(data stored in ACNUC7421 zone)

EMBL: CP000609

ID   CP000609; SV 1; circular; genomic DNA; STD; PRO; 1780761 BP.
XX
AC   CP000609; AAWI01000000-AAWI01000007;
XX
PR   Project:PRJNA17641;
XX
DT   17-MAR-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Methanococcus maripaludis C5, complete genome.
XX
KW   .
XX
OS   Methanococcus maripaludis C5
OC   Archaea; Euryarchaeota; Methanomada group; Methanococci; Methanococcales;
OC   Methanococcaceae; Methanococcus.
XX
RN   [1]
RP   1-1780761
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chertkov O., Brettin T., Bruce D., Han C.,
RA   Detter J.C., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Mikhailova N., Sieprawska-Lupa M., Whitman W.B., Richardson P.;
RT   "Complete sequence of chromosome of Methanococcus maripaludis C5";
RL   Unpublished.
XX
RN   [2]
RP   1-1780761
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chertkov O., Brettin T., Bruce D., Han C.,
RA   Detter J.C., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Mikhailova N., Sieprawska-Lupa M., Whitman W.B., Richardson P.;
RT   ;
RL   Submitted (12-MAR-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 982967a498b8b00d2571003b673529c6.
DR   BioSample; SAMN02598397.
DR   EnsemblGenomes-Gn; EBG00001221983.
DR   EnsemblGenomes-Gn; EBG00001221984.
DR   EnsemblGenomes-Gn; EBG00001221985.
DR   EnsemblGenomes-Gn; EBG00001221986.
DR   EnsemblGenomes-Gn; EBG00001221987.
DR   EnsemblGenomes-Gn; EBG00001221988.
DR   EnsemblGenomes-Gn; EBG00001221989.
DR   EnsemblGenomes-Gn; EBG00001221990.
DR   EnsemblGenomes-Gn; EBG00001221991.
DR   EnsemblGenomes-Gn; EBG00001221992.
DR   EnsemblGenomes-Gn; EBG00001221993.
DR   EnsemblGenomes-Gn; EBG00001221994.
DR   EnsemblGenomes-Gn; EBG00001221995.
DR   EnsemblGenomes-Gn; EBG00001221996.
DR   EnsemblGenomes-Gn; EBG00001221997.
DR   EnsemblGenomes-Gn; EBG00001221998.
DR   EnsemblGenomes-Gn; EBG00001221999.
DR   EnsemblGenomes-Gn; EBG00001222001.
DR   EnsemblGenomes-Gn; EBG00001222002.
DR   EnsemblGenomes-Gn; EBG00001222003.
DR   EnsemblGenomes-Gn; EBG00001222004.
DR   EnsemblGenomes-Gn; EBG00001222005.
DR   EnsemblGenomes-Gn; EBG00001222006.
DR   EnsemblGenomes-Gn; EBG00001222007.
DR   EnsemblGenomes-Gn; EBG00001222008.
DR   EnsemblGenomes-Gn; EBG00001222009.
DR   EnsemblGenomes-Gn; EBG00001222010.
DR   EnsemblGenomes-Gn; EBG00001222011.
DR   EnsemblGenomes-Gn; EBG00001222012.
DR   EnsemblGenomes-Gn; EBG00001222013.
DR   EnsemblGenomes-Gn; EBG00001222014.
DR   EnsemblGenomes-Gn; EBG00001222015.
DR   EnsemblGenomes-Gn; EBG00001222016.
DR   EnsemblGenomes-Gn; EBG00001222017.
DR   EnsemblGenomes-Gn; EBG00001222018.
DR   EnsemblGenomes-Gn; EBG00001222019.
DR   EnsemblGenomes-Gn; EBG00001222020.
DR   EnsemblGenomes-Gn; EBG00001222021.
DR   EnsemblGenomes-Gn; EBG00001222022.
DR   EnsemblGenomes-Gn; EBG00001222023.
DR   EnsemblGenomes-Gn; EBG00001222024.
DR   EnsemblGenomes-Gn; EBG00001222025.
DR   EnsemblGenomes-Gn; EBG00001222026.
DR   EnsemblGenomes-Gn; EBG00001222027.
DR   EnsemblGenomes-Gn; EBG00001222028.
DR   EnsemblGenomes-Gn; EBG00001222030.
DR   EnsemblGenomes-Gn; EBG00001222032.
DR   EnsemblGenomes-Gn; EBG00001222035.
DR   EnsemblGenomes-Gn; EBG00001222038.
DR   EnsemblGenomes-Gn; EBG00001222042.
DR   EnsemblGenomes-Gn; EBG00001222044.
DR   EnsemblGenomes-Gn; EBG00001222049.
DR   EnsemblGenomes-Gn; EBG00001222054.
DR   EnsemblGenomes-Gn; EBG00001222057.
DR   EnsemblGenomes-Gn; EBG00001222061.
DR   EnsemblGenomes-Gn; EBG00001222065.
DR   EnsemblGenomes-Gn; EBG00001222068.
DR   EnsemblGenomes-Gn; EBG00001222073.
DR   EnsemblGenomes-Gn; EBG00001222078.
DR   EnsemblGenomes-Gn; EBG00001222088.
DR   EnsemblGenomes-Gn; EBG00001222093.
DR   EnsemblGenomes-Gn; EBG00001222098.
DR   EnsemblGenomes-Gn; EBG00001222103.
DR   EnsemblGenomes-Gn; EBG00001222109.
DR   EnsemblGenomes-Gn; EBG00001222113.
DR   EnsemblGenomes-Gn; EBG00001222114.
DR   EnsemblGenomes-Gn; EBG00001222116.
DR   EnsemblGenomes-Gn; EBG00001222117.
DR   EnsemblGenomes-Gn; EBG00001222118.
DR   EnsemblGenomes-Gn; EBG00001222119.
DR   EnsemblGenomes-Gn; EBG00001222120.
DR   EnsemblGenomes-Gn; EBG00001222121.
DR   EnsemblGenomes-Gn; EBG00001222122.
DR   EnsemblGenomes-Gn; EBG00001222123.
DR   EnsemblGenomes-Gn; EBG00001222124.
DR   EnsemblGenomes-Gn; EBG00001222125.
DR   EnsemblGenomes-Gn; EBG00001222126.
DR   EnsemblGenomes-Gn; EBG00001222127.
DR   EnsemblGenomes-Gn; EBG00001222128.
DR   EnsemblGenomes-Gn; EBG00001222129.
DR   EnsemblGenomes-Gn; EBG00001222130.
DR   EnsemblGenomes-Gn; EBG00001222131.
DR   EnsemblGenomes-Gn; EBG00001222132.
DR   EnsemblGenomes-Gn; EBG00001222133.
DR   EnsemblGenomes-Gn; EBG00001222134.
DR   EnsemblGenomes-Gn; EBG00001222135.
DR   EnsemblGenomes-Gn; EBG00001222136.
DR   EnsemblGenomes-Gn; EBG00001222137.
DR   EnsemblGenomes-Gn; EBG00001222138.
DR   EnsemblGenomes-Gn; EBG00001222139.
DR   EnsemblGenomes-Gn; MmarC5_R0001.
DR   EnsemblGenomes-Gn; MmarC5_R0002.
DR   EnsemblGenomes-Gn; MmarC5_R0003.
DR   EnsemblGenomes-Gn; MmarC5_R0005.
DR   EnsemblGenomes-Gn; MmarC5_R0006.
DR   EnsemblGenomes-Gn; MmarC5_R0007.
DR   EnsemblGenomes-Gn; MmarC5_R0008.
DR   EnsemblGenomes-Gn; MmarC5_R0009.
DR   EnsemblGenomes-Gn; MmarC5_R0010.
DR   EnsemblGenomes-Gn; MmarC5_R0011.
DR   EnsemblGenomes-Gn; MmarC5_R0012.
DR   EnsemblGenomes-Gn; MmarC5_R0013.
DR   EnsemblGenomes-Gn; MmarC5_R0014.
DR   EnsemblGenomes-Gn; MmarC5_R0015.
DR   EnsemblGenomes-Gn; MmarC5_R0016.
DR   EnsemblGenomes-Gn; MmarC5_R0017.
DR   EnsemblGenomes-Gn; MmarC5_R0018.
DR   EnsemblGenomes-Gn; MmarC5_R0019.
DR   EnsemblGenomes-Gn; MmarC5_R0020.
DR   EnsemblGenomes-Gn; MmarC5_R0021.
DR   EnsemblGenomes-Gn; MmarC5_R0022.
DR   EnsemblGenomes-Gn; MmarC5_R0023.
DR   EnsemblGenomes-Gn; MmarC5_R0024.
DR   EnsemblGenomes-Gn; MmarC5_R0025.
DR   EnsemblGenomes-Gn; MmarC5_R0026.
DR   EnsemblGenomes-Gn; MmarC5_R0027.
DR   EnsemblGenomes-Gn; MmarC5_R0028.
DR   EnsemblGenomes-Gn; MmarC5_R0029.
DR   EnsemblGenomes-Gn; MmarC5_R0030.
DR   EnsemblGenomes-Gn; MmarC5_R0031.
DR   EnsemblGenomes-Gn; MmarC5_R0032.
DR   EnsemblGenomes-Gn; MmarC5_R0033.
DR   EnsemblGenomes-Gn; MmarC5_R0034.
DR   EnsemblGenomes-Gn; MmarC5_R0035.
DR   EnsemblGenomes-Gn; MmarC5_R0036.
DR   EnsemblGenomes-Gn; MmarC5_R0037.
DR   EnsemblGenomes-Gn; MmarC5_R0038.
DR   EnsemblGenomes-Gn; MmarC5_R0039.
DR   EnsemblGenomes-Gn; MmarC5_R0040.
DR   EnsemblGenomes-Gn; MmarC5_R0041.
DR   EnsemblGenomes-Gn; MmarC5_R0042.
DR   EnsemblGenomes-Gn; MmarC5_R0043.
DR   EnsemblGenomes-Gn; MmarC5_R0044.
DR   EnsemblGenomes-Gn; MmarC5_R0045.
DR   EnsemblGenomes-Gn; MmarC5_R0046.
DR   EnsemblGenomes-Gn; MmarC5_R0047.
DR   EnsemblGenomes-Tr; EBT00001790527.
DR   EnsemblGenomes-Tr; EBT00001790528.
DR   EnsemblGenomes-Tr; EBT00001790529.
DR   EnsemblGenomes-Tr; EBT00001790530.
DR   EnsemblGenomes-Tr; EBT00001790531.
DR   EnsemblGenomes-Tr; EBT00001790532.
DR   EnsemblGenomes-Tr; EBT00001790533.
DR   EnsemblGenomes-Tr; EBT00001790534.
DR   EnsemblGenomes-Tr; EBT00001790535.
DR   EnsemblGenomes-Tr; EBT00001790536.
DR   EnsemblGenomes-Tr; EBT00001790537.
DR   EnsemblGenomes-Tr; EBT00001790538.
DR   EnsemblGenomes-Tr; EBT00001790539.
DR   EnsemblGenomes-Tr; EBT00001790540.
DR   EnsemblGenomes-Tr; EBT00001790541.
DR   EnsemblGenomes-Tr; EBT00001790542.
DR   EnsemblGenomes-Tr; EBT00001790543.
DR   EnsemblGenomes-Tr; EBT00001790544.
DR   EnsemblGenomes-Tr; EBT00001790545.
DR   EnsemblGenomes-Tr; EBT00001790546.
DR   EnsemblGenomes-Tr; EBT00001790547.
DR   EnsemblGenomes-Tr; EBT00001790548.
DR   EnsemblGenomes-Tr; EBT00001790549.
DR   EnsemblGenomes-Tr; EBT00001790550.
DR   EnsemblGenomes-Tr; EBT00001790551.
DR   EnsemblGenomes-Tr; EBT00001790552.
DR   EnsemblGenomes-Tr; EBT00001790553.
DR   EnsemblGenomes-Tr; EBT00001790554.
DR   EnsemblGenomes-Tr; EBT00001790555.
DR   EnsemblGenomes-Tr; EBT00001790556.
DR   EnsemblGenomes-Tr; EBT00001790557.
DR   EnsemblGenomes-Tr; EBT00001790558.
DR   EnsemblGenomes-Tr; EBT00001790559.
DR   EnsemblGenomes-Tr; EBT00001790560.
DR   EnsemblGenomes-Tr; EBT00001790561.
DR   EnsemblGenomes-Tr; EBT00001790562.
DR   EnsemblGenomes-Tr; EBT00001790563.
DR   EnsemblGenomes-Tr; EBT00001790564.
DR   EnsemblGenomes-Tr; EBT00001790565.
DR   EnsemblGenomes-Tr; EBT00001790566.
DR   EnsemblGenomes-Tr; EBT00001790567.
DR   EnsemblGenomes-Tr; EBT00001790568.
DR   EnsemblGenomes-Tr; EBT00001790569.
DR   EnsemblGenomes-Tr; EBT00001790570.
DR   EnsemblGenomes-Tr; EBT00001790572.
DR   EnsemblGenomes-Tr; EBT00001790573.
DR   EnsemblGenomes-Tr; EBT00001790574.
DR   EnsemblGenomes-Tr; EBT00001790575.
DR   EnsemblGenomes-Tr; EBT00001790576.
DR   EnsemblGenomes-Tr; EBT00001790577.
DR   EnsemblGenomes-Tr; EBT00001790578.
DR   EnsemblGenomes-Tr; EBT00001790579.
DR   EnsemblGenomes-Tr; EBT00001790580.
DR   EnsemblGenomes-Tr; EBT00001790581.
DR   EnsemblGenomes-Tr; EBT00001790582.
DR   EnsemblGenomes-Tr; EBT00001790583.
DR   EnsemblGenomes-Tr; EBT00001790584.
DR   EnsemblGenomes-Tr; EBT00001790585.
DR   EnsemblGenomes-Tr; EBT00001790587.
DR   EnsemblGenomes-Tr; EBT00001790588.
DR   EnsemblGenomes-Tr; EBT00001790589.
DR   EnsemblGenomes-Tr; EBT00001790590.
DR   EnsemblGenomes-Tr; EBT00001790591.
DR   EnsemblGenomes-Tr; EBT00001790592.
DR   EnsemblGenomes-Tr; EBT00001790593.
DR   EnsemblGenomes-Tr; EBT00001790594.
DR   EnsemblGenomes-Tr; EBT00001790595.
DR   EnsemblGenomes-Tr; EBT00001790596.
DR   EnsemblGenomes-Tr; EBT00001790597.
DR   EnsemblGenomes-Tr; EBT00001790598.
DR   EnsemblGenomes-Tr; EBT00001790599.
DR   EnsemblGenomes-Tr; EBT00001790600.
DR   EnsemblGenomes-Tr; EBT00001790601.
DR   EnsemblGenomes-Tr; EBT00001790602.
DR   EnsemblGenomes-Tr; EBT00001790603.
DR   EnsemblGenomes-Tr; EBT00001790604.
DR   EnsemblGenomes-Tr; EBT00001790605.
DR   EnsemblGenomes-Tr; EBT00001790606.
DR   EnsemblGenomes-Tr; EBT00001790607.
DR   EnsemblGenomes-Tr; EBT00001790608.
DR   EnsemblGenomes-Tr; EBT00001790609.
DR   EnsemblGenomes-Tr; EBT00001790610.
DR   EnsemblGenomes-Tr; EBT00001790611.
DR   EnsemblGenomes-Tr; EBT00001790613.
DR   EnsemblGenomes-Tr; EBT00001790614.
DR   EnsemblGenomes-Tr; EBT00001790615.
DR   EnsemblGenomes-Tr; EBT00001790616.
DR   EnsemblGenomes-Tr; EBT00001790617.
DR   EnsemblGenomes-Tr; EBT00001790618.
DR   EnsemblGenomes-Tr; EBT00001790619.
DR   EnsemblGenomes-Tr; MmarC5_R0001-1.
DR   EnsemblGenomes-Tr; MmarC5_R0002-1.
DR   EnsemblGenomes-Tr; MmarC5_R0003-1.
DR   EnsemblGenomes-Tr; MmarC5_R0005-1.
DR   EnsemblGenomes-Tr; MmarC5_R0006-1.
DR   EnsemblGenomes-Tr; MmarC5_R0007-1.
DR   EnsemblGenomes-Tr; MmarC5_R0008-1.
DR   EnsemblGenomes-Tr; MmarC5_R0009-1.
DR   EnsemblGenomes-Tr; MmarC5_R0010-1.
DR   EnsemblGenomes-Tr; MmarC5_R0011-1.
DR   EnsemblGenomes-Tr; MmarC5_R0012-1.
DR   EnsemblGenomes-Tr; MmarC5_R0013-1.
DR   EnsemblGenomes-Tr; MmarC5_R0014-1.
DR   EnsemblGenomes-Tr; MmarC5_R0015-1.
DR   EnsemblGenomes-Tr; MmarC5_R0016-1.
DR   EnsemblGenomes-Tr; MmarC5_R0017-1.
DR   EnsemblGenomes-Tr; MmarC5_R0018-1.
DR   EnsemblGenomes-Tr; MmarC5_R0019-1.
DR   EnsemblGenomes-Tr; MmarC5_R0020-1.
DR   EnsemblGenomes-Tr; MmarC5_R0021-1.
DR   EnsemblGenomes-Tr; MmarC5_R0022-1.
DR   EnsemblGenomes-Tr; MmarC5_R0023-1.
DR   EnsemblGenomes-Tr; MmarC5_R0024-1.
DR   EnsemblGenomes-Tr; MmarC5_R0025-1.
DR   EnsemblGenomes-Tr; MmarC5_R0026-1.
DR   EnsemblGenomes-Tr; MmarC5_R0027-1.
DR   EnsemblGenomes-Tr; MmarC5_R0028-1.
DR   EnsemblGenomes-Tr; MmarC5_R0029-1.
DR   EnsemblGenomes-Tr; MmarC5_R0030-1.
DR   EnsemblGenomes-Tr; MmarC5_R0031-1.
DR   EnsemblGenomes-Tr; MmarC5_R0032-1.
DR   EnsemblGenomes-Tr; MmarC5_R0033-1.
DR   EnsemblGenomes-Tr; MmarC5_R0034-1.
DR   EnsemblGenomes-Tr; MmarC5_R0035-1.
DR   EnsemblGenomes-Tr; MmarC5_R0036-1.
DR   EnsemblGenomes-Tr; MmarC5_R0037-1.
DR   EnsemblGenomes-Tr; MmarC5_R0038-1.
DR   EnsemblGenomes-Tr; MmarC5_R0039-1.
DR   EnsemblGenomes-Tr; MmarC5_R0040-1.
DR   EnsemblGenomes-Tr; MmarC5_R0041-1.
DR   EnsemblGenomes-Tr; MmarC5_R0042-1.
DR   EnsemblGenomes-Tr; MmarC5_R0043-1.
DR   EnsemblGenomes-Tr; MmarC5_R0044-1.
DR   EnsemblGenomes-Tr; MmarC5_R0045-1.
DR   EnsemblGenomes-Tr; MmarC5_R0046-1.
DR   EnsemblGenomes-Tr; MmarC5_R0047-1.
DR   EuropePMC; PMC2222616; 18042280.
DR   EuropePMC; PMC3479195; 22879377.
DR   EuropePMC; PMC3570448; 23374508.
DR   EuropePMC; PMC6617141; 31216720.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01125; sR4.
DR   RFAM; RF01139; sR2.
DR   RFAM; RF01375; CRISPR-DR62.
DR   RFAM; RF01737; flpD.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000609.
DR   SILVA-SSU; CP000609.
DR   StrainInfo; 715349; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003073
CC   Source DNA and bacteria available from William B. Whitman
CC   (whitman@uga.edu)
CC   Contacts: William B. Whitman (whitman@uga.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1780761
FT                   /organism="Methanococcus maripaludis C5"
FT                   /strain="C5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:402880"
FT   gene            9..743
FT                   /locus_tag="MmarC5_0001"
FT   CDS_pept        9..743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0001"
FT                   /product="6-carboxyhexanoate-CoA ligase"
FT                   /EC_number="6.2.1.14"
FT                   /note="PFAM: 6-carboxyhexanoate--CoA ligase; KEGG:
FT                   mmp:MMP1575 6-carboxyhexanoate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34318"
FT                   /db_xref="GOA:A4FVV0"
FT                   /db_xref="InterPro:IPR005499"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FVV0"
FT                   /protein_id="ABO34318.1"
FT                   /translation="MFSLKMRASRNGNHVSGAERLVNEEKIEKISSELIKRAMSHENGV
FT                   PDFINLKIEKVTEKINKLKHLEIKTVHSTSKENSRNIARNLLKNELEKYYLKNGKDIEK
FT                   IDELIDFAFKIIDAGNMRGAAILDLDGNRLENILERGIRVKNIDTTEELSEKILKDSSL
FT                   TERTVDAIAIATKVVNCGVISELCTSDNFSYTTGYVATKDGYFRILNLKDKGQVGGRVF
FT                   FVENSKIDELYDKLENMPVTVY"
FT   gene            752..1864
FT                   /locus_tag="MmarC5_0002"
FT   CDS_pept        752..1864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0002"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mmp:MMP1574 8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34319"
FT                   /db_xref="GOA:A4FVV1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVV1"
FT                   /protein_id="ABO34319.1"
FT                   /translation="MFRENLKNEIDSIKNQKLYRKLKGEKGIELNFSTNDYLGLSKNND
FT                   VINDYNEGLKYGAGATGSRLTSGNLNHEKLEETISEFKGTEKSLVYSSGYSANLGVISA
FT                   LCKKGDLILSDELNHASIVDGIRLSGADKKIYSHNNTFNLIEILEENKNYENKFIVTDA
FT                   VFSMGGDIAPVDELKKIADEYNAVLILDDAHGTGVLGNGKGTLQHFKIKPNDNIIQIGT
FT                   LSKAIGTVGGFVTGIEELSDYLINTSRSFIYSTALPPAVISASIKSFKLIKSGELTDKL
FT                   SKNIDIANKIFKSAGFIEEEQITPIYPFLFGEKSIKISEELLNYKIFCVGIRYPTVKKG
FT                   SERIRVSITAENKKEDFEYLCESISKINNG"
FT   gene            1939..2499
FT                   /locus_tag="MmarC5_0003"
FT   CDS_pept        1939..2499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0003"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: mmp:MMP1573
FT                   dethiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34320"
FT                   /db_xref="GOA:A4FVV2"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVV2"
FT                   /protein_id="ABO34320.1"
FT                   /translation="MKEKGVNVGYMKPIESGGVEDTLYAKKELGLSENIETLNPINLKN
FT                   PLSPNIAAEVEDFEIDIGKIKESFQKLKENHDYLIVEGAGGVCVPILTDYLMADMIKDL
FT                   KLPCVLVSRPDLGTINHTILSVEYLRKKGITVKGIIINCINELEDVPYYEKTFKTIEEF
FT                   GNIEIIGFVKNKDDYSIKIEKLF"
FT   gene            complement(2514..2810)
FT                   /locus_tag="MmarC5_0004"
FT   CDS_pept        complement(2514..2810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34321"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVV3"
FT                   /protein_id="ABO34321.1"
FT                   /translation="MTPNEQSNVNDLKRQLNIINGTEKLGIESKIDEIGKKWKKIVEET
FT                   KNDFELDSILNLIDFRKEKLISEVSEKEISDGDKELLIVKIYEIRQKLELIKK"
FT   gene            2837..3832
FT                   /locus_tag="MmarC5_0005"
FT   CDS_pept        2837..3832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0005"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   mmp:MMP1571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34322"
FT                   /db_xref="GOA:A4FVV4"
FT                   /db_xref="InterPro:IPR038880"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVV4"
FT                   /protein_id="ABO34322.1"
FT                   /translation="MQIIIIKIALDYIYYLLGDNLDSILIAEAFSSSFFYTVRISAVVL
FT                   LTIYIVNYFVNNGLLEKISSYTYPITQKLNLNSFLVSSILVSFFSPTVGYTMLADGIAE
FT                   KELTETEVLAGTLANSFPAVLSHVLTYYIPVVIPILGYTGIIYVILRLSIAFTKSILGL
FT                   FVLLMISRKSEKKIQTQINNKNNKKSPFEKTFKFARRFVPVMFVSMFLVLYLSKTGFFN
FT                   IFSTIVMPVTNIFNLNPNTGILAITEIINVSAAMVMAGTFLNEGSLSANEVLIGLIFGN
FT                   IVAFSTRSVKHSIPLHFSLFGSKRGTKIILLNSSVTIILDILIIGLLIMF"
FT   gene            3841..4596
FT                   /locus_tag="MmarC5_0006"
FT   CDS_pept        3841..4596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0006"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: mmp:MMP1570 TatD-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34323"
FT                   /db_xref="GOA:A4FVV5"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVV5"
FT                   /protein_id="ABO34323.1"
FT                   /translation="MNLDDFKYIDSHCHVEDKSLNKFREDIVKRAFDEKVQMVTSGTNL
FT                   GGCRRAVELKDKYGIYITLGYHPGRVNAEDNAIDKVYRFIQSKEKDILAVGEIGLDFDA
FT                   GNTERQESIFKKFIKLAEELNKPVVIHARGMEERSYEILRNDSVSMYHCYSGSLELAKG
FT                   LIENGNFISYSTLVCFSDHHKNLVKNLSLENIVVETDSPYISPIKGEKNEPRNVIKVIE
FT                   TIWELKKDEYSLDEITKIIYNNTKRLYHI"
FT   gene            4607..4915
FT                   /locus_tag="MmarC5_0007"
FT   CDS_pept        4607..4915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0007"
FT                   /product="Protein of unknown function DUF749"
FT                   /note="PFAM: Protein of unknown function DUF749; KEGG:
FT                   mmp:MMP1569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34324"
FT                   /db_xref="InterPro:IPR008032"
FT                   /db_xref="InterPro:IPR035933"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVV6"
FT                   /protein_id="ABO34324.1"
FT                   /translation="MVKFTAKLISIITVEEALNSEVSGTVRVRASHDNRELDPNQNVAI
FT                   LNIEGTTSYQAYFVDPDTDIEKIKADLEKYGAVLNHNSEEIIKKYVERMNDEGCQGD"
FT   gene            4890..5426
FT                   /locus_tag="MmarC5_0008"
FT   CDS_pept        4890..5426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34325"
FT                   /db_xref="InterPro:IPR017098"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVV7"
FT                   /protein_id="ABO34325.1"
FT                   /translation="MMKDAKGIDKQWVILNELASKVSKIRPLPEDVYSKLRIANNIITY
FT                   YLLDEHADFEVLRDAEKEISKIQVILFGLADPDTSKEYLIKMGQALRNEIDLEFPLKQT
FT                   SFNTEVKRKKDSETIRINMPVEVHIEVLGELSEHNGVIFELSQEDEKKVLIEGVKEKIT
FT                   TTLKDFSVIWKFTDN"
FT   gene            complement(5510..6469)
FT                   /locus_tag="MmarC5_0009"
FT   CDS_pept        complement(5510..6469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0009"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit H"
FT                   /EC_number="2.1.1.86"
FT                   /note="TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, MtrH subunit; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase, MtrH subunit;
FT                   KEGG: mmp:MMP1567 N5-methyltetrahydromethanopterin:
FT                   methyltransferase, subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34326"
FT                   /db_xref="GOA:A4FVV8"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR023467"
FT                   /db_xref="InterPro:IPR028342"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FVV8"
FT                   /protein_id="ABO34326.1"
FT                   /translation="MFRFDKEQMVIEFAGAKFGGQPGEYPTALSGTIFYARHKIVEDAK
FT                   KGIFDKKAAEALINKQAEMQDITGNSAFVQVFGGTEEALVNYIDFVSEVWDGPMLLDST
FT                   SGKARMAAANRATEAGYAKQCVYNSINVAAEDEEIENLTNSDVEASIVLCFDPMDPSVG
FT                   GKLNVLNDGGKTKDIGMLELAEKAGIKYPLIDVAVTPMGNGAGHAVRASFAVKAKLGLP
FT                   VGSGIHNVPSAWDWLREFRKGLREEGKDQISKDVHHVCDIGANIVQTMASGDYVLYGPI
FT                   DNAELAFPAVAMTDMIIAETAKEMGTATVAEHPLNKLI"
FT   gene            complement(6494..6718)
FT                   /locus_tag="MmarC5_0010"
FT   CDS_pept        complement(6494..6718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0010"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit G"
FT                   /EC_number="2.1.1.86"
FT                   /note="PFAM: Tetrahydromethanopterin S-methyltransferase,
FT                   subunit G; KEGG: mmp:MMP1566
FT                   N5-methyltetrahydromethanopterin: methyltransferase,
FT                   subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34327"
FT                   /db_xref="GOA:A4FVV9"
FT                   /db_xref="InterPro:IPR005866"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVV9"
FT                   /protein_id="ABO34327.1"
FT                   /translation="MSEIPTVVTPTKDYKKLQAKLDEIENTVENTNAEIIQRTGKKAGR
FT                   DVGIAYGLAIGFIFVYVLGTVLPLFDLIK"
FT   gene            complement(6723..7484)
FT                   /locus_tag="MmarC5_0011"
FT   CDS_pept        complement(6723..7484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0011"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit A / tetrahydromethanopterin S-methyltransferase,
FT                   subunit F"
FT                   /EC_number="2.1.1.86"
FT                   /note="TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, subunit A; tetrahydromethanopterin
FT                   S-methyltransferase, F subunit; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase subunit A, N
FT                   terminal domain protein; KEGG: mmp:MMP1565
FT                   N5-methyltetrahydromethanopterin: methyltransferase,
FT                   subunit A and F related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34328"
FT                   /db_xref="GOA:A4FVW0"
FT                   /db_xref="InterPro:IPR005778"
FT                   /db_xref="InterPro:IPR013347"
FT                   /db_xref="InterPro:IPR030688"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVW0"
FT                   /protein_id="ABO34328.1"
FT                   /translation="MADKKAPAAGWPVANGEYVVGNPESCVAVITLGSHGLDQAAIDAG
FT                   AAISGPCHTENLGIEKVVANYISNPNIRFMVIAGSEVQGHITGQCIKALYENGIGDDGG
FT                   IIGAKGAIPFMENVGKEPVGRLQTQVVECIDLIDVEDKGKIADAIKNCISKDPGAFEED
FT                   PMVIELEGGAAAAGDEEGGLMIEGIPTVAEPDIESIKSLNEALDYKVGLMTRDLGLASG
FT                   VQTETVTGLMYGSVFAIALIAVPIALKFLMG"
FT   gene            complement(7501..8220)
FT                   /locus_tag="MmarC5_0012"
FT   CDS_pept        complement(7501..8220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0012"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit A"
FT                   /EC_number="2.1.1.86"
FT                   /note="TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, subunit A; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase subunit A, N
FT                   terminal domain protein; KEGG: mmp:MMP1564
FT                   N5-methyltetrahydromethanopterin: methyltransferase,
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34329"
FT                   /db_xref="GOA:A4FVW1"
FT                   /db_xref="InterPro:IPR005778"
FT                   /db_xref="InterPro:IPR030688"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVW1"
FT                   /protein_id="ABO34329.1"
FT                   /translation="MADKKAPAAGWPVANGEYVVGNPESCVAVITLGSHGLDQAAIDAG
FT                   AAISGPCHTENLGIEKVVANYISNPNIRFMVIAGSEVQGHITGQCIKALYENGIGDDGG
FT                   IIGAKGAIPFMENVGKEPVGRLQTQVVECIDLIDVEDKGKIADAIKNCISKDPGAFEED
FT                   PMVIELEGGAAAAGDESTSIKPTSPEMALLEARMRIVSEKMNEAAMIAKFNSGYYNGKI
FT                   QGIAIGLFLSILVFSLL"
FT   gene            complement(8242..8568)
FT                   /locus_tag="MmarC5_0013"
FT   CDS_pept        complement(8242..8568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0013"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit B"
FT                   /EC_number="2.1.1.86"
FT                   /note="PFAM: Tetrahydromethanopterin S-methyltransferase
FT                   subunit B; KEGG: mmp:MMP1563
FT                   N5-methyltetrahydromethanopterin: methyltransferase,
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34330"
FT                   /db_xref="GOA:A4FVW2"
FT                   /db_xref="InterPro:IPR008690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FVW2"
FT                   /protein_id="ABO34330.1"
FT                   /translation="MDIVKVCPEIQIAMDIDSGLIAEMRKDILVVDLHPVEDEINRLAQ
FT                   YAKALENSLDPRNSPMKAYAGREGTYKLAGMFQGMFFGFWVTMAILVLVTILAVKMNLS
FT                   LIGL"
FT   gene            complement(8579..9367)
FT                   /locus_tag="MmarC5_0014"
FT   CDS_pept        complement(8579..9367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0014"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit C"
FT                   /EC_number="2.1.1.86"
FT                   /note="TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, subunit C; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase, subunit C;
FT                   KEGG: mmp:MMP1562 N5-methyltetrahydromethanopterin:
FT                   methultransferase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34331"
FT                   /db_xref="GOA:A4FVW3"
FT                   /db_xref="InterPro:IPR005865"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FVW3"
FT                   /protein_id="ABO34331.1"
FT                   /translation="MSHGGGGHAAELFPEDQVLAFGAVLSLVGIYIAHFFPSLAMLLGG
FT                   LLAAGACVAGANTTRRVAAYGLGTGVPSIGMVSLGMGTISALAGVLIPSAFGLPVLVTP
FT                   ILAAVIAVVVGFIVGKLTQNPVGMKVPIIVSSMTKLSLMGALAILGFCTAFAGGFSADI
FT                   IINGAINNGVIALAFIAAGMAILHPFNACIGPDESHKRTMTLAVACGFMAWLVFAIAKL
FT                   DIVSTAVAAIFWFIAYGTFVKTSLADACEVKYVPELPKKE"
FT   gene            complement(9406..10113)
FT                   /locus_tag="MmarC5_0015"
FT   CDS_pept        complement(9406..10113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0015"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit D"
FT                   /EC_number="2.1.1.86"
FT                   /note="TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, subunit D; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase, subunit D;
FT                   KEGG: mmp:MMP1561 N5-methyltetrahydromethanopterin:
FT                   methyltransferase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34332"
FT                   /db_xref="GOA:A4FVW4"
FT                   /db_xref="InterPro:IPR005779"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVW4"
FT                   /protein_id="ABO34332.1"
FT                   /translation="MDATSFILPLAEITIAGAIINASVHFVPVGGAPAAMATSTGVGTG
FT                   TTQLAAGAGFTGLLAAATMASQAGVSLANPVHMLLIMLSGAVGAMIMLGLTMLIGQIIY
FT                   VYGIGIVPAADKCEKDPITGDIQKPYITPGTTGHGIPTVCFVSGTIGAALGGLGGALAY
FT                   IALQQLGFAAAIAGVLAVGFFFMNAVLASYNIGGTIEGFHDPKFKKMPNGVIASFVSSL
FT                   IAGAVLIGMAMGL"
FT   gene            complement(10140..11039)
FT                   /locus_tag="MmarC5_0016"
FT   CDS_pept        complement(10140..11039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0016"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit E"
FT                   /EC_number="2.1.1.86"
FT                   /note="KEGG: mmp:MMP1560 N5-methyltetrahydromethanopterin:
FT                   methyltransferase, subunit E; TIGRFAM:
FT                   tetrahydromethanopterin S-methyltransferase, subunit E;
FT                   PFAM: Tetrahydromethanopterin S-methyltransferase, subunit
FT                   E"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34333"
FT                   /db_xref="GOA:A4FVW5"
FT                   /db_xref="InterPro:IPR005780"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FVW5"
FT                   /protein_id="ABO34333.1"
FT                   /translation="MDPTLISLGALALAGAAATVSGCAEDLESDVGSQSNPNSQVQLGP
FT                   QMGNIHRYFNKAISGEPVSYGLYVAVAGTIAWALINAGLNAVLAIIVGSGVAAVVHGAY
FT                   SVSAFLGRTVGQSKKFGQPVYMDVLTSHIGPIVGHGFIAVFTMTLAAYLATTALGNPFP
FT                   LPLVALIFGITVGAIGSSTGDVHYGAEREYQKYPFGGGIPVANQGDIDIYAEYGVRNGL
FT                   DSSYFCSRFGGPLTGLCFGLIIFLDGWRSILGNIIGGDLVTKTSIALLVGLLVVAVAAG
FT                   INRKLEVYARNKYGPYRN"
FT   sig_peptide     complement(10965..11039)
FT                   /locus_tag="MmarC5_0016"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.763 at
FT                   residue 25"
FT   gene            complement(11309..12970)
FT                   /locus_tag="MmarC5_0017"
FT   CDS_pept        complement(11309..12970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0017"
FT                   /product="methyl-coenzyme M reductase, alpha subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="PFAM: methyl-coenzyme M reductase, alpha subunit
FT                   domain protein; KEGG: mmp:MMP1559 methyl-coenzyme M
FT                   reductase I, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34334"
FT                   /db_xref="GOA:A4FVW6"
FT                   /db_xref="InterPro:IPR003183"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR009047"
FT                   /db_xref="InterPro:IPR015811"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR016212"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVW6"
FT                   /protein_id="ABO34334.1"
FT                   /translation="MEAEKRLFLKALKEKFEEDPKEKYTKFYTYGGWEQSARKREFVEA
FT                   NEKILAEKRQGVPLYNPDIGVPLGQRKLMPYKLSNTDDYCEGDDLHFMNNAAIQQLWDD
FT                   IRRTVIVGMDTAHSVLEKRLGVEVTPETINEYMHTINHALAGGAVVQEHMVEVHPSLAW
FT                   DCYARIFTGDDELADELDDKFLIDINKLFPEDQAETIKAAIGKKTYQVSRVPSLVGRVC
FT                   DGGTISRWSAMQIGMSFITAYKLCAGEAATADFSYASKHADVIQMGNALPGRRARGPNE
FT                   PGGIRFGILSDVVQTTRVSEDPVEQSLEVVATGAALYDQIWLGAYMSGGVGFTQYATAS
FT                   YTDDILDDFSYYGLDYVEKKYGRMGTKATMDVVEDVAGEVTLYALEQYDEYPALLEDHF
FT                   GGSQRAAVAAAASGISVCMATGNSNAGVNGWYLSQLLHKEYHSRLGFYGYDLQDQCGAS
FT                   NSLAIRNDEAAPLELRGPNYPNYAMNVGHQGEYAGIAQSAHSARGDAFALSPLVKVAFA
FT                   DPMLVFDFSKPRKEFARGALREFDAAGERDIILPAK"
FT   gene            complement(13011..13793)
FT                   /locus_tag="MmarC5_0018"
FT   CDS_pept        complement(13011..13793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0018"
FT                   /product="methyl-coenzyme M reductase, gamma subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="PFAM: Methyl-coenzyme M reductase, gamma subunit;
FT                   KEGG: mmp:MMP1558 methyl-coenzyme M reductase I, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34335"
FT                   /db_xref="GOA:A4FVW7"
FT                   /db_xref="InterPro:IPR003178"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR036994"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVW7"
FT                   /protein_id="ABO34335.1"
FT                   /translation="MAYTPQFYPGATKVAENRRNHLNPNYELEKLREIPDEDVVKIMGH
FT                   RQPGEDYKTVHPPLEEMDFIEDYARDLVEPLNGAKEGHRVRYIQFADSMYYAPAQPYDR
FT                   SRSYMTRLRGVDAGTLSGRQVVECRESDLEEFSKNILMDTELFDPATSGVRGATVHGHS
FT                   LRLDENGMMFDALQRSVFDEKTGHVMYVKDQVGKPLDAPVDVGEPLPEAKLREMTTIYR
FT                   KDGIEMRADPDVIDVVKRIHRARTLGGYIPTNEIFKGL"
FT   gene            complement(13803..14399)
FT                   /locus_tag="MmarC5_0019"
FT   CDS_pept        complement(13803..14399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0019"
FT                   /product="Methyl-coenzyme M reductase operon protein C"
FT                   /note="PFAM: Methyl-coenzyme M reductase operon protein C;
FT                   KEGG: mmp:MMP1557 methyl coenzyme M reductase I, protein C"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34336"
FT                   /db_xref="GOA:A4FVW8"
FT                   /db_xref="InterPro:IPR007687"
FT                   /db_xref="InterPro:IPR026327"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVW8"
FT                   /protein_id="ABO34336.1"
FT                   /translation="MPVGRKEQIVDCRAVMGLGEGGGLAQRGTFAEGLRNDVVVVAMSP
FT                   GRRHITKPVCEITYGIREAGIQTSVLVLDAGAGIPSDAPQGSLGSTFGLKPEEAKQVNR
FT                   HKLCVIHFGNVKSHIIYKARLFLRYVDIPTIVVCQSPVDMEDFATIGIKTRNVMPLESK
FT                   TEGKIVEIITGVIRGESAPQKKIDEIIECIKKHLG"
FT   gene            complement(14408..14887)
FT                   /locus_tag="MmarC5_0020"
FT   CDS_pept        complement(14408..14887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0020"
FT                   /product="Methyl-coenzyme M reductase, protein D"
FT                   /note="PFAM: Methyl-coenzyme M reductase, protein D; KEGG:
FT                   mmp:MMP1556 methyl-coenzyme M reductase I, protein D"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34337"
FT                   /db_xref="GOA:A4FVW9"
FT                   /db_xref="InterPro:IPR003901"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVW9"
FT                   /protein_id="ABO34337.1"
FT                   /translation="MIELEVFPHRYLKAETTEKFLNSAYSLSTVQRVVIHGESLPKKVG
FT                   YGPAKGTPVNHSEKKEITVRGVPVELMLQVGRLWVLLDDESEIEKIDEICKDLFPFGYR
FT                   LTKGKFLRNTPTVTDFIKYGESAVNDIDKRLLSATDPRSKFDSSVALIPKSETNE"
FT   gene            complement(14899..16230)
FT                   /locus_tag="MmarC5_0021"
FT   CDS_pept        complement(14899..16230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0021"
FT                   /product="methyl-coenzyme M reductase, beta subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="PFAM: Methyl-coenzyme M reductase, beta subunit;
FT                   KEGG: mmp:MMP1555 methyl-coenzyme M reductase I, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34338"
FT                   /db_xref="GOA:A4FVX0"
FT                   /db_xref="InterPro:IPR003179"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR022679"
FT                   /db_xref="InterPro:IPR022680"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVX0"
FT                   /protein_id="ABO34338.1"
FT                   /translation="MVKYDDKISLYDAKGNLVADNVPLEAISPLYNPTIKNMVKNIKRT
FT                   VAVNLAGIESTLAAGKIGGKGCQVPGRTLDISAVSNAQAIADEVEKILKVSEDDDTAVK
FT                   LVNGGKQLAVQVPTARLEVAAEYSVSMLSTAMALKEALIKTFDIDMFDGSTVHAAIVGN
FT                   YPQVMDYAGGNIASLLGAPSNMEGLGYALRNIPVNHAVATTKKNMMNAIAFSSVMEQTA
FT                   TFEMGDAVGSFERQHLLGLAYQGLNADNLVIDFIKANGKGTVGSVVETVVERAIADGVI
FT                   VVDKTMSSGFNMYKPADVNKWNAYAAAGLVAAVAVSCGAARAAQNVASVILYFNDILEY
FT                   ETGLPGVDYGRSMGTAVGFSFFSHSIYGGGGPGIFNGNHVVTRHSKGFAIPPVCAAMCA
FT                   DAGTQMFSPETTSGLVGAVYSAFDEFREPMKYVIEGALSIKDQF"
