006431 - methionyl-tRNA aminoacylation"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46688"
FT                   /db_xref="GOA:A4IXN6"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXN6"
FT                   /protein_id="ABO46688.1"
FT                   /translation="MKKLNIIFAGTPDISAQVLKDLYKSQHNIQAVLTQPDRAKGRGKK
FT                   VQFSPVKEVALANHTPVFQPLSFKKNPEVLEQIKQLKPDVIVVIAYGIIVPQEFLDIPR
FT                   YGCLNIHVSLLPKWRGAAPIQRAIQAGDTKTGVCIMQMDAGLDTGDILNTLEIEIQETD
FT                   TSQTLHDKFAKLSIKPLLETLEKIEIIKPEPQQGEPTYAHKITKQEGLIDFTKSAWQIS
FT                   CHIRAFTPWPGAYFILDDEAIKVGEFEILYQNTDNRKAGTIIDIYRSGFDIATSDKIIR
FT                   FRQLQFPNKKMLNIVDILNGKDLDKYIGYKLG"
FT   gene            797965..798939
FT                   /gene="gshB"
FT                   /locus_tag="FTW_0819"
FT   CDS_pept        797965..798939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="FTW_0819"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /note="GO_function: GO:0004363 - glutathione synthase
FT                   activity; GO_process: GO:0006750 - glutathione
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46689"
FT                   /protein_id="ABO46689.1"
FT                   /translation="MKVGFIIDNLNSFNISKDSTYMMLHAAQDKGWEIYTFYLNDLSII
FT                   NGKPKGDALKIKIHKTKQDWYEILSQRHDFSLLDLDCIFMRKDPPFNMEYIYVTYMLDL
FT                   AKKNDVLVVNNPQALRDFNEKVAISNYPKFAPHTLITRSYKQINEFYEKHKDIIVKPLD
FT                   GMGGSSIFRIKEGDKNKNVILEILTQHQSRYIMVQDYQKAIKEGDKRILIVNGEPIKYL
FT                   LARVPSDSDNRGNLAAGATAEVRELQDSDYKIAKKVAKKLKKEGVMFAGIDVIGDKLTE
FT                   VNITSPTGIQEIYKATKINAASLLMQAVEKKINKMRQEHENGE"
FT   gene            798929..800224
FT                   /gene="hemL"
FT                   /locus_tag="FTW_0820"
FT   CDS_pept        798929..800224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="FTW_0820"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0042286 - glutamate-1-semialdehyde 2,1-aminomutase
FT                   activity; GO_process: GO:0006779 - porphyrin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0820"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46690"
FT                   /db_xref="GOA:A4IXN8"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXN8"
FT                   /protein_id="ABO46690.1"
FT                   /translation="MENKSNSQILFAEAQQYIPGGVNSPVRAFKSVGQEFPRFIKFAKG
FT                   AYLYDVDWNKYIDYIGSWGPMILGHCDDDVLEAIQCQVKNGLSYGAPCKQEVDLAKKII
FT                   ELMPNIEQVRFVNSGTEATMSAIRLARAYTCRNKIIKFEGCYHGHADEFLVAAGSGALS
FT                   LGQPNSPGVPEDVVKDTLVASFNDMESIQALFEKYKDEIACIIVEPIAGNMNMIFPQDD
FT                   FLAKLRAICDQNSSLLIFDEVMTGFRVALGGAQSIYNVKPDLTTLGKVIGGGMPVGAFG
FT                   GRKEIMQKVSPAGPVYQAGTLSGNPIAMTAGIKTLEKISQPGLFDELGAKAQKLVDGLN
FT                   EAAKAYDFNFHAKCLGGMFGLFFCSDKIAVNTFVDLGKTNLKMFNQFFAYMLDNGVYLA
FT                   PSAYEAGFISIAHSDEDIEKTICLAKKFFQEN"
FT   gene            complement(800245..801912)
FT                   /locus_tag="FTW_0821"
FT   CDS_pept        complement(800245..801912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0821"
FT                   /product="Glycosyl hydrolase, family 3"
FT                   /EC_number="3.2.1.-"
FT                   /note="GO_function: GO:0004553 - hydrolase activity,
FT                   hydrolyzing O-glycosyl compounds; GO_process: GO:0005975 -
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0821"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46691"
FT                   /protein_id="ABO46691.1"
FT                   /translation="MSTNSNIRQKLGQLIMMDFRYWGEDSNNQRIPFTKTNDIVNKIFK
FT                   DYNLGGFILFRENIQNNEQVISLLRDLQANTNTPIFFATDQEGGRVNRLQQGTSGCGNM
FT                   ALAATDNPHNAYTMAKIIGDELYSLGININFAPAVDVNSNKNNPIIGVRSYSDNPDIVI
FT                   DYAKNAINGYHDAKIIDCIKHFPGHGDTATDSHLGNVNLDKTLKELQTTELLPFSKLAR
FT                   DCSMIMTAHISVPALDDTQYQSVSTSENIYVPATLSYKIITKLLKQQMKFDGLVVSDAM
FT                   DMHAIAKHFGTIEASKLAILAGIDILLMPVRVWSENDLYKLEELFCELEKGYNQNSNFA
FT                   NAVDNVYTNITDFKAKHKLDESLIFKLSQDEQLKYANQIVNSNKHQQIALDIAKQSTTV
FT                   VKNSGIIPCDLNKLKNILIVDSDNQRLADFHSELQKIVLDNNSNVIINCENINNHNIKT
FT                   IIENADLILLISANLREYNQTYSYITSIKPEQTINIAALTPYDINYIDNIINYVCIYGA
FT                   TSMDQTNYTKTSLKINIQTTLENIFGNKEIKGVLPVSL"
FT   gene            complement(801973..802755)
FT                   /locus_tag="FTW_0822"
FT                   /note="beta-hydroxybutyrate dehydrogenase"
FT   misc_feature    complement(801973..802755)
FT                   /locus_tag="FTW_0822"
FT                   /note="disruption due to premature stop"
FT   gene            complement(802777..803504)
FT                   /locus_tag="FTW_0824"
FT                   /note="acetoacetate decarboxylase"
FT   misc_feature    complement(802777..803504)
FT                   /locus_tag="FTW_0824"
FT                   /note="contains frameshift"
FT   gene            803655..804889
FT                   /locus_tag="FTW_0825"
FT                   /note="major facilitator superfamily (MFS) transport
FT                   protein"
FT   misc_feature    803655..804889
FT                   /locus_tag="FTW_0825"
FT                   /note="contains frameshift"
FT   gene            804939..805790
FT                   /locus_tag="FTW_0827"
FT   CDS_pept        804939..805790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0827"
FT                   /product="ROK family protein"
FT                   /EC_number="2.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0827"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46692"
FT                   /protein_id="ABO46692.1"
FT                   /translation="MVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVI
FT                   NTIAKVFTSEVEGIGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDN
FT                   DANCFAIGQRLYGKGKQYENFVGITIGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDG
FT                   ILEDYCSGQFFIKKIGVEGVEILKRARNNDKDAINIYKQFGKHLGVAIKSIMYTLDPEV
FT                   IIIAGSIISAREFFEKAMWDEIKTFAFTQSAKKIKIEWSETEGDFQVFGAAAVYLDRSS
FT                   NL"
FT   gene            805813..806775
FT                   /gene="birA"
FT                   /locus_tag="FTW_0828"
FT   CDS_pept        805813..806775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="FTW_0828"
FT                   /product="biotin-(acetyl-CoA-carboxylase) ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="GO_function: GO:0004077 -
FT                   biotin-[acetyl-CoA-carboxylase] ligase activity;
FT                   GO_process: GO:0006464 - protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0828"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46693"
FT                   /protein_id="ABO46693.1"
FT                   /translation="MNKTQLQILTFLDDEKYVSGEDIAQKLGISRAAISKNIKALKDSY
FT                   QITVSSNSRVGYRLQEKLDLIKVDELAKFFKNINYFYSVDSTSKYAIENQANFSESAIF
FT                   ISEFQTDGFGRFKRRWISPFGKNIYCTMLEIVELDISKLNGLSLVVGISIARVLKNINL
FT                   NAKLKWPNDIYVDDKKIAGVIINVSAEINGRAKLFIGFGININMQYNEEISKDWTSIKL
FT                   QSQRHANRTNLTIQIVKAIKEDLSVFIDKGFTHFKNEFESLNYLKDKVFSFALADKTYN
FT                   NCSYVDLANNGEILIKNSEGNYSFSSGDISILDKSIKSK"
FT   gene            complement(806718..807395)
FT                   /locus_tag="FTW_2081"
FT   CDS_pept        complement(806718..807395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_2081"
FT                   /product="dethiobiotin synthetase"
FT                   /note="inferred from blast alignment with NRAA database"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_2081"
FT                   /db_xref="EnsemblGenomes-Tr:ABO47478"
FT                   /db_xref="GOA:A4IXP2"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXP2"
FT                   /protein_id="ABO47478.1"
FT                   /translation="MKKFFIIGTDTEVGKTYISTKLIEVCEHQNIKSLCLKPVASGQSQ
FT                   FSELCEDVESILNAYKHKFTAAEINLISFNQAVAPHIIAAKTKVDISIENLKQFIEDKY
FT                   NQDLDILFIEGAGGLLTPYSDHTTQLDLIKALQIPVLLVSAIKVGCINHTLLTINELNR
FT                   HNIKLAGWIANCNDSNIKYIDEQINTIEELSGYKCSAKISRNADYLDFIDLSKILISPE
FT                   ENE"
FT   gene            complement(807399..808136)
FT                   /locus_tag="FTW_0829"
FT   CDS_pept        complement(807399..808136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0829"
FT                   /product="putative biotin synthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0829"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46694"
FT                   /protein_id="ABO46694.1"
FT                   /translation="MSIYDQIRGNFSKATEYSKNSAIQNQVRQLLLEQTLNYSRLVNYN
FT                   HINIILNLGVRDLSEPSELNRIFSPNQIDACDIALSKNSHNMSNIKMLKINFDKDLRLL
FT                   KNDYDLIFSNMSFQWSQNIEKLIRNLTKKLNNRAILAFTTLLDKNFHQIKDILRVNKMH
FT                   SCSNILDFIKRSNLKCLHHEDLYLDVRFNNFRELANHLKSTGVNTYTGNDNKQNFSSIR
FT                   KLCLSSNHINLSYHVGLFICFKE"
FT   gene            complement(808114..809241)
FT                   /locus_tag="FTW_0830"
FT   CDS_pept        complement(808114..809241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0830"
FT                   /product="aminotransferase, classes I and II"
FT                   /EC_number="2.-.-.-"
FT                   /note="GO_function: GO:0008483 - transaminase activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0830"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46695"