FT   gene            16490..17800
FT                   /locus_tag="MmarC5_0022"
FT   CDS_pept        16490..17800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0022"
FT                   /product="protein of unknown function DUF512"
FT                   /note="PFAM: Radical SAM domain protein; protein of unknown
FT                   function DUF512; KEGG: mmp:MMP1554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34339"
FT                   /db_xref="GOA:A4FVX1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017672"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVX1"
FT                   /protein_id="ABO34339.1"
FT                   /translation="MNQKFGFNNIDVGFGFEDNEDNNADDKSQILIDLKGEPGKNCGGF
FT                   CKFCYFRKVNFNNPKPLGCGQCTFQIGCDYCTNSIREINGNFIPIPFAVEQVQNALLFK
FT                   KYEKVNITSGGDTSYYPYLEDLCKIINEMGLKIHLGYTSGKGLNGIESAKYLVKSGVEE
FT                   VTFSVFSTDPKLREEWMNDKNPEQSLECLKYFCETCETHCAIIVVPGVNDGEVLKNTIS
FT                   DLVSWGANAVILMRFANKVENGLIFENEPLIEDINVQSVEEFGKLVKEMYELFGNNIRI
FT                   SGTPVYDPITNTPFAIYYEDEVLNELRSKIKAEATIITGNVSFIYLSKIFENTPIKVIS
FT                   VNKDIADLITKKDLESVDLSEVTDTVLYPENAIVHERDAEDIFTKDGMKRIVLRGIDKL
FT                   TMDGEVSGIFTKEEAIEFEVNAFNELIEKINFFGNPI"
FT   gene            complement(17793..18065)
FT                   /locus_tag="MmarC5_0023"
FT   CDS_pept        complement(17793..18065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34340"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVX2"
FT                   /protein_id="ABO34340.1"
FT                   /translation="MLKCHKPHTDYLTKITYKNKILETSNSNFIIDDSKIFETMLNQVD
FT                   NSFTEWRYVFEKNNLEIDLLYFSIFAECLNREADYVFEHKYPEFK"
FT   gene            complement(18404..18518)
FT                   /pseudo
FT                   /locus_tag="MmarC5_R0001"
FT                   /note="tRNA-OTHER3"
FT   tRNA            complement(18404..18518)
FT                   /pseudo
FT                   /locus_tag="MmarC5_R0001"
FT                   /product="tRNA-OTHER"
FT   gene            18648..18732
FT                   /locus_tag="MmarC5_R0002"
FT                   /note="tRNA-Leu1"
FT   tRNA            18648..18732
FT                   /locus_tag="MmarC5_R0002"
FT                   /product="tRNA-Leu"
FT   gene            18896..19453
FT                   /locus_tag="MmarC5_0024"
FT   CDS_pept        18896..19453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0024"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; KEGG: mmp:MMP1552
FT                   flavoprotein:phenylacrylic acid decarboxylase,
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34341"
FT                   /db_xref="GOA:A4FVX3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVX3"
FT                   /protein_id="ABO34341.1"
FT                   /translation="MDEIIVCITGASGVIYSKRLLEVLKEENIKTSLIISNSAKKIIKH
FT                   ELKMEIDEFKKLADNYYENDNFFSPVASGSHKFKAAVVVPCSMKSLSSIATGYSDNLIG
FT                   RVCDIALKERRNLTIVPREMPFSTIHLENMAKLSHLGVSIIPPAPGFYNDPKTIDDLVN
FT                   FVVGRILDNLKIENKIFKRWGE"
FT   gene            19480..20832
FT                   /locus_tag="MmarC5_0025"
FT   CDS_pept        19480..20832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0025"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="PFAM: GTP-binding signal recognition particle SRP54,
FT                   G- domain; Signal peptide binding (SRP54) M- domain
FT                   protein; GTP-binding signal recognition particle SRP54,
FT                   helical bundle; SMART: AAA ATPase; KEGG: mmp:MMP1551 signal
FT                   recognition particle protein SRP54"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34342"
FT                   /db_xref="GOA:A4FVX4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FVX4"
FT                   /protein_id="ABO34342.1"
FT                   /translation="MLDKLGQNLSDALNKIKNATFVDKKLVKEVIKDIQKALIQSDVNV
FT                   KLVFNMSKEIERKAIEEAPPKGLSKKEHIVKIVYDELVKLLGETTQKLELDPSKKSVIL
FT                   LIGIQGSGKTTSAAKLARYIQKKGLRPGLIAADVYRPAAYQQLKQLSEKINVPLFGDET
FT                   RTKTPVDITKEGMEKLKKVDVIIIDTAGRHKEEESLLAEMKEMKDLTNPNEIILVIDGT
FT                   LGQQAKNQAKAFKESVSEIGSILVTKLDGSAKGGGALSAVAEINAPIKFIGTGEGVDNL
FT                   EQFDPKKFISRILGLGDLDSLLEKTEDIMDESTEESIDSILKGKFTLIELYAQLETISK
FT                   MGPMKQILSMIPGMGGNLPKEAAQLTEDKLKRYKIMMDSMTLEEKENPELIKTSRLQRI
FT                   AKGAGVKQDEIKDLLKYYSTTKNAFGNLKRGKMPKMGGQMGQIMRQLMYKD"
FT   gene            complement(21184..21855)
FT                   /locus_tag="MmarC5_0026"
FT   CDS_pept        complement(21184..21855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0026"
FT                   /product="reduced coenzyme F420:NADP oxidoreductase"
FT                   /EC_number="1.6.99.-"
FT                   /note="TIGRFAM: NADPH-dependent F420 reductase; PFAM: NADP
FT                   oxidoreductase, coenzyme F420-dependent; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; KEGG:
FT                   mmp:MMP1550 NADP oxidoreductase, coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34343"
FT                   /db_xref="GOA:A4FVX5"
FT                   /db_xref="InterPro:IPR010185"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVX5"
FT                   /protein_id="ABO34343.1"
FT                   /translation="MKIAILGGTGDQGFGLGLRFSKNHEILIGSRKAEKAEEAAENALK
FT                   IISEKGYSADIKGMTNIEASKLADVVIVSLPFEYTISTLKELKDVLKGKIVVSIGVPLA
FT                   TAIGDKPTRVIACPQGSVAELIQEMLPESNVVSGFQNICSKCLEDLDCDVACDVLIAGN
FT                   DKDAKKVIVDLASEIPGVRGIDAGKLEISKFIEQITPLLIQLNIKYKLKGAGIHITGLN
FT                   L"
FT   gene            complement(21877..22683)
FT                   /locus_tag="MmarC5_0027"
FT   CDS_pept        complement(21877..22683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0027"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   SMART: AP endonuclease, family 2; KEGG: mmp:MMP1549 AP
FT                   endonuclease, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34344"
FT                   /db_xref="GOA:A4FVX6"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVX6"
FT                   /protein_id="ABO34344.1"
FT                   /translation="MKYGISSLVFLPETLQSSMEKVATNSFDCWEIVSEGSHQLNPKNI
FT                   KYLRNLREEYDVDLVIHAPFSDLNPASMNRDVRNLTTNSIIEAIEGAFELDANVVTVHP
FT                   GYLPPLWSDYTKEILDNNFSSLNDIVEMAEDYEVMIGLENMPNYPGVLGVTIESLKDII
FT                   KDINSKYLGITFDIGHANTATKNPETFVKELNKIGKGIVHVHIHDNMGTEDEHALIGAG
FT                   NIDFLKILSELKDINYDNVLSFESKSIRDAVNSRETINKYLSMIEK"
FT   gene            22761..23336
FT                   /locus_tag="MmarC5_0028"
FT   CDS_pept        22761..23336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0028"
FT                   /product="fumarase beta subunit"
FT                   /EC_number="4.2.1.2"
FT                   /note="KEGG: mmp:MMP1548 Fe-S type hydro-lyases
FT                   tartrate/fumarate beta region; TIGRFAM: hydro-lyases, Fe-S
FT                   type, tartrate/fumarate subfamily, beta subunit; PFAM: Fe-S
FT                   type hydro-lyases tartrate/fumarate beta region"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34345"
FT                   /db_xref="GOA:A4FVX7"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVX7"
FT                   /protein_id="ABO34345.1"
FT                   /translation="MQLKTPISKEDVKKLKVGDIVYLSGDICTGRDEAHITTIEEKKPP
FT                   INLENGVIYHAGPIMKKEKNGKWTCVAIGPTTSARMNGLEEDFIRITNISAIVGKGGMD
FT                   DKLLKTFEESGVIYFAAPGGCAALLADSVNEVKNVYHLELGMPEAFWELSVENFGPLIV
FT                   AMDAHGNSLYSKVNEDVDKNLENILKKL"
FT   gene            complement(23422..23907)
FT                   /locus_tag="MmarC5_0029"
FT   CDS_pept        complement(23422..23907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0029"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: mmp:MMP1547 SSU ribosomal protein
FT                   S19P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34346"
FT                   /db_xref="GOA:A4FVX8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FVX8"
FT                   /protein_id="ABO34346.1"
FT                   /translation="MARQKKYSGKGGARKKNKQKQNVAPRRRVEFKYKGFTLEELQEMP
FT                   IKKFMEIVPSRQRRTMARGITPKQRKLVMKIKKARRLTNRGKEARVIRTHCRDFVITPE
FT                   MIGLTFGIYNGKEFKEIKLVEETVGRFLGEMAPTRAVVQHGSPGMGATRGSMFVPIK"
FT   gene            complement(23946..24668)
FT                   /locus_tag="MmarC5_0030"
FT   CDS_pept        complement(23946..24668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0030"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: mmp:MMP1546 LSU
FT                   ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34347"
FT                   /db_xref="GOA:A4FVX9"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="InterPro:IPR023672"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FVX9"
FT                   /protein_id="ABO34347.1"
FT                   /translation="MGKRLISQNRGRGTPKYRSPTHKRKGAVKYRSYDEMEKDGKILGT
FT                   VVDILHDPGRSAPVAKVRFANDEERLVLIPEGIQVGEEIECGISAEIKPGNVLPLGEIP
FT                   EGIPVYNIETIPGDGGKLVRSGGCYAHVISHDVGKTIVKLPSGFSKVLNPACRATVGVV
FT                   AGGGRKEKPFVKAGKKYHSLSAKAVAWPKVRGVAMNAVDHPYGGGRHQHLGKPSSVSRH
FT                   TSPGRKVGHIASRRTGRK"
FT   gene            complement(24709..24969)
FT                   /locus_tag="MmarC5_0031"
FT   CDS_pept        complement(24709..24969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0031"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: mmp:MMP1545
FT                   LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34348"
FT                   /db_xref="GOA:A4FVY0"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="InterPro:IPR019985"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FVY0"
FT                   /protein_id="ABO34348.1"
FT                   /translation="MDAFDVIKTPIVSEKTMKLIEEENRLVFYVERKATKADIRAAIKE
FT                   LFDAEVADINTSITPKGKKKAYITLKAEYNAGEVAASLGIY"
FT   gene            complement(24991..25749)
FT                   /locus_tag="MmarC5_0032"
FT   CDS_pept        complement(24991..25749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0032"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: mmp:MMP1544
FT                   LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34349"
FT                   /db_xref="GOA:A4FVY1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013000"
FT                   /db_xref="InterPro:IPR019970"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FVY1"
FT                   /protein_id="ABO34349.1"
FT                   /translation="MNVKVYNLDGSEKGDIELPAVFETEYRPDLIKRAVISSLTAKLQP
FT                   KGCDAFAGYRTSAKSIGKGHGKARVRRTAQGAGAFVPQAVGGRRAHPPKVEKILFERIN
FT                   KKEKLKALASAIAASAIPEIVSARGHKIEGVPSLPLVVNAEFEGLVKTKEVLDVFKALN
FT                   LAADVEKAKDGIKIKAGRAKLRGRKYKKPRSVLVVVGDACEAIAASRNLAGVDVITAND
FT                   LSAIHIAPGTMAGRLTLWTENAIEKINGRF"
FT   gene            complement(25780..26784)
FT                   /locus_tag="MmarC5_0033"
FT   CDS_pept        complement(25780..26784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0033"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: mmp:MMP1543 LSU
FT                   ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34350"
FT                   /db_xref="GOA:A4FVY2"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FVY2"
FT                   /protein_id="ABO34350.1"
FT                   /translation="MGMKKNRPRRGSLAFSPRKRAKKLVPKIRSWPADKKVGLQAFPVY
FT                   KAGTTHALLIENNPKSPNNGQEVFTPVTVLETPDVTVAGIRLYEKTTKGLKALTEVWAE
FT                   QLDGDLGRKLTLAKKEEKKTADALDAVVEKATEVRAIVHTNPKTTGIPKKKPEVVEIRI
FT                   GGSSVAERLAYAKEILGKTLAIGDVFEAGEIIDTLAITKGKGFQGSVKRWGIKVQFGKH
FT                   QRKGVGRHTGSIGPWRPRRVMWTVPLPGQMGFHQRTEYNKRILKLGSEGAEITPKGGFL
FT                   NYGAVKNGYVVVKGTVQGPAKRLVVLRGSVRAAEDKFGLPEVAYISTESKQGN"
FT   gene            27051..27641
FT                   /locus_tag="MmarC5_0034"
FT   CDS_pept        27051..27641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0034"
FT                   /product="Translin"
FT                   /note="PFAM: Translin; KEGG: mmp:MMP1542 translin related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34351"
FT                   /db_xref="GOA:A4FVY3"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR036081"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVY3"
FT                   /protein_id="ABO34351.1"
FT                   /translation="MKNRSYLIEFFEKKNNTREKILKISREIVKDSGLIIRKIQKGTEV
FT                   DFTDIEEKLKELKNFSEDHFEFQKYRGTPEQEYVETRVYYSIIFENKILDFFDFDNILE
FT                   ESYILGLCDVIGELRRIILESIRKDEKTKAELYFEYMNKIYDFLMEFDNYHVIDGLRRK
FT                   QDVSRSLIEKTHGDIINFNENLKLRIELSKFNK"
FT   gene            complement(27698..27772)
FT                   /locus_tag="MmarC5_R0003"
FT                   /note="tRNA-Ile1"
FT   tRNA            complement(27698..27772)
FT                   /locus_tag="MmarC5_R0003"
FT                   /product="tRNA-Ile"
FT   gene            complement(27939..28760)
FT                   /locus_tag="MmarC5_0035"
FT   CDS_pept        complement(27939..28760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34352"
FT                   /db_xref="GOA:A4FVY4"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVY4"
FT                   /protein_id="ABO34352.1"
FT                   /translation="MIIAGAVPIKGMDLIKGPVKLNKDTVEIENKKLPLSMGTCALLGA
FT                   AFKTLEYFGKETELTFITSGDVGEGEGSLKIYEELHEINDEITIIHYIKPKISEIIKVD
FT                   FSKKVIGDAGGMYAGKAAGIGDKFHMFFPDVGELAFLADEKSSHPAYVRGFISEIDDQE
FT                   IPKLIKMAYTQKMPKNMVVKGSKDHIVHEGNVIDTVEYPKFEAMECIGGTGDTLTGITS
FT                   SLIACGFKTEKAGVLGCKLNRKLGELVKPKPDTQIYEIIQKIPDALKEFDL"
FT   gene            complement(28757..29323)
FT                   /locus_tag="MmarC5_0036"
FT   CDS_pept        complement(28757..29323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34353"
FT                   /db_xref="InterPro:IPR021778"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVY5"
FT                   /protein_id="ABO34353.1"
FT                   /translation="MSSIFGKLNTILNPKKEKVEKKGNGLILFKNVKDAISAERILKDY
FT                   SVKVVAPPQEIREGCDLAVEYDLVEEMGIKRELENNNLEAVKFISLDDTSMEPLSLVKV
FT                   KKIDGFTLVRSGNMKITIDKVGNIVNISGGGCPDVPYLNLKLKGKNILDVAEEDSPKHL
FT                   GYTLCAYTLNKAFEKAKTIALEGIK"
FT   gene            complement(29385..29855)
FT                   /locus_tag="MmarC5_0037"
FT   CDS_pept        complement(29385..29855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0037"
FT                   /product="transporter component"
FT                   /note="KEGG: mmp:MMP1538 predicted transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34354"
FT                   /db_xref="GOA:A4FVY6"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVY6"
FT                   /protein_id="ABO34354.1"
FT                   /translation="MSYVPAIATLAFGILLGYLGQRSSMCFCGGIRDFYLMKDTWLVKG
FT                   LLGFVGGALIGSIIFNVIGMLPLFPWIATKGLTAIPGDAAGSLGFGAHFIVTIIGGFGV
FT                   GFLSVIQGGCPFRNYVMAGEGNQTAMAYVIGLAIGAIAFHQWVAPFVASILA"
FT   gene            complement(29877..30332)
FT                   /locus_tag="MmarC5_0038"
FT   CDS_pept        complement(29877..30332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0038"
FT                   /product="cytochrome c heme-binding site"
FT                   /note="KEGG: mmp:MMP1537 cytochrome c heme-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34355"
FT                   /db_xref="GOA:A4FVY7"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVY7"
FT                   /protein_id="ABO34355.1"
FT                   /translation="MKVSPLQTGLIAGFSAILLEVIFKVTPPPAYGLCVACHTRDLVNW
FT                   IVNSVAGTTLGMAPVSKLIPLLTVVGLLIGALIGAIVHKDFKIRKTHGLVTGFILGFLV
FT                   LNFALLMGGCPVRMGLRTAYGDIFGLLGILGIAAGVIVSTEVYLKKA"
FT   gene            30553..31164
FT                   /locus_tag="MmarC5_0039"
FT   CDS_pept        30553..31164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0039"
FT                   /product="nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; KEGG: mmp:MMP1536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34356"
FT                   /db_xref="GOA:A4FVY8"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVY8"
FT                   /protein_id="ABO34356.1"
FT                   /translation="MSSLVLNDKKIVFSCILCVIFGISFLSTYNIDPEEKYISNLNEGD
FT                   YVKITAKIQKLDVKMKEYLEVTGIKSIKLMDETAGDLLVYVSDDISDEFLEIILKTTPR
FT                   IKEGDIVEVTGKIQIYNGLYEIVLKDPNDFELVEKVNFERDIFLSKSRTNYYASKNSKV
FT                   YHNYEDCPYGGKIVEKIYFKTEEDAIDLGYELCSYCEKRD"
FT   gene            31165..32361
FT                   /locus_tag="MmarC5_0040"
FT   CDS_pept        31165..32361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0040"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112,
FT                   transmembrane; KEGG: mmp:MMP1535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34357"
FT                   /db_xref="GOA:A4FVY9"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVY9"
FT                   /protein_id="ABO34357.1"
FT                   /translation="MIQNLLFLIFGTVTGTITGLIPGIHPNTIIPISIVLYPYFGSNNY
FT                   FSFLIGLLIAHYFLNYIPSAFIGVPDDESAVAAVPMHNLTILGRGYEAVVLAGFGAFFG
FT                   IICSILVFMIISAINIDFQSFYSNFKPFIPYILILFMLISIIFSKNRIWTFLIILFSGI
FT                   LGTIVFYKNPSFNYSLTVIFTGMFGIPLLFENLTKKELGNQFISFPEIKMSYLKSAIFG
FT                   TLGGFFRIFIPATGGAQMNYFLSKLIKEENIENFIISQGSITLSNELFSILAIMLIGTG
FT                   RSGISEAIKSLKIEYVTSELFSNVLIATGLSFLILTVISKYFLQNINKYDYSIISKILI
FT                   VFCTILMLILSFKSYPIYHIIIYLVSISIGILCVKKRVNLSNMMGVLIFPTILYFLKI"
FT   gene            complement(32369..32800)
FT                   /locus_tag="MmarC5_0041"
FT   CDS_pept        complement(32369..32800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34358"
FT                   /db_xref="GOA:A4FVZ0"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVZ0"
FT                   /protein_id="ABO34358.1"
FT                   /translation="MVSKEGLYLEKDIEMDSYVVDFDKLNEYIQSVGTKDILLDGHVSH
FT                   YLNPDYIIVLRANPLLIKNRLESRNYNSEKLNENVEAELLDVCLVESIERNDESMIFEI
FT                   ECSEKDPEKIVNEILMFLDSKNPEYGNVSWLEDYFYLIE"
FT   gene            complement(32923..33375)
FT                   /locus_tag="MmarC5_0042"
FT   CDS_pept        complement(32923..33375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34359"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVZ1"
FT                   /protein_id="ABO34359.1"
FT                   /translation="MFKKIKRIFVGNKELPTQVPVHEEEYVVIGQEYSAYEIKESEKIP
FT                   ITQETSENKVQVIKHKIYPRVLTTRIKSPEDFEYIKNIVEHDVIVINLEEVPIEAIIKE
FT                   FNDFKKYLETLDYSLGRVGENTILAIKSDVEVDKYVSEEPVHEVEE"
FT   gene            33748..34992
FT                   /locus_tag="MmarC5_0043"
FT   CDS_pept        33748..34992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0043"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: mmp:MMP1532
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34360"
FT                   /db_xref="GOA:A4FVZ2"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVZ2"
FT                   /protein_id="ABO34360.1"
FT                   /translation="MFLTLDDFELEGKTVALRVDINSPIDVNTGDILDDTRIKACYDTI
FT                   TGLSKKGAKVVILAHQSRPGKKDFTTLEAHAKKLSEVLNMEVTHVDGLICASARDAILS
FT                   MDNGEIILLENVRLLAEEVLSDWKSWEAITPEKQAKTVMIKKLHPFFDYFVNDAFAAAH
FT                   RAQPSLVGFSYYVPMLCGRVMEKELFTLTKVLKNPERPCVFALGGAKADDSIEVLKNVL
FT                   EKQTADQVLTSGVVANIFLVAKGYKIGPNENLIADMGYTGQIEIAKELISKYGDKIVVP
FT                   IDAGLNVDGERVEKELDINEEITHPIHDMGENTMKLYEEILKNAKTIVANGPAGVFENK
FT                   NFLKGTEELLKSVANSEGFSVIGGGHLSAAAEVVGLAGKMGHISTGGGACIEFLAGKKL
FT                   PVIEMLSESYEKHKI"
FT   gene            35120..36103
FT                   /locus_tag="MmarC5_0044"
FT   CDS_pept        35120..36103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0044"
FT                   /product="AIR synthase related protein"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: mmp:MMP1531
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34361"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011413"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR017668"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVZ3"
FT                   /protein_id="ABO34361.1"
FT                   /translation="MGDFMDLSKLADELRNFEGVTRKKEIKNVVNNFNFQEDYEFDIVV
FT                   DFGDDAAIIGIDDENAVLLAADGIWGKLLETDPFWAGYCAVLVNANDIAAMGGRSIGMT
FT                   NIIGIKDCDKGRDLLKGLKEGVSKFGIPVVGGHTHPDAQCNVLDISITGLVKRDNVLRS
FT                   DAAKTGDKIVFAYDLDGKIHETFNLNWDTTSMKSKKYVRDQLKVLEIIGEEHLANSCKD
FT                   ISNPGGLGTLGMLLEVSKKGAMVDVSKIPVPEDVSLNHWLKMYPGSGFVFTAPENKTKD
FT                   LIERLEFTGIASAVCGEVKNDRKFMITDGNEKTVFFDFEKEYICGC"
FT   gene            36113..36403
FT                   /locus_tag="MmarC5_0045"
FT   CDS_pept        36113..36403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34362"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVZ4"
FT                   /protein_id="ABO34362.1"
FT                   /translation="MKMMIDGVFYNPEEIDFEGVLQKLVELLGEELKVLSLEFPEFAAI
FT                   YEPECYYRSGFCLDKEVDKELSNDELAKIREEIIAVFPEGTIVYSLKCEIL"
FT   gene            36400..37110
FT                   /locus_tag="MmarC5_0046"
FT   CDS_pept        36400..37110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0046"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mmp:MMP1529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34363"
FT                   /db_xref="GOA:A4FVZ5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVZ5"
FT                   /protein_id="ABO34363.1"
FT                   /translation="MNKSKSDKVKDFYENWDVSKYPDYLKVLMEFEENLIFKIISKDDF
FT                   FKSLSKSPKNIKVLDCGCGFGSFYDLTKDFDTIYLDFSLNLLRKFKIEKNKICASIENL
FT                   PFKDGIFDLILCINVLEHVDFKKAVFEVKRVLKTNGRAYFIVVNSDSIINDEIFVEWKI
FT                   PHNLISKSDFNDIESEDFKIDYIKSFYFLHPFFKVFPKPILKGIINLFFKNDEKISSFL
FT                   KFKGQFLICRMVKK"
FT   gene            37107..37916
FT                   /locus_tag="MmarC5_0047"
FT   CDS_pept        37107..37916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0047"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; KEGG: mmp:MMP1528
FT                   prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34364"
FT                   /db_xref="GOA:A4FVZ6"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVZ6"
FT                   /protein_id="ABO34364.1"
FT                   /translation="MICCLGPKGSYTEKAAVTFSKAINDNEIQFEDSIYNVFKAVETNS
FT                   EFFGVVPSENSIGGSVSLTQDLLLEFPVKIIGEVDVSINHCLIGIDIKKVTEVLAHPQA
FT                   LTQCGHYITKNNWNITPVDSNAKAAKIVSEKKDEKLAAICGVENAEIYGLKVLDENIQD
FT                   YKNNTTRFFLICNKNNDFKTNLKPNKVSIVIEINKNMPGAFYEVLGVFKYRNVNLTRIE
FT                   SRPSKKEIGNYVFYIDYEFYEDNAALLRDLRMWALNVIELGNYFVLK"
FT   gene            38024..39274
FT                   /locus_tag="MmarC5_0048"
FT   CDS_pept        38024..39274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0048"
FT                   /product="LL-diaminopimelate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.83"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mmp:MMP1527 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34365"
FT                   /db_xref="GOA:A4FVZ7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVZ7"
FT                   /protein_id="ABO34365.1"
FT                   /translation="MESYIQNLFAERIGGKSFGKEDVIYKFEKIKRAKQAAKLKYPDME
FT                   LIDMGVGEPDEMADESVVEVLCEEAKKHENRGYSDNGVQALKDEIPLYMEKVFGVKDLD
FT                   PVNEVVHSIGSKPALAYITSVFINPGDVTLMTVPGYPVTATHTKWYGGSVETLPLLEKN
FT                   NFLPELDAISKEVREKAKILYLNYPNNPTGAQATKKFYKEAVDFAFENDLIVIQDAAYA
FT                   ALTYGDKPLSFLTVKGAKEVGVEIHSFSKAYNMTGWRLAFVAGNELIVRGFAAVKDNYD
FT                   SGQFIPIQKAGIHCLRHPEITEKTRAKYERRLSKMVKILKEAGFNAKMPGGTFYLYVKA
FT                   PIGTKDGAKFANAEEFSQFMIKEKLISTVPWDDAGNFVRMAACFEAFKDGEISIEEEDR
FT                   ILNEVKRRLTEVEFVFE"
FT   gene            complement(39302..39991)
FT                   /locus_tag="MmarC5_0049"
FT   CDS_pept        complement(39302..39991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0049"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein; KEGG: mmp:MMP1526 ribonuclease III
FT                   family:double-stranded RNA binding (DsRBD) domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34366"
FT                   /db_xref="GOA:A4FVZ8"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVZ8"
FT                   /protein_id="ABO34366.1"
FT                   /translation="MKNFEKLLSKLDIKFNDLNIFKRAFMHSSYVNEQKNTNLEDNERL
FT                   EYLGDAVLELIIIEYLFKKENLSEGEMSKLRAKYVCESALFTYAKKLNFNNYILLGKGE
FT                   LNSKGYNKPAIISDVFEAFIAAIYLDQGLDSAKKFVYNNIIPIIEESSKELFIDHKTRL
FT                   QELPELNNKTIKYVKLEEAGKPHDKKFVIAVKSGQKMLGKGIGKSKKEAEMKAAKNALL
FT                   KLEKNKN"
FT   gene            complement(40041..41303)
FT                   /locus_tag="MmarC5_0050"
FT   CDS_pept        complement(40041..41303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0050"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   mmp:MMP1525 modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34367"
FT                   /db_xref="GOA:A4FVZ9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVZ9"
FT                   /protein_id="ABO34367.1"
FT                   /translation="METDLGYIIDKIMEISENKGFKTEVFISKGKHFSSELDGENLDSI
FT                   EESDDFGIGVRVIKDKKVGFAYSSKKDVDVVNKAMENLIYDSDTSFSNPGKYAHPKGML
FT                   YGNVKTLSEKELIDALFEMKDILKENKITTVSGGVSNSYDYSRIVNSNGVDVEEESTYY
FT                   SASIAGINNGETAYDYLTKNNIFDVKELAENVVEFLKNPNAIKTEFEGNIVLDQRALNS
FT                   LLSYTLIPAFNAENVQRNRSVLKDRLGEEVFGEKITIEDDGTRDYSLYSAVVDGEGTPT
FT                   QKTMLIENGVLKNYLYDIKRANIEEKESTGNASRGYSSFPSVGPTNIVIEPVEKQENID
FT                   EYLYINTLIGTHTANPITGDFSVEISNSYIMKKGEKTPVKKGLLSGNIFEILKTAIPLD
FT                   RVEQRGKLISPPLLFTGKILV"
FT   gene            41411..42256
FT                   /locus_tag="MmarC5_0051"
FT   CDS_pept        41411..42256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0051"
FT                   /product="protein translocase subunit secF"
FT                   /note="PFAM: SecD/SecF/SecDF export membrane protein; KEGG:
FT                   mmp:MMP1524 SecD/SecF/SecDF export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34368"
FT                   /db_xref="GOA:A4FVT4"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR024921"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVT4"
FT                   /protein_id="ABO34368.1"
FT                   /translation="MNINYKVLTIIPIILALLSLALVSVNGLKESIDVSGGTEISILAS
FT                   ENTDLSVLKEQLPDSEVKISESSIGTFVVIKSGLATDVDSVRAVVKEFFNVDDLSELSY
FT                   TEKQIGSVLSSKFWEEGMKAVGFAFIFMAIVVYAIFRTPVPSGAVILAAASDMAIAIGG
FT                   MSLFGIPVSTATIAALLMLVGYSVDTDIMLTTRVLKRRTGTLDERIAGAMKTGITMSLT
FT                   TIFAMAVLYLVVTFVVPAADVLANIAAVLLIGLIGDLMLTWMTNAGILRYYMTEYKKGK
FT                   "
FT   sig_peptide     41411..41500
FT                   /locus_tag="MmarC5_0051"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.342 at
FT                   residue 30"
FT   gene            42274..43440
FT                   /locus_tag="MmarC5_0052"
FT   CDS_pept        42274..43440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0052"
FT                   /product="SecD/SecF/SecDF export membrane protein"
FT                   /note="PFAM: SecD/SecF/SecDF export membrane protein; KEGG:
FT                   mmp:MMP1523 SecD/SecF/SecDF export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34369"
FT                   /db_xref="GOA:A4FVT5"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR024912"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVT5"
FT                   /protein_id="ABO34369.1"
FT                   /translation="MKLLKDPKVIILLVCILASLLLIAFKGISFGVDLSGGSTIVLQTE
FT                   TELSDSEMVVVNEILTSRLNTNGLSDVRIYPRGSDEIIIEIPESADLDRIKKILTQQGV
FT                   FIAIINNQTAYTGQEISYVEEPGITASGYGVGFKLTLDGAQGFADVAYGKGGYPVELYM
FT                   DGNLISAPILSADLADGNIHQSQVITVAGSSPTEEDIDEAWVIYTALQSGSLPVKVQIE
FT                   YISSVSPTLGSEFIKGSAIAGFFAFIAVAAVISFRYKNPKIVLPILITGFSEVLLILGF
FT                   ASLINWKLDLASIAGIIAAVGTGVDHQIVITDETIAGEAKKVTKSIKRAFFIIFGAAAT
FT                   TIAAMLPLFVMGIGMLKGFAITTIAGVLMGISISRPAFSRIIQYVLKH"
FT   sig_peptide     42274..42369
FT                   /locus_tag="MmarC5_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.566 at
FT                   residue 32"
FT   gene            43492..44514
FT                   /locus_tag="MmarC5_0053"
FT   CDS_pept        43492..44514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0053"
FT                   /product="conserved hypothetical protein 374"
FT                   /note="PFAM: conserved hypothetical protein 374; KEGG:
FT                   mmp:MMP1522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34370"
FT                   /db_xref="GOA:A4FVT6"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVT6"
FT                   /protein_id="ABO34370.1"
FT                   /translation="MDRKQHRLLRNIVVYGLGISIISFIIYKIGIFEVYAVLASAHVEI
FT                   YLLAVFIYLLTLYVLSLRWNYLLKLNGYSAGSKNLLLLITMGQFINNVTPSMKGGSEPF
FT                   RAYYLSKLEKIPYHVSFSAVVIERILDTVIFLIFSFFVIIYFALSGVVYTQAFFMAWIL
FT                   VMALTVFIIYLAMHKEWAFKITLQIAKVVTKFSSKTLNEQKIKDTIDKFQKTMIFFKGN
FT                   RKGMFTALFISSAWWILDIFRIYVLFIAISTHVAFISVASTYLVALLVGILPMLPGGLG
FT                   TSDTAMIAMYSFFKIPYSNAAAGTLLDRSISYMGVTIIGSIAFKIIKKKAKENSYEVES
FT                   "
FT   gene            44524..44952
FT                   /locus_tag="MmarC5_0054"
FT   CDS_pept        44524..44952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34371"
FT                   /db_xref="InterPro:IPR014515"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW00"
FT                   /protein_id="ABO34371.1"
FT                   /translation="MNNVNMIMGRLVKSMEAFKGSKPVINKEGILSVRSVCRDSEFEKY
FT                   NSIKEYLTEKLVQNGFELASEDDILEMVAKINELIGDSETYSDEFGFEGVKSGFENIGC
FT                   DCDYVVGKKGSTYVGVSMWYEKLSKEPKFVEVMSIYNI"
FT   gene            complement(44977..45651)
FT                   /locus_tag="MmarC5_0055"
FT   CDS_pept        complement(44977..45651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0055"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein, P47K; KEGG: mmp:MMP1520
FT                   ATP/GTP-binding site motif A (P-loop):HypB/UreG,
FT                   nucleotide-binding:hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34372"
FT                   /db_xref="GOA:A4FW01"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW01"
FT                   /protein_id="ABO34372.1"
FT                   /translation="MHFVDVLNIGKDIIKANNKNADKNRKILESHGIAAFDFMGAIGSG
FT                   KTLLIEKLINELKDEYKIACIAGDVIAKYDAGRMEKHGVKVIPLNTGKECHLDAHQVGH
FT                   CFHDLDLDNLDIIFIENVGNLICPTDFDLGTHKRTVVVSVTEGDDTVEKHPEIFKTANL
FT                   TIINKIDICEAVGADPQKMLNDAKKINKDMEVLLTAIKHGQGVDEVVNFIKKTVKEVKN
FT                   QK"
FT   gene            45741..46583
FT                   /locus_tag="MmarC5_0056"
FT   CDS_pept        45741..46583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0056"
FT                   /product="tungstate/molybdate transport system permease
FT                   protein"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mmp:MMP1519 anion transport
FT                   system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34373"
FT                   /db_xref="GOA:A4FW02"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW02"
FT                   /protein_id="ABO34373.1"
FT                   /translation="MNYNYHYLNILIQNYLQYNTVWCDNLKADKGFNLLFLVISLFLLA
FT                   FVLLPLLNMIFNPGNVTGAINDSEVIKSLLVSIKAAGTATVFAIFLGIPLSYMLARYNF
FT                   IGKNVVEAVIDIPMAIPHSVIGIMILAFFYGTSIGRGIEDIGFEIVDNFWGIVVVMLYV
FT                   GLPYMVNSGRDGFLMVEEELENVSRTLGASRIKTFFNVSLPLIKNNLVSGSILTFARGI
FT                   SEVGAILIVAYFPKTTPVLILDRFNEYGLSSSKPISVIMIVLSIVLFSIFRLVSYNKK"
FT   gene            46596..47534
FT                   /locus_tag="MmarC5_0057"
FT   CDS_pept        46596..47534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0057"
FT                   /product="tungstate/molybdate transport system ATP-binding
FT                   protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmp:MMP1518 sulfate/molybdate ABC-transporter
FT                   homolog, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34374"
FT                   /db_xref="GOA:A4FW03"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW03"
FT                   /protein_id="ABO34374.1"
FT                   /translation="MLKLEKLCKSWKEFQLKSVNLDIDDNYCILLGPSGAGKSVIIQCI
FT                   TGILKPDSGRIYFDGEDITDIPPEKRNFGYVPQNYALFPHMNVYNNIAYGMKLRKCPKL
FT                   EIEKKITEIAEFLKITHILNRKPTTLSGGEQQRVAIARALVLDPKILLLDEPTSALDTN
FT                   IKENVISELKRIGELVPIIHITHDFVEAKTLGNQIAILINGELNDFGDSEIFKTPKNEK
FT                   IANFLGYNVITEEKESFAVAPEEIFVKKHDDTDNGEYIKGKVESLVDFGYYKKVSVNIN
FT                   ETVVKTITDGENPVNVGDIVSIKYKRKVPIN"
FT   gene            47704..48306
FT                   /locus_tag="MmarC5_0058"
FT   CDS_pept        47704..48306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0058"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: mmp:MMP1517 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34375"
FT                   /db_xref="GOA:A4FW04"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW04"
FT                   /protein_id="ABO34375.1"
FT                   /translation="MSSFKGIFGFNNIELKDLLISSLAIALVVVWPRGFPSFSVGFLLQ
FT                   YVAALFTVGTAFILHELAHRTVARHFGAWSEFRAWYEGLGIALFLKVILGFTFIAPGAV
FT                   YVHKDYLTTKENGLISIAGPLTNIALAVLFLVLPIPAIYYSGYYIDIAGFGYYVNVFLA
FT                   FFNMLPIYPFDGSKVMRWNFLIWAAIFIPLVALYFFV"
FT   gene            48325..48993
FT                   /locus_tag="MmarC5_0059"
FT   CDS_pept        48325..48993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0059"
FT                   /product="condensin subunit ScpA"
FT                   /note="PFAM: chromosome segregation and condensation
FT                   protein ScpA; KEGG: mmp:MMP1516 putative segregation and
FT                   condensation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34376"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW05"
FT                   /protein_id="ABO34376.1"
FT                   /translation="MEFDLWVRIIKESIEKKDVDPWNINISEITEEYLGTIKELRRFDI
FT                   RLSADVVLVAGILLRLKSQVLYGECETAFSEEEEEVYEDDYRDDDYIEPETVEKSKKEP
FT                   AKDINPKSMTLDGLISTLNTELKKIKDAKPRKKREVVRPTALYNLVEEMIEEDDISDIM
FT                   EFLVLELKKSGGKFTFQNKFKTREEIIKNFLPALYLANDGKIDLGQDDLFEELNLELKK
FT                   "
FT   gene            49177..50814
FT                   /locus_tag="MmarC5_0060"
FT   CDS_pept        49177..50814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0060"
FT                   /product="thermosome subunit"
FT                   /note="TIGRFAM: thermosome; PFAM: chaperonin Cpn60/TCP-1;
FT                   KEGG: mmp:MMP1515 chaperonin GroEL (thermosome, HSP60
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34377"
FT                   /db_xref="GOA:A4FW06"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW06"
FT                   /protein_id="ABO34377.1"
FT                   /translation="MAQPGVLPENMKRYMGRDAQRMNILAGRIIAETVRSTLGPKGMDK
FT                   MLVDDLGDVVVTNDGVTILREMSVEHPAAKMLIEVAKTQEKEVGDGTTTAVVVAGELLR
FT                   KAEELLDQNVHPTIVVKGYQMAAQKAQELLKSIACEVGAQDKEILTKIAMTSITGKGAE
FT                   KAKEKLADIIVDAVSAVVDEEGKVDKDLIKIEKKSGASIDDTELIKGVLVDKERVSAQM
FT                   PKKVTDSKIALLNCAIEIKETETDAEIRITDPAKLMEFIEQEEKMLKDMVAEIKASGAN
FT                   VLFCQKGIDDLAQHYLAKEGIMAARRVKKSDMEKLAKATGANVITNIKDLSAEDLGDAG
FT                   LVEERKISGDSMIFVEECKHPKAVTMLIRGTTEHVIEEVARAVDDAVGVVACTIEDGRI
FT                   VAGGGSTEVELSMKLREYAEGISGREQLAVRAFADALEVIPRTLAENAGLDAIEILVKV
FT                   RAAHASNGNKCAGLNVFTGEVEDMCDNGVVEPLRVKTQAIQSAAESTEMLLRIDDVIAA
FT                   EKLRGGPDMGDMGGMGGMGGMGGMPGMM"
FT   gene            complement(50911..52242)
FT                   /locus_tag="MmarC5_0061"
FT   CDS_pept        complement(50911..52242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0061"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="PFAM: Prephenate dehydrogenase; 6-phosphogluconate
FT                   dehydrogenase, NAD-binding; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; KEGG:
FT                   mmp:MMP1514 prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34378"
FT                   /db_xref="GOA:A4FW07"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008299"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW07"
FT                   /protein_id="ABO34378.1"
FT                   /translation="MEKIMIISIIGGTDGLGKWFASFLKNRGFDVIVSGRDLVKGKDVE
FT                   NELGVIYTNDNIDAAKKGDIVIISVPINVTESVIKDVAPHVREGSLLMDITSIKEKPSK
FT                   LMNELSKSGVFVLPTHPMFGPETPSLNRQVVILTPTEKEKNPFFEKIHEFLENEGAKVI
FT                   VVSPKEHDKIMGVVQGLTHFVYISLGSTLKDLGIDIKESRNFASPIYELMINIIARIIG
FT                   QNPYLYADIQMHNPQIKTIHDTFIKNCENISEIVQNKDRDSFVENMKNSAKHFGNETKR
FT                   GLNCSNKAVYAISKETEKLIKSVGKEIGLKHIYSENVHYGILKEVYADNIVLKQNEKEI
FT                   ILNISNVSLMENKELEDWKTENLEKYFVDISVLFKKDIDLSIILELLTHKFEIEVIDKY
FT                   SGEKIDENELSATFRINSYEKEDLKTLKENFNEIVENIGGKLRY"
FT   gene            52542..53663
FT                   /locus_tag="MmarC5_0062"
FT   CDS_pept        52542..53663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0062"
FT                   /product="L-alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="TIGRFAM: alanine dehydrogenase; PFAM: alanine
FT                   dehydrogenase/PNT domain protein; KEGG: mmp:MMP1513 alanine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34379"
FT                   /db_xref="GOA:A4FW08"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW08"
FT                   /protein_id="ABO34379.1"
FT                   /translation="MLIGVPKEIKNNENRVAITPAGVEAFVLAGHKVYIEKDAGLGSAI
FT                   TDEEYLAAGAEILKTAKEVFDIAEMIIKVKEPLKSEFELFKEGQILFTYLHLAPEPQLT
FT                   QALLDKKITGIAYETVQLADRSLPLLTPMSEIAGRMSIQLGAQYLEKQEGGKGVLLGGV
FT                   PGVEPAEVVIVGGGIVGTNAAKIAVGMGAKVTILDVNTRRLAYLDDIFGNKVTTLMSNS
FT                   FNIAKAVKKADLLVGCVLIPGAKAPKLVSEEMVKSMQPGSVIVDVAIDQGGSIETIDRI
FT                   TTHDNPTYEKFGVIHYAVANIPGAVARTSTYALTNDTLPYALQIANKGYKQAVIENPAL
FT                   LKGLNTLNGKVTYEAVAKAHDLPYTPAEKALNE"
FT   gene            53721..54842
FT                   /locus_tag="MmarC5_0063"
FT   CDS_pept        53721..54842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0063"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: mmp:MMP1512 alanine racemase; TIGRFAM: alanine
FT                   racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34380"
FT                   /db_xref="GOA:A4FW09"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW09"
FT                   /protein_id="ABO34380.1"
FT                   /translation="MVSHPIWAEIDLSAIKNNIEEIRRITNPKSQVMAVVKANAYGHGA
FT                   VEVSKVCLENGADRLAVARSTEALELRNAGITCPILVFGYCTEEEIEKMVENDITLTVY
FT                   SFETASSIQKTAEKLGKHPKIHIKVDTGMSRLGFLPRKDAVETIQKIMELENIEVEGIY
FT                   THFADADNSDKTYTTLQFSRFTNFLHDLEENEIFIPIKHASNSAAIIDHPETHLNLVRP
FT                   GIILYGLYPSELVHKERINLKPAMSLKVLVTHVKEVPENTKISYGCTFETKKPSKIASL
FT                   PIGYADGFTRMLKNGYVLIHGSRVPVIGRICMDQCMIDVSYIENVQVGDVVTIFGTQEN
FT                   ETIPIEEFGEKLGTINYELVCMVASRVPRKYLQ"
FT   gene            55112..56419
FT                   /locus_tag="MmarC5_0064"
FT   CDS_pept        55112..56419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0064"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: mmp:MMP1511 sodium:alanine
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34381"
FT                   /db_xref="GOA:A4FW10"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW10"
FT                   /protein_id="ABO34381.1"
FT                   /translation="MLVLLLGTGIFLTLRLGFMQIHTLPYALKLAFSKNQDKTSEGDIS
FT                   HFQALMTALAATIGTGNIAGVATAYVLGGPGAIFWMWVTAFFGMATKYAEAVLAIKYRT
FT                   VDDNGEMAGGPMYFLEKGLPDHGLGKILGVAFAFFGAFAAFGIGNMVQTNSVADAVASN
FT                   FGVDPLITGFILAVFTAAVILGGIKSIGKATGIIVPFMAVFYILAGLVILAMNIGYILP
FT                   AFATIFSSAFNFDAGFGALIGTAIMWGVKRGVFSNEAGLGSAPIAAAAAKTDHPGRQAL
FT                   VSMTGTFLDTIIVCSITGLVLTIAGLKAFPGLTDLTGASLTAASFDALMPMGGLIVTIG
FT                   LVFFAYSTVLGWSYYGEKCFEYLIGTKGIRLYRIAFVLVAFWGATASLPLVWNIADTLN
FT                   GAMAIPNLIGLLLLSGVVVSETKAFNEIRKNETKNA"
FT   gene            56589..57884
FT                   /locus_tag="MmarC5_0065"
FT   CDS_pept        56589..57884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0065"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: mmp:MMP1510
FT                   Asp-tRNAAsn/Glu-tRNAGln amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34382"
FT                   /db_xref="GOA:A4FW11"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW11"
FT                   /protein_id="ABO34382.1"
FT                   /translation="MITDRVSDYLEKIEKSDVNAFIDVNSEKVLKEAEELEKNDDLKNK
FT                   PLYGKIVAVKSNINVKGYKISCASKTLEKYVGTYDATVVKKLRSQGALIVGMTNMDEFA
FT                   GGSSGETSCYGPTKNPAALDRIPGGSSSGSAAAVAADLCDMAIGSDTGGSIRNPASHCG
FT                   IVGFKPSYGVVSRQGLCDLAMSFDQIGPLTKNAEDALVLTNAIKGIDRSDSTSLETPKF
FT                   EKKDISNYKVGVVKEFMDVTDEKIRNEIEKGIEVFKDMGCKIVDLSYKYIDLALPTYYL
FT                   INYVEFFSATRKYDGRRYGEFIEEACGEEVLRRILIGKHISEQEFSGKYYKKALQARKS
FT                   MKKEMLGLFNSADLIVGPTVPKLPHKLGEDLSPMEMYAYDVLTVPTNICGICSGVVRCG
FT                   NISGVPVGLQIQGAPLEDEKVLSAMIEFEKNY"
FT   gene            complement(57898..58368)
FT                   /locus_tag="MmarC5_0066"
FT   CDS_pept        complement(57898..58368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34383"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW12"
FT                   /protein_id="ABO34383.1"
FT                   /translation="MINEIIGYSIVKNTKISSEFLAYTQNFSRTMNSDFKKVDPMLYLD
FT                   LVMETMHIFRILEDELDSISLLNNEKNTLDLFKGYKKWNYLKPYDNNYIMFATLKSEKF
FT                   GIEYLLLKPSELKKFENDFEIVYSAILPNKYAIKSLYRIFMKAANKLSTSKN"
FT   gene            complement(58399..59157)
FT                   /locus_tag="MmarC5_0067"
FT   CDS_pept        complement(58399..59157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0067"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: mmp:MMP0455 probable amino-acid ABC transporter;
FT                   TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34384"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW13"
FT                   /protein_id="ABO34384.1"
FT                   /translation="MKSLYMVLLTLLSPLSNVVDIENEYQITGVLTVGVYPDLTPYTYE
FT                   ENGELKGFEIDLINEIAKRIEVTPEFILYNYTNEPYEAVKNKQIDCAISSNFLSRNNDN
FT                   IEYSRTYLSTYEVLMCEKSQKFFRLEDLKDKKIGVLKNSKAEEKAKYLLRSMNFEIITY
FT                   DNPKDIENDIGSGNLDAAISDKHHLNYIQKESDSLKFVQELDIKYVSMVINSKNPELTE
FT                   KIDEILLEMEEDGTYQEIYDKWFGNLEKSL"
FT   sig_peptide     complement(59101..59157)
FT                   /locus_tag="MmarC5_0067"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.766) with cleavage site probability 0.683 at
FT                   residue 19"
FT   gene            complement(59365..59706)
FT                   /locus_tag="MmarC5_0068"
FT   CDS_pept        complement(59365..59706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0068"
FT                   /product="Protein of unknown function DUF555"
FT                   /note="PFAM: Protein of unknown function DUF555; KEGG:
FT                   mmp:MMP1509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34385"
FT                   /db_xref="InterPro:IPR007564"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW14"
FT                   /protein_id="ABO34385.1"
FT                   /translation="MGNYHVTLQASYIAKNVEDVEDAIGVAISQIGKLLNKGSLDYVDI
FT                   DVGLTICPKCGEPIDCVLVVAKTAIVGILLSMKVFNAESPEHAVRIAKSSIGRALKDIP
FT                   LEDVDVVEI"
FT   gene            complement(59727..60032)
FT                   /locus_tag="MmarC5_0069"
FT   CDS_pept        complement(59727..60032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0069"
FT                   /product="Protein of unknown function DUF357"
FT                   /note="PFAM: Protein of unknown function DUF357; KEGG:
FT                   mmp:MMP1508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34386"
FT                   /db_xref="InterPro:IPR023140"
FT                   /db_xref="InterPro:IPR036809"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW15"
FT                   /protein_id="ABO34386.1"
FT                   /translation="MVEIDNIITDEKIENYFERTKEAISIIKNGLPPEKSLLSDVASDF
FT                   LLMIDCYFEDAKTFIDKGDYINAFASLNYAYGWIDAGARLGIFNVGDDDVRFTLAK"
FT   gene            60288..60818
FT                   /locus_tag="MmarC5_0070"
FT   CDS_pept        60288..60818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0070"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="KEGG: mmp:MMP1507 pyruvate oxidoreductase (synthase)
FT                   subunit gamma; TIGRFAM: pyruvate/ketoisovalerate
FT                   oxidoreductase, gamma subunit; PFAM: pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34387"
FT                   /db_xref="GOA:A4FW16"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW16"
FT                   /protein_id="ABO34387.1"
FT                   /translation="MIEVRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGA
FT                   PVMAFTRIDDEKIRLRSQIYEPNYVIVQDPTLMDSVDVTSGLKDGGKILINTLKDIDLN
FT                   GYDVQTIDATGIALEVLGVPIVNTVLCGAFAGITGEVTIESLKKAILETFPGKLGPKNA
FT                   EAAEKAYNLIKGL"
FT   gene            60835..61092
FT                   /locus_tag="MmarC5_0071"
FT   CDS_pept        60835..61092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0071"
FT                   /product="pyruvate ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein; KEGG: mmp:MMP1506
FT                   pyruvate oxidoreductase (synthase) subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34388"
FT                   /db_xref="GOA:A4FW17"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW17"
FT                   /protein_id="ABO34388.1"
FT                   /translation="MVNTGTIIYEPGSSANNKTGSWRVFKPVLDQEKCVKCENCYIFCP
FT                   EGCIQEKDGKFEIDYDYCKGCLICEKECPVKAIKTEREEK"
FT   gene            61114..62277
FT                   /locus_tag="MmarC5_0072"
FT   CDS_pept        61114..62277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0072"
FT                   /product="pyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: mmp:MMP1505 pyruvate oxidoreductase
FT                   (synthase) subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34389"
FT                   /db_xref="GOA:A4FW18"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW18"
FT                   /protein_id="ABO34389.1"
FT                   /translation="MSEVKVITGTSAAAEAAKLADVDVIAAYPITPQTTCVEKLADFVA
FT                   NGELNAEYIKVESEHSAMSASIAASATGARTFTATSSQGLALMHEVLFAAAGMRVPVVM
FT                   MNANRALSAPINIWNDQQDSLSQRDTGWIQLYAEDNQEVLDLVIQAFKIAEDEKVLLPV
FT                   MVNLDGFILTHTVEPVTLPKQESVLDFIGSYEPKHAYLDPKKPMTQGSLGDPNYYMETR
FT                   YAIETAMRNAEKVIADVHDAFAEKFNRAYGNGLIESYNLEKAENVIVAMGSICGTIKDM
FT                   IDLKKKEGVEIGLLKIRCYRPLPVEMIKDALKNAKNVAILDKSISLGMNKGAIYADVAS
FT                   FLKDKKTVNYIVGLGGRDITPEDILGIYVDVETSEDGKTNWVGLKEE"
FT   gene            62294..63190
FT                   /locus_tag="MmarC5_0073"
FT   CDS_pept        62294..63190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0073"
FT                   /product="pyruvate ferredoxin oxidoreductase, beta subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: mmp:MMP1504 pyruvate oxidoreductase
FT                   (synthase) subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34390"
FT                   /db_xref="GOA:A4FW19"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW19"
FT                   /protein_id="ABO34390.1"
FT                   /translation="MTGSQFPREELFAPGHRGCAGCGAAIVARLALKAAGKNTIVANAT
FT                   GCLEVMTTPYPETAWRVPWIHVAFENAAAVASGIEGAVVALKRKKGKYGEEKVNVIAFG
FT                   GDGGTADIGFQALSGAMERGHDMVYIMYDNEAYMNTGVQRSGSTPFMASTTTSPAGSHI
FT                   RGENRPKKDMPMIMAAHGIPYIATASISYPEDFMNKVKKACEVNGPAFIQVLQPCTTGW
FT                   GYPAENTVEMGRLAVETGVWPLFEIENGEFKLNYKPLKRKPIEEYLKVQKRYRHLKPED
FT                   ISVIQETIDMKCDEYGL"
FT   gene            63214..63717
FT                   /locus_tag="MmarC5_0074"
FT   CDS_pept        63214..63717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0074"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1503 hypothetical protein, pyruvate
FT                   oxidoreductase-associated"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34391"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW20"
FT                   /protein_id="ABO34391.1"
FT                   /translation="MKKVMMVNEACDNCGDCVKACSEVHEVSGISIWEHEGRYLPVVCQ
FT                   HCTSSPCMEVCPVSAIESKDGVIYLDKESCIGCGLCAMACPFGAIYISGKTAHKCDLCF
FT                   GRDEQACVKACSKRCLEVVNVDELVMDKKLKNIENLTVLGPKGKSKNKKGLLSLVTASS
FT                   RCNP"
FT   gene            63735..64151
FT                   /locus_tag="MmarC5_0075"
FT   CDS_pept        63735..64151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0075"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34392"
FT                   /db_xref="GOA:A4FW21"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW21"
FT                   /protein_id="ABO34392.1"
FT                   /translation="MKVMPNIDLCVDCKKCERACPINAIHVFEGIPIRCMHCEDAPCLN
FT                   VCPEDAIKKIDDKVVIESEKCIGCALCAEVCPVGAIQIDKCKKVAVKCDGCVERGSEIC
FT                   MEVCPTKALDYYENTIENKRAELVSKLKKLTSRK"
FT   gene            complement(64157..64648)
FT                   /locus_tag="MmarC5_0076"
FT   CDS_pept        complement(64157..64648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0076"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: mmp:MMP1501 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34393"
FT                   /db_xref="GOA:A4FW22"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW22"
FT                   /protein_id="ABO34393.1"
FT                   /translation="MIIGLISDTHIPERAKKLPKEIFEHFSDVDLIIHCGDVTSESVLN
FT                   DLKKISELLVVSGNMDCMNYPKELEVVIENFKIGIIHGNQIHPRGDTLKMKYLCLEKNW
FT                   DILISGHTHTPRIKEITVENKKILLLNPGSPTVPRYPLKTIMKLKIEEKKVNAELIPIK
FT                   "
FT   gene            complement(64710..65016)
FT                   /gene="ffs"
FT                   /locus_tag="MmarC5_R0004"
FT   misc_RNA        complement(64710..65016)
FT                   /gene="ffs"
FT                   /locus_tag="MmarC5_R0004"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            65213..66310
FT                   /locus_tag="MmarC5_0077"
FT   CDS_pept        65213..66310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0077"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ, GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   mmp:MMP1500 cell division protein FtsZ2"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34394"
FT                   /db_xref="GOA:A4FW23"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW23"
FT                   /protein_id="ABO34394.1"
FT                   /translation="MRLVKEALSKNNDELYNTQMSKEDFGNAKILVVGCGGAGNNTIHR
FT                   LSEIGIEGAETIAINTDKQHLEHINADKKILIGSTLTRGLGAGGYPEIGKKSAELAKNV
FT                   LEDVIKSADLIFVSAGMGGGTGTGSAPVVAEIAKENGAVVIGVVTYPFKIERARLKKAD
FT                   EGLRRLTESCDTVIVIDNNRLVDFVPNLPMNEAFRVADEIIAQAVKGITETISLKSLIN
FT                   IDYADVKAVMTDGGVAMIGVGEVDYDTKGDRVEKVVKDTLQCPLLDIDYKGATGALIHI
FT                   TGGPDLTLGEANRIGEGITSSMDINANVIWGSRLDPSMDGAIRVMAIITGVKSPNIIGG
FT                   GRSPAKIIPSSAKKAKGSLGIDYIV"
FT   gene            66350..66862
FT                   /locus_tag="MmarC5_0078"
FT   CDS_pept        66350..66862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0078"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: mmp:MMP1499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34395"
FT                   /db_xref="InterPro:IPR016472"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW24"
FT                   /protein_id="ABO34395.1"
FT                   /translation="MRAHERLLLSVGSDKFTDEFKKVLLELDVPLKEFSEISDIPYSTL
FT                   YKITNEKDFRISTLKKIINTIKSFEEEDSSEEKIALIAARPSLNKISTKRIAVNGKTYL
FT                   LKEYPASTLEDCIVSAIYAEREGVKAIVCAPIVSTSIEKVVRIPVAVIIAEKNAFMEAL
FT                   EIVVSKI"
FT   gene            complement(66872..67654)
FT                   /locus_tag="MmarC5_0079"
FT   CDS_pept        complement(66872..67654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0079"
FT                   /product="Protein of unknown function DUF1188"
FT                   /note="PFAM: Protein of unknown function DUF1188; KEGG:
FT                   mmp:MMP1498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34396"
FT                   /db_xref="InterPro:IPR009573"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW25"
FT                   /protein_id="ABO34396.1"
FT                   /translation="MNYGITESVKTTRSKIKIKDIVSDVVEKKANAIKYFLEGEEFKQA
FT                   VVFGAYLSGSYIAYTLLKDCDEVIIVDIQPHLQDILFNEGIKFMDLNRLQLELRNGTSI
FT                   DPDLVIDLTGLGGVSPDLLSKFNPKVLIVEDPKGNHDKGISKIDNTDKRLCVGDKKGIL
FT                   KTYRSSKFSKTSGTMTLVVDIIMESCKEINEIDGVLYTIPNLKYFEGTVFHEKNVKKFL
FT                   TELNMPAITVSSIDHVEYELEEALSKNISRVNSFVKEI"
FT   gene            complement(67651..68130)
FT                   /locus_tag="MmarC5_0080"
FT   CDS_pept        complement(67651..68130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34397"
FT                   /db_xref="InterPro:IPR010254"
FT                   /db_xref="InterPro:IPR012019"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW26"
FT                   /protein_id="ABO34397.1"
FT                   /translation="MNIEETIKTAYGESLNSARFGDKFEEIDAIQSIIKSAKSVVVATR
FT                   NEKKFKVVFNIISKITDANISMIEIPTNSADLTRMPAVSKGLIAVDSSDADIIISRGRL
FT                   GIPGSGSFLLIMDKKGRILTGSISPSSIIHKNPIDKTVELELINALERIGIKVKK"
FT   gene            complement(68153..69658)
FT                   /locus_tag="MmarC5_0081"
FT   CDS_pept        complement(68153..69658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0081"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="KEGG: mmp:MMP1496 phenylalanyl-tRNA synthetase alpha
FT                   subunit; TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase, class IIc"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34398"
FT                   /db_xref="GOA:A4FW27"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022917"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW27"
FT                   /protein_id="ABO34398.1"
FT                   /translation="MELHNDEKRLLKAFQESNEKIMNLEELSKYIEKEKVMRAAFWLSG
FT                   RDFLEIIENKTKICELTELGNQSLDLGIPERKVANYIKENNLESIPIKDLSKILEKDET
FT                   GAALGNLKKKGLVAIDKGNIVFKDLDYVDIEEEVLKKASEDFNLSNYSEDEVKIIENLK
FT                   KRGFLKINEVVDRSFELKNAGIDFIKKPIEIKEEITQLTREMIVSGKWNDYFIRPYDAK
FT                   IPTEELYPAKAHPMSKIIQEVNEVLISMGFKEVKSQIVQTEFWNFDTLFEPQDHPARDM
FT                   QDTFFVKYPNTGTVPKDLLEKVKGIHECGTIGDEKISKGWCYNFDENVSERTVLRTHTT
FT                   VSSIKYLASLSECERENAQKVFCIDRVFRNEAIDYKHLPEFYQCEGIVMAEDVNFDNLV
FT                   GILKEFLQKLGFEKVRIRPAYFPFTEPSLEAEVYMEGKGWLELLGAGIFRPEVLEPFGI
FT                   KKPVLAWGIGLSRLAMLRLGLTDIRELHKNDMQWLKKTVISEE"
FT   gene            69738..70736
FT                   /locus_tag="MmarC5_0082"
FT   CDS_pept        69738..70736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0082"
FT                   /product="conserved hypothetical radical SAM protein"
FT                   /note="KEGG: mmp:MMP1495 hypothetical protein; TIGRFAM:
FT                   conserved hypothetical radical SAM protein; PFAM: Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34399"
FT                   /db_xref="GOA:A4FW28"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW28"
FT                   /protein_id="ABO34399.1"
FT                   /translation="MNTGAQIYRNSSSSIDKNIVDRIYKDGFLIAQYGLYMKRERDYKT
FT                   FKVPVDAGFSCPNKDGTIDTRGCIFCPKMGRPISVEYCNIKYSLKDQIETQVKQNKEKG
FT                   IGKFYVYFYPGTNTHGTPERLKELWDYALSFEDVIGISIGTRPDCLEDEKLDILENYVK
FT                   QGYEIWIDLGIQTMHDKTLDFLNRKHSSNDIRRVLIECKKRGILVCGHIILGLPDESWN
FT                   MMMETSKMLSDLEIDALKIYPLVVIENTELEEIYWKGEYKSLDEKQYIHLVSDFLEHLS
FT                   PYVIIQRVSKDKVPDEIKISPEWSLRRLRILNEVSKELARRNSKQGSKYKK"
FT   gene            complement(70749..71351)
FT                   /locus_tag="MmarC5_0083"
FT   CDS_pept        complement(70749..71351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0083"
FT                   /product="protein of unknown function DUF366"
FT                   /note="PFAM: protein of unknown function DUF366; KEGG:
FT                   mmp:MMP1494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34400"
FT                   /db_xref="InterPro:IPR007162"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW29"
FT                   /protein_id="ABO34400.1"
FT                   /translation="MKKIDFDTISAIILEEFKTYTGEEIEPLWAFETFDVQKDSIVGFI
FT                   GPMDVKIENMKDLKDVKEEKYIAVPIQSSEAINFIVEHFDNPDLKMTYLRQRIFVSIAK
FT                   DVIENHSNLKLKKSGDDLYFDEKKLSVCIACRGISSGKIHLGINLKSDSVPSHVSAVGL
FT                   NDMGIENVFEIMEEIAIEYSKEMSKIEKDIRKTLPLF"
FT   gene            complement(71448..72791)
FT                   /locus_tag="MmarC5_0084"
FT   CDS_pept        complement(71448..72791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0084"
FT                   /product="S-layer protein"
FT                   /note="PFAM: S-layer protein; KEGG: mmp:MMP1493
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34401"
FT                   /db_xref="GOA:A4FW30"
FT                   /db_xref="InterPro:IPR006454"
FT                   /db_xref="InterPro:IPR022651"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW30"
FT                   /protein_id="ABO34401.1"
FT                   /translation="MSAPTKLIALFVLAALCTIPITYGMVVDDPLIVVNSEKVDKEYAE
FT                   LLMDKYYSKRTLEINSDNEIVVTENIIYNVPALDEFEINDGKGNLLVEFTKSGETVTYK
FT                   NFEYEEELESDDEGDEVTFMGKTYKLIEYDEDEKIVLGNKVEDTETTEEFSYDAFTFKI
FT                   IGMDSTGQILVSVYEGSDRIENVKMYPDDTYFVSGSKISIYYDEYMESGDTPYFFFEIY
FT                   DSLEIEDGETISGYSNIDTDLDGKRINLEYESPKSLSQNFELLNYKVELTDVSDEDLTV
FT                   FFTVTQNLNYEFDMDEGTKYFGNNIFAVKIENDEDDDSDDESYLYKNNKKYSEIVDYQG
FT                   SVQLVDQDELLSASSDLILIGGPVSNKVTESIQNSLSVEVTNDYPGEGKGIIQTITNPN
FT                   NDESTILVLAGSDRDGTKACVLALNQGLYSGSGNLVVKLTGDDSVSVI"
FT   sig_peptide     complement(72717..72791)
FT                   /locus_tag="MmarC5_0084"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.967) with cleavage site probability 0.721 at
FT                   residue 25"
FT   gene            72898..73455
FT                   /locus_tag="MmarC5_0085"
FT   CDS_pept        72898..73455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0085"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: mmp:MMP1492 orotate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34402"
FT                   /db_xref="GOA:A4FW31"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW31"
FT                   /protein_id="ABO34402.1"
FT                   /translation="MVTAEELSLKNELIRLLKDVNCVKFGDFTLASGKQSKYYVDIKKA
FT                   TTNPKVLKAAAKLVNYYVSNENTENLKIAGVELGSVSIATAVSLETEKDLLIIRKKAKE
FT                   YGTKNKIEGELNHGDNVIVMEDVTTTGGSVSKAVDEIRAVSGNVKKIYVIVDRQEGAKE
FT                   NLAQNNVELIPLVTIEELGLNK"
FT   gene            73500..74768
FT                   /locus_tag="MmarC5_0086"
FT   CDS_pept        73500..74768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0086"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   mmp:MMP1491 chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34403"
FT                   /db_xref="GOA:A4FW32"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023512"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW32"
FT                   /protein_id="ABO34403.1"
FT                   /translation="MILVKDAIINGKKQNMLVEGNIIKKIGNISNSEVSKDETEIIDGK
FT                   NCVLIPGLINTHTHVPMSLFRGVADDIPLMDWLSGHIWPMESKLNEKIVYAGTLLGTIE
FT                   MIKSGTTAFNDMYFFLDSIIKAVDETGIRSTIAYGMIDLFDEEKREKELKTARESLEMI
FT                   KNLNNSRITGALGPHAPYTCSKEILESTNALAREFNVPIHIHMNETLDEINQVVERTGM
FT                   RPFEYLNSFGFFEDVTTICAHCVHLSDSEIQIMKEKNMFAAHNPVSNLKLASGVSPVLK
FT                   LLENNIPVTLGTDGCGSNNNMNLFEEIKAVALIHKGVNLNPVAVTAKEAFEFGTKNGAK
FT                   ALNINSGEIKEGKLADFVLINMKKPYLTPKENIESHLVYSFNGVVDTVVIDGKIVLNAG
FT                   KMVNIDEEKVYELAEEAYFELAK"
FT   gene            complement(74772..75539)
FT                   /locus_tag="MmarC5_0087"
FT   CDS_pept        complement(74772..75539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0087"
FT                   /product="seryl-tRNA(Sec) kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="PFAM: Chromatin associated protein KTI12; KEGG:
FT                   mmp:MMP1490 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34404"
FT                   /db_xref="GOA:A4FW33"
FT                   /db_xref="InterPro:IPR013641"
FT                   /db_xref="InterPro:IPR020024"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW33"
FT                   /protein_id="ABO34404.1"
FT                   /translation="MLIILTGLPSVGKSTFSKAISKKMAEKNIDNIILGTDLIRESFPV
FT                   WKESYEEFIRDSNNYLIKEALGNNFSVIVDDTNYYNSKRRDLMNIANEFDSNYVTIYLK
FT                   APLDLLLKRNIERGQKIPNEVIKNMYEKFDTPGTKYAWDLPDITVDTTEKIDHGKILNQ
FT                   ILKINKNKSLKINENKIPKSEPVESNLQKIDNITRTIVGNLIKTGKIDKKDIKLVSELR
FT                   KSFLKDCKKIESGNLDFEKIERYFLNCINKNLK"
FT   gene            75631..77331
FT                   /locus_tag="MmarC5_0088"
FT   CDS_pept        75631..77331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0088"
FT                   /product="D-fructose 1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="PFAM: inositol monophosphatase; ATP-NAD/AcoX kinase;
FT                   KEGG: mmp:MMP1489 inositol monophosphate related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34405"
FT                   /db_xref="GOA:A4FW34"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR021175"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW34"
FT                   /protein_id="ABO34405.1"
FT                   /translation="MDMLDMALNIAKDIEKSVKPLIGWEKSNEVVKIGADGTPTKRIDL
FT                   IAENVAINSIEKVCSAILISEEIGFKKIGKNKPEYVIVLDPVDGTYNSLKDIPFYSAAI
FT                   AIGRIDKFTDNFEEMIKNLKMSDLEVGVVRNIATGDTYYAKKGNGAYLLKKDEKKSISI
FT                   SNSSNLKDSSIGLFAHDISLDTLKFIKDRRFRRIRLFGSIALEMCYVAKGALDAFINVN
FT                   ETTRLCDIAAGYVIIKEAGGLVTDKNGQEVNLDLDVNSKVSVICSNEMLHKKLVGIFGN
FT                   RWRIKPTNFGIISRIDNEESIAVAQDVIKYLDLKGIKYELDSGTYNALKNRLSKECNVI
FT                   SNIEEISHMISIGGDGTVLRASKMIEGNEIPIVCINMGTVGFLTEFSKDEIFSAIDSII
FT                   CGCYKVEKRTKLMGFAKLSDGRQQILNDSLNEVVITTKNPAKMLHFEVYIDGNLVEDVR
FT                   ADGIIVSTPNGSTAYSLSSGGPIIEPTVEGFVIVPICPFKLSSRPLVVNANSEIKIKLL
FT                   KKSTYVVIDGNTEFEAKKGDEIILRKSESNAYFVKGDNFYNKLKKLSLM"
FT   gene            complement(77519..78895)
FT                   /locus_tag="MmarC5_0089"
FT   CDS_pept        complement(77519..78895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0089"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   mmp:MMP1488 modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34406"
FT                   /db_xref="GOA:A4FW35"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW35"
FT                   /protein_id="ABO34406.1"
FT                   /translation="MSFLNELDLNIEKLEKLLEIGTYADLRIVSGESNNIIQKDGIIDE
FT                   ISSGMSSGVIIRVLEKNGWGFATSNNVSLKNIEEIIKKAHNMAKISNTHTKKSIELKDI
FT                   PVICDNVKADVKIHPETISIEEKKEYLKSAHENMSGEKIVSTSVSYSDGEGHSILMTSE
FT                   GTRIENESVKALMRMTAIAKDGTLQFAFDRIGGNGFEIIKNAKIEEMAKSTKERAIRLL
FT                   TAESCPKGTFDVILDPELAGVFIHEAVGHAAEADLFLQNDSVFHDKLGNSVGSEEVTVI
FT                   DDATIEKSFGQYKYDHEGVKGEKTTLIENGILNGYLHSRETAGRLNMDVTGNARADGLN
FT                   RPIVRMSNTYIKPGSWKFEELLEDTKTGIFLKGSRGGQVDTGKGLFQFNAVEAFLIEDG
FT                   ILTKPLRDAGLSGEILDILHHIDAVSDEFELSVGYCGKGGQSVPVGDGGGSVRTKTTLS
FT                   "
FT   gene            complement(78940..80337)
FT                   /locus_tag="MmarC5_0090"
FT   CDS_pept        complement(78940..80337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0090"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmp:MMP1487
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34407"
FT                   /db_xref="GOA:A4FW36"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW36"
FT                   /protein_id="ABO34407.1"
FT                   /translation="MFIDGKWILREDIDVFDPYTLENIEKITALDREETKSAIEVAEKN
FT                   KEIMKNLSPSKRYSILMKIAEQISLKKDLFAKTISIDVGKPIKQSKIEVDRTLTALKLS
FT                   AFYAKELRGETINSENGLIFTKKEPLGVVGAITPFNFPLNLITHKIGPAIATGNSVVLH
FT                   PSSKAPIVAIYLTKIIEHVLKQMDVPRGIFNLATGNGDIVGDEISKNDNINMVSFTGSV
FT                   EVGESISKNAKMKKVALELGGNNPMIVLKDSDIKLAAKSAVKSKFLNAGQVCISVGQVL
FT                   VEEEVLETFTKHVIEETKKLILGNPLDTKTDIGPLISPESALRIENLIKKSVNEGGEVL
FT                   IGGNRQNSLISPAVINIDENNILSKIETFGPVLPILKVKDSEEAVSIANNSKYGLQAGV
FT                   FTNDINKAMKIADSLEYGGIMINSSPTFRKDNMPFGGVKKSGLGREGIKYTVEEMCETK
FT                   TIVIHNI"
FT   gene            80456..81259
FT                   /locus_tag="MmarC5_0091"
FT   CDS_pept        80456..81259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0091"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mmp:MMP1486 putative mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34408"
FT                   /db_xref="GOA:A4FW37"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW37"
FT                   /protein_id="ABO34408.1"
FT                   /translation="MPISLMGYTLSINVFLIVKAILVLVLGYLAVRIVSGILERGAKKS
FT                   KIPELVSEFVIKLFSAILYLFVILLAVGVFGVETGPIILGLSASLGLILGFGLQDTLTN
FT                   LTSGLWIAVMKPLDKEETVQIGGMTGKVVEVGIMATKLLTPDNVVITLPNKLVWGSPIT
FT                   NFTRMDIRRVDVAVGVSYGENLDNAVSTALELISGHPLVLKDPAPAVAITGLGDSSVDL
FT                   QLRAWTKTGDYWAVKGDLTKGIYEKYGKEGIEIPFPQMDVHIHKY"
FT   gene            complement(81284..81769)
FT                   /locus_tag="MmarC5_0092"
FT   CDS_pept        complement(81284..81769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0092"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: mmp:MMP1485 molybdenum
FT                   cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34409"
FT                   /db_xref="GOA:A4FW38"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW38"
FT                   /protein_id="ABO34409.1"
FT                   /translation="MHERISEIKYAVITVSDSRFNEKIAGTEITDKSGDFLREELDAKI
FT                   YHLIPDNELMLNGLIEHIVEFTDVDSIVITGGTGLSKRDVTADVVKEIYEKELDGFKII
FT                   FHNLSYGEVKYSTILSRASAGIYKEKIIYSIPGSINACKTALDIIKTETGHIIGHIK"
FT   gene            complement(81772..82608)
FT                   /locus_tag="MmarC5_0093"
FT   CDS_pept        complement(81772..82608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0093"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="KEGG: mmp:MMP1484 cobalt transport protein O;
FT                   TIGRFAM: cobalt ABC transporter, ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34410"
FT                   /db_xref="GOA:A4FW39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW39"
FT                   /protein_id="ABO34410.1"
FT                   /translation="MAILETRDLKYSYPDGTVALNGINFKAEEGEMIAILGPNGAGKST
FT                   TFLHFNGILKPSSGSVILKDDPIKYDNKSLLNVRKTVGIVFQNPDDQLFAPTVEQDVAF
FT                   GPMNLGLSKEEIEKRVKDSLKAVSMEGFERKPPHHLSGGQKKRIAIAGILAMNPEIIVL
FT                   DEPTSGLDPMGASQIMKLLYDLNKKGITIIISTHDVDLVPIYANKVYLLNEGKIIKGGT
FT                   PREIFSDSETVRSANLRLPRVAHLIELLEKEDKLGIKMGYTIGEARNNIKEFIKGD"
FT   gene            82886..84001
FT                   /locus_tag="MmarC5_0094"
FT   CDS_pept        82886..84001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lme:LEUM_1286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34411"
FT                   /db_xref="InterPro:IPR025584"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW40"
FT                   /protein_id="ABO34411.1"
FT                   /translation="MKSKISIFLVLLSLVLLQQGFAASNIDLGSYSGGETVSISEAGDY
FT                   EISGSLIGGGIVVNCEGSAVNLILNGVTISSVDTACIYGEDLETLTITLLEGTTSNLGN
FT                   DGETDYDGVIYSNSDIIVEGEGKLIVEGNAEEGISTEDKDITINGGTIVITAVDDGINA
FT                   GGDNGGLISINGGNIYVNAEGDGIDSNGDLEINGGTLFVVGSTSADDSALDSDGTLAIN
FT                   GGTVVALGNGMLQSPDSDSLQDFLAVNVDTIDAGNIIALVDANGEKIVSFATTEKSFST
FT                   IVISSAFLDSDNYKLYKNCENTGSLVNGIYTGGVLTLGDELSVSESSSNMGGPGNIGEP
FT                   REIPSDTESEEDEDVGFFEKIFNFLLGWLYD"
FT   sig_peptide     82886..82954
FT                   /locus_tag="MmarC5_0094"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.976 at
FT                   residue 23"
FT   gene            complement(84241..85014)
FT                   /locus_tag="MmarC5_0095"
FT   CDS_pept        complement(84241..85014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0095"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   mmp:MMP1483 cobalt transport protein Q"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34412"
FT                   /db_xref="GOA:A4FW41"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW41"
FT                   /protein_id="ABO34412.1"