FT                   /protein_id="ABO46695.1"
FT                   /translation="MLNLQDKYTQYQRDNLLRELTPFIKDDSIIDFTTSDYLNLSSAHN
FT                   LKHAIVNGFDKYGFGSKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIY
FT                   STLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYKHQQLSQLQDIYDGKSFITTEGVFS
FT                   TSGSITQLDKLAKITPEKLIVDEAHSFGVLGKNGRGAINSFRISYKNCPICVFPLGKAF
FT                   GGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENANDNRARLQQNI
FT                   TFFNELCDAKDLELVSKDLSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKDQ
FT                   AILRFSLHSNNTFDQIQQALKIISKEVKYEYIRSN"
FT   gene            complement(809235..810176)
FT                   /gene="bioB"
FT                   /locus_tag="FTW_0831"
FT   CDS_pept        complement(809235..810176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="FTW_0831"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="GO_function: GO:0004076 - biotin synthase activity;
FT                   GO_function: GO:0003824 - catalytic activity; GO_process:
FT                   GO:0009102 - biotin biosynthesis; GO_process: GO:0008152 -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0831"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46696"
FT                   /db_xref="GOA:A4IXP5"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXP5"
FT                   /protein_id="ABO46696.1"
FT                   /translation="MTLQQIKEIYSRPLTELILQALEIHNKNFGNDIELCSLKSIKTGT
FT                   CPEDCKYCPQSGHYNTSIEKHKLLDKDSILAEAKNAKDAGSKRFCMGAAWKHIPKKDFD
FT                   QVAEIITEVKNLGLETCVTLGSINADEATKLKQAGLDYYNHNLDTSREFYPEIITTRKF
FT                   EERIETIRNVANADINVCCGGILGMGESLDDRFNLLLELLQLPAAPKSIPINTLIPVKG
FT                   TPLGDKYTNAQIDSFELVRFIATTRILFPQARLRLSAGRENMSLETQTLCFLAGINSIF
FT                   YGNKLLTENNATVNSDNFLLAKLGLKSNAELC"
FT   gene            810267..811553
FT                   /locus_tag="FTW_0832"
FT   CDS_pept        810267..811553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0832"
FT                   /product="aminotransferase class III"
FT                   /EC_number="2.6.1.-"
FT                   /note="GO_function: GO:0004015 -
FT                   adenosylmethionine-8-amino-7-oxononanoate transaminase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0832"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46697"
FT                   /protein_id="ABO46697.1"
FT                   /translation="MYSSNIWHPCTQMKDFEKSPPLNVYRTEGRYIYTKDNRKLFDATS
FT                   SWWCKSLGHRHPYIIDKLKKQLDKYEHTIFANTTNDEIDRFSQRICNLTGMDKTLYASD
FT                   GSCAVEIALKMTIHLRSFQNQTKKIKFVCLENSYHGETLATMSVSDCGLYSDPYKPLLF
FT                   DSFKLKNIPYVTGKNDPLWANAERYWNKSQQYLEQHKEFINALIVEPICQGAGGMLIYS
FT                   KDYLNILCKWCKENDIYIIFDEIMTGLGRLGKLFAYEYLDITPDFLCVSKGLTSGIIPF
FT                   SIVLTKNQYYEMFYDDQLTKAFLHSHTHSGNVLGAVVANAVLDIFEEENILTNVKDLEK
FT                   QFSESFLELQEQLPIIKNVRGIGAVIAADLNIDKKRAGLDVYREAIKLGALLRPLGNTI
FT                   YWLPPFNSTYQEIDLLKQITKQSIINAFK"
FT   gene            complement(811663..812607)
FT                   /gene="add"
FT                   /locus_tag="FTW_0833"
FT   CDS_pept        complement(811663..812607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="FTW_0833"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="GO_function: GO:0004000 - adenosine deaminase
FT                   activity; GO_process: GO:0043101 - purine salvage"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0833"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46698"
FT                   /protein_id="ABO46698.1"
FT                   /translation="MLNEKLLLRPKAELHLHIEGTIEPEMMFQLAQRNNVKLKYNSIKE
FT                   ISKAYVFNNLQNFLDLYYQGVSVLITEQDFYDITYSYLVKAHKDNVTHTEIFIDPQVHS
FT                   ERGISLSVIFNGVTQAIREAEKNFGIKTSVIVCFLLHLSQDHALRYFEKLMDFHDRFIG
FT                   IGLDGYEFGNPPSKFKKLFEIAKKEGLYLTTHVSEPVEYIWEAIDVLGVNRIDHGNSIL
FT                   EDETLIQRVIKDNIPLTMCPLSDKFLKTNSNLSSHPVGILLEKGVKVTINSDDPAYFSG
FT                   YINENYRQISQALKLSEDQIIKLINNSLESKFI"
FT   gene            complement(812755..813255)
FT                   /locus_tag="FTW_0834"
FT   CDS_pept        complement(812755..813255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0834"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0834"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46699"
FT                   /protein_id="ABO46699.1"
FT                   /translation="MTPFFKTDKKSGEKSEELIKRFNDLPAFVATGGEIVFVSDDFLEV
FT                   HLKFNLTENTKNYHGTGFGGAIYSSLDPIYPLQLCNILGDDYVVWDLSANIDYVRPITD