FT                   /translation="MTNSYLIDSIANCNSLRSVNPTLKVIFAVSSLLVSLFSKTFVVPF
FT                   LIAFIMSFVVIFAAKVPKTVYLKLLSIPFIFGIITFVMMTFLFGTEIYMSFDFFGITLN
FT                   LLKDGFSLGLLTFFKMLGGVSCTLFLALTTPFTELFCILKKSKMPKNMLEIAMMMYRYI
FT                   FMLMDETLSIENSQKTRLGYKNLKTSYHSLGLLAGSLFIKALDKGDVIYNSLNSRGYDG
FT                   NLMFFGDISYPKTNSVVLIGIFELLLLSLNYIKIY"
FT   gene            complement(85028..85321)
FT                   /locus_tag="MmarC5_0096"
FT   CDS_pept        complement(85028..85321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0096"
FT                   /product="cobalt transport protein"
FT                   /note="TIGRFAM: cobalt transport protein; PFAM: Cobalt
FT                   transport protein CbiN; KEGG: mmp:MMP1482 cobalt transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34413"
FT                   /db_xref="GOA:A4FW42"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW42"
FT                   /protein_id="ABO34413.1"
FT                   /translation="MEFKHVLMILGVIILILAPLIMYSGLGEDEGYFGGADGAAGDLIM
FT                   EISPNYEPWFEPFWEPPSGEIESLLFALQAAIGAIIIGYFFGYNKAKYEDKN"
FT   gene            complement(85321..85998)
FT                   /locus_tag="MmarC5_0097"
FT   CDS_pept        complement(85321..85998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0097"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiM; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiM protein; KEGG:
FT                   mmp:MMP1481 cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34414"
FT                   /db_xref="GOA:A4FW43"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW43"
FT                   /protein_id="ABO34414.1"
FT                   /translation="MHIMEGFLPPMWAAFWFVLSGIIVIYGIIQLNKLINDKPEVKPTL
FT                   ALAGAFMFILSSLKLPSVTGSCSHPTGGGLGAVMFGPAITAVLATIVLLFQAILLAHGG
FT                   LTTLGANIFSMGIMGPAIGFLVFKLLKGKLNITWVVVLAAIFADWGTYATTSIQLALAY
FT                   PLPDFGTALSNFGTVFAVTQIPLAIMEGLLTGLIWDYIMKLRPDLLAKLGLIDPAKAEG
FT                   GAE"
FT   gene            complement(86194..87450)
FT                   /locus_tag="MmarC5_0098"
FT   CDS_pept        complement(86194..87450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0098"
FT                   /product="2-oxosuberate synthase, isomerase large subunit"
FT                   /EC_number="4.2.1.-"
FT                   /note="TIGRFAM: homoaconitate hydratase family protein;
FT                   3-isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein; KEGG: mmp:MMP1480 aconitase family"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34415"
FT                   /db_xref="GOA:A4FW44"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW44"
FT                   /protein_id="ABO34415.1"
FT                   /translation="MTLAEKIISKNVGKNVYAGDSVEIDVDVAMTHDGTTPLTVKAFEQ
FT                   ISDKVWDNEKIVIIFDHNIPANTSKAANMQVITREFIKKQGIKNYYLDGEGICHQVLPE
FT                   KGHVKPNMIIAGADSHTCTHGAFGAFATGFGATDMGYVYATGKTWLRVPETIQVNVTGE
FT                   NENISGKDIILKTCKEVGRRGATYLSLEYGGNAVQNLDMDERMVLSNMAIEMGGKAGII
FT                   EADDTTYKYLENAGVSREEILNLKKNKIKVNESEENYYKTFEFDITDMEEQIACPHHPD
FT                   NVKGVSEVSGIELDQVFIGSCTNGRLNDLRIAAKHLKGKKVNESTRLIVIPASKSIFKE
FT                   ALKEGLIDTFVDSGALICTPGCGPCLGAHQGVLGDGEVCLATTNRNFKGRMGNTKSEVY
FT                   LSSPAIAAKSAVKGYITNE"
FT   gene            complement(87564..88496)
FT                   /locus_tag="MmarC5_0099"
FT   CDS_pept        complement(87564..88496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0099"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   mmp:MMP1479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34416"
FT                   /db_xref="GOA:A4FW45"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014499"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW45"
FT                   /protein_id="ABO34416.1"
FT                   /translation="MDKVKSLLKHGFNLAIDINADILLIFTETGRTYEYYKDQEAIYKR
FT                   ARKNRSSKDFKSLKVVVTTPNEETFLKLKNEPKIIPLLMTYRNDDRSSMIKQAVTNLFS
FT                   NNIVKKGDVVVSILGIPKVTGGTDTISIFEVNEYPQILRYYEYISTIEKTKGKVINEVL
FT                   NLCMELAVEGREGIPVGSIFVIGDTQKVLKMSSQLILNPFEGHESFIFDKQVKGTVKEL
FT                   STIDGAFIIGEKGEVLCAGRYISCSGGNIELPLGLGARHHAAATISKYTNALAITISES
FT                   GGIIRIFKNGEILSEIKPKKLNNDSEYSY"
FT   gene            complement(88511..89854)
FT                   /locus_tag="MmarC5_0100"
FT   CDS_pept        complement(88511..89854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0100"
FT                   /product="cobyrinate a,c-diamide synthase /
FT                   hydrogenobyrinic acid a,c-diamide synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.-"
FT                   /EC_number="6.3.5.9"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; KEGG: mmp:MMP1478
FT                   cobyrinic acid a,c-diamide synthase:cobyrinic acid
FT                   a,c-diamide synthase CbiA"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34417"
FT                   /db_xref="GOA:A4FW46"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW46"
FT                   /protein_id="ABO34417.1"
FT                   /translation="MKRVVIAGTSSMVGKTTISTGIMKALSKKNNVQPYKIGPDYIDPT
FT                   YHTEATKNKSRNLDSFFMDEMQVRSIFKRHSKNKDINVIEGVRGLYEGISPYNDVGSTA
FT                   SVSKTLNAPVILLMDARSLTRSAAAIIKGFKSFDTELNIKGVIFNKIRGEGHLNKLKEA
FT                   VKYYDNDIEIIGAIPRDDGLSVSQRHLGLVPTPENKQKLLERIDLWGNTVEECLDIEKI
FT                   VELSDESFDFEVDEKNKEETLWKVEKNNSKIAVAFDESFNFYYWDNFDALEENGAKIKF
FT                   FSPLNDVEVPDCDTIYLGGGYPELFSEKLSNNKSMIDSIRNFDGKIYGECGGLMYLTNS
FT                   IDGKEMLKLIDADAVMTPNVQGLSYVKGTFEKDCIIGEKSKEFKAHEFHYSKLININEN
FT                   DFSYRINRGKGIINSMDGITSKDGDIVGGYAHQHCIGNPYFAANLSKT"
FT   gene            89972..90709
FT                   /locus_tag="MmarC5_0101"
FT   CDS_pept        89972..90709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34418"
FT                   /db_xref="GOA:A4FW47"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW47"
FT                   /protein_id="ABO34418.1"
FT                   /translation="MSFEFLKKQFSWFLNLNFTNKFIITYFLSWTGLFTTLFVSKLLKP
FT                   LVNVESAGVLTTVKYEVISTAVSSQIGINYYSIWYSYFISNSLACMTIFLVFILLPYIY
FT                   TRDISKGKSTINDYFNVLLFFYVLIIVNPLTGVLGASLSLSEMLAIIPHGLFEYAGFSM
FT                   AIVLGIEYSIYKLPLEAKKEVWDTKQKLKFSMKFFSILIFIFIAGGIETLDWIIFNYAK
FT                   ENDLSIFRTFFEVYYSILKSLLF"
FT   gene            90995..91267
FT                   /locus_tag="MmarC5_0102"
FT   CDS_pept        90995..91267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34419"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW48"
FT                   /protein_id="ABO34419.1"
FT                   /translation="MELVANRNEIWGYSIETTLRIMADDLNIEMDGLAKVDMKNKKMYM
FT                   SLVSDEEITEYYVFEDAIYTKTVADGETRGLKCHPMTKILKKVLE"
FT   gene            91267..91635
FT                   /locus_tag="MmarC5_0103"
FT   CDS_pept        91267..91635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34420"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW49"
FT                   /protein_id="ABO34420.1"
FT                   /translation="MAQYNKDMNDLENKDYIVEGEETVNGISCYKIRMDIDDIVSFMAE
FT                   CGIDDNLVSSWESAYVTYYISKSDGHMVKSIEDIKVTFKSGDLVEFNDILIFKNINEVQ
FT                   DIELPEEAENAIDMSSLY"
FT   gene            complement(91679..94783)
FT                   /locus_tag="MmarC5_0104"
FT   CDS_pept        complement(91679..94783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0104"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   mmp:MMP1474 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34421"
FT                   /db_xref="GOA:A4FW50"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW50"
FT                   /protein_id="ABO34421.1"
FT                   /translation="MKQVKSVNFRELDKKIKEYWETENIYKKVKALNEQGPEYYFVDGP
FT                   PYCSGAIHLGTAWNKIIKDTVLRFKRIQGYNVLDKAGWDMHGLPIEVKVENEFNIGSKK
FT                   DIETKIGTLEFINKCKEFALNHLEFMEVQFKNLGVWLDFENAYMPIKRDYMEMGWWTLK
FT                   KAHEKDLLTKDLRSGYWCPRCETSLAEHEVRGEYKEVLDPSVYVKFKLEKSDEYITIWT
FT                   TTPWTLPSNMLVCVNPEFDYAYVNVEFENGNVETWVIAEKLVNDVMKKAEKNNEISKFS
FT                   ISKVVKGDSLIGLKYIHPLLEENEKQQEFAKIENVHTIVPGDHVTLEGGTGLVHTAPGF
FT                   GEDDFNIGKKYNIPVYAPIDDNGRYIDSIWKGTFVKDMNESVIETLISKNLLVNSGKVK
FT                   HTYPHCWRCKTPLLFRATEQWFLSISKIKESIIEQGKTVDWVPDWVKTRYVNGVSFVGD
FT                   WNISRQRYWGIPLPIWICEECGNYEVIGSVDELTQRANEKDLDLSDIHKPAVDNITLTC
FT                   SCGGKMKRTPDVLDVWYDSGLAPYASIGSKTLKKAKFITEGNDQVTKWFYSQHALSAVV
FT                   FDDTSYEKCMMHGFTLDETGEKMSKSLGNIVSPDDVTEQYGADVLRFYLLSANKAWEDL
FT                   RFSYSEMDETRSMLNTLWNSYAFSANYMVLDDFVPNDEYFKHVKDEDAWILSRINTVAK
FT                   EAVEALEKPHLHTYTWTLRDFILNDFSRWYIKLIRDRTWMEKNDVQKLSAYQTLYYVIM
FT                   KLISIMAPVTPHLSEEIYQNLKTEDMPESIFMNKLTIESEFINETLEKDTEIIREIVDS
FT                   ILKGRDKAKYTLRYPITKITLPENIAETIEKYGYIIKEQGNVKEIELKEFEGNVTVKPD
FT                   FKELGKIFRSDVPKVVAAINSVDPKELKENLKSGEFEISEYVLKPEYVEFRVEIPENII
FT                   GVEFSKGNVYINIDMNDEVITEGLVREVIRRIQSMRKDMDLDINEKINVKLEGLDFSSD
FT                   YLNHIANEVRGNFVDSLKSDYNQKWTIKTPNEETYDISIDIEKMK"
FT   gene            complement(94823..95203)
FT                   /locus_tag="MmarC5_0105"
FT   CDS_pept        complement(94823..95203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0105"
FT                   /product="Protein of unknown function DUF356"
FT                   /note="PFAM: Protein of unknown function DUF356; KEGG:
FT                   mmp:MMP1473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34422"
FT                   /db_xref="InterPro:IPR007154"
FT                   /db_xref="UniProtKB/TrEMBL:A8B1G0"
FT                   /protein_id="ABO34422.1"
FT                   /translation="MVLLIIRGDSYEKIKNAIADVHRHAKLTILGKPRIMVPEAADEIL
FT                   EHIVGNIKKPCKKACLVRIEENAPRAIDRIRKIHPPAHIVIVSERHEPYFYLLEDLPKM
FT                   PLLKGYYKSKSLDSDEEIEESH"
FT   gene            complement(95260..95931)
FT                   /locus_tag="MmarC5_0106"
FT   CDS_pept        complement(95260..95931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1472 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34423"
FT                   /db_xref="InterPro:IPR014856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW52"
FT                   /protein_id="ABO34423.1"
FT                   /translation="MQKQRFCLDTTAITDSDVRKSLGVSNISESAEKIMDIIAQARVQL
FT                   DISCHIPYNTVYKELIGFLVREECAPETLIKVNTWLVKKTPNRYEIKIPAEIFYEYIKD
FT                   LRERINKGMRISENAMYETALEAYILSKPDEKDREDVLNEVLSKTVNSFRDKYRNTLRG
FT                   GTLDSAPDLDVLLLAKELDAAVVANDEGIEKWAQRLGLRFVNARDFPFIIQEYLDLWDK
FT                   K"
FT   gene            complement(95947..96996)
FT                   /locus_tag="MmarC5_0107"
FT   CDS_pept        complement(95947..96996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0107"
FT                   /product="protein of unknown function DUF795"
FT                   /note="PFAM: protein of unknown function DUF795; KEGG:
FT                   mmp:MMP1471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34424"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR032266"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW53"
FT                   /protein_id="ABO34424.1"
FT                   /translation="MEDEIKSFAKDRKLIIEDSKNSKNNIVEVQKAIETLKDEKNAKNV
FT                   VVDFTEYNPLHNGHKYCMDFGKREGLFISVIPGPLERSGRGIPYLVNRYIRSEMALLAG
FT                   ADLVVEGPPMGIMGSGQYMQCLIKIFSALNGDIIPRGYIEEETMEKVINSINNKNHIKI
FT                   KPYNISCIETGEKFGEKLEIDNYVIASMSYTIYKLKENFPEWKPKFKFIERIEGISGTK
FT                   IREGVFNNNFESIKHMLPETTLNVFKSFENNLSEIILKRNEQMVLDTVNNFDLSKYLPE
FT                   NISEKLNEKEYYKSIEEIKECIPRGFSKNNIERTISKLEARIEKETISKYIENYPANLK
FT                   ILKGINNNE"
FT   gene            97098..97174
FT                   /locus_tag="MmarC5_R0005"
FT                   /note="tRNA-Val1"
FT   tRNA            97098..97174
FT                   /locus_tag="MmarC5_R0005"
FT                   /product="tRNA-Val"
FT   gene            complement(97305..97739)
FT                   /locus_tag="MmarC5_0108"
FT   CDS_pept        complement(97305..97739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0108"
FT                   /product="prefoldin, alpha subunit"
FT                   /note="TIGRFAM: prefoldin, alpha subunit; PFAM: Prefoldin
FT                   alpha domain protein domain protein; KEGG: mmp:MMP1470
FT                   prefoldin alpha subunit (GimC alpha subunit)."
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34425"
FT                   /db_xref="GOA:A4FW54"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW54"
FT                   /protein_id="ABO34425.1"
FT                   /translation="MNEELQNQFMALDVYNQQVQKLQEELSNIDMMIMELLKSIESMEG
FT                   LKTSKEILLPLGAGAFVNAQVQNPEKIVLSVGVDVLLEKDVDEVIVDFQKSVEELEQTK
FT                   ELVNTQIQKTNQEIVKLRSELEKRAAAIEQRSAQMKPRTN"
FT   gene            97933..98235
FT                   /locus_tag="MmarC5_0109"
FT   CDS_pept        97933..98235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0109"
FT                   /product="membrane-bound hydrogenase subunit ehbA"
FT                   /note="PFAM: cation antiporter; KEGG: mmp:MMP1469
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34426"
FT                   /db_xref="GOA:A4FW55"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW55"
FT                   /protein_id="ABO34426.1"
FT                   /translation="MKLFGFFGYLIVFLKALGEAWIDVVKRSFDGKIDPEVIEINTDIN
FT                   SLMGQVLLASSITLTPGTLTIDLNSENKTLKVASISPRTKDEIVPFEPYIKKIFD"
FT   gene            98286..99479
FT                   /locus_tag="MmarC5_0110"
FT   CDS_pept        98286..99479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0110"
FT                   /product="protein of unknown function DUF1063"
FT                   /note="PFAM: protein of unknown function DUF1063; KEGG:
FT                   mmp:MMP1468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34427"
FT                   /db_xref="GOA:A4FW56"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW56"
FT                   /protein_id="ABO34427.1"
FT                   /translation="MDDSKRILITKILKNEVTEALGCTEVGLIGYAVSLCNISDPFSIE
FT                   KIELTLNNGSFKNVYAVGVPNTGKYGLLPAVVGGFLGNSKNKLLIFNDITYSQELEDFT
FT                   KEKLEIKVINGPLYCSVKIKDNSGKIHESLIKDNHLNVVIPEIKKEKINMEINSSEKEK
FT                   YKNLELLDFLNYLDEIPEEIIKLVEKTIYTNKNLIKGDFLNYGTDILSNMVNKTTSACN
FT                   IRMTGENMTAMSVAKSGNMGIMATLPIISYDFSTENNSEKLIKSVLLSMLVTIYSTYNS
FT                   SYLSSMCGCVSKGGMGAVIGLSHYKNGKNLKKFDSSARTFTANLPGIICDGGKVGCALK
FT                   LASGCFAAYSSLFVDISYENGIVGKNFKECVENISKISKAMGDLDCDIVEIMSKKEM"
FT   gene            complement(99482..99883)
FT                   /locus_tag="MmarC5_0111"
FT   CDS_pept        complement(99482..99883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0111"
FT                   /product="Helix-turn-helix, type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix, type 11 domain protein;
FT                   KEGG: mmp:MMP1467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34428"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW57"
FT                   /protein_id="ABO34428.1"
FT                   /translation="MSELINIPKYGRKIDFWTCLKKAFEKNVKIDIGHFKIICMFLDVM
FT                   DFYENLSKDTSKKEARKILEKEGIFSKNSEYISGEYIKKHIDRESRVAVHNRINDLRKL
FT                   EFSIETKPGPLGGYKLLKTPDWFLNGENV"
FT   gene            complement(99904..100545)
FT                   /locus_tag="MmarC5_0112"
FT   CDS_pept        complement(99904..100545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0112"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmp:MMP1466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34429"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR016486"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW58"
FT                   /protein_id="ABO34429.1"
FT                   /translation="MKVKSLMDKKFIKIYPDFTVQTVIDLMYKNKKFSTPIIDNDGKMV
FT                   GWTTAIDLMVVSDKNIPIKDIMSPIADVIVVNKNEPAREAVTKIVEYKVISIPVLNDRG
FT                   QLVGIVRNCDITKTLSKLYDIPVHSIFKSLMGELKGISWEELMNAAAIVTKQTTGETIT
FT                   GEDYERRIKGSTFGQAIWACGGLEKFFTGLIKIGEVALARKVSCKNVIKK"
FT   gene            complement(100561..101319)
FT                   /locus_tag="MmarC5_0113"
FT   CDS_pept        complement(100561..101319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0113"
FT                   /product="membrane-bound hydrogenase subunit ehaR"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34430"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW59"
FT                   /protein_id="ABO34430.1"
FT                   /translation="MITVKKPVPKIISDISEKLGIDEESVKKKLQDIIVPVERNLYVET
FT                   NKCVRCELCYEVCPVQAIKEPSVKSPAEIIPEKCVKCEICAKTCPVGAINVLEGRAELK
FT                   DDNVIYELKEIDVTHRKIRLKKHELDEESCIKCGICERFCPTSAIKVEKRTSIDINLDL
FT                   CMGCTACEKVCPKSSIKVENEMGEIPTENVISLNNDTCINCMVCSEICPVGAIIYEDGL
FT                   MKLDDKKCIFCGKCEKNCPVTAIAIQSKNM"
FT   gene            complement(101340..101825)
FT                   /locus_tag="MmarC5_0114"
FT   CDS_pept        complement(101340..101825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0114"
FT                   /product="membrane-bound hydrogenase subunit ehaQ"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34431"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW60"
FT                   /protein_id="ABO34431.1"
FT                   /translation="MIDMISEILKKYFGDLDIQFELDRQYINNKIEINPETCILCNRCL
FT                   EVCPVTAISSNFSEIPNINDKCVYCNTCVETCPVNAINITKTRVKVENGKLIIENRLKS
FT                   ENLEYNRQKCVMCLVCSKNCPFGAISESDDKISFDMEKCVLCGHCEKICPAKAIKLE"
FT   gene            complement(101818..102999)
FT                   /locus_tag="MmarC5_0115"
FT   CDS_pept        complement(101818..102999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0115"
FT                   /product="membrane-bound hydrogenase subunit ehaP"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1463 polyferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34432"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW61"
FT                   /protein_id="ABO34432.1"
FT                   /translation="MSSSIWYLYEFVRKKWFMRFTNAKSEKGSFIPPKRFRKIPVIFDL
FT                   PEKCISCSACAESCPSDAIKMEYNEEFKKNMPVFDAGSCINCGNCVESCPTNVLEMGTL
FT                   RKEATELLWNVPKLVNLLIDEEICVSCGSCENACPVDAISHNSNGLYEIDVNLCVSCKN
FT                   CVEACPVENAIVTYDESGLSEKIEIAQNIKFNRKRLGSDFKEETELISEVPRIVPSLCI
FT                   GCGNCVDVCSGSIDLERLEVTSCVRCGKCLEVCPTTAIRIGIPEKITKRTAECYLVDEE
FT                   KCIGCRICYRACNVPEAVSISNETNLPYINPEYCVRCGLCQNACPVDAITYIKTEVAKD
FT                   LYSERKVRDEFENILHNDLEEFTKNYVLVKEEIKTLGKQSVSDENIGEKRKDD"
FT   gene            complement(103025..104155)
FT                   /locus_tag="MmarC5_0116"
FT   CDS_pept        complement(103025..104155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0116"
FT                   /product="membrane-bound hydrogenase subunit ehaO"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 49kDa;
FT                   KEGG: mmp:MMP1462 energy conserving hydrogenase A large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34433"
FT                   /db_xref="GOA:A4FW62"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW62"
FT                   /protein_id="ABO34433.1"
FT                   /translation="MNVVPIGPIHPILKEPLRIKLLVEGENVKGAEIDMGYVHRGIERI
FT                   MEGKHYLKCIHLSERVCGICSYIHTQSFAECIENMCKIEVPDKAKYLRVITCELERIHS
FT                   HLIAAAVYNLTIEHETIGIWLLNVRETSMDLLELITGNRVNMGFNVVGGVRLDLNKEIL
FT                   DTIHKKIDEFEEDVKNIIEAFETGPLIALRSKHIGNIGYKEIMKTRAAGPVARASGIPE
FT                   SDWRIRHETYQALNFKPDWRDEGDNYARMMVRHDEVLTSVELIRRALEQYAECSGIVRN
FT                   KAEIRATEGEWYNEAHRGEVYYKIAITDGGLIKRIIIRTPTVMNLEAYKYMIKDCPTIA
FT                   DAVATYTSIDPCVSCTERTIQLKDLNNGKLSDYKFQ"
FT   gene            complement(104170..104640)
FT                   /locus_tag="MmarC5_0117"
FT   CDS_pept        complement(104170..104640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0117"
FT                   /product="membrane-bound hydrogenase subunit ehaN"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase, 20 kDa
FT                   subunit; KEGG: mmp:MMP1461 energy conserving hydrogenase A
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34434"
FT                   /db_xref="GOA:A4FW63"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW63"
FT                   /protein_id="ABO34434.1"
FT                   /translation="MIKDFVRKRSINVCLVNTGGCNGCDIEVVSCLAPRYDIEQYGIYV
FT                   HNNPREADVLVVTGPVTGAWEKRLLEIYEKTPEPKIVIAVGACALSGGIFKEGHIHGPV
FT                   DSVIPVDAKLPGCPPRPSEIISAVVTIAPDALAAKEKLLNQKLKEEKNKAKA"
FT   gene            complement(104662..105072)
FT                   /locus_tag="MmarC5_0118"
FT   CDS_pept        complement(104662..105072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0118"
FT                   /product="membrane-bound hydrogenase subunit ehaM"
FT                   /note="KEGG: mmp:MMP1460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34435"
FT                   /db_xref="InterPro:IPR012056"
FT                   /db_xref="InterPro:IPR036606"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW64"
FT                   /protein_id="ABO34435.1"
FT                   /translation="MLEEIDKNYENSSLEQKYNIIKGNRYIMEEAIVPISKALKMSMEE
FT                   VIDVFVKTCDGVALYESHAYVEQAKMGCLGRKVDIDLGLCWIADFFGLISKQDADLIRK
FT                   RVVEDTIIRKKPYKEALEEGRALTVKILKGEE"
FT   gene            complement(105088..105387)
FT                   /locus_tag="MmarC5_0119"
FT   CDS_pept        complement(105088..105387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0119"
FT                   /product="membrane-bound hydrogenase subunit ehaL"
FT                   /note="KEGG: mmp:MMP1459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34436"
FT                   /db_xref="GOA:A4FW65"
FT                   /db_xref="InterPro:IPR019211"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW65"
FT                   /protein_id="ABO34436.1"
FT                   /translation="MNEVPFMLLYCAITFVIGSALGLSYSYKKYGKPYVEKTLDSVALV
FT                   SAIIGGLAFTVNAPISVLFLAFPLGMRPGYGHSEFSLGLLIALIGYILLTIGLI"
FT   gene            complement(105392..105643)
FT                   /locus_tag="MmarC5_0120"
FT   CDS_pept        complement(105392..105643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0120"
FT                   /product="membrane-bound hydrogenase subunit ehaK"
FT                   /note="KEGG: mmp:MMP1458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34437"
FT                   /db_xref="GOA:A4FW66"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW66"
FT                   /protein_id="ABO34437.1"
FT                   /translation="MKQYIQLLSIAGFVVLGMIVLINILQYPVTPILGLFVVLLMGILV
FT                   LIIQNKKITHLIETTEHLMMLAVLIAFIYLGYFAFITG"
FT   gene            complement(105652..106530)
FT                   /locus_tag="MmarC5_0121"
FT   CDS_pept        complement(105652..106530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0121"
FT                   /product="membrane-bound hydrogenase subunit ehaJ"
FT                   /note="KEGG: mmp:MMP1457 energy conserving hydrogenase A
FT                   integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34438"
FT                   /db_xref="GOA:A4FW67"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW67"
FT                   /protein_id="ABO34438.1"
FT                   /translation="MSAALSMVNGLMYALYAFLIGSILLGFHRKLMARIQCRPGPPIIQ
FT                   YLIHTFKFYFKELTFPISAGNPLYVFVALMDIMVWMSALSIAVVFESSLLILIGLYIMQ
FT                   KIVEHGCGLSSGSPYGKVGGVRSVFSAAAEVPLFAAAGIVYTVTDSLMIGDIINYQAIN
FT                   GPLLFQLPICAFAVFVLVLSKAPFSPFAIVKGKDIVSGYITEHYGPLEAIIMIGDAMAW
FT                   FVLLWLFMALFLGPLVLASSVLTLVGMFVLTVVIAFICALTPLLAPNHSVMLQITIASL
FT                   TLIDLAYRIIH"
FT   gene            complement(106532..106741)
FT                   /locus_tag="MmarC5_0122"
FT   CDS_pept        complement(106532..106741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0122"
FT                   /product="membrane-bound hydrogenase subunit ehaI"
FT                   /note="KEGG: mmp:MMP1456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34439"
FT                   /db_xref="GOA:A4FW68"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW68"
FT                   /protein_id="ABO34439.1"
FT                   /translation="MSPETKSGFIALIIGILGYIGTLYLNSQNEMVTYLLTAVFTPFLI
FT                   FGIAMFLNPKSRREKIGQIPFRGW"
FT   gene            complement(106751..107413)
FT                   /locus_tag="MmarC5_0123"
FT   CDS_pept        complement(106751..107413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0123"
FT                   /product="membrane-bound hydrogenase subunit ehaH"
FT                   /note="KEGG: mmp:MMP1455 putative transmembrane subunit of
FT                   a hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34440"
FT                   /db_xref="GOA:A4FW69"
FT                   /db_xref="InterPro:IPR017059"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW69"
FT                   /protein_id="ABO34440.1"
FT                   /translation="MLVEYIAGNFHGIIPLGDIIFYMTDFSLIAFIIAMLFTAIVYLTK
FT                   PEKQLEAQVHEFGDKFNYVTVEELKIRRFMSIVCGIATAFSMLTGDLFDFALFLAVIGI
FT                   TNIGIVSAVKKEWVLNAAFHYGIIAIISSLPLFGGAALILGKTGTLSIFELAKNGNELF
FT                   YQKLLYAVGMIGETGVAPFYAAKAEMFRAPGAPYILMIHLSSLLVIVRTVEILLTIS"
FT   gene            complement(107435..108121)
FT                   /locus_tag="MmarC5_0124"
FT   CDS_pept        complement(107435..108121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0124"
FT                   /product="membrane-bound hydrogenase subunit ehaG"
FT                   /note="KEGG: mmp:MMP1454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34441"
FT                   /db_xref="GOA:A4FW70"
FT                   /db_xref="InterPro:IPR011311"
FT                   /db_xref="InterPro:IPR019212"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW70"
FT                   /protein_id="ABO34441.1"
FT                   /translation="MDYVSLLFSRTVTVGLIVGIISLYSISRQKTDLNMILLTDLVEYG
FT                   MLVIIAAIGSDLAEALILPGLVVGMAELLAVAEIYVSRNDLRKQSKKKRSKLLEEFTIK
FT                   ETPNMDINFSKMEVLYTTPKFFAFVLVVYGAMLSGFTGGAVMASGLLFYVLAKRVLGQK
FT                   ILPEDLKVSWEGISAFSGIAWAIWILGFIGFFLFPSKWPYFLIIAGFGLALKVGSKLGL
FT                   IGELFE"
FT   gene            complement(108121..108594)
FT                   /locus_tag="MmarC5_0125"
FT   CDS_pept        complement(108121..108594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0125"
FT                   /product="membrane-bound hydrogenase subunit ehaF"
FT                   /note="KEGG: mmp:MMP1453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34442"
FT                   /db_xref="GOA:A4FW71"
FT                   /db_xref="InterPro:IPR011313"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW71"
FT                   /protein_id="ABO34442.1"
FT                   /translation="MKKINEAWNYISKPSAVSRLFAGFICIVLFIGIFLPTEFTSDQLY
FT                   PKDAIQNQVLKTPLAPYDRGGITLTEPADIKSQYPKYQGIGGQITAYLSPVAIAISENT
FT                   MYFGTTIVSTPGGILDEILYYTRGFDTVLESLTLLLSFTIFGWLFLNRNNRVK"
FT   gene            complement(108596..108850)
FT                   /locus_tag="MmarC5_0126"
FT   CDS_pept        complement(108596..108850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0126"
FT                   /product="membrane-bound hydrogenase subunit ehaE"
FT                   /note="KEGG: mmp:MMP1452 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34443"
FT                   /db_xref="GOA:A4FW72"
FT                   /db_xref="InterPro:IPR011317"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW72"
FT                   /protein_id="ABO34443.1"
FT                   /translation="MDLVTLAMYVGYFLLILGTVGAVIGPLTKDPFKRFLNIEVPSIGV
FT                   CLIFLAYNQTLALMTFLGVNAILTLVLVRAIIKNEELEE"
FT   gene            complement(108859..109137)
FT                   /locus_tag="MmarC5_0127"
FT   CDS_pept        complement(108859..109137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0127"
FT                   /product="membrane-bound hydrogenase subunit ehaD"
FT                   /note="KEGG: mmp:MMP1451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34444"
FT                   /db_xref="GOA:A4FW73"
FT                   /db_xref="InterPro:IPR011308"
FT                   /db_xref="InterPro:IPR019213"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW73"
FT                   /protein_id="ABO34444.1"
FT                   /translation="MEILPIVAAGCCILGGIGTIIHTHNINKIIMFALLESGLIGLIAS
FT                   FYYLDVAIISSMLEPVATLILLLGVLKYEYMLKNKKKYSTEVPVLTK"
FT   gene            complement(109143..109412)
FT                   /locus_tag="MmarC5_0128"
FT   CDS_pept        complement(109143..109412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0128"
FT                   /product="membrane-bound hydrogenase subunit ehaC"
FT                   /note="KEGG: mmp:MMP1450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34445"
FT                   /db_xref="GOA:A4FW74"
FT                   /db_xref="InterPro:IPR011316"
FT                   /db_xref="InterPro:IPR019214"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW74"
FT                   /protein_id="ABO34445.1"
FT                   /translation="MESSLVTFVIGIVGIISVIKVFLTKSRALKLPILCCINFCIAALI
FT                   ALYIKSPMGAIAAVVYFISSTVSSNAIAHTLGELDKMDEFEKKR"
FT   gene            complement(109412..109900)
FT                   /locus_tag="MmarC5_0129"
FT   CDS_pept        complement(109412..109900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0129"
FT                   /product="membrane-bound hydrogenase subunit ehaB"
FT                   /note="KEGG: mmp:MMP1449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34446"
FT                   /db_xref="GOA:A4FW75"
FT                   /db_xref="InterPro:IPR011314"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW75"
FT                   /protein_id="ABO34446.1"
FT                   /translation="MLIETGKILAAFAVCWLNFVIVDTYFGLPKKPGVLGAKVIGEKIE
FT                   NVGGNINGGYFMGNIVCSPDASAGTLMASIFYYLMGFEGGLIAALFIYIGNRLCNDTGY
FT                   AGTIGAITATILIYLLSGFISAEYFIAGMVLAIFSIQGVDHSAASRLLGSIARKMGRI"
FT   gene            complement(109890..110153)
FT                   /locus_tag="MmarC5_0130"
FT   CDS_pept        complement(109890..110153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0130"
FT                   /product="membrane-bound hydrogenase subunit ehaA"
FT                   /note="KEGG: mmp:MMP1448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34447"
FT                   /db_xref="GOA:A4FW76"
FT                   /db_xref="InterPro:IPR011306"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW76"
FT                   /protein_id="ABO34447.1"
FT                   /translation="MILLINYAVALVSSIVVGAILGMKISFDMDSFEGSVLFPTPFVAL
FT                   GLTALIGYLITLDLISSVIIGIFASVFSKFANKIFPGVTDVN"
FT   gene            complement(110158..110814)
FT                   /locus_tag="MmarC5_0131"
FT   CDS_pept        complement(110158..110814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0131"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mmp:MMP1447 Cro repressor family helix-turn-helix motif
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34448"
FT                   /db_xref="GOA:A4FW77"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW77"
FT                   /protein_id="ABO34448.1"
FT                   /translation="MSKSGKMYDKLKIIERAILLNPENIKVFREKLKITQSKLAEESGV
FT                   SQSHLSMLEKGKREIGEAHAAAITLGMLKCSNFWDKENPVLYLLDVLSLTKLEGAIVDF
FT                   IQDLTSKNDIFCKRYIEGHPVYIIDIKYFTGEIKKRLGVVDINEVDFFRGRMNIRGLHL
FT                   DKKTVLIQLDCSDIRRLEHKVSNVLNNKTIIQIFPKEEVPPIYSIKKDCMIVHCW"
FT   gene            111144..111716
FT                   /locus_tag="MmarC5_0132"
FT   CDS_pept        111144..111716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0132"
FT                   /product="ZPR1-related zinc finger protein"
FT                   /note="TIGRFAM: ZPR1-like zinc finger protein; ZPR1-related
FT                   zinc finger protein; PFAM: Zinc finger, ZPR1-type; KEGG:
FT                   mmp:MMP1446 Zn-finger, ZPR1 type:Zn-finger, ZPR1-related
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34449"
FT                   /db_xref="GOA:A4FW78"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR004470"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="InterPro:IPR042451"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW78"
FT                   /protein_id="ABO34449.1"
FT                   /translation="MEKQCNVMDCPICRKENSLKLITQELEIPYFGKVIETTIFCEECK
FT                   YKKSDIFPVDVKEPKRYTLRVEDEYDLNKRVIRGSSGHISIPEFGFEVSPGPASEAYVS
FT                   NVEGVLTRMEGAIKTLMSWVESEDEKKKAEELIEKLEEVRLGKEKITLIIEDPLGHSAI
FT                   IGDGVKEEVLTEEEIALLSDNTIIMDK"
FT   gene            complement(111750..112319)
FT                   /locus_tag="MmarC5_0133"
FT   CDS_pept        complement(111750..112319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0133"
FT                   /product="GMP synthase, small subunit"
FT                   /note="TIGRFAM: GMP synthase, small subunit; PFAM:
FT                   glutamine amidotransferase class-I; KEGG: mmp:MMP1445 GMP
FT                   synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34450"
FT                   /db_xref="GOA:A4FW79"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR023686"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW79"
FT                   /protein_id="ABO34450.1"
FT                   /translation="MIVILNNGGQYVHRIQRSLKYLDVPAKIIPNSTTLEEIIADSEIK
FT                   GIILSGGPDITKATNCENIALNSELPVLGICLGHQLISKAYGGEVSRADSEEYASIKIY
FT                   VKEENDLFNGVPSEFTAWASHMDEVKVIPDCFEVLAYSDICGIESIKHKEKSIYGVQFH
FT                   PEVSHTEYGDVILKNFCKKCGFEFEE"
FT   gene            complement(112341..113240)
FT                   /locus_tag="MmarC5_0134"
FT   CDS_pept        complement(112341..113240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0134"
FT                   /product="methionine aminopeptidase, type II"
FT                   /EC_number="3.4.11.18"
FT                   /note="KEGG: mmp:MMP1444 methionine aminopeptidase;
FT                   TIGRFAM: methionine aminopeptidase, type II; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34451"
FT                   /db_xref="GOA:A4FW80"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR018349"
FT                   /db_xref="InterPro:IPR028595"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW80"
FT                   /protein_id="ABO34451.1"
FT                   /translation="MVDKMDNEEYTKIIEAGKIASQVKKEAIKLVKPGAKLYDVAEFVE
FT                   NRTRELGAGVGFPCNISLNNIAAHYSPSYGDESVFSEEDIVKLDLGSHVDGFIADTAVT
FT                   IDLSGKYSDLKKASEDALNTVIKEIVPGINVGAMGKIIQEVIESYGYKPISNLSGHVMH
FT                   QYSLHSGVSIPNVSENTRDTIDIGDLVAIEPFATDGFGQVVDGKDVYIFKYLRSRPVRL
FT                   PAARNLLRDIEQNHAYLPFSERDMAKIDKHYKTGLKGLMMAGVLYGYPTLVEREHGMVS
FT                   QCEHTVLITENGVEVTTK"
FT   gene            complement(113240..114349)
FT                   /locus_tag="MmarC5_0135"
FT   CDS_pept        complement(113240..114349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0135"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein, HSR1-related; TGS domain protein;
FT                   KEGG: mmp:MMP1443 GTP1/OBG family:ATP/GTP-binding site
FT                   motif A (P-loop):TGS domain:small GTP-binding protein
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34452"
FT                   /db_xref="GOA:A4FW81"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW81"
FT                   /protein_id="ABO34452.1"
FT                   /translation="MGIQEDIKKLEDELLHTQYNKATQKHVGILKAKLAKLRDEQQNPK
FT                   GSGGSSGPSYAIRKTGDATVAFVGFPSVGKSTLLNKLTNANSEVGAYAFTTLTIIPGLM
FT                   EHKGAKIQVLDAPGIISGASFGRGRGSEVLAAVRNVDLVMLVVDVFSPEHIPILEKELG
FT                   NVGIRLDQEKPDVKIEKHDRGGLAINKTVNLTKIDEGTITAIVGEHKIHNAAILIREDI
FT                   NADQLIDVVLNSRSYIPTLVIVNKIDLADEANLKKTEAAIGDRPHVFVSGHKEINLEEL
FT                   KDKIFETLGFIKLYLKPQGGKADLEEPLIILKNSTVEDVCNRLHRDFVKNFRYALVWGD
FT                   SAKHPGQRVGLDHVLKDGDILTIVVKRAL"
FT   gene            complement(114544..114831)
FT                   /locus_tag="MmarC5_0136"
FT   CDS_pept        complement(114544..114831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0136"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: mmp:MMP1442
FT                   ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34453"
FT                   /db_xref="GOA:A4FW82"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW82"
FT                   /protein_id="ABO34453.1"
FT                   /translation="MAMEEYKYEYMAEVFKAFADPTRLMILELLSENESMCVCKIIDEL
FT                   KKPQPTISHHLNILKKSGIIKARKEGTWNHYYIVNPKVREMISIMGGIVD"
FT   gene            complement(114944..115633)
FT                   /locus_tag="MmarC5_0137"
FT   CDS_pept        complement(114944..115633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0137"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B; PFAM: molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; Fe-S cluster domain
FT                   protein; KEGG: mmp:MMP1441 ATP/GTP-binding site motif A
FT                   (P-loop):molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34454"
FT                   /db_xref="GOA:A4FW83"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW83"
FT                   /protein_id="ABO34454.1"
FT                   /translation="MIRVIGVIGRKDTGKTGLIANILKNLDGMSVATVKNSHMDIDVDS
FT                   PDTDSYRLKQLADTSVFVTQKGSAFYYNRMNLKEILAKLDCDLVFVEGFKEDLIELNIP
FT                   KILVTEGGRGAELKDNQTIMVIDDFKYDIDEVTAQVLEKAIVPTYNLNCGHCGYNCKGF
FT                   ANKLASGEVKWNKCVMSTALTLIVDGRTIPVNPFVSDIIKNTLKGIVRTLKGTENPETI
FT                   SIKIEKK"
FT   gene            115739..116680
FT                   /locus_tag="MmarC5_0138"
FT   CDS_pept        115739..116680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0138"
FT                   /product="Wyosine base formation"
FT                   /note="PFAM: Radical SAM domain protein; Wyosine base
FT                   formation; KEGG: mmp:MMP1440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34455"
FT                   /db_xref="GOA:A4FW84"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW84"
FT                   /protein_id="ABO34455.1"
FT                   /translation="MIPEQIHNILRKQHYQLKEHSGVKLCGWVRKSFLEGKECYKSKFY
FT                   GINTHRCVQSTPSVAWCQQSCIFCWRVLPKDLGLDSFESPEWKEPEVVAEDILSMHKTI
FT                   ITGYKGILDRIGEEKYLEATKPKHVALSLSGEPTMYPYIDELIEVFHKKGMSTFLVSNG
FT                   ILTDVIEKVNPTQLYISLDAYDLESYKKICGGTKDNWESILNTLDILDSKKRTCIRTTV
FT                   IRNINDNILKFKELFERANSNFIELKSYMNVGYSRKRLNLDDMVKQDELLEMGKILGEN
FT                   SIFEIEDDSPESRVVLLTNKNRKINPKIDFGF"
FT   gene            complement(116682..117902)
FT                   /locus_tag="MmarC5_0139"
FT   CDS_pept        complement(116682..117902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0139"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: mmp:MMP1439 cofactor-independent
FT                   phosphoglycerate mutase; TIGRFAM: phosphonopyruvate
FT                   decarboxylase-related protein; PFAM: metalloenzyme domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34456"
FT                   /db_xref="GOA:A4FW85"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW85"
FT                   /protein_id="ABO34456.1"
FT                   /translation="MKAVIFIMDGLGDRPNKDGNTPLKEAKTPVMDKMAKDGICGLMNA
FT                   VDVGVRPGSDTAHLAILGYDPYTTYTGRGPFEACGVGVTVKPGDIAFRCNFSSVNENFI
FT                   VTDRRAGRIEDTSELEKELDGLKIDDIDIIFKESGGYRAALVLRGPGLSDKISDADPKK
FT                   EGKRVKEIHPLDNSKEAKKTAEIVNKLLKIAYEKLDKHPVNEERRKQNLPVANMIVPRG
FT                   VGQVPEIMQFSEKTGLKGACIAGTGLIKGIAKMVGLDVIDVEGCDGTPNSDLMAKACAI
FT                   VETLKDYDFILVNVKGADEAGHDGNYELKKEIIEKIDEMLDYITKNIDKDEVYIAMSGD
FT                   HSTPIEEMDHSADPLPILIWGKSVRVDDVEKFDEFSTYKGGLNWIKGTNIMPILMDLMS
FT                   IAKKYGA"
FT   gene            complement(118052..119170)
FT                   /locus_tag="MmarC5_0140"
FT   CDS_pept        complement(118052..119170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0140"
FT                   /product="Allergen V5/Tpx-1 family protein"
FT                   /note="PFAM: Allergen V5/Tpx-1 family protein; KEGG:
FT                   mmp:MMP1438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34457"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW86"
FT                   /protein_id="ABO34457.1"
FT                   /translation="MDWPFKAFTLTLITLSLLVAASANCVFDGCEPTFSNVTYQNFNEN
FT                   YSNLFDNNHNLFFELNSLFKNNLDYKTFEVKAYAPLKKTSSKIDFLESRYVPVTTVDTS
FT                   SEDNTDTSSEDNTDTSSEDNTDTSSEDNTDTSSEDNTDTSSEDNTDTSSEDNTDTSSED
FT                   YVYLPSKITQSPKTSLYIIKTTQEPVVEEPVVEEPVVEEPVVEEPVVEEPVVEEPVVDK
FT                   NSLIEQYILDYTNIERSSYGLDELILDSKLSQISQAHSDDMVENDYFSHVNLDGETPTD
FT                   RAIAADYNVVKYLGDGYYATGIGENIAKMPTGNVIGIGYVSDDAESIAKAIVDAWMDSP
FT                   GHRANILNSQYTNMGIGVSFDGTYYVATQNFY"
FT   sig_peptide     complement(119105..119170)
FT                   /locus_tag="MmarC5_0140"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.958) with cleavage site probability 0.549 at
FT                   residue 22"
FT   gene            complement(119358..120455)
FT                   /locus_tag="MmarC5_0141"
FT   CDS_pept        complement(119358..120455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0141"
FT                   /product="Spo11/DNA topoisomerase VI, subunit A-like
FT                   protein"
FT                   /note="PFAM: Spo11/DNA topoisomerase VI, subunit A,
FT                   N-terminal domain; KEGG: mmp:MMP1437 DNA topoisomerase VI
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34458"
FT                   /db_xref="GOA:A4FW87"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR004085"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="InterPro:IPR034136"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW87"
FT                   /protein_id="ABO34458.1"
FT                   /translation="MITSEERNLAAKKLLKLANDMYEDIIRGKRPKITFPIRSLANAKF
FT                   DAEKGTFAILGKEKDRMLTVNQAKIFAQTIKMMEFSKELLDTNDFSTLREAYYVSKNWG
FT                   EARFDDQQPSNGVIEDIEAASEHLREDLGFIPEEDGAAVIGPLRIADKTADGEEIKIDC
FT                   TKLGSGAYNIPNDVTKLEFETKADFILAIETAGMFARLNAEEFWKKHNCILISLKGVPA
FT                   RATRRFIKRLNEEHKLPILVFTDGDPYGYLNIYRTLKVGSGKAVHLADKLAVPESRLIG
FT                   VTPQDIVDYELPTHPLKDHDVKRLKDGLKNDDFVRSFPEWQKALNQMADGKVRAEQQSL
FT                   AKYGLKYVVEEYLPAKIEDSKTWLP"
FT   gene            120684..121766
FT                   /locus_tag="MmarC5_0142"
FT   CDS_pept        120684..121766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0142"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ, GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   mmp:MMP1436 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34459"
FT                   /db_xref="GOA:A4FW88"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW88"
FT                   /protein_id="ABO34459.1"
FT                   /translation="MKFLKNIAQTDFLEPAPEQLSDIDRELLELIEQSKARITVVGCGG
FT                   AGNNAINRLIAESIEGARIVAINTDAQQLVKTHADQKVLIGKNLTKGLGAGGNPVKGEE
FT                   SAKENSEEVKKAVQDSDLVFVTCGLGGGTGTGSAPVVAEISKKVGALTVAVVTLPFSME
FT                   GKVRMSNAIAGLNKLKEVADTIVIIPNDKLLEIVQNVPLRTAFKVADEVLMNSVRGMVE
FT                   LVNNAGDIHVDFADVRAVMNNGGIAMMGIGESDSEKRAREAIQIALNSPLLCVDVDGAT
FT                   GALIHITGPEDMSLEEAKEIVSTVSDRLDEKATIIWGTTIDETLENSLRVLLIVTGTKS
FT                   TGDYTIDVTKKKYLIDIPKI"
FT   gene            121798..122037
FT                   /locus_tag="MmarC5_0143"
FT   CDS_pept        121798..122037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0143"
FT                   /product="protein translocase SEC61 complex, gamma subunit"
FT                   /note="TIGRFAM: protein translocase SEC61 complex, gamma
FT                   subunit; KEGG: mmp:MMP1435 preprotein translocase subunit
FT                   gamma"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34460"
FT                   /db_xref="GOA:A4FW89"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW89"
FT                   /protein_id="ABO34460.1"
FT                   /translation="MAKEKTTSTEISTSKVNTTLNNLKDFLHQCRRVLMISRKPTRQEY
FT                   ITISKVTGLGICLLGFVGFIIHVPITYVKGLIKP"
FT   gene            122173..122613
FT                   /locus_tag="MmarC5_0144"
FT   CDS_pept        122173..122613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0144"
FT                   /product="LSU ribosomal protein L24A"
FT                   /note="KEGG: mmp:MMP1434 LSU ribosomal protein L24A;
FT                   TIGRFAM: ribosomal protein L24; PFAM: transcription
FT                   antitermination protein NusG; KOW domain protein; SMART:
FT                   NGN domain protein; KOW (Kyrpides, Ouzounis, Woese) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34461"
FT                   /db_xref="GOA:A4FW90"
FT                   /db_xref="InterPro:IPR005100"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011590"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="InterPro:IPR039659"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW90"
FT                   /protein_id="ABO34461.1"
FT                   /translation="MIFAVRTTTGQEKNVAESLASKAEKENLEVFSILATEDLKGYILI
FT                   EAANKGALDDLVRKSFKVKGIVPGETSVSELDHLLTPTKIIEHIDKGDIVELVGGPFKG
FT                   ERARVTRVDKHKEEITLELIDAAVPIPITVGVEQVKIVSKQD"
FT   gene            122727..123206
FT                   /locus_tag="MmarC5_0145"
FT   CDS_pept        122727..123206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0145"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11; KEGG: mmp:MMP1433
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34462"
FT                   /db_xref="GOA:A4FW91"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW91"
FT                   /protein_id="ABO34462.1"
FT                   /translation="MAEQVVEILVSGGKATAGPPLGPAIGPLGVNIMQVVQKINDMTKD
FT                   YDGMSVPVKVIVDTDKRTFEVEVGIPPASALVKKELGIATGAQEPKHQVAGNLTMEQVV
FT                   KIAKMKQDAMLAYNLKNASKEVIGTCVSVGVNVEGMTPKEAQKAIDAGQFDSYFN"
FT   gene            123315..124328
FT                   /locus_tag="MmarC5_0146"
FT   CDS_pept        123315..124328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0146"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG: mmp:MMP1432
FT                   adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34463"
FT                   /db_xref="GOA:A4FW92"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW92"
FT                   /protein_id="ABO34463.1"
FT                   /translation="MTCTIVVGGQWGDEGKGKIISYLCKKDNPSIIARGGVGPNAGHTV
FT                   EVDGEKYGIRMVPTGFPNVNAKLAVGAGVLTDPEVLLKEIKMLEKFNVGERMIIDYRCG
FT                   IIEDVHKETDKSNEHLSKEIGSTGTGCGPANVDRAMRTLKQGKDVESISKYLGDVSEEV
FT                   NEALESGDNVLIEGTQGSLLSLFYGSYPYVTSKDTNAASFAADVGVGPTKIDEVVAVFK
FT                   SYPTRVGEGPFPTEMTVEEAESLGVVEYGTVTGRRRRVGYFDHDLAKKVCRLNGATQIA
FT                   ITCLDKYDTDCYGIIEYDKLSEKGKAFIKEVEEKVGVKVTLISTGPELGQTIDVRK"
FT   gene            124410..125351
FT                   /locus_tag="MmarC5_0147"
FT   CDS_pept        124410..125351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0147"
FT                   /product="2-phosphoglycerate kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="PFAM: ATP-cone domain protein; KEGG: mmp:MMP1431
FT                   2-phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34464"
FT                   /db_xref="GOA:A4FW93"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR020872"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW93"
FT                   /protein_id="ABO34464.1"
FT                   /translation="MTFDENISRILVKDKEYEMPFSKGLLARSLTAAGMKPSESYTLAR
FT                   EIERDLNEQNVLKISKDELRRRVYYTLINRDYEGIGEKYLLWRRVLKKHSIIILVGGSS
FT                   GVGTSTIAFELASRLGIPSVIGTDSIREVMRRSISKDLVPMLYESSYTAWTALRRSQWD
FT                   EQDTKEMHLLGFERHVEPVLLGIESIIDRSLTEGTSVIIEGTHIVPGLMGEKYQSMPNV
FT                   IFLNLTLSSEETHKKRFTARAKVSDRPLERYLENFEIIKEINQYIVEKSKENKVPVIEN
FT                   VSISETVQKCLEIVTERFSNLNDEPIIDSDMY"
FT   gene            125373..126815
FT                   /locus_tag="MmarC5_0148"
FT   CDS_pept        125373..126815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0148"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter; KEGG: mmp:MMP1430 putative
FT                   trk system cation (K+) uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34465"
FT                   /db_xref="GOA:A4FW94"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW94"
FT                   /protein_id="ABO34465.1"
FT                   /translation="MKIFKKSDISGILHELGILISTIGLIMMLPSFIGLYFHEPFFYFL
FT                   YPSLFFMIVGLLINKLTKPVSVKLKHAMVISALAWLMASLIGAIPFYIGIEYFGYLDGV
FT                   FESMSAWTTTGFSIVRDVESLPRTLQIWRSLEQWIGGVGVLAMVISILSKAGASAYYRA
FT                   EAREEKIMPSTIGTIKKIWHIYLLYTTIGICLLYLSGLNLWVALNICMCGISTGGMSIS
FT                   NQSFPFNNFAKIIMTLIMYIGGVVSFSVHHNVLTGRRVDDIQTKTSIPILFFAAFVITL
FT                   TSGIDPLDSMFTVVSAMTSTGFSSVKISALTNISIAVLIFVMAIGGATGTTTGGIKLIR
FT                   LVIMSKGFYYRLKEVVSPGNAILNKKIGKNPLSDFLILDAFIITFGYIVHYLFGTFVLI
FT                   SLGYDPFLSVFEAVSLVANMGLSVDIVNHSLHPAAKLMGIFSMWVGRLEILPIYVLIIL
FT                   PLYLKLKDVGKNKIVKKIESYK"
FT   gene            126885..127202
FT                   /locus_tag="MmarC5_0149"
FT   CDS_pept        126885..127202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0149"
FT                   /product="DNA-directed RNA polymerase, subunit M"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: transcription factor S; PFAM: Transcription
FT                   factor TFIIS; DNA-directed RNA polymerase, M/15 kDa
FT                   subunit; KEGG: mmp:MMP1429 transcription factor
FT                   TFIIS:DNA-directed RNA polymerase, M/15 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34466"
FT                   /db_xref="GOA:A4FW95"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR006288"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW95"
FT                   /protein_id="ABO34466.1"
FT                   /translation="MVEFCPKCNNIMLPKGGVLKCVVCKHEEELGDANQEYALKEKIES
FT                   KKQDVTVIENVDTLPTTRIECPACGNMEAFWWLQQTRCADEPETRFYKCKKCSHTWREY
FT                   D"
FT   gene            complement(127254..127415)
FT                   /locus_tag="MmarC5_0150"
FT   CDS_pept        complement(127254..127415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34467"
FT                   /db_xref="GOA:A4FW96"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="UniProtKB/TrEMBL:A4FW96"
FT                   /protein_id="ABO34467.1"
FT                   /translation="MAKNQDAGLSTSAGLVRYMDEDVSKIKISPEKVLGLTVSIIIIEA
FT                   VLNYGILI"
FT   gene            complement(127479..128855)
FT                   /locus_tag="MmarC5_0151"
FT   CDS_pept        complement(127479..128855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0151"
FT                   /product="protein of unknown function DUF711"
FT                   /note="PFAM: protein of unknown function DUF711; KEGG:
FT                   mmp:MMP1427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34468"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW97"
FT                   /protein_id="ABO34468.1"
FT                   /translation="MYVPEEIIETIKMIEYQNLDIRTTTLGVNLKDCADKDLDLLKENI
FT                   YNKITSYGGNLVETANKVSQKYGIPIVNKRISVTPIGLIMGSTLKGLSNEEAVDACVEV
FT                   GITLDNIAKEVGVDFIGGYSALVQKRATPEEKMLIRSIPKLMTKTDRVCASVNVATTKA
FT                   GINMYAVKKMGEIVKETSEITKDAIGCAKIVVFCNAPEDNPFMAGAFHGPGEGDAVINA
FT                   GVSGPGVVRAVVEQLKGKDIGTVSDEIKKTAFKITRMGELVGKEVASELGVDFGIVDLS
FT                   LAPTPAIGDSIANILEAVGLERCGTHGTTAALAMLNDAVKKGGAMASSNVGGLSGAFIP
FT                   VSEDAGMIEAVEVGALRLEKLEAMTCVCSVGLDMIAVPGKTPASTLSAIIADEMAIGMI
FT                   NKKTTAVRIIPVPGKDVGDSVEYGGLLGTAPIMPVSEFSSEELIERGGRIPAPIQSLTN
FT                   "
FT   gene            complement(128859..129479)
FT                   /locus_tag="MmarC5_0152"
FT   CDS_pept        complement(128859..129479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0152"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; KEGG:
FT                   mmp:MMP1426 bifunctional dCTP deaminase/dUTP diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34469"
FT                   /db_xref="GOA:A4FW98"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW98"
FT                   /protein_id="ABO34469.1"
FT                   /translation="MILSDKDIFDYVNSKRVLIEPFNSKFVGPCSYDVTLGSEFIKYKD
FT                   DVYDLKKSLSHNKFEIENSIMICPLNHHLDETIIKNYKEKYNVNCVVSGGLLGTTNEYV
FT                   ELPNDVCAQYQGRSSFGRVFLQTHQTAGWIDSGFKGKITLEIVAYDKPVILYKNQRVGQ
FT                   LIFSKTLSPADTGYSDRECSKYAGQKSVMASLIKKDFEIDEEE"
FT   gene            complement(129504..130043)
FT                   /locus_tag="MmarC5_0153"
FT   CDS_pept        complement(129504..130043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0153"
FT                   /product="protein of unknown function DUF127"
FT                   /note="PFAM: protein of unknown function DUF127; KEGG:
FT                   mmp:MMP1425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34470"
FT                   /db_xref="GOA:A4FW99"
FT                   /db_xref="InterPro:IPR002845"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FW99"
FT                   /protein_id="ABO34470.1"
FT                   /translation="MAIEILRLGHRGERDKRISTHVALTSRALGAEKIIFTEEDKHVKE
FT                   SVERIVDSWGGDFKFEVVKSWRTYAKRFKDNGIVVHLTMYGENINKIMTEIREDISKTN
FT                   KNLLLIIGAEKVPREAYDLANYNLSVGNQPHSEVAALAIFLDRLTEGKTLYSEYDNAKI
FT                   KVTPSKSEKCVFVEKD"
FT   gene            complement(130159..132720)
FT                   /locus_tag="MmarC5_0154"
FT   CDS_pept        complement(130159..132720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0154"
FT                   /product="Oligosaccharyl transferase, STT3 subunit"
FT                   /note="PFAM: Oligosaccharyl transferase, STT3 subunit;
FT                   KEGG: mmp:MMP1424 oligosaccharyl transferase, STT3 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34471"
FT                   /db_xref="GOA:A4FWA0"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWA0"
FT                   /protein_id="ABO34471.1"
FT                   /translation="MGELLNKISDFFKKNEKIKLILIILFIGMMSFQIRAQTADMPFAE
FT                   DSQYLKELFSDDNGRMYLTALDPYYYLRLTENYQNSGYSHVGETIVQIDNKNVPYDTIQ
FT                   YAPPGHTVGSVSALSIATIIVYSLWNSLDSTVTLLNAAFWVPAIMSIFLGIPVFFIIRR
FT                   NTSSNMGGLVGALLLISSQSLIYKTSAGFSDTPIFEILPLLFIVWLIMEAIHAQDNTKK
FT                   SVIFGGLATILMGIYPKMWLGWWYAYDITAGFMAIYLAYEYITKSKNLKNVLYTSTLFL
FT                   IGGGLIISLISGINKFIQGVFSPIGFTAISEGSKITGWPNVYTTVSELAIPTFNEIITN
FT                   SVGSILLFIVGVIGIMFSFVSFRHEKREFDIKYALYLTLWLLATFYAATKGVRFIALMT
FT                   PALAIGIGIFAGQVENILKRYEKKVEYILYPVIGIISAVTLFKYGAEISDILIPTTYVP
FT                   IVVYISIISILSLLIYKISDIISEKENAFKKVFGILLAIMLVLPSMATAVPFYTAPTMN
FT                   DGWMDSLNWIKTETPENSVVTCWWDNGHIYTWATRKMVTFDGGSQNTPRAYWVGHAFST
FT                   SDENLSVGILRMLASSGDSAFDEDSLLLKKTGSVKDTVNILNEILPLSKKDAKALLLEK
FT                   YGLNSTEVDEIIALTHPENTNPDYLITYNRMTDIAQVWSMFGNWNFSLPSDTDNSVRDK
FT                   GYYQKLTGTAEVINKTTVIRLPLYSGDEYDIINIIEISQSGIATANALIDTEGQVEMQT
FT                   PNFHKLILKFGENVYEQDINENGDYSEIVRLEKVSEDTYQVYAWISTKDLEDSVYTKLH
FT                   FLDGYGLEKISLEKASQDPTTYGVQPGFKVYSVNYGTEYLN"
FT   sig_peptide     complement(132610..132720)
FT                   /locus_tag="MmarC5_0154"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.960 at
FT                   residue 37"
FT   gene            132819..133718
FT                   /locus_tag="MmarC5_0155"
FT   CDS_pept        132819..133718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0155"
FT                   /product="glycosyl transferase, family 4"
FT                   /note="PFAM: glycosyl transferase, family 4; KEGG:
FT                   mmp:MMP1423 putative glycosyl transferase, family
FT                   4:aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34472"
FT                   /db_xref="GOA:A4FVT9"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVT9"
FT                   /protein_id="ABO34472.1"
FT                   /translation="MDLYFVLSALFSFVISIIFTKFIIGKMANNKYGYDLHKENKIKVA
FT                   EMGGISPVVISSITMLFFNPALSLSIFLSGFVGVIDDISRLNSREKVILTFLIGFPVAF
FT                   LLKLNILSSVLLILGIFISSNLTNMLAGFNGLEIGIGIILCLFMATVCLINGDIFGFKI
FT                   LILFSAAYLGLLYYNKYPAKVFPGDTGTLPIGAFLATVAVWRGFIPEFFIVMIPFMVDA
FT                   LLKQVTAGVTKKDSIFTPTELKNGKLHVEGGYLSLPRMILMKKPMEEYKIVLVLWVIEA
FT                   FFGILSIIYTKYMGFNIF"
FT   gene            complement(133747..135075)
FT                   /locus_tag="MmarC5_0156"
FT   CDS_pept        complement(133747..135075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0156"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: mmp:MMP1422 aldehyde dehydrogenase:SecY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34473"
FT                   /db_xref="GOA:A4FVU0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVU0"
FT                   /protein_id="ABO34473.1"
FT                   /translation="MESFLLKIKPILELIPEVKRPLKEISFKEKIQWTGLVLILYFILG
FT                   TIDIYTGGSEMPAIFDFWQTVTASKMGTLITLGIGPIVTAGIIMQLLVGSEIISLDLSK
FT                   PMNRALFQGLQKLFGIGLCFLEALMFVGAGAFGTLTPLLMVVLVLQLALGAILIIYLDE
FT                   IVSRYGIGSGIGLFIAAGVSQTIFVGTFGAEGYLWKFFSAMTVGSLWTALEYILPILGT
FT                   ILVFLVVVYVESIRVEIPLAHGRVKGAVGKYPIKFIYVSNLPVILAAALFANIQLWGMF
FT                   LEKMGFPILGHYTSGRAVDGLAYYFSTPYGISSLIADPIHAVFYTIMMTIFCILFGLFW
FT                   VETSGLDAKSMAKKLGNLDMAIKGFRKSQKSIEQRLKRYITPITVMGSAFVGFLAAAAD
FT                   FTGALGGGTGVLLTVSIVYRLYEQLVQEQLSELHPSIAKFIRK"
FT   gene            complement(135303..135734)
FT                   /locus_tag="MmarC5_0157"
FT   CDS_pept        complement(135303..135734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0157"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15; KEGG: mmp:MMP1421 LSU
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34474"
FT                   /db_xref="GOA:A4FVT7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR027386"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FVT7"
FT                   /protein_id="ABO34474.1"
FT                   /translation="MIRKSKKITKMRGSRTCGYGEAKKHRGAGHRGGRGNAGHQKHKWL
FT                   SVCKFNPDYFGKYGFNRNPCLIKQLETINIGELEEYILKYKDAFQVEDGKVVVDATTIG
FT                   YEKVLGKGRISTAMVVKAVEFSEGAKEKIEAAGGEFVEL"
FT   gene            complement(135749..136213)
FT                   /locus_tag="MmarC5_0158"
FT   CDS_pept        complement(135749..136213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0158"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="TIGRFAM: ribosomal protein L30P; PFAM: ribosomal
FT                   protein L30; KEGG: mmp:MMP1420 LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34475"
FT                   /db_xref="GOA:A4FVT8"
FT                   /db_xref="InterPro:IPR005997"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FVT8"
FT                   /protein_id="ABO34475.1"
FT                   /translation="MAYAVVRVRGSVGVRGNIADTMKMLRLHRVNHCVVIPDNEHYTGM
FT                   IKKVKDYVTYGEIDKDTLVALILKRGRLPGNKRLTEELVKELTELPVEELAEKIIAGEI
FT                   KIKDTPIKPVFRLHPPRKGYDRAGVKKGFSIGGALGYRSGKINDLLNKMM"
FT   gene            complement(136245..136934)
FT                   /locus_tag="MmarC5_0159"
FT   CDS_pept        complement(136245..136934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0159"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like; KEGG:
FT                   mmp:MMP1419 SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34476"
FT                   /db_xref="GOA:A4FWA1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWA1"
FT                   /protein_id="ABO34476.1"
FT                   /translation="MAEKKADKRAEKRKFNTEAWEPKTQIGRMVKEGTISDISYIMDKG
FT                   LPLLEPEIVDALLPDLEEQVLDVKLVQRMHKSGRRARYRATVAVGNKNGYVGVGMGKSK
FT                   EVGPAIRKAIAHAKLSLIKVRVGCGSWECGCGSPHSIPFAAKGACGSVKVELLPAPRGV
FT                   GLVAGNVAKAVLGLAGVKDAWTKTFGDTRTTFNFAEATFDALNNLNFVRCLPNQKEKLG
FT                   LTEGRVL"
FT   gene            complement(136945..137526)
FT                   /locus_tag="MmarC5_0160"
FT   CDS_pept        complement(136945..137526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0160"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="PFAM: ribosomal protein L18P/L5E; KEGG: mmp:MMP1418
FT                   LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34477"
FT                   /db_xref="GOA:A4FWA2"
FT                   /db_xref="InterPro:IPR005485"
FT                   /db_xref="InterPro:IPR025607"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWA2"
FT                   /protein_id="ABO34477.1"
FT                   /translation="MAKNAKFRVPFRRRREGKTDFRQRLGLLLSGKPRLVARKSLNNVT
FT                   AQLMSYDEKGDVVLVSAHTKELVKMGYKGHCGNLPAAYLTGLLLGKKAVKEGAEEAILD
FT                   KGLHRATKGAAIFAVLKGALDAGMDIPHGDEIIAEEERLNGTHVKNYAESLKEDADAYK
FT                   KQFSKYLEKGLNPEDLPEHVAELKEKILNL"
FT   gene            complement(137550..137999)
FT                   /locus_tag="MmarC5_0161"
FT   CDS_pept        complement(137550..137999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0161"
FT                   /product="LSU ribosomal protein L19E"
FT                   /note="PFAM: Ribosomal protein L19e; KEGG: mmp:MMP1417 LSU
FT                   ribosomal protein L19E"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34478"
FT                   /db_xref="GOA:A4FWA3"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR023638"
FT                   /db_xref="InterPro:IPR033936"
FT                   /db_xref="InterPro:IPR035970"
FT                   /db_xref="InterPro:IPR039547"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWA3"
FT                   /protein_id="ABO34478.1"
FT                   /translation="MDVSTQRRIAAAVLDCGIDRVWIDPENLERVKMAITKDDIRLLIN
FT                   DGIIVKKQEKGISSARKKQVQEQKRKGKRKGQGSRKGAKGARTPKKEKWMNTIRPLRKM
FT                   LKDLRENEKIERSAYRKLYRMAKGGAFRSRNHMKLYMKEHGILAE"
FT   gene            complement(138026..138433)
FT                   /locus_tag="MmarC5_0162"
FT   CDS_pept        complement(138026..138433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0162"
FT                   /product="LSU ribosomal protein L32E"
FT                   /note="PFAM: Ribosomal protein L32e; KEGG: mmp:MMP1416 LSU
FT                   ribosomal protein L32E"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34479"
FT                   /db_xref="GOA:A4FWA4"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="InterPro:IPR018263"
FT                   /db_xref="InterPro:IPR023654"
FT                   /db_xref="InterPro:IPR036351"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWA4"
FT                   /protein_id="ABO34479.1"
FT                   /translation="MSEFKRLMRLKLKMKQKRPEFKRQDWFKCSRIGTSWRRPFGKHSG
FT                   MRIGLTHRAAVATVGYRGPALVRGLHPSGLQDILVNNVKELVALNPEIQGARIAATVGK
FT                   RKRIEIVKKANELGIRVFNVSKQKQDEFLSL"
FT   gene            complement(138443..138991)
FT                   /locus_tag="MmarC5_0163"
FT   CDS_pept        complement(138443..138991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0163"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: mmp:MMP1415 LSU
FT                   ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34480"
FT                   /db_xref="GOA:A4FWA5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002359"
FT                   /db_xref="InterPro:IPR019907"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWA5"
FT                   /protein_id="ABO34480.1"
FT                   /translation="MPVAALIREEIEIPENVNVEINGNTVAVKSGAKELRRDLMYPGIE
FT                   ISTEDGKVVIECTFPRKVQTAIVGTYRSHIQNMITGVTDGFEYKLVIRYAHFPMKVSAK
FT                   GNTVTIDNFLGEKYTRTAKIMDGVTVKVSGEEVIVSGANKEFVGQTAANIEQATKVKGR
FT                   DTRIFQDGIYIVEKAGKVL"
FT   gene            complement(139013..139405)
FT                   /locus_tag="MmarC5_0164"
FT   CDS_pept        complement(139013..139405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0164"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: mmp:MMP1414 SSU
FT                   ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34481"
FT                   /db_xref="GOA:A4FWA6"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWA6"
FT                   /protein_id="ABO34481.1"
FT                   /translation="MSLMDPLANALNHVSNCESVGKNVAYLKPASKLIGRVLNVMQDQG
FT                   YIGNFEYIEDGKAGVYKVDLIGQINKCGAVKPRYAVKNHDFEKFEKRYLPAKGFGLLIV
FT                   STPKGLMTHDEARNAGVGGRLISYIY"
FT   gene            complement(139424..139585)
FT                   /locus_tag="MmarC5_0165"
FT   CDS_pept        complement(139424..139585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0165"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: mmp:MMP1413 SSU
FT                   ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34482"
FT                   /db_xref="GOA:A4FWA7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023676"
FT                   /db_xref="InterPro:IPR039744"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWA7"
FT                   /protein_id="ABO34482.1"
FT                   /translation="MTKAPFKTKFGQGSKVCKRCGRKGPGIIRKYGLNLCRQCFRELAP
FT                   KLGFKKYD"
FT   gene            complement(139595..140140)
FT                   /locus_tag="MmarC5_0166"
FT   CDS_pept        complement(139595..140140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0166"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: mmp:MMP1412 LSU
FT                   ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34483"
FT                   /db_xref="GOA:A4FWA8"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR022804"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWA8"
FT                   /protein_id="ABO34483.1"
FT                   /translation="MSFQEVWEKEPMKKPRIQKITVNFGVGEAGDRLTIGAKVIEELTG
FT                   QSPVRTLAKQTNPAYGIRKKLPIGLKVTLRGKNAEEFLKNAFTAFKACGKVLYASSFDQ
FT                   VGNFSFGVPEHIDFPGQKYDPSVGIYGMDVCVTFDKAGYRVKSRKLKRSHIPKKHLVTK
FT                   DEAIEYIQTKFDTEVVRE"
FT   gene            complement(140169..140903)
FT                   /locus_tag="MmarC5_0167"
FT   CDS_pept        complement(140169..140903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0167"
FT                   /product="SSU ribosomal protein S4E"
FT                   /note="PFAM: RNA-binding S4 domain protein; Ribosomal
FT                   protein S4E-like; Ribosomal protein S4E, central; KEGG:
FT                   mmp:MMP1411 SSU ribosomal protein S4E"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34484"
FT                   /db_xref="GOA:A4FWA9"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWA9"
FT                   /protein_id="ABO34484.1"
FT                   /translation="MAIKGPRKHLKRLAAPANWQLPRKVKAFTVRPSPGPHSMDKSLPL
FT                   LLVVRDVLKYADNAREAKKIIQTGKILIDGLKRKEYKHPAGLMDVLSIPEMDENYLVLF
FT                   DESGRISLKKTDKADAKLCKIVNKTVIKGGHIQLNLHDGRNQIVKVSDATKAEEDVYKT
FT                   GDSVLVSIPEQSIVGHVAFGEGKLAYVTGGKHVGEFAKIVEVENRALYSDIVTLENKDG
FT                   EKFKTVKPYVFIVGQDEPVISM"
FT   gene            complement(140915..141274)
FT                   /locus_tag="MmarC5_0168"
FT   CDS_pept        complement(140915..141274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0168"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="KEGG: mmp:MMP1410 LSU ribosomal protein L24P;
FT                   TIGRFAM: ribosomal protein L24; PFAM: KOW domain protein;
FT                   SMART: KOW (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34485"
FT                   /db_xref="GOA:A4FWB0"
FT                   /db_xref="InterPro:IPR005756"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWB0"
FT                   /protein_id="ABO34485.1"
FT                   /translation="MVLTNSKQPRKQRKALYNAPLHLRNSVMAAMLSKELKEKFNKNSL
FT                   PVKKGDTVKVLRGNFKGIEGEVSKVDYAGYKIIVEGVVNKKQDGTETAYPIHPSNVMIT
FT                   KLDESDEKRFKNSSN"
FT   gene            complement(141294..141692)
FT                   /locus_tag="MmarC5_0169"
FT   CDS_pept        complement(141294..141692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0169"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="PFAM: ribosomal protein L14b/L23e; KEGG: mmp:MMP1409
FT                   LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34486"
FT                   /db_xref="GOA:A4FWB1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019971"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWB1"
FT                   /protein_id="ABO34486.1"
FT                   /translation="MKGLGSTIVRSLPNGARLVCADNTGAKELEVIAVKNYVGTVRRLP
FT                   AGGVGHMVFVSVKKGTPEMRKQVLPAIIIRQKKEYKRADGTRVKFEDNAAVIVTPEGTP
FT                   KGSEIKGPVSKEAAERWPGVSRLAKIIH"
FT   gene            complement(141713..142042)
FT                   /locus_tag="MmarC5_0170"
FT   CDS_pept        complement(141713..142042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0170"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: mmp:MMP1408 SSU
FT                   ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34487"
FT                   /db_xref="GOA:A4FWB2"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019978"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR028333"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWB2"