FT                   HVYARFLLSQEIIAKIKQDVIDKNKSVVSLPVCYEDTDNNIYAEATKTIYIADREYFNS
FT                   RKK"
FT   gene            complement(813271..814191)
FT                   /locus_tag="FTW_0835"
FT   CDS_pept        complement(813271..814191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0835"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0835"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46700"
FT                   /protein_id="ABO46700.1"
FT                   /translation="MPYNPSLEALLDTPEIRRIKKLDLTQQREIFTSLSVEQLKRLPRP
FT                   DILEEDIKLENNTILRHYQPKKSSNKAVLFIHGGGWCLGSINTYDHVCRYLCDQGNLNI
FT                   FSLEYGLAPEQKYPAAVDHALYAYDWLYQNINKFKISAENIFVMGDSAGGNLVTIVCHE
FT                   RQENMPKAQILVYPAVDMYTKYDSNKKFDENKYHLTTEWCELFLKAYIGEDVMSEPKKL
FT                   RHPTISPLFYKDTKQPDTLIVAATHDILIDGIYAYEEKLKQQGTYVETYYDDEMFHGFM
FT                   GILGITPFENPKIALNKVIEFINKR"
FT   gene            complement(814204..815469)
FT                   /locus_tag="FTW_0836"
FT   CDS_pept        complement(814204..815469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0836"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase/Dihydropteroate synthase"
FT                   /EC_number="2.7.6.3"
FT                   /EC_number="2.5.1.15"
FT                   /note="GO_function: GO:0004156 - dihydropteroate synthase
FT                   activity; GO_function: GO:0003848 -
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase activity; GO_process: GO:0006760 - folic
FT                   acid and derivative metabolism; GO_process: GO:0009396 -
FT                   folic acid and derivative biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0836"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46701"
FT                   /protein_id="ABO46701.1"
FT                   /translation="MQYIIGIGTNIGFTIENIHLAITALESQQNIRIIRKASLYSSKAV
FT                   LKEDAPKEWDIRFLNTAVKISSSLKPDELLVLLKDIELKIGRDLNAPAWSPRVIDLDIL
FT                   AAEDLILETDKLTIPHKELINRSFALAPLLELSKGWHHPKYVEWDLNIRLKELGEIVKL
FT                   KQTLANTIRMGIVNLSNQSFSDGNFDDNQRKLNLDELIQSGAEIIDIGAESTKPDAKPI
FT                   SIEEEFNKLDEFLEYFKSQLANLIYKPLVSIDTRKLEVMQKILAKHHDIIWMINDVECN
FT                   NIEQKAQLIAKYNKKYVIIHNLGITDRNQYLDKENAIDNVCDYIEQKKQILLKHGIAQQ
FT                   NIYFDIGFGFGKKSDTARYLLENIIEIKRRLELKALVGHSRKQSVLGLAKDSNLATLDR
FT                   ATRELSRKLEKLDIDIIRVHKI"
FT   gene            complement(815471..815824)
FT                   /locus_tag="FTW_0837"
FT   CDS_pept        complement(815471..815824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0837"
FT                   /product="putative dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0837"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46702"
FT                   /protein_id="ABO46702.1"
FT                   /translation="MKQSLFLNDVKIYVSLGCSGEERAYKQMITLDLELEFSQNYRASD
FT                   SDNLEETICYYTLRNNIQQFCDSISCNLIEYLAKQIYLFIQKNYSDITIKYLKINKKPP
FT                   VSQIESACFIIRN"
FT   gene            815906..817276
FT                   /locus_tag="FTW_0838"
FT   CDS_pept        815906..817276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0838"
FT                   /product="AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0838"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46703"
FT                   /protein_id="ABO46703.1"
FT                   /translation="MIQLDKFLANIKNYGKNNYIFFEDKRYDYVEILQISYSLARFLES
FT                   YGYRKVYSNLKNSPLLVSLYIASWIADIDLFVPINPRLVDNELAAIVDGDSLFITDKIS
FT                   NLEVNKLYIENATCFFESLEYTQDYITHAKALTAHVSSGTTGFYQKYLHKIDQIIKYAN
FT                   DRIADLGLKQDDHLLVALSINHAFAFSYQILPALAIGLDITIIREFDAKLVARIINQNS
FT                   VTALALLPIMYHFLLEQNINKNHNLRYLSVAGDVASISLVTAVKDKLGLPLLNGIGMTE
FT                   VFGYGQNISANTVNKVKIFSDTEVKILKFENSNYGKIFIKNNMLPLNIETEWLETGDIG
FT                   SFDHQSYELSFYGRYKDIIIKGGSNISPFELETAILKIPNIDNCIVTSKKDKIWGETVW
FT                   AYLVASQQYSLEFINNQLRNYIAEYKKLDGIIYIDEIPITTTGKTNRKKIKEMINHE"
FT   gene            817269..819032
FT                   /locus_tag="FTW_0839"
FT   CDS_pept        817269..819032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0839"
FT                   /product="chorismate binding family protein/para-amino
FT                   benzoate synthase component I"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0839"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46704"
FT                   /protein_id="ABO46704.1"
FT                   /translation="MSNNQLPQFAILEDTLTDKQKYYFYNPIAEVIANSKETLELAFYQ
FT                   LEKLQQQRLYLVGYLSYEASYYLNNNLYDLRDPDDSKLLHFVAFSDYSNEIPDDLISDK
FT                   NIDMMIDSLNFADYQKSFDKVQQALIDGESYQINLTKNILATTKLTSYELYNKLKQQQS
FT                   VKYAAYLPFLNPDIISISPELFFKKDAENLVVNPMKGTARLTGNELKDLKIYQELALCD
FT                   KNRAENLIIVDLLRNDLSAIAKTHTVKVDKLFSIEKYKNLLQMTSQISAKVDKQISFRK
FT                   ILDGLFPCGSITGAPKKRTMELIKQIEKGKRGVYTGSIGYIMPNNDMCFNVAIRTIQKY
FT                   RDNLQIGVGGGITVYSDVQSEWQEMNTKINFIRQIYQPDFCLIESLYYCNQFRDLELHL
FT                   ERLEDSARQLFFDIDICKIRDQLYDYVEKLTDDKEYKIRIEYHYDKSIIIEHTQIDTTN
FT                   QQAIKLIICPEKINSANKLFQHKTTHNSTRGFYTQMHQKYIQDKNCELIYLNEKDNITE
FT                   TRFHNIIIEKNDKFYTPKLEDGVLAGIARKSLIKQGKLQAKSLNLNDLKTADKIYLINS
FT                   VRGLIPAYLGI"
FT   gene            819034..819588
FT                   /locus_tag="FTW_0840"
FT   CDS_pept        819034..819588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0840"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase or para-aminobenzoate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="GO_function: GO:0016884 - carbon-nitrogen ligase
FT                   activity, with glutamine as amido-N-donor"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0840"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46705"
FT                   /protein_id="ABO46705.1"
FT                   /translation="MVLYIDHYDSFSSTIVDYITYLGYQVSMLKTDEQIDNIDQYSHII
FT                   IGPGPGHPDELKNIYPIIEYCQQKKLPLLGICLGHQLIAQYYGAKIIKAKQIYHGKLSE
FT                   IKQLQSSALYKDHPVKFAVTRYHSLIVNDIKEPLITLAATDNHEIMAFAHQNAKIFGVQ
FT                   YHPEAYLTEYGLATLKNFLSI"
FT   gene            complement(819589..820847)
FT                   /locus_tag="FTW_0843"
FT                   /note="MFS family transport protein"
FT   misc_feature    complement(819589..820847)
FT                   /locus_tag="FTW_0843"
FT                   /note="contains frameshift and premature stop"
FT   gene            complement(820810..821874)
FT                   /locus_tag="FTW_0844"
FT                   /note="aldo/keto reductase"
FT   misc_feature    complement(820810..821874)
FT                   /locus_tag="FTW_0844"
FT                   /note="contains frameshift"
FT   gene            complement(821968..822888)
FT                   /locus_tag="FTW_0845"
FT   CDS_pept        complement(821968..822888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0845"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /EC_number="3.5.-.-"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0845"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46706"
FT                   /protein_id="ABO46706.1"
FT                   /translation="MFKNIKSLILFCLLMSGCYAQTINVAAAQMIIKQQSFDEFASDIK
FT                   RLAKQAKDQGAEIVVFPEDNSVNLIDDLPWNKQSIIKLSEYYSQTKSFIANLAKEYSMI
FT                   VIGGTIAKNDNGKISNTVLIGLPDGQIIENDKIYLTPEERSIGYNKFGKNILVLDYKGT
FT                   KMAILICYTSEFPNISLELAKIKPDIIIVPSYTNDLYGLNRVHNAVKMLSIQNFAYGVI
FT                   VGMASGFDKQNTQGIDGVSQILFTSPQNKAFALNHLSRGNFNKEDVVVENLDITKLHQA
FT                   HKNYDAFPNEDIKYNQNLTIKSVSI"
FT   gene            complement(822966..823391)
FT                   /locus_tag="FTW_0846"
FT   CDS_pept        complement(822966..823391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0846"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0846"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46707"
FT                   /protein_id="ABO46707.1"
FT                   /translation="MFFKDIFLKIMIIFSVAIGFLFIFLNTSNAKEKNNSEPILEIVSF
FT                   ETAKNTTTEQVLQASDKVTQDLQGSNGFIKRTLTQNTNNPNQWVDIIEWQSIKDAHSSM
FT                   DKAVADKDLQVFLKLMKNGSRVYQTKSEYLSIKSQTE"
FT   gene            complement(823531..824224)
FT                   /locus_tag="FTW_0847"
FT                   /note="hypothetical protein"
FT   misc_feature    complement(823531..824224)
FT                   /locus_tag="FTW_0847"
FT                   /note="contains frameshift"
FT   gene            complement(824238..824855)
FT                   /locus_tag="FTW_0849"
FT   CDS_pept        complement(824238..824855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0849"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="GO_function: GO:0003934 - GTP cyclohydrolase I
FT                   activity; GO_process: GO:0006760 - folic acid and
FT                   derivative metabolism; GO_process: GO:0046654 -
FT                   tetrahydrofolate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0849"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46708"
FT                   /protein_id="ABO46708.1"
FT                   /translation="MMKDKYCSKLGKSVQEHLIKLGLEQPREFNLDNDNKITIITKAYR
FT                   QILDALGLYTDEFEKTPFRVARMFTQEIFNGLDYANFPACALYENEFNYTGVLTQKNIT