FT                   /protein_id="ABO34487.1"
FT                   /translation="MSNIGIDVKAPEHVCEDPNCPFHGTLSVRGQIFEGTVTSDKGHDT
FT                   IVLKREVTGYISKYERYEKRTTSLVAHNPACIKAKVGDTVKVMECRPISKTKSFVVIEK
FT                   TENLE"
FT   gene            complement(142207..142506)
FT                   /locus_tag="MmarC5_0171"
FT   CDS_pept        complement(142207..142506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0171"
FT                   /product="ribonuclease P protein subunit Rpp29"
FT                   /EC_number="3.1.26.5"
FT                   /note="PFAM: Ribonuclease P, Rpp29; KEGG: mmp:MMP1407
FT                   protein of unknown function UPF0086"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34488"
FT                   /db_xref="GOA:A4FWB3"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR023538"
FT                   /db_xref="InterPro:IPR036980"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWB3"
FT                   /protein_id="ABO34488.1"
FT                   /translation="MKLSQNILRHELIGLDLEVVKSTDSGLISTKGRVINETRNTLVLE
FT                   KENGKEITVVKEISTFRIDFKNSGDVVKVDIDGRLLVGRPEDRLKRKIKQLYSY"
FT   gene            complement(142574..142882)
FT                   /locus_tag="MmarC5_0172"
FT   CDS_pept        complement(142574..142882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0172"
FT                   /product="translation initiation factor 1 (eIF-1/SUI1)"
FT                   /note="PFAM: translation initiation factor SUI1; KEGG:
FT                   mmp:MMP1406 protein translation factor SUI1 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34489"
FT                   /db_xref="GOA:A4FWB4"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR022851"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWB4"
FT                   /protein_id="ABO34489.1"
FT                   /translation="MPEICPICGLPKDLCVCEEIAKEEQKIKVYVTKRRFGKLMTVVDG
FT                   FDADLIDVKDLAKKLKDICACGGTVKKDSIELQGDHRRKAEETLIKMGFSKDMIDVR"
FT   gene            complement(142966..143181)
FT                   /locus_tag="MmarC5_0173"
FT   CDS_pept        complement(142966..143181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0173"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: mmp:MMP1405 LSU
FT                   ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34490"
FT                   /db_xref="GOA:A4FWB5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWB5"
FT                   /protein_id="ABO34490.1"
FT                   /translation="MAILKASEIRELSAEEMKGKIAELKRELMKEGVNKSTGGAPSNPG
FT                   KISEIKRTIARILTIMNEKEAQAKNA"
FT   gene            complement(143192..143827)
FT                   /locus_tag="MmarC5_0174"
FT   CDS_pept        complement(143192..143827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0174"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: mmp:MMP1404 SSU ribosomal protein S3P;
FT                   TIGRFAM: ribosomal protein S3; PFAM: ribosomal protein
FT                   S3-C-terminal domain protein; KH, type 2 domain protein;
FT                   SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34491"
FT                   /db_xref="GOA:A4FWB6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR027488"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWB6"
FT                   /protein_id="ABO34491.1"
FT                   /translation="MIERTFVGENVSETLIDEYFKTKLVRAGYSHIDLKKTPIGTRITV
FT                   FAEKPGFVIGRKGKMVKELTETLAKEYAVKNPQIEVKQVENPDLDPAIVGHKIASSLER
FT                   GMHFRRTAHSAIRRVMGSGAKGVSIIVSGKLSGERSRTEKFMDGYMKHCGEPAEALVNK
FT                   SHQLAKLKLGVVGVTVKIMKPDVTLPDEITILSGEIKEVTEYSEASQE"
FT   gene            complement(143838..144299)
FT                   /locus_tag="MmarC5_0175"
FT   CDS_pept        complement(143838..144299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0175"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: mmp:MMP1403 LSU ribosomal protein
FT                   L22P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34492"
FT                   /db_xref="GOA:A4FWB7"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWB7"
FT                   /protein_id="ABO34492.1"
FT                   /translation="MAKLKYKVEADPKNTARAMGRTLRISRKHAIELCRELSGMKLDAA
FT                   VAYLNRVIALETPVPFKVHNKDLPHRKGKIGTHSGRFPQKASLEILQVLDNAKKNAEQK
FT                   GLNTEKLRIKHISSNRGFTIKRYMPRAFGRASPKNQETIHIQVILEEFY"
FT   gene            complement(144319..144528)
FT                   /locus_tag="MmarC5_0176"
FT   CDS_pept        complement(144319..144528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34493"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWB8"
FT                   /protein_id="ABO34493.1"
FT                   /translation="MINYINKFKQIKKAIDYMDDRGYSINVTHENNPVIEIGNKKTNLI
FT                   IKNMIGNVKVHYINTAKLLLKMRD"
FT   gene            complement(144620..144889)
FT                   /locus_tag="MmarC5_0177"
FT   CDS_pept        complement(144620..144889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0177"
FT                   /product="translation elongation factor 1B (aEF-1B)"
FT                   /note="TIGRFAM: translation elongation factor aEF-1 beta;
FT                   PFAM: Elongation factor 1, beta/beta'/delta chain; KEGG:
FT                   mmp:MMP1401 translation elongation factor aEF-1 beta"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34494"
FT                   /db_xref="GOA:A4FWB9"
FT                   /db_xref="InterPro:IPR004542"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWB9"
FT                   /protein_id="ABO34494.1"
FT                   /translation="MATVIAKVKVMPTSPEVEKEALKETLKELVENNDAKCRGVSDEPL
FT                   AFGLYTVFVMVEMEEKEGGMDPIEEAMNALENVESAEVVELSLV"
FT   gene            complement(144922..145086)
FT                   /locus_tag="MmarC5_0178"
FT   CDS_pept        complement(144922..145086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0178"
FT                   /product="Protein of unknown function DUF1610"
FT                   /note="PFAM: Protein of unknown function DUF1610; KEGG:
FT                   mmp:MMP1400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34495"
FT                   /db_xref="InterPro:IPR011668"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWC0"
FT                   /protein_id="ABO34495.1"
FT                   /translation="MKQKCTSCNAEIAPRENATKFLCPNCGKAELVRCEKCRKLSNTYN
FT                   CPVCGYEGP"
FT   gene            complement(145104..145742)
FT                   /locus_tag="MmarC5_0179"
FT   CDS_pept        complement(145104..145742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0179"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   mmp:MMP1399 aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34496"
FT                   /db_xref="GOA:A4FWC1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011375"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWC1"
FT                   /protein_id="ABO34496.1"
FT                   /translation="MVIVYVLKIGGSLTNNAEKLLQSLEKSGEKIVIIPGGGNFANNVR
FT                   TLHENGKITDISAHKLATLCTDITGTYFSEISGIKTADNLFDAKKILQNESIVIILPSK
FT                   IILSTDELPCSWEVTSDSFAGYITKLLKSKTLIIATDVDGIYDKYPEGKLLNTINTKTI
FT                   KGFTSVDKHLPKLISEYGIECFVVNGNHPERINNIFKGVFDTYTKITLK"
FT   gene            complement(145743..146990)
FT                   /locus_tag="MmarC5_0180"
FT   CDS_pept        complement(145743..146990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0180"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein; KEGG:
FT                   mmp:MMP1398 succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34497"
FT                   /db_xref="GOA:A4FWC2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWC2"
FT                   /protein_id="ABO34497.1"
FT                   /translation="MKSILDETIEISSDLIAINSVNPTFGGVGEKEKSIYIKNKLKEYH
FT                   EKYSIKNCKISEYNTIDSNGIERPNIVSKYDFGKDTSLTIISHMDIVPEGDFGLWNSDP
FT                   FKAEIKDGIIYGRGSEDNHKGIVSSFLLLKMIFEEKIYPKYNLNLIFVSDEEDGSEYGL
FT                   SYLVNNFKNELFDSKDLIIVPDFGMPEGEFIEIAEKNILWLNFKIKGKQCHGSTPENGF
FT                   NADVMAFSFGKGLYDTLYNKYSELDSIFNPPFSTFEPTILRNNVENTNTIPGYVELNFD
FT                   CRIIPKYDPKEVLVDIENYIEDFKNEIEKHVVHFDISEKENISIEYEILKLEKTEKTKT
FT                   DSEVVEKLGSAIKNVLNKEPVLCGMGGGTVAAFLREKKYNVAVWGIGYETAHQPNEHIK
FT                   IEHLIQMAEIYLDILK"
FT   gene            complement(147020..150589)
FT                   /locus_tag="MmarC5_0181"
FT   CDS_pept        complement(147020..150589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0181"
FT                   /product="condensin subunit Smc"
FT                   /note="TIGRFAM: chromosome segregation protein SMC; PFAM:
FT                   SMC domain protein; SMCs flexible hinge domain protein;
FT                   KEGG: mmp:MMP1397 structural maintenance of chromosome
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34498"
FT                   /db_xref="GOA:A4FWC3"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWC3"
FT                   /protein_id="ABO34498.1"
FT                   /translation="MASLSEIHMKNFKSFKNSKLKIPDGFTAILGPNGSGKSNTIDGIC
FT                   FVLGKTSAKSLRAGKFNQLITYHNGKRENFAEVTLFFDNKDRKMPVESDKVGISRKVKL
FT                   NGDNNYYIIWDEEKEVKENGEIKKVMEEKRKKVKKSEILDVIGKISLSADGFNIILQGD
FT                   LIKIIDTTPNERRKIIDEISGVAEFDEKGEKAEKELGKAREFIEKIDIRINEVKNNLEK
FT                   LRKEKEDAEIYVKLSEELKATKYILTSKKIDFLNGVLEKTKEEIEALKEMKVCFLKEIS
FT                   EYDVKSNDIRNRLQNLINELNEKGNEEIMELHKSIKEMEVTVDNDKKSLNGALDDLKNV
FT                   NSQSEKKGQDLVETRQKIETIRTETLEKEAEIKTLKTEMENLETEKKKLKSKVEESETQ
FT                   TEILKQQERKLSEKLNESQNEHYNLKNEFNALENEINKKSFNLTKNKETIETLQKELDD
FT                   IKSEGEDTKALYKELEDVAVELEYSKKKVITLLEDKKEYQEKLDNSHADYIKENAKIKA
FT                   MKDMEDFSIDRAVKSVLEAKLPGVVDIAGNLGKTDAEYKTAIENAGGNRLNYIVVKRMD
FT                   DGARAIHYLKKNNLGRTTFLPLDRINGPEALYLDDEGVVGRAIDLVEYKPEYEDLFRYV
FT                   FGNTIIVENLDYAKILSKDHRARFVTLEGEVIEPSGAMIGGRSRKKSVIKVDIDTSRIE
FT                   KLAEQISELDSTLTETKDEIERLQNKNATYSTRKMELESRLKIIRDTEHRKEGILTNNG
FT                   IKIKELELESKKLEEELDYLDGSKEELERKIEEYTKKINEFTAQRSRISEEITSFENSE
FT                   HSKRIKVIDETILNFEKKKNEFENEIKRDAVLIKEILIPKISELNNNIKELSEKRVILE
FT                   QNIQFYKANVEKNFEILKNKKERYEDLTKDLRELTEKKEAFEKELEMLNGEKRRVYGRI
FT                   NQNESQINSLSIDMAKYETRLEEENRKLYVCENIEHISEDITSKIKEFDVDALESHQID
FT                   LEGHIKKLEPINMRAIEDYQFIVDRYDELFEKRTDYENEEKKYLQLIEEVSKRKKEVFM
FT                   DTYVKVAENYEKIYTEIGGSGKLSLENSDDPFSGGLLIDASPMNKKLQSLDVMSGGEKS
FT                   LTALAFLFAIQHLNPAPFYVLDEVDAALDTKNAGLIGEMIKNASKNSQFIVISHREQMI
FT                   SKSDVMYGVCMENGLSKLVGLKI"
FT   gene            150976..152280
FT                   /locus_tag="MmarC5_0182"
FT   CDS_pept        150976..152280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0182"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mmp:MMP1396 aminotransferase (subgroup I)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34499"
FT                   /db_xref="GOA:A4FWC4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWC4"
FT                   /protein_id="ABO34499.1"
FT                   /translation="MRTDIVNSGVGELSYEIREIVKVANEAKKSGLDIVWENIGDPIAK
FT                   GEKLPLWIKEIVSETTMDDSSYGYCPTRGLLETREFLCDLNNNRNGAQITPDEIVFFNG
FT                   LGDAITNIYGLMRKECRVIGPTPAYSTHSSAEGLYSNCSPVMYELDRDDGWNPDIDDLR
FT                   NKVKYNPSIASILLINPGNPTGAVYSKKVLSDVVDIANEYDLFILADEIYSNLVYNGKK
FT                   HNYLSEVLDDVPGISLKGISKDLPWPGSRCGWTEFYNTQSDELFKKYTENICKFKMIEV
FT                   CSTTLPQKVIPKIMSDKRYKSYLEERKSYYEKASNYAHNKMKNIEGLNVNRTDGAFYNT
FT                   IVLEKEYLNENQSLKIQDSRLKTYVDSISKGIPEDKRFVYYLLASTGICGVPLTSFCSE
FT                   HNGMRFTLLERDEEKRNWVFETIAEKVEEYINSSN"
FT   gene            152443..154692
FT                   /locus_tag="MmarC5_0183"
FT   CDS_pept        152443..154692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0183"
FT                   /product="ERCC4 domain protein"
FT                   /note="PFAM: helix-hairpin-helix motif; helicase domain
FT                   protein; ERCC4 domain protein; type III restriction enzyme,
FT                   res subunit; DEAD/DEAH box helicase domain protein; SMART:
FT                   Helix-hairpin-helix DNA-binding, class 1; DEAD-like
FT                   helicases-like; KEGG: mmp:MMP1395 helix-hairpin-helix
FT                   motif:DEAD/DEAH box helicase:helicase,
FT                   C-terminal:helix-hairpin-helix DNA-binding, class 1:ERCC4
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34500"
FT                   /db_xref="GOA:A4FWC5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039686"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="InterPro:IPR041755"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWC5"
FT                   /protein_id="ABO34500.1"
FT                   /translation="MHVNHPLIKPESIEARIYQQLVVASALKQNTLCVLGTGLGKTAIA
FT                   ALTIAGILSKQDGKVLIIAPSRPLVDQHFKSMNQFLNIDSEKIVILNGKISPKKRETMW
FT                   ESGKIFIATPQVAENDIISKILKPSQFSLLIADEAHHTTGNHSYTFVANKFKKKSHVLG
FT                   LTASPGSNIERIIEICGNLGIEHVEIKTEEDPDVSPYVAKVKMRPRRVELPEEFGVNLT
FT                   LLKNALKDRLRDLKENRVIHTINVNKSELLGLNKRIMSMDDNIKYEMLRISSEAVKLEH
FT                   AIEMLETQGRSTFLNYYQKLLTQNTKSAKEITNDPRFIQVVKNLNELDIEHPKYEKMLE
FT                   IVSEILKENEKIIIFAQYRDTVQKIVDLLSENEIEAIMFVGQSNKDGKGMSQKEQAKAI
FT                   EKFKNEANVLVSTSVSEEGIDISSVNYVLFYEPVPSEIRMIQRRGRAARGEGGQVIVLI
FT                   AEKTRDEGYYRAGLAKEKNMKNILKNMQTSLNKKLKELHEEKVEKTENKDHYLDLRSVV
FT                   NSKTSAKSEEKKPTKLDKKSRNGLPNKATIIVDSRERHIGRYLSERAEVEFKTLEIGDY
FT                   ILSDRVVVERKTAEDFENSIIDKRLFNQIMDLKKYERPLMIIEGNEFVRIHENAIRGMM
FT                   FSIMIDYQIPIMFSRDIEDTADILVKLAEREQIKEKREISIRYGKRPMSLKERQKFLVE
FT                   GLPDVGPVMAENLLDNFNSVENIFTATEEELKAVEGMGPVTAKKIKEVVTKNYRE"
FT   gene            154701..155357
FT                   /locus_tag="MmarC5_0184"
FT   CDS_pept        154701..155357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0184"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: mmp:MMP1394 3-dehydroquinate dehydratase (type
FT                   I DHQase); TIGRFAM: 3-dehydroquinate dehydratase, type I;
FT                   PFAM: dehydroquinase class I"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34501"
FT                   /db_xref="GOA:A4FWC6"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018508"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWC6"
FT                   /protein_id="ABO34501.1"
FT                   /translation="MICIPVIDEDMSDAINSAKEALKYGDIVEFRVDLLNNVTFEDITE
FT                   FSKIPSIITIRAEWEGGAWKKSNEERIELLKHAIKNNAKFVDIELKEEKNLELVKYRNE
FT                   IRSNTKIIVSYHDFEKTPEIDELIDVVEKELKIGDIAKFATFANSKEDTLKILNLMNKY
FT                   YGKIIAIGMGESGKLTRILGLDFGSILTFASMEGKASAPGQVDVKKLKEILELIE"
FT   gene            complement(155360..155776)
FT                   /locus_tag="MmarC5_0185"
FT   CDS_pept        complement(155360..155776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0185"
FT                   /product="Protein of unknown function DUF371"
FT                   /note="PFAM: Protein of unknown function DUF371; KEGG:
FT                   mmp:MMP1393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34502"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWC7"
FT                   /protein_id="ABO34502.1"
FT                   /translation="MAFEFTIYAKGHENIRANHKSTLEITKENHVTCTGDCIVGISADK
FT                   SILDFSESFKENLRNSDKITVEIEVEGLKEIITGKGNSKLTFTHETDIVIRTSDFSCGR
FT                   TLMVNSDKASKDINREIVEKLKKGADLKFKIIVE"
FT   gene            155915..157357
FT                   /locus_tag="MmarC5_0186"
FT   CDS_pept        155915..157357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0186"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   mmp:MMP1392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34503"
FT                   /db_xref="GOA:A4FWC8"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWC8"
FT                   /protein_id="ABO34503.1"
FT                   /translation="MKSTVTKIAEKTYQLPVSYKDCMRVPGNVYLDEVLFEHLEPDVFE
FT                   QIANVACLPGIQKYSLAMPDCHYGYGFCIGGVAAFDEVTGVISPGGVGFDINCGVRLVK
FT                   TNLTRNDVTPKLKELLSEIFKNVPSGLGSKGKIRVTKDEIDNVLEEGVSWAVEEGYGWE
FT                   NDIKHIEEHGKMKEADPTLVSDNAKKRGLPQLGSLGSGNHFLEVQYVDEIFDEEAAKTF
FT                   GVSPDQVVLMIHTGSRGLGHQICADYLRYMENAAKKYNIKLPDRQLACAPINSEEGQKY
FT                   FKAMSCGANYAWANRQLITHWIRESFETVFKTSAEDLEMDIIYDVAHNIAKKEQHLVDG
FT                   VLKNVIVHRKGATRAFGPGHAEIPADYANIGQPVIIPGDMGTASYLMHGTEKAMEETFG
FT                   STAHGAGRALSRVKALKLYRGNEVQEALQKRGILVMADSKGVIAEECPEAYKDIENVAE
FT                   ICHDSGISLKVAKMKPMGVVKG"
FT   gene            157435..158481
FT                   /locus_tag="MmarC5_0187"
FT   CDS_pept        157435..158481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0187"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase, NAD - binding; Semialdehyde
FT                   dehydrogenase, dimerisation region; KEGG: mmp:MMP1391
FT                   aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34504"
FT                   /db_xref="GOA:A4FWC9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWC9"
FT                   /protein_id="ABO34504.1"
FT                   /translation="MKIKVGILGATGNVGQRFIQMLENHPVFELEALGASQRSAGKTYE
FT                   DACYWYQTEAIPEEVASATVVSTDPNDKAYDDIDIVFSALPADLAKTLEPEFAKRGKYV
FT                   FSNASAMRMEADVPLIIPEVNHEHFGMLEVQKSNRCSDGAIITNPNCSTIGAVISLKPI
FT                   MDKFGIDLVNITTMQAISGAGYSGVPSMAILDNLVPYIGGEEEKMQTEALKILGSIEGN
FT                   DFKNGNFKIGVSCNRVPVIDGHTESIFVKTTEEATPEEIAKVMDDFDPLKGLNLSSYAK
FT                   PIVLREENDRPQPRLDRNTGNGMSIVVGRVRKDPIFNVKYTALEHNTIRGAAGASVLNA
FT                   ELFVQKYL"
FT   gene            158582..158752
FT                   /locus_tag="MmarC5_0188"
FT   CDS_pept        158582..158752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34505"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWD0"
FT                   /protein_id="ABO34505.1"
FT                   /translation="MLQWNLQCPKCNKRLTYRVDVCICKAAEVEIPNCEFCGTKMEIDV
FT                   SGLKGRRRVKK"
FT   gene            158854..160001
FT                   /pseudo
FT                   /locus_tag="MmarC5_0189"
FT   gene            160055..160300
FT                   /locus_tag="MmarC5_0190"
FT   CDS_pept        160055..160300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0190"
FT                   /product="redox-active disulfide protein 2"
FT                   /note="TIGRFAM: redox-active disulfide protein 2; KEGG:
FT                   mmp:MMP1388 redox-active disulfide protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34506"
FT                   /db_xref="GOA:A4FWD1"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWD1"
FT                   /protein_id="ABO34506.1"
FT                   /translation="MKIRVFGMGCSKCNETYENVKKAVEESKIDAEIVKITDIKKISEW
FT                   VLMAPAVAFDEDIIFEGTMPSVNDLKKELEDYLKSN"
FT   gene            complement(160335..161189)
FT                   /locus_tag="MmarC5_0191"
FT   CDS_pept        complement(160335..161189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0191"
FT                   /product="protein of unknown function DUF52"
FT                   /note="PFAM: protein of unknown function DUF52; KEGG:
FT                   mmp:MMP1387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34507"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWD2"
FT                   /protein_id="ABO34507.1"
FT                   /translation="MKRNPVVAGMFYPAEYHELLEMIEYCYLSPRGPKELPSKRGNYTK
FT                   PLGIVSPHAGYIYSGPVAAHGYKKISENINGEVTAIILGPNHTGLGSGISTMKGIWKTP
FT                   FGDMEIDNEFADRLWKECDVLDLDENSHLREHSIEVQLPFLKHLEDLNIAKFKFVPICM
FT                   MMQDYETSMDVGYFIAKVAKEMNRKIIIIASTDFSHYESQESASKKDALVIKDILELKD
FT                   EEIFTDVVTHNISMCGYGPVIAMIKAMKDLGAKNSNLLYYSTSGDVTKDYSEVVGYASI
FT                   LVK"
FT   gene            complement(161240..162247)
FT                   /locus_tag="MmarC5_0192"
FT   CDS_pept        complement(161240..162247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0192"
FT                   /product="conserved hypothetical protein 341"
FT                   /note="PFAM: conserved hypothetical protein 341; KEGG:
FT                   mmp:MMP1386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34508"
FT                   /db_xref="GOA:A4FWD3"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWD3"
FT                   /protein_id="ABO34508.1"
FT                   /translation="MNVRLIECYVPKKIYAGYEESLEDNIENIIWHSVCEESNYTVIRL
FT                   LTETEHVEKVIDVLSSKYGGSNFRILVTEPTATVPEIKKEEKEEVEDKAPKRVSRHEII
FT                   GKIGDVSNLSKEYYSLLFLAAVVASIGIWLDDVALIIGSMIIAPFLSPMISFTFSVAVM
FT                   DLAFAKKSLKNLLLGILTVLIFSFVIGTFLQVSPESPQIASRMNLGLQNIAIALSAGFV
FT                   GTLSMLIPEISSTVVGVMIAVALMPPLVAFGLMLGSGYYVESIPILILFIVNIISVNFA
FT                   SAFLFYLYGITPYKWWEIEKARKLAIFSIIFWFLNLVILAGIILIFGNGYFKII"
FT   gene            complement(162351..163199)
FT                   /locus_tag="MmarC5_0193"
FT   CDS_pept        complement(162351..163199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0193"
FT                   /product="coenzyme F420-reducing hydrogenase, beta subunit"
FT                   /EC_number="1.12.98.1"
FT                   /note="PFAM: coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; KEGG: mmp:MMP1385 coenzyme
FT                   F420-reducing hydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34509"
FT                   /db_xref="GOA:A4FWD4"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017679"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWD4"
FT                   /protein_id="ABO34509.1"
FT                   /translation="MDPFGTYIKAVSARAADKEILKKAQDGGIVSAAYIYGLESGLLDG
FT                   VIIADKEDGFAAVPKVATTREEILSAAGTKYTVCSNLSVVKSAVREYGCDKLGFVGTPC
FT                   QVRSIRKAIKYPVGYRHVPDKIALIMGIFCMENFPYNGMKAIVEEHCGIKMDDVVKTDI
FT                   GKGKFWVYSKWGDVKTVPLKDTHPYEQGSCHVCMDYTAELADISTGSVGSPDGWSTIFV
FT                   RTAKGEEYLNKMVEAGALETKEIDAVKPGLGLVEKLAISKKEKNAKEVEHRKEIGLPVP
FT                   Y"
FT   gene            complement(163233..163919)
FT                   /locus_tag="MmarC5_0194"
FT   CDS_pept        complement(163233..163919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0194"
FT                   /product="coenzyme F420-reducing hydrogenase, gamma
FT                   subunit"
FT                   /EC_number="1.12.98.1"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; NADH ubiquinone oxidoreductase, 20 kDa subunit;
FT                   KEGG: mmp:MMP1384 coenzyme F420-reducing hydrogenase
FT                   subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34510"
FT                   /db_xref="GOA:A4FWD5"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR017681"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWD5"
FT                   /protein_id="ABO34510.1"
FT                   /translation="MVKVAHVQLSSCCGCLVSLADTYEKLLDVLGAIDLVYSQTLADVR
FT                   EVPDDVDIILLEGSVCLSDHHAMEVALDSRKKAKILVALGACAATGNVTRFSKGNQPSK
FT                   PVHDAFAPLTEVVKCDLAIPGCPPSPESIVAVVLAALNGDMEYLEPYAELAKYGSEACG
FT                   CDLITKVINKSLCMGCGSCAAACPTRAVSMDAGRPLVDKEICIKCGSCSVQCPRIRFPD
FT                   LIEKIE"
FT   gene            complement(163934..164458)
FT                   /locus_tag="MmarC5_0195"
FT   CDS_pept        complement(163934..164458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0195"
FT                   /product="coenzyme F420-reducing hydrogenase, delta
FT                   subunit"
FT                   /EC_number="1.12.98.1"
FT                   /note="TIGRFAM: hydrogenase maturation protease; coenzyme
FT                   F420-reducing hydrogenase delta subunit; hydrogenase
FT                   maturation peptidase superfamily; PFAM: peptidase M52,
FT                   hydrogen uptake protein; KEGG: mmp:MMP1383 coenzyme
FT                   F420-reducing hydrogenase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34511"
FT                   /db_xref="GOA:A4FWD6"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004411"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWD6"
FT                   /protein_id="ABO34511.1"
FT                   /translation="MEYKLTPSYLLKENMVLACGNILFADDGFSVHVIEKLQELLTEEE
FT                   KENIALVDAGAGAPQQVLTLIDSEAKTKKIIVVDIIDYGLEPGEIKILTMDDLPKPEHT
FT                   KVDSHDWPLSTTMYRVFRDAPHEIDFKVVGCQKKYVSEPDVVIELSEEVQNAVDVAVDI
FT                   VLSELRGKPIN"
FT   gene            complement(164629..165801)
FT                   /locus_tag="MmarC5_0196"
FT   CDS_pept        complement(164629..165801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0196"
FT                   /product="nickel-dependent hydrogenase, large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase, large subunit;
FT                   KEGG: mmp:MMP1382 coenzyme F420-reducing hydrogenase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34512"
FT                   /db_xref="GOA:A4FWD7"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR017682"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWD7"
FT                   /protein_id="ABO34512.1"
FT                   /translation="MAEPVTISPTTRHEGHAKLVLNVDDEGIVTKAFYPNTTPVRGFET
FT                   MLQGKPAAFGPIAVMRICGICQATHGIASCEAIEHAIDMEIPKDGMILRELVGLGNRMH
FT                   SHPLHHLLIVDDLLKPEEAGTLRVEGIKLIQRMRKAGQMLVDVAGGEGIHPPNLMVGGM
FT                   RTNITERAKAKLYYACREYEKDCNAMLEVLEMLMERYLEEIGIPDLGKHDLPYIASDTT
FT                   FGNRDAINFKDITEVTAQRYYADFPDIAQTATNQIPFYRGNPAEGGPRARMIKYGNFKS
FT                   AGGAMDINLARAMENFEAVKRSLELIDELNINGTTREIPNFSNAKEEYGIGVHEAPRAI
FT                   NTHMAKMGKDGKIEKYNIIAASTWNFPAVEKAIEGYHHQYAEVIMRAYDI"
FT   gene            complement(166005..167273)
FT                   /locus_tag="MmarC5_0197"
FT   CDS_pept        complement(166005..167273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0197"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase; KEGG: mmp:MMP1381
FT                   beta-lactamase-like:ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34513"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWD8"
FT                   /protein_id="ABO34513.1"
FT                   /translation="MTIAKFHGGCHQIGKSCVEINTKKSKVLIDCGMDPSDNGLPDIND
FT                   SDVDAVLVSHAHLDHCGAIPYFNFKKIYCNPPTADLMYNVWKDTVSLSKTYREEDIKKS
FT                   MDVIKTVNYREEKQVTSDIKMKMYDAGHILGSSSLYLDIDGKKLLYTGDINEIETRTLR
FT                   AADTDFDNIDTIIIESTYGSPLDIKPARKVLEKQLIDEISETIDNGGKVIIPVFAVGRS
FT                   QEIIVVINNYMKSGALKEVPIYINGSLTHTTGMYMGYSDWLNPKIKNAIENRINPFGNL
FT                   IKGGDEVFSREPCIIISTSGMVQGGPVLQYLSLLKNPRNKIILTGYQAEGTIGRSLEEG
FT                   ATEVKPFKRAIPVNGKVVKIEFSAHADYNSLLRFMKKIPQPSKAIVMHGERYQALSLAM
FT                   TIWKTLKIPALAPSIGSVLPLFD"
FT   gene            complement(167334..168452)
FT                   /locus_tag="MmarC5_0198"
FT   CDS_pept        complement(167334..168452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0198"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: mmp:MMP1380
FT                   chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34514"
FT                   /db_xref="GOA:A4FWD9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWD9"
FT                   /protein_id="ABO34514.1"
FT                   /translation="MVYLNSNFLYGDDFEPKKGILVIEDGIIKGFTSEHHSNVLNYKGL
FT                   VIPPLINSHTHIGDNSIKDIGIGKSLDELVKPPNGIKHKFLNSCSEKELVHGMSEGLYD
FT                   LENNGIKAFCDFRENGINGINLLKSAFEDSDVSIKPIILGRPTERDENLLKHEIAIILD
FT                   NCDGLGLSGSNEYSDQELKFICKLVNKKILSIHANEHKGSVQYSKEKYGISEIERLINL
FT                   NIKPDFIIHATHSSSDDLSLLSENKIPVVVCPRANAAFNVGIPAISKMLEYDLKLGIGT
FT                   DNFMANSPSIFKEMDFIYKTYHVDPKEILKMATINGAEIIGLQNTGLIKEGYNPIFTFI
FT                   KNGNILKTSKNIVASVVTRLENGDVDSKFLVC"
FT   gene            168525..169157
FT                   /locus_tag="MmarC5_0199"
FT   CDS_pept        168525..169157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0199"
FT                   /product="Thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="PFAM: thymidylate synthase; KEGG: mmp:MMP1379
FT                   thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34515"
FT                   /db_xref="GOA:A4FWE0"
FT                   /db_xref="InterPro:IPR014620"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWE0"
FT                   /protein_id="ABO34515.1"
FT                   /translation="MLALKKKSVKAAFEALIPKIMEEGTEMVSEDGQKCKELMNTIIEI
FT                   TDPSDKSISEKYPLGERAVESYTEQLLHGSAATFVYDYHERIFEYPSDKKELKNDQIDY
FT                   IVNKLKEQINSRRAIAITWNPYIDQTVKDVPCLQIVQFLIRDNKLYQTVLFRSNDAFLA
FT                   FHANAIGLIALGEMVAEKLEIELAKYTHHSVSMHVYSERDIDALKKF"
FT   gene            complement(169180..169356)
FT                   /locus_tag="MmarC5_0200"
FT   CDS_pept        complement(169180..169356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1378 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34516"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWE1"
FT                   /protein_id="ABO34516.1"
FT                   /translation="MGVGNSLKNVWREIRGKPSVELQQIIDCFKARGSYKCIEDCMDFL
FT                   ELGKKLKQLSGNK"
FT   gene            complement(169575..170642)
FT                   /locus_tag="MmarC5_0201"
FT   CDS_pept        complement(169575..170642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34517"
FT                   /db_xref="GOA:A4FWE2"
FT                   /db_xref="InterPro:IPR007562"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWE2"
FT                   /protein_id="ABO34517.1"
FT                   /translation="MNLKLKNILYITIVGILAVSALFFVQNNSETFNLSDIFENRGFGE
FT                   TSEKLPKYIFEDSIEMYLSPNELEKVSYLAKSLNGNTIEDSIWNIILWEEDNIEYNHVK
FT                   AEFPNPEVTYWVTGKKEVSDPYNNTIQSPAETLELGSGICGDYALLTSSLLLKMDYSPI
FT                   YILTFESEGNAGHATSAVNINGNYYIIDQQPPIIELYNYLDYKKDVEDYKIDNITFYKI
FT                   ELINNSIYFEKDFESVETYDSDSNKYNDITGLSRYLMTYFENNYEIKSDYNIKYLDSME
FT                   YLPRSYEKGVTIQYFFEFGGYTPIFEKQYAKWAFDYIKNDMVKSDYNISDYNSIWIRSS
FT                   YDGEKLILIINLAKK"
FT   sig_peptide     complement(170553..170642)
FT                   /locus_tag="MmarC5_0201"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.813) with cleavage site probability 0.531 at
FT                   residue 30"
FT   gene            complement(170675..170935)
FT                   /locus_tag="MmarC5_0202"
FT   CDS_pept        complement(170675..170935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0202"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: mmp:MMP1376
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34518"
FT                   /db_xref="GOA:A4FWE3"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWE3"
FT                   /protein_id="ABO34518.1"
FT                   /translation="MKRLYRSDKERMLSGVCGGLAIYFNVDPTLIRLLWVLLFFMNPLM
FT                   IVVYIIGAIIIPIAPEGVFYDFYEEPEKLEHESEIESKPEE"
FT   gene            complement(171026..171898)
FT                   /locus_tag="MmarC5_0203"
FT   CDS_pept        complement(171026..171898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0203"
FT                   /product="tRNA (adenine-57, 58-N(1)-) methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="KEGG: mmp:MMP1375 SAM (and some other nucleotide)
FT                   binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34519"
FT                   /db_xref="GOA:A4FWE4"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWE4"
FT                   /protein_id="ABO34519.1"
FT                   /translation="MVNKKLIIDNRGKKYLLNKDLDNFGNDLGVVDLVGKEEGSILITN
FT                   KGGDFYLVTPTIHDIIKKMKRSVTTLLPKDIGLIIAECGIENGETVVEAGTGSAALTIY
FT                   LANAVGKEGKIITYEKRPEFAKIARKNLEIVGAVRKNQKIIGIDDEDEEEMEIVENGLY
FT                   NVTQKIGDITEKIEDENIDVLVLDMPDPWNVVEHAKKSLNKAKGRIAIYVPYVEQAKKG
FT                   VEALKEHGFLDIRTVECIVRDIEISEKGVRPSTRMIGHTGYITTARVCPEEVVEYVPKI
FT                   KKEKQESEE"
FT   gene            complement(171898..172617)
FT                   /locus_tag="MmarC5_0204"
FT   CDS_pept        complement(171898..172617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0204"
FT                   /product="RNase HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="KEGG: mmp:MMP1374 ribonuclease HII; TIGRFAM:
FT                   ribonuclease HII; PFAM: ribonuclease HII/HIII"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34520"
FT                   /db_xref="GOA:A4FWE5"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020787"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWE5"
FT                   /protein_id="ABO34520.1"
FT                   /translation="MNEDIKNNLNNSDESNGKIIVGLDEAGRGPVIGPMVIASVKINEK
FT                   DLPRLDDLGLRDSKQLSKKKREELYTKISEICDVKKVVINPEKIDEQMEIINLNKIELG
FT                   AFSKLANHFIKENENISIYIDACSSNEQSFSNQFKAKLINKNVEIIAEHKADENYKIVS
FT                   AASIIAKVTRDNVIEEYKKTFGEIGSGYPSDPKTKKFLKNYVHENKGLPKIARKSWATS
FT                   KNLLKEIEESKIFQWVK"
FT   gene            172735..173820
FT                   /locus_tag="MmarC5_0205"
FT   CDS_pept        172735..173820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0205"
FT                   /product="Protein of unknown function DUF1297"
FT                   /note="PFAM: Protein of unknown function DUF1297; Protein
FT                   of unknown function DUF1246; KEGG: mmp:MMP1373 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34521"
FT                   /db_xref="GOA:A4FWE6"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWE6"
FT                   /protein_id="ABO34521.1"
FT                   /translation="MIPKEEIMGIFEKYNKDEVTIVTVGSHTSLHILKGAKLEGFSTAV
FT                   ITTKDRAIPYKRFGVADKFIYVDQFSDISKEEIQQQLRDMNAIIVPHGSFIAYCGLDNV
FT                   EDSFKVPMFGNRAILRWEAERDLEGQLLGESGLRIPKKYGGPDDIDGPVMVKFPGARGG
FT                   RGYFPCSTVEEFWRKIAEFKAKGILTEDDVKKAHIEEYVVGANYCIHYFYSPLKDQVEL
FT                   MGIDRRYESSIDGLVRVPAKDQLELNVDPSYVITGNFPVVIRESLLPQVFDIGDKLSAK
FT                   SKELVKPGMLGPFCLQSLCNDNLELVVFEMSARVDGGTNTFMNGSPYSCLYTGEPLSMG
FT                   QRIAKEIKLALELGMIDKVLS"
FT   gene            complement(173888..175201)
FT                   /locus_tag="MmarC5_0206"
FT   CDS_pept        complement(173888..175201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0206"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase C
FT                   terminal; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III; KEGG: mmp:MMP1372
FT                   phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34522"
FT                   /db_xref="GOA:A4FWE7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWE7"
FT                   /protein_id="ABO34522.1"
FT                   /translation="MVFKAYDIRGIYEKELDDNFAYSLGKLVGKKYGRIMVGNDIRIGS
FT                   KKLLKPFIYGILETSKVYYAGEISTPLMYFGTLKKFDLGVILTASHNPKEYTGFKMCDI
FT                   DAIPLSPVDEIKPDFEMFELSETQKKEIKNLDLEGLKVDISSEYLKFLSEKIEKTNRKI
FT                   AVDFANGATTHAEKQVLEKILENKIFINDFPDGKFPAHEPDTLKKECLIDIITSVKNNS
FT                   CEFGLIFDGDGDRIGMVDEKGKILAGDIITAIISNEILNEVKGKIVYDLRCSKIVPEII
FT                   SKNGGTPVKTRVGHYFIKKLMHEIDAEFAGEFSNHFYFKSVGYFESPLLALNYILKALE
FT                   REGKPLSEISKNYNKYFHSGEINFKVTDQNKSIKSIEERYGNICKIEKLDGISLYCDKF
FT                   WFNVRSSNTEPLLRLNLEADDEKTMNDKLKEIKEIINS"
FT   gene            complement(175486..175794)
FT                   /locus_tag="MmarC5_0207"
FT   CDS_pept        complement(175486..175794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0207"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: mmp:MMP1371 SSU
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34523"
FT                   /db_xref="GOA:A4FWE8"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWE8"
FT                   /protein_id="ABO34523.1"
FT                   /translation="MQKARIKLSSTQHTELDGVCNQIKAIAEKTGVDMAGPIPLPTKAL
FT                   KVTTRKSTDGEGSSSFDRWTMRVHKRVIDIEADERTMKHIMKVRIPDTVQIEIELRN"
FT   gene            complement(175844..177130)
FT                   /locus_tag="MmarC5_0208"
FT   CDS_pept        complement(175844..177130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0208"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="KEGG: mmp:MMP1370 translation elongation factor
FT                   EF-1, subunit alpha; TIGRFAM: translation elongation factor
FT                   EF-1, subunit alpha; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34524"
FT                   /db_xref="GOA:A4FWE9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWE9"
FT                   /protein_id="ABO34524.1"
FT                   /translation="MAKEKPILNVAFIGHVDAGKSTTVGRLLLDGGAIDPQLIVRLKKE
FT                   AEEKGKAGFEFAYVMDGLKEERERGVTIDVAHKKFPTAKYEVTIVDCPGHRDFIKNMIT
FT                   GASQADAAILVVNVDDAKSGIQPQTREHVFLSRTLGISQLAVAINKMDTVNFSEADYNE
FT                   MKKMLGDQLLKMVGFNPDNITFVPVASLHGDNVFKKSDKTPWYNGPTLAEVIDAFQPPE
FT                   KPTTLPLRLPIQDVYSITGVGTVPVGRVETGIIKPGDKVIFEPAGAVGEIKTVEMHHEQ
FT                   LPSAEPGDNIGFNVRGVGKKDIKRGDVLGHTTNPPTVAADFTAQIVVLQHPSVMTVGYT
FT                   PVFHAHTAQIACTFMELQKKLNPATGEVLEENPDFLKAGDAAIVKLMPTKPLVMESVKE
FT                   IPQLGRFAIRDMGMTVAAGMAIQVTAKNK"
FT   gene            complement(177215..179398)
FT                   /locus_tag="MmarC5_0209"
FT   CDS_pept        complement(177215..179398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0209"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor aEF-2; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: mmp:MMP1369 translation elongation factor EF-2"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34525"
FT                   /db_xref="GOA:A4FWF0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004543"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWF0"
FT                   /protein_id="ABO34525.1"
FT                   /translation="MGRRAKMVEKVKTLMETHDQIRNMGICAHIDHGKTTLSDNLLAGA
FT                   GMISKELAGDQLALDFDEEEAARGITIYAANVSMVHEYGGKEYLINLIDTPGHVDFGGD
FT                   VTRAMRAIDGAVVVCCAVEGVMPQTETVLRQALKEKVKPVLFINKVDRLINELKLTPEE
FT                   LQGRFMKIIAEVNKLIEKMAPEEFKTEWLCDVANGKVAFGSAYNNWAISVPYMQRSGIS
FT                   FKDIIDYCEQEKQGELADKAPLHEVVLDMSIKHLPNPLQAQKYRIPNIWKGDAESAIGK
FT                   SMVECNPNGPLAGVVTKIIVDKHAGAISACRLFSGRIKQGDDLYLVGSKQKARAQQVSI
FT                   FMGAERVQVPSISAGNICALTGLREATAGETVCSPSEILEPGFESLSHTSEPVITVAIE
FT                   AKNTKDLPKLIEILRQIAREDNTVRVEINEETGEHLISGMGELHIEVITNTKIGRDGGI
FT                   EVDVGEPIVVYRETIMGTSPEIEGKSPNKHNKLYMIAEPMEESVYAAYVEGKLHDEDYK
FT                   KKTTADGEARLVEAGLEKDQAKKVMSIYNGNMIVNMTRGIVQLDEARELIIEGFKEGVR
FT                   NGPLAAEKVQGVKIKLMDATFHEDAIHRGPAQIIPAVRFGVRDAVSQAKPVLLEPMQSV
FT                   YINTPQDYMGDGMKEINNRRGQILDMEQEGDMSIIKSSVPVAEMFGFAGAIRGATQGRC
FT                   LWSVEFSGFEKVPGELQPKIVKQIRDRKGLKSE"
FT   gene            complement(179502..180068)
FT                   /locus_tag="MmarC5_0210"
FT   CDS_pept        complement(179502..180068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0210"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: mmp:MMP1368 SSU
FT                   ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34526"
FT                   /db_xref="GOA:A4FWF1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR026018"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWF1"
FT                   /protein_id="ABO34526.1"
FT                   /translation="MEIKLFGKWDSETVTVKDPSLKSYISVAPVLVPHTAGRNTKKSFD
FT                   KAKMNIVERLANKLMANQNNTGKKHETLAIVEEALAIIENRTKENPVQVLVDALENSGP
FT                   REETTRISYGGIAFLQSVDVSPSRRLDTAFRNIALGASDSAHKNKKTVAQCLADEIIFA
FT                   SKADMQKSFAVRKKEEKERVAQSAR"
FT   gene            complement(180102..180545)
FT                   /locus_tag="MmarC5_0211"
FT   CDS_pept        complement(180102..180545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0211"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S23 (S12); PFAM:
FT                   ribosomal protein S12/S23; KEGG: mmp:MMP1367 SSU ribosomal
FT                   protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34527"
FT                   /db_xref="GOA:A4FWF2"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022863"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWF2"
FT                   /protein_id="ABO34527.1"
FT                   /translation="MAGSKSPKGEFAGRKLLLKRKASRWHHYKYVNKALSLKLKADPLE
FT                   GAPMGRGIVVEKVGLEAKQPNSAIRKCVRVQLIKNGRQVTAFAPGNHAINFIDEHDEVV
FT                   IEGIGGPSGQAKGDIPGVRYKVVMVGKNSIRELVRGRQEKVKR"
FT   gene            complement(180555..181076)
FT                   /locus_tag="MmarC5_0212"
FT   CDS_pept        complement(180555..181076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0212"
FT                   /product="NusA family KH domain protein"
FT                   /note="KEGG: mmp:MMP1366 KH domain:KH domain, type 1;
FT                   TIGRFAM: NusA family KH domain protein; PFAM: KH, type 2
FT                   domain protein; KH, type 1, domain protein; SMART: KH
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34528"
FT                   /db_xref="GOA:A4FWF3"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWF3"
FT                   /protein_id="ABO34528.1"
FT                   /translation="MRIKLNTEDIMRISLFEKMTGANVIDSTSDDEKIVFVVKEGDIGA
FT                   AIGKGGENVRNATEKFGKKIDLIEYSEDAKQFIKNIFAPIELEDVWTKKFSDDLVVYVR
FT                   VHPRLRRAVIGDKGKNIDRAVDIAGRLAGVKNIKVVAGLKKDNDKKPKQEEIPEKAAES
FT                   STNVEAEENQ"
FT   gene            complement(181093..181413)
FT                   /locus_tag="MmarC5_0213"
FT   CDS_pept        complement(181093..181413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0213"
FT                   /product="LSU ribosomal protein L30E"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   mmp:MMP1365 ribosomal protein L30E"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34529"
FT                   /db_xref="GOA:A4FWF4"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWF4"
FT                   /protein_id="ABO34529.1"
FT                   /translation="MRRRSSMDINRAIRVAVDTGNVVLGTKQAIKNIKHGEGQLVIVAD
FT                   NCAKDVKEDIFYYTKLSETPVYTHQATSIELGAICGKPFPVSALLVLEPGNSAILNVNN
FT                   EE"
FT   gene            complement(181610..182770)
FT                   /locus_tag="MmarC5_0214"
FT   CDS_pept        complement(181610..182770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0214"
FT                   /product="DNA-directed RNA polymerase, subunit A' '"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: mmp:MMP1364 RNA polymerase, A/beta'/A'
FT                   subunit; TIGRFAM: DNA-directed RNA polymerase, subunit A'';
FT                   PFAM: RNA polymerase Rpb1, domain 5"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34530"
FT                   /db_xref="GOA:A4FWF5"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012757"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWF5"
FT                   /protein_id="ABO34530.1"
FT                   /translation="MQMADLEKKLENSVLPPLLKRELSEKILKDGLSEEYLVDEIISET
FT                   TRAYERTLVEPGEAVGVVAAQSIGEPGTQMTMRTFHYAGVAELNVTLGLPRMIEIVDAR
FT                   KEPSTPTMTIYLNDEFKGDREKASMVAKNIESTNVESVSEDISVDLVNECITIILNSQQ
FT                   LESRGLTVPDVIEAIKSKMKLKIDDHENVLNLKIKTPSLKALRKRLPKVRAIHLKGVQN
FT                   IKRVIIRKEVDEYILYSEGSNIKEVFDIEGVDTTKTTTNNIVEIQDVLGIEAARNAIIY
FT                   EMDATLGNQGLTVDKRHLMMVADLMCTDGVVKPIGRHGIGGEKASVLARAAFEETVKHL
FT                   YSASMRGYVDELGGVVENIIVGKPIAMGTGCIDICIDKTYEEGKEL"
FT   gene            complement(182815..185484)
FT                   /locus_tag="MmarC5_0215"
FT   CDS_pept        complement(182815..185484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0215"
FT                   /product="DNA-directed RNA polymerase, subunit A'"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: mmp:MMP1363 RNA polymerase, alpha subunit;
FT                   TIGRFAM: DNA-directed RNA polymerase subunit A'; PFAM: RNA
FT                   polymerase, alpha subunit; RNA polymerase Rpb1, domain 3;
FT                   RNA polymerase Rpb1, domain 1; RNA polymerase Rpb1, domain
FT                   4; SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34531"
FT                   /db_xref="GOA:A4FWF6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWF6"
FT                   /protein_id="ABO34531.1"
FT                   /translation="MDRFDVPKEIGDITFGLLSPEQIRTMSVAKIVTADTYDDDGYPID
FT                   GGLMDTRLGVIDPGLVCKSCSGRVGTCPGHFGHIELSKPVIHIGFAKDIYKILKAVCPH
FT                   CGKVAITELKRDEYLEKMAKLEEDGGDPWTLCDDLLKEAAKGSVCPSCGEVKADVKYDK
FT                   PTAYHQLDGKAQKQLTSSEVREILEKIPAEDCRLLGINAKVARPEFMVLTVLPVPPVTV
FT                   RPSITLESGERSEDDLTHKLVDIIRINQRLEENINGGAPNLIIEDLWDLLQYHINTYFD
FT                   NEAPGIPPARHRSGRPLRTLAQRLKGKEGRFRHNLAGKRVNFSARTVISPDPRLSINEV
FT                   GIPKLIAKELTVPEKVTPYNIEKVRTLLRNGADTHPGVNYVVKKVRTKDGKEEEYKIKI
FT                   TDANKDMWVENITDGMVVERHLSNGDIVLYNRQPSLHRMSIMAHKVKVLPYRTFRHNLC
FT                   VCPPYNADFDGDEMNVHVPQSEEARAEAENLMLVEKHIVSPRFGGPIIGGIHDFISGAY
FT                   ILTSSLFTKDEALTLLNSSGLNLDLGEPDLVENKVEYYSGKTLFSKTLPEGLSLQYRAK
FT                   ICKKCDNCTKEECEHDAYVVIRNGKLLRGVIDKNGFGSEAGIVLNTLVKDFGSEDARLF
FT                   LDAATKMSIKAMVLKGFTTGIDDEDIPAEAIQEIQDLLNKAEQDVEDIVEKYENGTLES
FT                   LPGRGVEESREAYIMQILGKARDQAGNVAEKYLSKENHAALMARTGARGSLLNITMMAA
FT                   SVGQQSVRGGRVFRGYRDRTLPHFGKGSLDAKSHGFVRSCYKKGLAPTEYFFHAMGGRE
FT                   GLVDQAVRTAQSGYMQRRLVNALQDIRAEYDGTVRDSRGLVVQFEYGEDLVDPAKADHG
FT                   KGVDLDKVFTKVTSKYEN"
FT   gene            complement(185535..187370)
FT                   /locus_tag="MmarC5_0216"
FT   CDS_pept        complement(185535..187370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0216"
FT                   /product="DNA-directed RNA polymerase, subunit B'"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb2, domain 6; RNA polymerase
FT                   Rpb2, domain 7; RNA polymerase Rpb2, domain 4; RNA
FT                   polymerase Rpb2, domain 5; KEGG: mmp:MMP1362 glycoside
FT                   hydrolase, family 1:DNA-directed RNA polymerase, beta
FT                   subunit:ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34532"
FT                   /db_xref="GOA:A4FWF7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019969"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWF7"
FT                   /protein_id="ABO34532.1"
FT                   /translation="MEKQTNVYVNGKLIDTTEDPETLVKNLRENRRSGKLSPSTSISFN
FT                   EESNDVHISTDGGRAVRPLVVVENGASKLTQELLEKVDAQELTFHELVDSGVIEYLDAE
FT                   EEENARIAMYEDEITEENTHIEIDPLVILGIGAGVAPYPEHNSAPRITMAAAMSKQSLG
FT                   IPMANIKWRMDTRGHLLHYPQVPLVRTKHQEILGFDKRPAGQNFVVAVMSYEGYNMEDA
FT                   FIINKASLERGLGRSTFFRSYESFEKRYPGGQLDKFEVPEKGVRGYRAEDAYRNLGDDG
FT                   LIDLESNVRSGDVILGKTSPPRFLEEQEITLQTKSQRRDTSVTIRHGEEGIVDLVILSE
FT                   TKEGNRLGKVRVRDLRIPEFGDKFASRHGQKGVIGLIVPQEDLPYTEDGVIPDLIINPH
FT                   AIPSRMTIGQVLEMIGGKVGSLECRRIDGTIFSGESEWKLREGLEKYGFEHHAKEAMYD
FT                   GKSGRKLECDIFVGVAYYQKLHHLVAGKIHARSRGPIQVLTRQPTEGRAREGGLRFGEM
FT                   ERDVLVAHGAAMLLKERLLDESDPHEDYVCAKCGEIAIFDYKRGMKFCPVCGESEDIQD
FT                   NRKIPPVKIAYAFKLLLDELKSMGIDPKLELKDRA"
FT   gene            complement(187414..188913)
FT                   /locus_tag="MmarC5_0217"
FT   CDS_pept        complement(187414..188913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0217"
FT                   /product="DNA-directed RNA polymerase, subunit B'"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb2, domain 2; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2, domain 3; KEGG:
FT                   mmp:MMP1361 DNA-directed RNA polymerase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34533"
FT                   /db_xref="GOA:A4FWF8"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWF8"
FT                   /protein_id="ABO34533.1"
FT                   /translation="MESRVVVDAFFKENSLVKHHIDSYDDFVKNKIQKIIDEVTGVETE
FT                   IKGGYKVSFAKVRVTKPINKEADGSVKEITPMEARIRNLAYSAPLYLEMIPTVGEDEEE
FT                   KVLSPVEVYIGELPVMLGSEICHLCGKSDEELIKYGEDIQDPLGYFIVNGSEKAVVAQE
FT                   DLIPNRIICEKVEKNNKVVDIAKVFSTRHGFRALCTVERNPDGLLNVSFPGMPSTIPLV
FT                   ILMRALGAESDREIIELISDEPTVVMQLIANLQEAREEHAINTTEDALEHIGKRVAPGQ
FT                   PKEYKLKRAETILCNYLLPHMGVESEKLGAKCKYLGRMAKNSIELYLGLRVEDDKDHYS
FT                   NKRLKLAGDLMEDLFRHSFNQLIKDIKYQLERQAIRNKEPSIQAAVRSDVLTERMRHAM
FT                   ATGNWVGGRTGVSQLLDRTSYLATVSQLRRVVSPLSRSQPHFEARDLHATQWGKICPSE
FT                   TPEGPNCGLVKNLAVMCKVTTDEGDDSVIELLRELGLTKEN"
FT   gene            complement(188994..189230)
FT                   /locus_tag="MmarC5_0218"
FT   CDS_pept        complement(188994..189230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0218"
FT                   /product="DNA-directed RNA polymerase, subunit H"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase subunit, RPB5; KEGG:
FT                   mmp:MMP1360 RNA polymerase H/23 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34534"
FT                   /db_xref="GOA:A4FWF9"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR020608"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWF9"
FT                   /protein_id="ABO34534.1"
FT                   /translation="MKVSSHEMVPTHEIIPREEIPLLLEKYDIKLQQLPKLLDTDPLVL
FT                   EVEATPGDVLKITRMSPTAGETTYYRLVIATSP"
FT   gene            189483..191024
FT                   /locus_tag="MmarC5_0219"
FT   CDS_pept        189483..191024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0219"
FT                   /product="protein of unknown function DUF39"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF39; KEGG: mmp:MMP1359 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34535"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002708"
FT                   /db_xref="InterPro:IPR016426"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWG0"
FT                   /protein_id="ABO34535.1"
FT                   /translation="MKTVHEINEKIRNGDAVVVTAEEMIDIVDKLGAEKAAVEIDVVTT
FT                   GTFGAMCSSGAFLNFGHSDPPIKMYKTYLNGVEAYSGLAAVDAYLGAAQTNSDDDIDIS
FT                   YGGSHVLEDLVAGKEIELVAEGYTTDCYPRKKVSTTITIDDLNQAILVNPRNCFQSYNG
FT                   ATNSTDEKIYTYMGALLPEYGNFNYSGAGQLNPLQNDFNKETKNYNTLGIGTKIFLGGA
FT                   QGYITGEGTQHSPNSGFGTLMVQGNLKEMNTKYLRGATIPKYGSTLYMGIGVPIPILNA
FT                   EIAKTCAIKDEDIAVPIIDYGIPRRDKPELGVTNYRDARSGKVTIEVEVEGKKVDKCMR
FT                   TASVSSYKISREISKELKNWISNSEFTLTERLEPLKSAVTKPMKAKMKLVKDILSKPAV
FT                   VGSLNTSITEASRVLIENNINHLPIIDENGKLSGIITSWDIAKAMAQDKHSISEIMTTY
FT                   IVSATPDETIDMAARKMSRNNISGLPVVDSNNRVLGVVSAEDISKLIGRTGLHKI"
FT   gene            191038..191436
FT                   /locus_tag="MmarC5_0220"
FT   CDS_pept        191038..191436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0220"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1358 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34536"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWG1"
FT                   /protein_id="ABO34536.1"
FT                   /translation="MKKRVFYWISGSNVREPVVSNVVLGTGVMVNILKAKMEPREGFLI
FT                   LELTGDEEQIEKSIEILKKFGEVEDIPKIIQKDDEKCIDCGACVVHCPVGAISVDDEFK
FT                   ILLDEDECIGCKNCAKICPVNAIKIFEI"
FT   gene            191485..191739
FT                   /locus_tag="MmarC5_0221"
FT   CDS_pept        191485..191739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0221"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: mmp:MMP1357
FT                   thiamineS"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34537"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWG2"
FT                   /protein_id="ABO34537.1"
FT                   /translation="MDLTIKFFAKCREDFGEGLKISIDLDEVSILKLIEILENDYNLQL
FT                   KEDFENGKIIVSKDFEIVSSNDVIDKNSEIGIYPPVSGG"
FT   gene            191754..192689
FT                   /locus_tag="MmarC5_0222"
FT   CDS_pept        191754..192689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0222"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: mmp:MMP1356
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34538"
FT                   /db_xref="GOA:A4FWG3"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWG3"
FT                   /protein_id="ABO34538.1"
FT                   /translation="MKCRKCGEPSVYHQKHSGNKYCRTCFIKETKRKVRKTLGRDVLKN
FT                   NIKVAMGLSGGKDSLVMAYLLNEFYKEIPNSKIIAIMVNEGIEGYRLDGIEAAVKFCEK
FT                   HDIEYKIVQFKDYLGTNLDEIVKLAKEKNLTMNPCSFCGVIRRKILNRVSIEEKCDFLA
FT                   IGHNLDDIAQAVMMNYIEGDVKKLAFLGKSLKHPKFVKRIKPLEKIPEDEVLLLADMLE
FT                   LTYHKSPCPYSCLSFRSEVSEITDTLEKNHPGTKYSIVRGYERLLEHIELPGYTGECKI
FT                   CGDLSATEVCKVCSYLKNLGILEKSKFEKI"
FT   gene            complement(192708..193388)
FT                   /locus_tag="MmarC5_0223"
FT   CDS_pept        complement(192708..193388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0223"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: mmp:MMP1355 bacterial transferase
FT                   hexapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34539"
FT                   /db_xref="GOA:A4FWG4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWG4"
FT                   /protein_id="ABO34539.1"
FT                   /translation="MNSNPFETYRDIRIMNENPKYPVRGDGIVREKIESENVEIGEYTY
FT                   YSGYYEGKKFKDCIMYLDEIDNCKNMDKLFIGKFCSIASGVKFIMGGNQGHRYDWISTY
FT                   PLTLISETPEDLKSENGKGYLKKGDTVIENDVWIGANVTIMPGVKIGNGAVVATGSIVT
FT                   KEVPPYTIVGGNPAKIIKKRFSDEKIELLLKIKWWDWPIEKIKASIKTLMSDDFEELKK
FT                   ICEE"
FT   gene            complement(193403..194554)
FT                   /locus_tag="MmarC5_0224"
FT   CDS_pept        complement(193403..194554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0224"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="TIGRFAM: thiamine biosynthesis/tRNA modification
FT                   protein ThiI; PFAM: thiamine biosynthesis protein; THUMP
FT                   domain protein; ExsB family protein; KEGG: mmp:MMP1354
FT                   thiamine biosynthesis protein:THUMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34540"
FT                   /db_xref="GOA:A4FWG5"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWG5"
FT                   /protein_id="ABO34540.1"
FT                   /translation="MKKFIVRYGEIGTKSRQTMHRFEKLLAKNISKLAKKHGISAEVEI
FT                   IHTRLIVDIPKENFEKMKELLKKVPGIVSFSPCYYIDPDIEKIKEISSELFEKEIEKYE
FT                   NKENITFRVKTQRPQKKFPLTSLEVNMEVGGPISEKYGIQVDLTNPTISLDIEVFNEYA
FT                   YVFAERISGIGGIPVGTQGRVLVLLSDGIDSPVSAYMMAKRGCKLLLLHMKTSDEGLEK
FT                   TQKLADVLSDFDPEAKFVYMDFKEELEKIKAELTEINRDKYTCLYCKKYMLKMAEKYAK
FT                   WHKCDAIINGDNMGQVASQTLKNLRVISEGIDYPILRPLIGLDKIEIMDIARKIGTFGI
FT                   STSKEVSCFAVPKHPITNATPEEIEKIEEQLLNLRNCNECKNC"
FT   gene            194688..195662
FT                   /locus_tag="MmarC5_0225"
FT   CDS_pept        194688..195662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0225"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: mmp:MMP1353
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34541"
FT                   /db_xref="GOA:A4FWG6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWG6"
FT                   /protein_id="ABO34541.1"
FT                   /translation="MIDLKELKKYCNHSYLTIRNDKIIVGNKGLARLSKEKMRKIEMDF
FT                   EIPVVYSRVFEEISERMGRYVSKNNIISPKDKILVGLSGGKDSLALLHLLEPYRRKYGV
FT                   QIYAVTVDLNINGIRPWTESNKNVKMISEHCKNLNIPHEIIAHDGNVVEMSKILSENTK
FT                   GIEYSPCFSCSMVRRHVLTNYAKNNFESDSNVKIAIGHTLEDNSDTIMANIFKGNVIKA
FT                   LEPIKNFNKTDVDFKDFKLNLKSCCMIRPMLNVSEEKIVKALVECDIEYYKDKDECPYS
FT                   RHNGDGIRKKSHEVLKSLEEDVPNIREMIISSILNSIEQYKQK"
FT   gene            195764..196549
FT                   /locus_tag="MmarC5_0226"
FT   CDS_pept        195764..196549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0226"
FT                   /product="thiazole-adenylate synthase"
FT                   /note="TIGRFAM: thiazole biosynthesis enzyme; PFAM:
FT                   thiamine biosynthesis Thi4 protein; FAD dependent
FT                   oxidoreductase; KEGG: mmp:MMP1352 NAD binding
FT                   site:TonB-dependent receptor protein:thiamine biosynthesis
FT                   Thi4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34542"
FT                   /db_xref="GOA:A4FWG7"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR022828"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWG7"
FT                   /protein_id="ABO34542.1"
FT                   /translation="MDGKLRADEVAVTKSILKSTFNMWMDVIDVDVVIVGAGPSGLTAA
FT                   KYLAQKGVKTVVLERHLSFGGGTWGGGMGFPNIVVEKPADEILREAGIKLDEVDGEDEL
FT                   FTADSVEVPAKLGVAAIDAGAKILTGIVVEDLILKEDKIAGVVIQSYAIEKAGLHIDPL
FT                   TISAKYVIDSTGHDASAVHTLARKNKDLGIEVPGEKSMWAEKGENSLTRNTREIFPGLY
FT                   VCGMAANAYHAGYRMGAIFGGMYLSGKKCAEMILEKMEK"
FT   gene            196682..197167
FT                   /locus_tag="MmarC5_0227"
FT   CDS_pept        196682..197167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0227"
FT                   /product="[SSU ribosomal protein S18P]-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: mmp:MMP1351 ribosomal-protein-alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34543"
FT                   /db_xref="GOA:A4FWG8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWG8"
FT                   /protein_id="ABO34543.1"
FT                   /translation="MIINIRKFREHDLKRVMEIEKESFDKNYPEFLMMHIYTSFPDGFL
FT                   VAETEDGKIVGYIIALMEWGNGHVVSIAVDSAYQNYGIGNALLSATENFLFNECHAKHC
FT                   VLEVRFDNKKAREFYYKRNYVDRKVLYNYYDDGADAILMIKRRFDLSGNYPIFVNMW"
FT   gene            197161..198486
FT                   /locus_tag="MmarC5_0228"
FT   CDS_pept        197161..198486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0228"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mmp:MMP1350 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34544"
FT                   /db_xref="GOA:A4FWG9"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023979"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWG9"
FT                   /protein_id="ABO34544.1"
FT                   /translation="MVEIMKITIYSKDIYTYGAMLVGGILKEKHNHNVKLTKDIKNKKL
FT                   FLKSDIVIFSLYSTLNIVDPVIKDTIDYLKSKNIKIYIAGPVSAYPGIILGELNIDGVI
FT                   LGEGEIKTPEIINGSTEGLAYLENGEIIINKPKSKPDLDFSKIYVPKDIETQNVRGANV
FT                   YIETHRGCLGHCTFCQVPEFFGRDIRSKPIELIIEEVKELKKNGVKRIAISGGTGSLYN
FT                   FKNTVNKNKFIEMIESVSNIIGRGNLSVPDMRVDYVDEEVLNAIKNYSIGWVFYGIESG
FT                   SDKLLNSMKKGTNTKKNLKAIELAKDCGVKVAGSFIVGHPKEKEVDFLMTKDFIVDAEL
FT                   DDVFVSAAEPIPRTELCNEVLTTGMDKNPTFMPHNGPYRKYGLKENEARAYDLMLHSEM
FT                   WKSTPRMITNTLSKVYLDEAKMQGSDIRKATELIFKYRDFLI"
FT   gene            198502..199278
FT                   /locus_tag="MmarC5_0229"
FT   CDS_pept        198502..199278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0229"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="TIGRFAM: NAD+ synthetase; PFAM: NAD+ synthase; KEGG:
FT                   mmp:MMP1349 NAD+ synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34545"
FT                   /db_xref="GOA:A4FWH0"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWH0"
FT                   /protein_id="ABO34545.1"
FT                   /translation="MIRTNEQLEELANNIRDFIREQVENADAKGVVVGLSGGIDSALVA
FT                   YLSVKALGKENVFGVIMPEKNSNPDDEKYGKLVAETLGINYTVFDITPVLVAFGAGGYV
FT                   EGKEFDRRVDANLKPRIRMTEVYYHANKKNYLVAGTSNKSEIYMGYGTKYGDLGSDFLT
FT                   IGNLFKTEVRQLAGHVGVLKEIIDKAPSAGLWDGQTDEDELGISYETLDKLLDLMEKGK
FT                   EIEDICEFLGISLEKIEELMLRITTNKHKSLPLPMP"
FT   gene            199306..200388
FT                   /locus_tag="MmarC5_0230"
FT   CDS_pept        199306..200388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0230"
FT                   /product="2,
FT                   5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine
FT                   1-reductase"
FT                   /EC_number="1.1.1.193"
FT                   /note="KEGG: mmp:MMP1348 hypothetical protein; TIGRFAM:
FT                   2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine
FT                   1-reductase; PFAM: bifunctional deaminase-reductase domain
FT                   protein; TOPRIM domain protein; SMART: Toprim sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34546"
FT                   /db_xref="GOA:A4FWH1"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006401"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR022972"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWH1"
FT                   /protein_id="ABO34546.1"
FT                   /translation="MDKQESLEKLLLIIDDLKLLAEKGIPILVEGPNDILSLKNLKINA
FT                   NFITVSNTPIFQIADDLIAENIPEIILLTDFDRAGRVYAKNIMEEFQSRGIKVNNLIRK
FT                   EIIKYSRGDLKDIESLYPYISRRITINSDLSDIMIPYVISNVGMTLDGKLATIENDSRI
FT                   SGENDLKRVHEIRKDVDAIMVGIGTVLKDDPRLTVHKINASPKDNPLRIVVDSNLKVPL
FT                   NARVLNKDAKTVIATTTPISDEKEEKIRKLKEMGIMVLQAGVQKVDLRKIMNEIYKMGI
FT                   NKILLEGGGTLNWGMFKENLINEVRVYIAPKVFGGANSPTYVDGKGFKNVEECTKLELK
FT                   NYYPLDDGIVLEYRVIGSFK"
FT   gene            200578..200778
FT                   /locus_tag="MmarC5_0231"
FT   CDS_pept        200578..200778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0231"
FT                   /product="archaeal histone"
FT                   /note="PFAM: Transcription factor CBF/NF-Y/archaeal
FT                   histone; Histone core domain protein; KEGG: mmp:MMP1347
FT                   archaeal histone B"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34547"
FT                   /db_xref="GOA:A8B1G1"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A8B1G1"
FT                   /protein_id="ABO34547.1"
FT                   /translation="MAELPVAPMERILKSAGAERVSRDAAVMLAEALEEIAVDVAKEAV
FT                   SLAKHAGRKTVKADDLKLAMK"
FT   gene            200907..201641
FT                   /locus_tag="MmarC5_0232"
FT   CDS_pept        200907..201641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0232"
FT                   /product="basic helix-loop-helix dimerization domain bHLH"
FT                   /note="KEGG: mmp:MMP1346 basic helix-loop-helix
FT                   dimerization domain bHLH"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34548"
FT                   /db_xref="GOA:A4FWH3"
FT                   /db_xref="InterPro:IPR016764"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWH3"
FT                   /protein_id="ABO34548.1"
FT                   /translation="MYAIGIGKNRDEVLIAAENLKKEGIEVELVENPEILIDGLINNRY
FT                   CGAVRGSLSSSELIPILRKRIGKFYRASILKNPFNNEIFILAPVGIDEISESPEIRFDE
FT                   KLEIIKYSSEFLKSNGITPKIGILSAGRLSDIGRSKKIDDSILEAEDLLKHVNSLDIFE
FT                   NLEIEHKGILIEEYLKDGYNIILSEDGISGNLLFRAFALVCNMEGFGAIILNSENIKFI
FT                   DTSRSGSSKRYYNAVKFLKEGF"
FT   gene            201658..202452
FT                   /locus_tag="MmarC5_0233"
FT   CDS_pept        201658..202452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0233"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: mmp:MMP1345 undecaprenyl pyrophospahte
FT                   synthetase related protein
FT                   (di-trans-poly-cis-decaprenylcistransferase); TIGRFAM:
FT                   undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34549"
FT                   /db_xref="GOA:A4FWH4"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWH4"
FT                   /protein_id="ABO34549.1"
FT                   /translation="MPLFKFYEYLSKFGALKLYEKELESKISKCPLPKHVGIIMDGNRR
FT                   LAKKLGENPELGHNLGASKVHEVIDWCVSLGIHTITLYAFSLENFNRPEHEVKVLMDLF
FT                   EREFIEIANHPNTHRDKIRVSVIGRREMLPKHVQKAISYAEDETKDYSNHFVNFAIAYG
FT                   GQQEIIDSVKKIAQQVKINEIGIEDITVELISKNLYTSNLPSPNPDLIIRTSGEERISN
FT                   FLTWQSCYSELYFCETYWPTFRKIDFLRSIREYQKRERRYGK"
FT   gene            202442..202924
FT                   /locus_tag="MmarC5_0234"
FT   CDS_pept        202442..202924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34550"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWH5"
FT                   /protein_id="ABO34550.1"
FT                   /translation="MGSEEMKYSFIFLISAVLIFSGCIENNITTESNETLFLNNTSSKN
FT                   PNIGVELNNGTESDDSSEIESISFKILEFGIYGDSYKHYESSIIGDKTIIEVYMGKKLG
FT                   SDNIIEINLIKLKNGVLIVYIEEITPETISDRAIVYPYEIVEVNGIYNNVEFKTIE"
FT   gene            202934..203734
FT                   /locus_tag="MmarC5_0235"
FT   CDS_pept        202934..203734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34551"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWH6"
FT                   /protein_id="ABO34551.1"
FT                   /translation="MLEIIFLGGGGGRWESITQVKGTGGFRIHSEDMNMHIDSGAGALV
FT                   RMNQLGINPWKTDAIISTHCHPDHYTDAENLIEAMTKGMTKKQGILIGNNSVLNGSSRF
FT                   EKGISTYHQSRVGERHVLKPYDELNVKTWKLTATKTKHNDPETIGCKIETDDGLIGYTS
FT                   DSEYIDSLIEDFDCIDFLIANVIRVKCQKVPGHMCSNDIIEVVNSMNKKPKMLTMYHMG
FT                   MKMTDPDSEAKYISEKIDIPVIPAKIGLKITMENKSCKYDYIKY"
FT   gene            complement(203751..204146)
FT                   /locus_tag="MmarC5_0236"
FT   CDS_pept        complement(203751..204146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0236"
FT                   /product="SSU processome protein Utp24"
FT                   /note="SMART: Nucleotide binding protein, PINc; KEGG:
FT                   mmp:MMP1342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34552"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWH7"
FT                   /protein_id="ABO34552.1"
FT                   /translation="MYRVIPDTNFLIYAFKQGINFEYELNSAIDRGYKIFIMDCVLKEL
FT                   EKLKLEFKGKEKLSVNLALKYAKNFEIIEYSNGKYADEMIINYSKENKDVIICTNDKKL
FT                   KKDLIDTGTPVILVKQHNHFELQGYLK"
FT   gene            complement(204156..207137)
FT                   /locus_tag="MmarC5_0237"
FT   CDS_pept        complement(204156..207137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0237"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: mmp:MMP1341 DNA
FT                   double-strand break repair rad50 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34553"
FT                   /db_xref="GOA:A4FWH8"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR022982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWH8"
FT                   /protein_id="ABO34553.1"
FT                   /translation="MIIKNIKMENFRSHRNTSINFNKGITSIIGQNGSGKSSIFQAMNF
FT                   ALFAPRGNNFRIENLMQQGSASFSVELEFEMMGNIYLVKRKRFQNKTDDKLYVNGKLNA
FT                   ESASEINKKIEEILEIDNSVFSNAIYIKQGEIANLIQMTPRDRKEVIGKLLGIEKYEKA
FT                   SEKMNIVKKSYEEMLFKLEGELVQEPEILENLEKLKNEVSESEILKEEILKKYENLEKL
FT                   KLEKNSELISMEEKFAENNLLKENLKDIISEIKNINLEIQNLENSLSSVVEESENLFKN
FT                   EEIYKKYLELELTIKELNTKLISHKSDYESYNKLKTIVESLINELNILKESLKDNKKNP
FT                   DELKENLNEIDKKIQKLDGVKEKITELNFIEKQISGINDHKKTVETHFDSSKLYEDLIK
FT                   TFDGLKTKKNSYENLLKEKNDLEKKLQSAIEEKIKLISELTVFEKIEEKINLENELKEK
FT                   YEGLSEKIDKLNEIITKKESKILETKNYKLELEKTKDSCHVCQSKITEEKKQELLKKYT
FT                   SLIQNEGLSIESIKKQLEVILNKKEQLKLKLNEIDSFKSKYGELKEKKNYLLKVEESII
FT                   ENTQKLNELTEQLNEYSSLNDEIKLIENKLNDLEEIYKKYTYSVQFLTKNDESEILNKK
FT                   SEILKIIGDYDYLKIKNEKESLENLKDELKIIISNLERENKLKSELKDIQDNMSSKIGI
FT                   VECYIKWETEKSAFETKISEYKENYEKYMESLAVLKNHSKIYSVEINELNEFLNQKLAE
FT                   KQNISKKLLENRINTEKNIQIVNYSPEVHENAKKAYESIINKFNDISITLERINFELKL
FT                   KNENIVYLNEKIQNLANKKEERRKIEEFKEYLDKIKREIFSKDGFQKYLREKYIPLIQR
FT                   HTNQIFQEFELPYSHIQLKDDYSLIVDGLPVETLSGGEQIAVSLALRLGISKAVCNNIE
FT                   CIILDEPTAYLDEDRRKNLLNIFKNIKTINQMAIITHHQELEQIADNIVKVRKIGENSK
FT                   VSLE"
FT   gene            complement(207127..208269)
FT                   /locus_tag="MmarC5_0238"
FT   CDS_pept        complement(207127..208269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0238"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mmp:MMP1340 DNA
FT                   repair exonuclease of the SbcD/Mre11-family"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34554"
FT                   /db_xref="GOA:A4FWH9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032885"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWH9"
FT                   /protein_id="ABO34554.1"
FT                   /translation="MQFVHMADNHLGYRQYNLDERENDIYESFLECIDKIIEIRPDFVI
FT                   HSGDLFESPQPPVNAIRCTMEGFLKLKEKNIPIYLIHGNHDIPKSQQKGKPFGILKKIL
FT                   GNSLLTFGKNKSHVFNNEVFIGGIEYVSQNKIPKTYEDLEKISFDSKNYKKKILLFHQS
FT                   VNPFIPQSFEMQVTDFPEDFNYIAGGHIHQRALKPINEGNSVFSYAGSTDIMSVSEVKD
FT                   YKQNGKGFYLGDLSGDFDINSIQKIDVECRNFLIDKRIKNENDYEKIIKELQNIQNEKK
FT                   KPVLYCDIVENLFNSFNDEITDLTLYKRISRIDENLEESFNINESSIEEIFQEYIKNKE
FT                   MDVNFVYGLYKKLLENDEDSLLYVNDYFKGNYYGGAFDDY"
FT   gene            208404..208949
FT                   /locus_tag="MmarC5_0239"
FT   CDS_pept        208404..208949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34555"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWI0"
FT                   /protein_id="ABO34555.1"
FT                   /translation="MSRPVIYVYCRGDEQKEEFTKMAKRNGFENTSEYARTSMIMYDKL
FT                   KDILETLMGFDNKLNSIVDKFDSIESNIDESNNKLVKSLSDMNSELKVLSTNEKRQDML
FT                   SQIFNIMSRIYPQRCTFEELGEYLGVRENEFKRNIFWELVNSNPIFDEYVERDGNTLRA
FT                   RLNPKTGKFGIGEIVEDL"
FT   gene            208936..209811
FT                   /locus_tag="MmarC5_0240"