FT                   IMSFCEHHFVPFEGTAEVSFIPKNNNIIGLCRINSICDFFSRRPQIQERMTAQIFEALK
FT                   FILSTEDVSVKIKAKHACVSLRGVNNQNSQTYTQMVGGVFAK"
FT   gene            824985..826310
FT                   /locus_tag="FTW_0850"
FT   CDS_pept        824985..826310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0850"
FT                   /product="DEAD/DEAH box helicase"
FT                   /note="GO_function: GO:0004386 - helicase activity;
FT                   GO_function: GO:0008026 - ATP-dependent helicase activity;
FT                   GO_process: GO:0006139 - nucleobase, nucleoside, nucleotide
FT                   and nucleic acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0850"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46709"
FT                   /protein_id="ABO46709.1"
FT                   /translation="MKFSDLGLNSLICSALEKKGYTKPTPIQAQAIPIVLKGNDVMASA
FT                   QTGTGKTAGFTLPIIQRLLDQPKAQANRIKTLILTPTRELAAQIQEQIQIYAANTHIRS
FT                   AVIFGGVSINPQMMKLRKGVEILIATPGRLLDLYSQNAVKFDSLNTFVLDEADRMLDMG
FT                   FINDLKKIHNLLPKKLQTLMFSATFSSEIKNLANEFLNNPQFVSADVVNTTVKKITQKI
FT                   YTLDKSNKINALISLIKDQNLHQVLVFSRTKNGANKISEKLNNAGISSSAIHGNKSQTA
FT                   RTKALADFKSNDINVLVATDIAARGIDIAQLPCVINLDLSNVAEDYVHRIGRTGRAGQE
FT                   GLAISLVSADEVESLSNIEHLIGHLLPREELEGFEATHNVPITSMSHKTKAKKIDEVKI
FT                   IAAKRAKKNNNNKKPSNKNDFAKKIRQKIHQNKSVRKPKAKD"
FT   gene            complement(826307..827848)
FT                   /locus_tag="FTW_0851"
FT   CDS_pept        complement(826307..827848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0851"
FT                   /product="amino acid/peptide transporter (Peptide:H+
FT                   symporter)"
FT                   /note="GO_component: GO:0005887 - integral to plasma
FT                   membrane; GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0005215 - transporter activity; GO_function: GO:0015333
FT                   - peptide:hydrogen symporter activity; GO_process:
FT                   GO:0015833 - peptide transport; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0851"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46710"
FT                   /protein_id="ABO46710.1"
FT                   /translation="MTISDVTHSKNNNITPFWVLWTLELWERFGYYGLQAILAIYFARK
FT                   LVFSDAEAMLIFGSFSALLYGGPLIGGWIGDSYLGAKRTIFIGAGILFLSYISLSFSTF
FT                   IAEYLGSTEKTVVMYSLAGVAIGGGLFKANPTSLISKLFEKGDPALDGAMTLYYMAINI
FT                   GSFVSMLLTPIVAAKYGYLHAFLCSAIGMFLGLISYTIFYPKIKRISTEAGRQKMSWFK
FT                   VFVVLLGACIAIFIIGNILENTTLCTSIVVVIAILALVYFFIQMLKQAEHERKRMIVAL
FT                   ILIIQGIIFFVLYQQMPTSLNFFAVNNVDPHFLGMNVHGEQWQVLNPLVIVLMSPILSV
FT                   VYNKIPGTHVTKFCFGMTLCALAFLVLYFPQFTATNGVVSGWWLVASYFFQSTGELLIS
FT                   ALGLSMVAELFPRNMSGLAQGMWLLTTMVAGPIGGYVGALTAPAAGTVFTKVEGLAVYG
FT                   HVFLTIGIFVAVIAAIMWIARGWLNAIIESTRVHFVSEGTHGMHEETAVLPTQNN"
FT   gene            complement(827986..828306)
FT                   /locus_tag="FTW_0852"
FT   CDS_pept        complement(827986..828306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0852"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0852"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46711"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IXR0"
FT                   /protein_id="ABO46711.1"
FT                   /translation="MILTTADTLGKREIIEYKGLVTGIIVRTPTITQGILGGLKNIIGG
FT                   KNTSYTNVCKEARLHAEQEMINQAKELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVV
FT                   VR"
FT   gene            complement(828317..829678)
FT                   /gene="gor"
FT                   /locus_tag="FTW_0853"
FT   CDS_pept        complement(828317..829678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="FTW_0853"
FT                   /product="glutathione-disulfide reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="GO_function: GO:0004362 - glutathione-disulfide
FT                   reductase activity; GO_function: GO:0016491 -
FT                   oxidoreductase activity; GO_function: GO:0050662 - coenzyme
FT                   binding; GO_process: GO:0006118 - electron transport;
FT                   GO_process: GO:0030503 - regulation of cell redox
FT                   homeostasis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0853"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46712"
FT                   /protein_id="ABO46712.1"
FT                   /translation="MSNNHFDVISLGGGSGGIASAVQAAKFGKKVAIIEKRELGGTCVN
FT                   RGCVPKKAMWYGANLAEILKHDVAGYGFDVEVKGFNWAKLKEKRATYIGNIHGFYDRLL
FT                   DKWNITHFNNWGKFKDNKTIVLDDGTELTADHIFISPGAYPIVPKNIEGAELGITSDEF
FT                   FELEETPKKAVIVGGGYIGVEIAGVLNAHGTDTTIMVRRDKPLMEFDNCISDALVECMQ
FT                   MTDLNIMNHTNITKVEKTGSTLKITTDTDKVLEDVDTLIWATGRAPNTHNLGIENTDIR
FT                   ITDKGVIPANEWSETNVAGVYSLGDASGVPQLTPVAIKTGRYLARRLFNGETNLKANLE
FT                   YIPTVIFSHPAIGTVGLTEKEARDKYGDENVKVYKSRFTALYCAISGHRMPTVMKLVVT
FT                   GDNEKIVGCHMIGLNVDEMLQGFAVAINMGATKRDFDDTIAIHPTSSEELVTLV"
FT   gene            complement(829716..830435)
FT                   /locus_tag="FTW_0854"
FT   CDS_pept        complement(829716..830435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0854"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0854"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46713"
FT                   /protein_id="ABO46713.1"
FT                   /translation="MKHKLFYKLFILFAFLFITLDSFAESFKQYNVYLIPDTTADKYVK
FT                   EFDDSLAKTNVLEKYKTTPFIKNHPVHLTLYLTSFQSKYIKDINSQLANLAKNTEPFYI
FT                   ETNGFSAGKSGFVMLDIKNSQSLQQLSNVVIKDLAKYRDKDYPAPSWIKFYPSKLVSFE
FT                   KYGSPNAFAEFNPHISILAANLQTDQERDNFDKDFNEIIKNTKLEPISFKIKAIGFGEV
FT                   DENGQITKILHIYKLNK"
FT   gene            complement(830435..830938)
FT                   /locus_tag="FTW_0855"
FT                   /note="hypothetical protein"
FT   misc_feature    complement(830435..830938)
FT                   /locus_tag="FTW_0855"
FT                   /note="disruption due to premature stop"
FT   gene            complement(830941..831648)
FT                   /locus_tag="FTW_0857"
FT   CDS_pept        complement(830941..831648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0857"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /EC_number="5.1.-.-"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_function: GO:0003824 - catalytic activity; GO_process:
FT                   GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0857"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46714"
FT                   /protein_id="ABO46714.1"
FT                   /translation="MSNRIVLITGATKGIGLATSLYLNNQGWQVIGIARSYIDNFPGEL
FT                   FLCDLANEEQTASTLIQINEIHGCPDAIINNVGIAIPEPLGKISISALNDVYNLNVRSA
FT                   VQVSQFFIEKMKLKEQCKIVNIASRAIFGVKNRTSYSTAKSALVGCTKTWALELAKYGI
FT                   CVNAIAPGPVDTELFRKTRPIGSSEEKEVLDSIPMMRIGKPEEIAATIAFLLSNEASFI
FT                   TGQVICVDGGGSL"
FT   gene            complement(831669..832457)
FT                   /gene="xthA"
FT                   /locus_tag="FTW_0858"
FT   CDS_pept        complement(831669..832457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="FTW_0858"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="GO_function: GO:0008853 - exodeoxyribonuclease III
FT                   activity; GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0858"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46715"
FT                   /protein_id="ABO46715.1"
FT                   /translation="MIKVMTFNANGIRAAARKGFWEWFKTQDVDFLCMQETKAQFHQLE
FT                   KDIEHFPTGYYYEFKDAVKKGYSGTAIYAKKKPLKVIKELGLDWADDEGRYIQFDYENF
FT                   SIASLYLPSGSSGDVRQEYKMQFLEKYKEILKEQVESGRDFIVCGDFNIVHKEIDIKNW
FT                   KSNYGKTSGVLPEEQAWLDHIFDDLGWVDTFRVINHEPLQYTWWSNRGQARANNVGWRI
FT                   DYHISTSALKDKVVPESDYVYKENWFSDHAPLTINYDYEV"
FT   gene            832741..833724
FT                   /locus_tag="FTW_0859"
FT   CDS_pept        832741..833724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0859"
FT                   /product="Succinylglutamate desuccinylase / Aspartoacylase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0859"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46716"
FT                   /protein_id="ABO46716.1"
FT                   /translation="MQASMHASELQGNAVMIELLEYFKKYQPKGDVYLIPQCNPIGKDV
FT                   FIGAGHQGRFDSATGDNFNRYYFYPKIDYSAFVKEHINSTTAEYKQAFENLLQQELDKE
FT                   LSNEWELSRAKRLNLLVQREAQKADYVLDLHTDTDATTYLYTADFARQTAEKFGYKDML
FT                   IIDNDKACGALDEAIFCPWWHLAQEFKKQDRDEKVLKEGYTLELGSEEYINFANAKMQT
FT                   QGILNYLKHKDIIDSPFDTDLLNTDIRHHIYGANYKHLKAIEGGSYEWFIKPGDIFKAG
FT                   DVIGQYIQTSTMQKKDLTLPYGGVVISIHNTGAVCQGSQLMNLAII"
FT   gene            833732..834322
FT                   /locus_tag="FTW_0860"
FT   CDS_pept        833732..834322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0860"
FT                   /product="Flavodoxin-like fold family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0860"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46717"
FT                   /protein_id="ABO46717.1"
FT                   /translation="MKKILLINGKKEFGHSKGALNQYLNDIAYDHLKSLGHDVKLTIVD
FT                   DDYNIDDEIQKWLWADTIIYQMPGWWMGPPWIIKKYIDEVFTTGHGVMYASDGRSRYDT
FT                   SKKYGSGGLLQGKTYMLSLTWNAPFEAFVEKDQLFEGVGVDGVYLHFHKAHEFIGMKGL
FT                   PTFIANDVMKNPLINEFTLSYKNHLDTVFRNAR"
FT   gene            834438..835100
FT                   /locus_tag="FTW_0861"
FT   CDS_pept        834438..835100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0861"
FT                   /product="DJ-1/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0861"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46718"
FT                   /protein_id="ABO46718.1"
FT                   /translation="MVTTSHDVMGNSNEKTGLWLSELTHPYYSIIDENINIDIVSIMGG
FT                   EIPIDPNSVAQEDYYNDKFLADDNLKNIMKNSTSLRDVNIKEYDAIVFAGGHGTMWDFP
FT                   NNSNIHSKVLDIYTKNGVIGAICHGVAALINVKDNNGQNIIRDKEVTGFSNNEEKIVGL
FT                   TDVVPFSLEDSLVEAGAKYSSASEWQSYVKSDSKIITAQNPQSATDFAKAIKQSLFN"
FT   gene            complement(835170..836282)
FT                   /gene="aroG"
FT                   /locus_tag="FTW_0862"
FT   CDS_pept        complement(835170..836282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG"
FT                   /locus_tag="FTW_0862"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="GO_function: GO:0003849 -
FT                   3-deoxy-7-phosphoheptulonate synthase activity; GO_process:
FT                   GO:0009423 - chorismate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0862"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46719"
FT                   /protein_id="ABO46719.1"
FT                   /translation="MIGDKNFDKVSNINIKKEKVLIPAEVLIQDIPLLKTSFETVRKSR
FT                   KEIANIIHGNDDRVAVVVGPCSIHDPAAAIEYATKLKEQVKKFHKDILIIMRVYFEKPR
FT                   TTIGWKGFINDPDLDNSYNINKGLRLARNLLSDLTNMGLPCATEFLDVITPQYFAELIT
FT                   WGAIGARTVESQVHRELASGLSASIGFKNATNGDVQVAVDAVKSATYPHHFLSTTKSGS
FT                   TAIFATKGNQNGHVILRGGASGPNFSKEHVDDCIAKLKKADINTKVMIDCSHGNSQKDH
FT                   SKQISVLADICEQIKHSNDIFGVMIESNLVAGNQDINKKPLTYGQSVTDKCVDFEETVK
FT                   MLEMLAEAVQVRRGSQTKQQVKEESQFSLL"
FT   gene            complement(836314..837690)
FT                   /gene="ffh"
FT                   /locus_tag="FTW_0863"
FT   CDS_pept        complement(836314..837690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="FTW_0863"
FT                   /product="signal recognition particle protein"
FT                   /note="GO_component: GO:0048501 - signal recognition
FT                   particle (sensu Bacteria and Archaea); GO_function:
FT                   GO:0005048 - signal sequence binding; GO_function:
FT                   GO:0003924 - GTPase activity; GO_function: GO:0003729 -
FT                   mRNA binding; GO_function: GO:0008312 - 7S RNA binding;
FT                   GO_process: GO:0006617 - SRP-dependent cotranslational
FT                   protein targeting to membrane, signal sequence recognition;
FT                   GO_process: GO:0009306 - protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0863"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46720"
FT                   /protein_id="ABO46720.1"
FT                   /translation="MFTSLSEKLQSSFKKIKGQTSLTEENIQSALRDIRVSLLEADVAL
FT                   PVVKKFIANIKEKAIGEEVKKSLTPDQTFISFVKKEIEKALGEEAVPINLKTQPPAVIL
FT                   MAGLQGAGKTTSTAKLAKYLKEQHKKKVMVVSADVYRPAAIDQLRTLANSLNVEFFESD
FT                   ASQQPEDIVTAAIKTAKTKLIDVLIIDTAGRLHIDNDMMDEIKQIHKIAKPIETFFTVD
FT                   SMTGQDAAVTAKAFNDALELTGVILTKTDGDARGGAALSIREITGKPIKFLGVGEKTDA
FT                   LEPFHPDRVASKILGMGDVLSLIESIEQKTEKKSAEQLTKKLKSGKSFDLEDFKAQIQQ
FT                   MKKMGGVGSIMSKLPNMPANLPGDVGDDMFKKIEAMIDSMTPLERKKPELIKHSRKQRI
FT                   IKGSGTTIQDLNKLLQQHTQMKKMMKSVIGKKGGMANLMKRMSAMQGMANMPGLFGKRK
FT                   "
FT   gene            complement(837771..838037)
FT                   /locus_tag="FTW_0864"
FT   CDS_pept        complement(837771..838037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FTW_0864"
FT                   /product="hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FTW_0864"
FT                   /db_xref="EnsemblGenomes-Tr:ABO46721"
FT                   /protein_id="ABO46721.1"
FT                   /translation="MIKENVIYKSLKLNLFVAILFIIIGALNAFTGNYSITKNIISIGI
FT                   LLIIISPLLRIFLELIFFIKEKNYTYVLVCIILFVIIAISVVC"
FT   gene            complement(838034..838940)
FT                   /locus_tag="FTW_0865"
FT                   /note="hypothetical membrane protein"
FT   misc_feature    complement(838034..838940)
FT                   /locus_tag="FTW_0865"
FT                   /note="contains frameshift"
FT   gene            839034..839252
FT                   /gene="infA"
FT                   /locus_tag="FTW_0867