FT   CDS_pept        208936..209811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0240"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   lic:LIC11599 putative integrase/recombinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34556"
FT                   /db_xref="GOA:A4FWI1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWI1"
FT                   /protein_id="ABO34556.1"
FT                   /translation="MRIYDGFKFKEQDQKIIDNYMAFRSGHSDKTVITNISGIRIFMRF
FT                   HKNKTFDEISLEDVIEFYRKHESSENTKIQYLSRLTLFYNWGISENYFLRNPVEKFLVT
FT                   LRKSKKEREYLTKEQTNYLLSNVFEYEYRLFLMFFLHTGVRNSEFRNLKIHDVDMDERT
FT                   IRILGKGRKERYVFIDNELYSYLKIWLIQRDSKFPKSDHFFVNRLGNPIRLTHLVSFTD
FT                   YLNEVSKNKIGFRITPHILRHTFATRCIDMGMDLKTLSLILGHEDIKTTSIYLHKNKES
FT                   LKREFLRVMN"
FT   gene            complement(210333..210722)
FT                   /locus_tag="MmarC5_0241"
FT   CDS_pept        complement(210333..210722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0241"
FT                   /product="transcriptional regulator"
FT                   /note="KEGG: mja:MJ0944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34557"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWI2"
FT                   /protein_id="ABO34557.1"
FT                   /translation="MLLELLAKNHVKEILYQLVDGKIEYSSLKKEIKIDNSYLKSILNE
FT                   LESCNLILKHEKRKYLIITKSYYSLTEKGVHSIRLYELEKSLIRKKEGRKIIKEFDIDI
FT                   PVYYFEDGEMKSFQMIGFGEVEVIE"
FT   gene            complement(210755..211696)
FT                   /locus_tag="MmarC5_0242"
FT   CDS_pept        complement(210755..211696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34558"
FT                   /db_xref="GOA:A4FWI3"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWI3"
FT                   /protein_id="ABO34558.1"
FT                   /translation="MTIRKKLVILFGIIFLMVLGGVVTVAGLLMIAPAENNSNSENIVS
FT                   STVSTSNQNNSENVKAVSEKYILINRSAVSSYYFNYLYDSFRFTKYANPDKEFMIVSLE
FT                   IENYGYDEFKVNPYNYKVVVDNVSYTPSYFNYNIPDLLKSVTLKNGGKTYGILVYELPE
FT                   NSRWYHIEYTGSVGYKLKYGDLILEKEIVEDDEEVILSLTNDIDTGFEESDFSHYYEGS
FT                   LLNESTLYLYFERTNYLDEEDILKEVRNILIETRSLIIDSSYDKPEYVYLKYNYDYNHQ
FT                   GSTKYSINLTWDEVYGIKIMQSSKFNEKLIIE"
FT   sig_peptide     complement(211619..211696)
FT                   /locus_tag="MmarC5_0242"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.451 at
FT                   residue 26"
FT   gene            complement(211853..213178)
FT                   /locus_tag="MmarC5_0243"
FT   CDS_pept        complement(211853..213178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34559"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWI4"
FT                   /protein_id="ABO34559.1"
FT                   /translation="MEKLPDNEMSKIINKILDLTYIHENKLEIRKDKSLFEFETYLSLL
FT                   NYELLKDENISKKITDLKYCTMISSDINNFELILDVLTELKTKNLNNYNEFKNILDLKI
FT                   KSLKSEFKQYTLYEMYIPLNLKTEFTIEKIKCRNFCAEIVKYRKIKGIINQPKLNESIK
FT                   KAHEIDPQCEINVNFDESEFLKITVNSQTDAHACLTARKIQNLFIGMVAYVITKNSSYR
FT                   TLKGPTEAIFPIYPQIMIETIGTQFVTVFVGDITRKRIPKDCIIPIEKFYETELNYLIQ
FT                   FYNSKRPDIQKKLEEIFTNYACGVYQDKKTDSFFNLWVALERATMVSDIGKHDMIPKIS
FT                   KALFNERNPLYAHVIENLYTVRNNFIHEGGSISQYDRNALKYCVDNLIEFLIKELNSYS
FT                   LNEIKTIYEYLTKNGNNLENIQKTIEHVIELKKNWKGEISEK"
FT   gene            complement(213287..213679)
FT                   /locus_tag="MmarC5_0244"
FT   CDS_pept        complement(213287..213679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0244"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: mmp:MMP0752
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34560"
FT                   /db_xref="GOA:A4FWI5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWI5"
FT                   /protein_id="ABO34560.1"
FT                   /translation="MFLKILSKSNAKEILMLLNEYDELYFGQIQKELDKPKSNLSRILS
FT                   ELQEESLVNKRTEETDDDGRIPKNYYSLTNLGKMAVEIYQKEDKMVKEKEKKSNDLTTC
FT                   IIGNNNQNIGNININNNFMSNNSFQK"
FT   gene            213905..214033
FT                   /locus_tag="MmarC5_0245"
FT   CDS_pept        213905..214033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34561"
FT                   /db_xref="InterPro:IPR019205"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWI6"
FT                   /protein_id="ABO34561.1"
FT                   /translation="MKKEKIIEKTVKPSGNTGHITLPKKYIGKKVKIKIQGEHKDD"
FT   gene            214034..214351
FT                   /locus_tag="MmarC5_0246"
FT   CDS_pept        214034..214351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34562"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWI7"
FT                   /protein_id="ABO34562.1"
FT                   /translation="MTLKRLDISIVPKIITIREIGEIELKDVQKFNITGERLNEETKKF
FT                   VKCIVQHEEEFYQMLLPDHNFKFYEKIEVKRNLTGIEIKRLEKRVNEHENTGFIKNTSK
FT                   C"
FT   gene            214368..214787
FT                   /locus_tag="MmarC5_0247"
FT   CDS_pept        214368..214787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34563"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWI8"
FT                   /protein_id="ABO34563.1"
FT                   /translation="MTVKFIAGSEAVDVLDPATGQPIKTKEGWNKKDWVVSKRQMGKVT
FT                   LTKGTGSTKKYMELTYLEFKELTEMNSKPQSKELIQYYSMVEALYNMKNLVAAGASKDF
FT                   IMKNVKELGYPESLAKLIIFGEIVSDEPKNEEIKA"
FT   gene            214814..216160
FT                   /locus_tag="MmarC5_0248"
FT   CDS_pept        214814..216160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA2804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34564"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWI9"
FT                   /protein_id="ABO34564.1"
FT                   /translation="MSSIKPPALTEEEHKRVSYEAVRKRNLLEKIKENNQKRPPTLAYP
FT                   RISLDRVMFSVFSHDIFKFVYDNKYDPAEIQHRINGVLQDLKENGIENLDVELPKKQHM
FT                   KYRKDVFIKYEQFKQNMIDHKGYSNGLHFSLCDFEGESIFWITISMREPHLAVVYINFQ
FT                   KYYRYKNKIDKPVGGFFDTNFLDISYDNRDKIFNDFAKLFLSVKNEIKKAYKSLIYQLF
FT                   GYDLEEVDVIPSTVEIPLEYLGNDVSEYEWLTDEAVCKTVLKYTDLTHTIYFNKNWKKL
FT                   LIQMKLYQKAAGIARLELTVHKNFASHYFCETDLETLKDKIKMCIDDVLAYYELSLHEI
FT                   KPVKLDHDEIVEQIALSMSLEKELLMTLIYNDVGELTFSADNQGLRTRLLKRGLIEKGD
FT                   KRGVYKKTNLLSFLKASLGKYFVCEKCGFLMMKKARGYVCPVCSNKKSF"
FT   gene            216233..216391
FT                   /locus_tag="MmarC5_0249"
FT   CDS_pept        216233..216391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34565"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWJ0"
FT                   /protein_id="ABO34565.1"
FT                   /translation="MDIEVYSHIKNGILIFEIEIPANDRLTNPKMIMEAVSVLKRFAEE
FT                   KREKMFF"
FT   gene            216399..216749
FT                   /locus_tag="MmarC5_0250"
FT   CDS_pept        216399..216749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34566"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWJ1"
FT                   /protein_id="ABO34566.1"
FT                   /translation="MIAFITEIPKNNHIFEDSSVYHVNSKLKEIAMDRIKYMMDSCKFD
FT                   DSIENILDSNNIAYDSDDIDITISVGIETRKRHVLGLRLVKKSGYITYKMISQNSSKYD
FT                   LNPVVSWEDEAF"
FT   gene            216736..218190
FT                   /locus_tag="MmarC5_0251"
FT   CDS_pept        216736..218190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34567"
FT                   /db_xref="GOA:A4FWJ2"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWJ2"
FT                   /protein_id="ABO34567.1"
FT                   /translation="MKHFKKLFFILLFLIPFVNADEGEDYSDVSSYEALNSFTDSSGSD
FT                   IYTVDGCDIVSFKYNTTTKELNFEIYNSNSHSVTMTAYDIYSKRNTEITLDPGRNYKEF
FT                   HSVQLKSGRFCFVFWKEGGNMAIVKEFATPLTLQQKFYIASSNALGFLSLQSGFLFAFL
FT                   VVFGQLTIKELLYKRMLIDYWKQGCYVLILGFVGLIAAMLSIKYGLPFSMYEVLTIEKW
FT                   KFVLKLPFFDFSNWNLLYLISYFNWIYPLALIIGYSLGFKLSKPEYINIWYMNFKSNMR
FT                   DIKILPVSWERDIARVRWDDGKIRVLRMPHVNATKYINPMTGNLEDLYEVTSFELHDTE
FT                   EKVYNESTAINRILTWFEKFVDWVKDYFGRIHGVVTIDFSKIMNKTVAESIFLHDNLET
FT                   IAEEVNNWAKKFYNEKYQKSIKAQEFTAVAVEKIARDLNPLAMENATDILGDIEDFFDK
FT                   GIDIFKKDEKDDINEPDGDGTENTGQ"
FT   sig_peptide     216736..216798
FT                   /locus_tag="MmarC5_0251"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 21"
FT   gene            218195..218419
FT                   /locus_tag="MmarC5_0252"
FT   CDS_pept        218195..218419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34568"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWJ3"
FT                   /protein_id="ABO34568.1"
FT                   /translation="MSFEYVSRDNDILMSAMAKVSKKIRTIWMANRLRRLVSLKPELYP
FT                   IYIKATGDKNSFKSFISALENERMKEETK"
FT   gene            218419..219054
FT                   /locus_tag="MmarC5_0253"
FT   CDS_pept        218419..219054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34569"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWJ4"
FT                   /protein_id="ABO34569.1"
FT                   /translation="MVNSALYGEYDLSLMKEHTLAKSLGFDVEIDFSDSEISILELVDM
FT                   YKPYNEHLSICIDGKRGSFKTTHLIAMHEECKKLGLKSVFIKTKADFEKLKGRRDLDIV
FT                   FIDDIAKYFYKRDGATKINKAFAKILQMVRTIVPVIIATTPDLSLLDKDGRAFFIEAYV
FT                   LRKGTISMMGVNIGVEAPNIEFYNGFKDKEHDTRFKEFDELVGIISQN"
FT   gene            220231..221025
FT                   /locus_tag="MmarC5_0254"
FT   CDS_pept        220231..221025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0254"
FT                   /product="protein of unknown function DUF890"
FT                   /note="PFAM: protein of unknown function DUF890; KEGG:
FT                   mmp:MMP1339 SAM (and some other nucleotide) binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34570"
FT                   /db_xref="GOA:A4FWJ5"
FT                   /db_xref="InterPro:IPR010286"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWJ5"
FT                   /protein_id="ABO34570.1"
FT                   /translation="MKQEPLELGLKIEDAILVNEKLKDFVVYKSGKPRIDFKNKEAMKE
FT                   YNIAILRHVFGLDMDFHEDALIPTPINRYLFIKNIFDEKEDIKEVLEIGTGSGIISILI
FT                   AKYFECNVTATDTVFDYLKIAEENISKNNLNSKINLVDSKGKIIFDIPELKNKKFDLII
FT                   SYPPYYADNSVASKRSFGGAFASEVELIGGGSYGEVFSQKIIQEGMNYLNNGGIIAIMF
FT                   PEKPFERRKLVEDKILELGLTLEKSEITTGKRIRHIIKAKNE"
FT   gene            complement(221049..221243)
FT                   /locus_tag="MmarC5_0255"
FT   CDS_pept        complement(221049..221243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34571"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWJ6"
FT                   /protein_id="ABO34571.1"
FT                   /translation="MKSYKIKLFFTGDEDSVKTEIVEAENPFEAKEMLLKKYGVVTPRI
FT                   KDKSFEILSKIEILGYNIL"
FT   gene            complement(221371..221853)
FT                   /locus_tag="MmarC5_0256"
FT   CDS_pept        complement(221371..221853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0256"
FT                   /product="coenzyme F420-reducing hydrogenase, delta
FT                   subunit"
FT                   /EC_number="1.12.98.1"
FT                   /note="TIGRFAM: hydrogenase maturation protease; coenzyme
FT                   F420-reducing hydrogenase delta subunit; hydrogenase
FT                   maturation peptidase superfamily; PFAM: peptidase M52,
FT                   hydrogen uptake protein; KEGG: mmp:MMP1337 hydrogenase
FT                   maturation protease, related"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34572"
FT                   /db_xref="GOA:A4FWJ7"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004411"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWJ7"
FT                   /protein_id="ABO34572.1"
FT                   /translation="MIPDSLKYEILVFGCGNLVFADDGFGYEVISKLEKMELPENVGII
FT                   DAGTGAPYYLMSIMDEECVTKKIIIVDIIDFQLPPGTLKILSTDELTKIDKYTFDAHDM
FT                   PLSDYLIKAQESGIDVTVIGCQAKRVTMPDIEVGLTDEVKASLDGAVKLVLEKISE"
FT   gene            221961..223367
FT                   /locus_tag="MmarC5_0257"
FT   CDS_pept        221961..223367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0257"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor SelB"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; small GTP-binding protein; PFAM: protein
FT                   synthesis factor, GTP-binding; elongation factor Tu, domain
FT                   2 protein; KEGG: mmp:MMP1336 archaeal translation factor
FT                   specialized for selenocysteine insertion"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34573"
FT                   /db_xref="GOA:A4FWJ8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038661"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWJ8"
FT                   /protein_id="ABO34573.1"
FT                   /translation="MDFKNINLGIFGHIDHGKTTLSKVLTEIASTSAHDKLPESQKRGI
FT                   TIDIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVADAKEGPKTQTGEHM
FT                   LILDHFNIPTIVVITKSDNAQNEEIKRTEMFMKSILQSTQNLKNSPLIPISAKTGFGVD
FT                   ELKNLIVNMLNSTEIIRNTDSYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLP
FT                   INMSTKVRSIQCFKESVMEAKAGDRVGMAIQGVESKQIYRGCILTSKDTKLQTVDKIVA
FT                   KIRISDIFKYNLTPKMKVHLNVGMLIVPAVVVPFKKVKFGKSEENVILNEVVSGDECYC
FT                   AFELEEKVLAEVGDRVLITRLDLPPTTLRICGHGLIEEFKPIKDLNIKKEVLREGKVKI
FT                   DKGRTVIDELAQSKVAAEKLIGEEISIGGKDVVGKIKGTFGTKGLLTAEFSGTVENRDK
FT                   VLLNRLRRWG"
FT   gene            223378..224331
FT                   /locus_tag="MmarC5_0258"
FT   CDS_pept        223378..224331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0258"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="TIGRFAM: mevalonate kinase; PFAM: GHMP kinase; GHMP
FT                   kinase, C terminal domain protein; KEGG: mmp:MMP1335
FT                   mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34574"
FT                   /db_xref="GOA:A4FWJ9"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022937"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWJ9"
FT                   /protein_id="ABO34574.1"
FT                   /translation="MKKIKTPSKIILFGEHAVVDGYPAISMALDLKTTGEIEENSDTIS
FT                   IDLVDLNEIFEITPELIKNLEISNFSPALKYVICAVKSVIFYLSEFKDLKEIKPFKLKL
FT                   YSEIPLSCGLGSSASVVVTVIRSISNFYGIELDNDETINLAYSVEKEVQGRASVTDTAT
FT                   ISLGGMIEIINGEYKPMPKDLEEFIKTCKFLVVNVEERTRKTAELVHDVSKHPEKEQIF
FT                   EEIGNIIQKVRQVTEKAELGKLMNENHELLRKFGISTEKLDLVAKAGQKYGYGGKLTGA
FT                   GGGGSAIILLKEDQNELLNELKKIGVIGIYECKMAN"
FT   gene            complement(224349..225503)
FT                   /locus_tag="MmarC5_0259"
FT   CDS_pept        complement(224349..225503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0259"
FT                   /product="Ras superfamily GTP-binding protein YlqF"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; KEGG:
FT                   mmp:MMP1334 solute-binding protein/glutamate
FT                   receptor:ATP/GTP-binding site motif A (P-loop):GTP-binding
FT                   protein, HSR1-related:GTP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34575"
FT                   /db_xref="GOA:A4FWK0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWK0"
FT                   /protein_id="ABO34575.1"
FT                   /translation="MLNNSVKHLKMDNMENKIPMKRMVHKIIYECNIVLLVVDARDPET
FT                   TRNRALEKYTIEKNKKLIYVINKSDLVPKKILEKWKEQFKSENPDSSVVFVSAKEKLGT
FT                   KMLRDEIKVYLNSNNIKYGQVGIVGYPNVGKSSVINALTGKKSARSGLTAGLTVGEQWV
FT                   KLTKDIKLLDSPGIIEPKDEDELVISGALRYEKADDVISPALKILNRIHTFDNTILKEY
FT                   YGFDIGEDINMELLEKIGTKLNFLTKDGKIDIDRTSKSIIREFQNGKLNYHRMNLKKYE
FT                   QKRTKNIDFITKNLENFPFINDADQIISHLENIDELGRMNTRPVIGIKELDDAFVIISF
FT                   SEKSRDTGRKKVEELARTDDIELYSLGGGRIGKHRIYVGVGEKR"
FT   gene            complement(225895..227016)
FT                   /locus_tag="MmarC5_0260"
FT   CDS_pept        complement(225895..227016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0260"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase; KEGG: mmp:MMP1333
FT                   chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34576"
FT                   /db_xref="GOA:A4FWK1"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWK1"
FT                   /protein_id="ABO34576.1"
FT                   /translation="MNTFGDNFRVTTWGESHGKALGAVIDGCPSNLPISEEDIQNELNR
FT                   RRPGYSIFSTPRKEEDKLEILSGIFEGKTTGTPISGLVFNKGQKSKDYSKIKNTPRPGH
FT                   ADLNYFLKYGNYDYRGGGRSSGRTTIGNVIGGAVAKKLIEFTHNIKIIGYSTKIGKING
FT                   DFDYYKNPEFFESNSNIEKLFEKIENNPLRCPSKNSDEMKDYVLDAMDKQDSVGGIIEI
FT                   IIKGIPQGVGNPVFNKLEGKLGSAFIGINAVKGFEIGRGFESSELYGSEMNDSYYMNKD
FT                   SIKGKTNNTGGIIGGISTGSPVVLRVSIKPTPSISKIQESVNLISNENEKIEIGGRHDP
FT                   IIVPRVIPVLESMAAITVADLMISSGYIDPCRI"
FT   gene            227099..228253
FT                   /locus_tag="MmarC5_0261"
FT   CDS_pept        227099..228253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0261"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmp:MMP1332 NAD binding
FT                   site:FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34577"
FT                   /db_xref="GOA:A4FWK2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWK2"
FT                   /protein_id="ABO34577.1"
FT                   /translation="MIAVVGGGPAGLSCAHALARYGLKVELYEMDKLGGTCLNYGCRYV
FT                   NALKEVSDLIDNLNTITGKKHDLEDIISLNELHEKVYKIHRSMREGAKKTLDELGIFVK
FT                   FEEFKEEYEKNYDYVIYANGQNYAKNYLGVECAIHSELPYLKKLPRKILIIGAGTVAAE
FT                   YASIFSTFGSEVTVYVRSKFLKKIEDDEIRDYIINDLSNFKITHSEEELKKMLYDDEYF
FT                   NILAIGGTPRYTTNEYFQVDGKSKVYACGDSVRGGYTPIANREGKTVAENIYNEINNLP
FT                   LKKMDYGIEIATIRMPISILVVGKQTKDFKTSYNRPGKGYYFRKTEKRGMNRIYYENGR
FT                   AVGAVVMTTATELAPYFAQYLKGIDVYKDFLEVYPSTDPYYWQV"
FT   gene            228292..228765
FT                   /locus_tag="MmarC5_0262"
FT   CDS_pept        228292..228765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34578"
FT                   /db_xref="GOA:A4FWK3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWK3"
FT                   /protein_id="ABO34578.1"
FT                   /translation="MDFVAIGMDLVNTYGLLAIFLIGFSEPIFQPIPTEVFMLGGLALG
FT                   LDWGYVILASTLGSTLGGIVTYFIASKYGENLFLKIFNKEKYSSAEEFLNKWGPFGIIV
FT                   ISFTPIPFEVICWLSGIFKMPFKIYVSALIVSRIVKHGLVVLPFAALSTILPF"
FT   gene            228862..229128
FT                   /locus_tag="MmarC5_0263"
FT   CDS_pept        228862..229128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0263"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC);
FT                   KEGG: mmp:MMP1330 hydrogenase expression/formation protein
FT                   (HUPF/HYPC)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34579"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A8B1G2"
FT                   /protein_id="ABO34579.1"
FT                   /translation="MCLAIPSVVIDIFEEDGEKYALAEYKGVKQKAKLALIEGVEIGDY
FT                   VLIHTGYALEKMSEDEAKLSLDAWEELFDVLDEMDGVKKENSE"
FT   gene            complement(229150..229338)
FT                   /locus_tag="MmarC5_0264"
FT   CDS_pept        complement(229150..229338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0264"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1329 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34580"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWK5"
FT                   /protein_id="ABO34580.1"
FT                   /translation="MSVVIDYDKCKGPECAECVNTCPVEVFEIQGDKVVVARESDCTFC
FT                   LVCVDVCPTGAITVKED"
FT   gene            complement(229385..230320)
FT                   /locus_tag="MmarC5_0265"
FT   CDS_pept        complement(229385..230320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0265"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: mmp:MMP1328 enolase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34581"
FT                   /db_xref="GOA:A4FWK6"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWK6"
FT                   /protein_id="ABO34581.1"
FT                   /translation="MENSTSIKRITAKKVFKDSKIQVRIATLTNKGIGYDVIDAENPDY
FT                   VISDVENVIAPELVGYPAYDQDIIDSIICDTSVDSPKVTMGTSLSVARAAANSVEIPLF
FT                   KHIGGVLSTNLPIVGCSLVSDGMNQLLTIPMAESIGEMIYVYNKILEKLSEEYDFKNNY
FT                   GEYVSKNIFKDIGKFKEIISNISEDEDIEILSGANISEFRKEIEELDYLESSEIIEFDG
FT                   ILCTENIDEEADFSKIDPYSMGTLTEMNYYINYTIEKGLTPTISGNNTSFPHIAIGFKV
FT                   PFLRANINSKALNEIWNIERILNSPNITRF"
FT   gene            complement(230353..230529)
FT                   /locus_tag="MmarC5_0266"
FT   CDS_pept        complement(230353..230529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0266"
FT                   /product="RNA polymerase Rpb6"
FT                   /note="PFAM: RNA polymerase Rpb6; KEGG: mmp:MMP1327
FT                   DNA-directed RNA polymerase, subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34582"
FT                   /db_xref="GOA:A4FWK7"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWK7"
FT                   /protein_id="ABO34582.1"
FT                   /translation="MKLTKFETARLVGARSLQISDGAPLTIESDKTSSLNLAEDEVKQG
FT                   KLPLCVKKQAKKQ"
FT   gene            complement(230567..230640)
FT                   /pseudo
FT                   /locus_tag="MmarC5_R0006"
FT                   /note="tRNA-OTHER2"
FT   tRNA            complement(230567..230640)
FT                   /pseudo
FT                   /locus_tag="MmarC5_R0006"
FT                   /product="tRNA-OTHER"
FT   gene            complement(230675..230881)
FT                   /locus_tag="MmarC5_0267"
FT   CDS_pept        complement(230675..230881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0267"
FT                   /product="DNA-directed RNA polymerase, subunit N"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerases N/8 Kd subunits; KEGG:
FT                   mmp:MMP1326 DNA-directed RNA polymerase, subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34583"
FT                   /db_xref="GOA:A4FWK8"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWK8"
FT                   /protein_id="ABO34583.1"
FT                   /translation="MIFPIRCFSCGAVISEVYEEYRTRLKNGENPEEILNDLEVKKYCC
FT                   RRMFASHRLDNDRELFDDIVEYK"
FT   gene            complement(230920..231324)
FT                   /locus_tag="MmarC5_0268"
FT   CDS_pept        complement(230920..231324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0268"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="PFAM: ribosomal protein S9; KEGG: mmp:MMP1325 SSU
FT                   ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34584"
FT                   /db_xref="GOA:A4FWK9"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019958"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWK9"
FT                   /protein_id="ABO34584.1"
FT                   /translation="MKVVHTVGKRRTAIARATAKEGSGKIRINKKPLELMEPKYIKMKL
FT                   MEPVILAGEALSDIDVDIDVKGGGIVSQMDATRTALGKAIVEFTGKMELKEKFLSYDRT
FT                   LLVSDARRTEPHKPSKSSKGPRAKRQKSYR"
FT   gene            complement(231338..231751)
FT                   /locus_tag="MmarC5_0269"
FT   CDS_pept        complement(231338..231751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0269"
FT                   /product="LSU ribosomal protein L13P"
FT                   /note="TIGRFAM: ribosomal protein L13; KEGG: mmp:MMP1324
FT                   LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34585"
FT                   /db_xref="GOA:A4FWL0"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWL0"
FT                   /protein_id="ABO34585.1"
FT                   /translation="MVVVNAENAVVGRLASYVAKLALSGEEVTVVNAEKAIMTGNKEYI
FT                   FQKYVQLRTRKSISNPKKMGPKYPRRPDDIVRRVIRGMLPYKKPRGVEAFKKIKIEVGV
FT                   PEGVSIDINLGSAPNTIKYVTVGELSQYLGAKF"
FT   gene            complement(231772..232134)
FT                   /locus_tag="MmarC5_0270"
FT   CDS_pept        complement(231772..232134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0270"
FT                   /product="LSU ribosomal protein L18AE"
FT                   /note="PFAM: ribosomal protein L15; KEGG: mmp:MMP1323 LSU
FT                   ribosomal protein L18E"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34586"
FT                   /db_xref="GOA:A4FWL1"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR022947"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWL1"
FT                   /protein_id="ABO34586.1"
FT                   /translation="MKKIMSTNPKTPELIQKLKEESFKNSAPIWKDVAKKLAKPARKKV
FT                   EVNVSKISRYASEGDVILIPGKVLGAGSLKINVTVAAFSFSETAKSAIEAVGGKCLTIE
FT                   ELIAENPKGSKVTIMA"
FT   gene            complement(232195..232737)
FT                   /locus_tag="MmarC5_0271"
FT   CDS_pept        complement(232195..232737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0271"
FT                   /product="DNA-directed RNA polymerase, subunit D"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase, dimerisation; RNA polymerase,
FT                   insert; SMART: RNA polymerase, RpoA/D/Rpb3-type; KEGG:
FT                   mmp:MMP1322 DNA-directed RNA polymerase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34587"
FT                   /db_xref="GOA:A4FWL2"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWL2"
FT                   /protein_id="ABO34587.1"
FT                   /translation="MKMELKAPLSFSSALRRIMISEVPTYAIENVYFYENTSSMYDEVL
FT                   AHRLGLVPIKGVPVSGDEVIVLTISKEGPCMVYSSDIKSESGEPAFENIPIVKLAEGQK
FT                   LELEAEALVGTGKIHAKWQPCNAVYKQISNDEVEFKIESFGNMDAEDIIRSSLEILKNK
FT                   AEKFLSELEGQELSDEN"
FT   gene            complement(232795..233169)
FT                   /locus_tag="MmarC5_0272"
FT   CDS_pept        complement(232795..233169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0272"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: mmp:MMP1321 SSU
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34588"
FT                   /db_xref="GOA:A4FWL3"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019961"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWL3"
FT                   /protein_id="ABO34588.1"
FT                   /translation="MSQKWGLVHIYASYNNTILHVTDLTGAETIAKVSGGMIVRNQRDE
FT                   SSPYAAMQAAFKIADLMRDKGIDQVHVKVRATGGQKSKNPGPGAQAAIRALSRAGIRIG
FT                   RIEDATPIPHDGTTPKRKNR"
FT   gene            complement(233179..233715)
FT                   /locus_tag="MmarC5_0273"
FT   CDS_pept        complement(233179..233715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0273"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="TIGRFAM: ribosomal protein S4; PFAM: RNA-binding S4
FT                   domain protein; KEGG: mmp:MMP1320 SSU ribosomal protein S4P
FT                   (S9E)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34589"
FT                   /db_xref="GOA:A4FWL4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR022802"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWL4"
FT                   /protein_id="ABO34589.1"
FT                   /translation="MGDPRRLGKKYDTPNHPWIGERIQSEKEISQKYGLVNKKELWKME
FT                   TQLRNYRRQARKLISDTTTQGGKEAVQLFNVLKRYAILVESEPTLDHVLSLNIESILER
FT                   RLQTIVYRKGLAKTAKQARQFIVHGHIAVNGKRVTAPAYLVSVAENDAIEYVPNSPMAS
FT                   ENHPERTAAVSEENQ"
FT   gene            complement(233736..234185)
FT                   /locus_tag="MmarC5_0274"
FT   CDS_pept        complement(233736..234185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0274"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13; KEGG: mmp:MMP1319 SSU
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34590"
FT                   /db_xref="GOA:A4FWL5"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR019977"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWL5"
FT                   /protein_id="ABO34590.1"
FT                   /translation="MTQTEFKHRIRISKTDLEGKNPLEYALQEMKGIGRAMARAVIRVT
FT                   ELDPKQQAGYLADEDVLKIESVLEDPATHGIPSWMFNRKKDVYSGLDKHLIETDLVLTV
FT                   QEDITNMKKIRCYKGVRHELRLPCRGQRTRGSFRKGTSMGVKRRK"
FT   gene            complement(234245..234332)
FT                   /locus_tag="MmarC5_R0007"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(234245..234332)
FT                   /locus_tag="MmarC5_R0007"
FT                   /product="tRNA-Ser"
FT   gene            234698..234771
FT                   /locus_tag="MmarC5_R0008"
FT                   /note="tRNA-Cys1"
FT   tRNA            234698..234771
FT                   /locus_tag="MmarC5_R0008"
FT                   /product="tRNA-Cys"
FT   gene            234952..236553
FT                   /locus_tag="MmarC5_0275"
FT   CDS_pept        234952..236553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0275"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="KEGG: mmp:MMP1318 lysyl-tRNA synthetase; TIGRFAM:
FT                   lysyl-tRNA synthetase; PFAM: Lysyl-tRNA synthetase, class
FT                   1c"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34591"
FT                   /db_xref="GOA:A4FWL6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="InterPro:IPR042078"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWL6"
FT                   /protein_id="ABO34591.1"
FT                   /translation="MHWADATSEKIMKKRNADEYVVSSGITPSGHIHIGNARETLTADA
FT                   VYKGIVKKGAKAKLIFVADDYDPLRKLYPFLPQEFEKYIGMPLSEIPCPKGCCKSYADH
FT                   FLMPFLNSLEELGVDITTHRANECYKAGMYNDAIINALENRLKIKEILDSYRKEPLADD
FT                   WFPLNVVCEKCGKMHETKVTAYNSEDKTITYVCKCGFENTVQPFNGVGKLPWRVDWPAR
FT                   WGIFGVTAEPMGKDHAASGGSYDTGIKIARQIYGYQAPEKMVYEWIQLKIGDKAMPMSS
FT                   SSGVVFAVKDWNEICHPEILRFLILKGKPTKHIDFDLKAISNLVDDYDELERKYFELIE
FT                   KQKIEELNDNESEKISLYELVTPKIPERLPLQVAYRFCSIIAQIALDKETQKIDMERVF
FT                   DILGRNGYNPAEFSEYDKSRLEKRLYMSKKWASDYGENLEINDLEQAKEQYETLSEEQK
FT                   AWLKAFSEEVEQIEIDATTIHELMYETATKLELAPKEAFVASYKILLGKNYGPKLGSFL
FT                   ASLKKEFVVGRFSLTE"
FT   gene            236704..237480
FT                   /locus_tag="MmarC5_0276"
FT   CDS_pept        236704..237480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34592"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWL7"
FT                   /protein_id="ABO34592.1"
FT                   /translation="MIETISYQELKGNNKEIVDEQFEKLIAEITEKYGAKVLSNESDEE
FT                   GELYTRITELKIKFETVLDYIKYCLMYGADLDVVSPTKLKISGNEMGNTIGYIIDFFKK
FT                   FAQKYGVAFNVYVKNEIDADLNALKEGRCDEDDIYLMESEEGLLRVKAVFEGDGKTEEI
FT                   IIKKILASLNQDIVVNKVITKSMDESKGIFSGLVAIEMFCKPFDIVEVAYKFLPVAISF
FT                   ENSDIELDISELQDIGNDLGGAVFELTHAAANMNKK"
FT   gene            237580..238377
FT                   /locus_tag="MmarC5_0277"
FT   CDS_pept        237580..238377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0277"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: mmp:MMP1316 2-oxoglutarate
FT                   oxidoreductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34593"
FT                   /db_xref="GOA:A4FWL8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWL8"
FT                   /protein_id="ABO34593.1"
FT                   /translation="MHPSLKYMRKDRLPHIFCSGCGNGIVLNCFTNALDKLALKNEDYI
FT                   AISGIGCSSRVPGYLFCDSLHTTHGRPIAFALGTKVIQNDKKVVVFTGDGDLSAIGGNH
FT                   FIHGCRRNIDITVICINNNIYGMTGGQCSPTTPHEKKATTAPYGNPENPLDLCELAKAA
FT                   GATYVARWTTANPIQLANSIKKGMDKKGFSFIEVVSQCPTYYGRFNVSRKPSEMMKNLK
FT                   ESAITVRKAESMEKEELLNKIVVGEFLNIEKPEYVEQLKKLQE"
FT   gene            238387..238920
FT                   /locus_tag="MmarC5_0278"
FT   CDS_pept        238387..238920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0278"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: mmp:MMP1315 2-oxoglutarate oxidoreductase gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34594"
FT                   /db_xref="GOA:A4FWL9"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWL9"
FT                   /protein_id="ABO34594.1"
FT                   /translation="MRKEIRFSGFGGQGIILAGVILGRAASLYAGKEAVQTQSYGPEAR
FT                   GGASKSEVVISEIEIDFPKVIQPDILISMSQPAFDKYGYDLKENARVIVDRDLVNLPEG
FT                   YEEKYEVYKVPFTEIANKEVGLGIVANIVMLGALTKLSGLVPKEEVEKALLDSIPKGTE
FT                   KKNLMAFEKGYEYL"
FT   gene            239248..241533
FT                   /locus_tag="MmarC5_0279"
FT   CDS_pept        239248..241533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0279"
FT                   /product="phosphoesterase, RecJ domain protein"
FT                   /note="PFAM: phosphoesterase, RecJ domain protein; RNA
FT                   binding S1 domain protein; nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; KEGG: mmp:MMP1314 phosphoesterase,
FT                   RecJ-like:RNA binding S1:OB-fold nucleic acid binding
FT                   domain related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34595"
FT                   /db_xref="GOA:A4FWM0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWM0"
FT                   /protein_id="ABO34595.1"
FT                   /translation="MIENCKICGGTGKKVVKYSECPECEGKGYLEEFETKSHFKNASKN
FT                   SKYDFDDEEIPCPTCNGTGKIPEYEDCEYCNGTGKVVKCDSCGREIGKYPEDKDLNTCE
FT                   NCSGKEEAQKENKKVVYVLDNMFTMSDLEEGKFYKGKINRTEKYGVFVQLNEKTRGLLR
FT                   FREVVGKRPSDFKIGDEIIVQVSELKLEKRELDLRYVPITGYKLEKLEKEHELIDIKEI
FT                   FDTGLMNMKDKVIRVQGEVLQAAQTPGPTVFTITDGSEVAWVAAFESAGVRTHPDVVMG
FT                   SIIDVVGSVSVRDGKLQIERMKLVKLEGEAEQKVMDKIDIELDKKAEPESDIEFLVESD
FT                   ILEKLRPKMADVAKRIRRAVLDGRPVIIRHHADTDGYCGGIALEKAIIPVLEKYSMDSG
FT                   AQWHYFRRSPSKAPFYELEDVTKDLLFSIEDFLRFGQKMPLIVLVDNGSTNEDIPAVSQ
FT                   VKAYDIEVVVVDHHFPGEVIDGKVEIDEFVEAHVNPYLVGGDSNLTAGALATEVARMIN
FT                   SEVTELVEHLPGIAVVGDHAKGEAVEAYIKIALERLTKCSSEFGTGKIYSRADVEKIGQ
FT                   CMDFEAFYLKFMNGMGIVEDIYGMNKKDFARHEKLINILYERAMAMVDRQMKAVRPAIK
FT                   TQILPNGIVFNTLDVEKYAHKFTFPAPGKTCGFAHDSIVEQYEAGTPVITLSYGPDFAV
FT                   VRATDAVSEKFNFNLNHIVTRFIEEIPEASLDGGGHECAGSLKFVEGLREKVINRFAEV
FT                   VLEMKEKD"
FT   gene            241572..242546
FT                   /locus_tag="MmarC5_0280"
FT   CDS_pept        241572..242546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0280"
FT                   /product="flap endonuclease 1"
FT                   /EC_number="3.1.-.-"
FT                   /note="PFAM: XPG-like; XPG I; SMART: Helix-hairpin-helix
FT                   domain protein, class 2; KEGG: mmp:MMP1313 flap
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34596"
FT                   /db_xref="GOA:A4FWM1"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019973"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWM1"
FT                   /protein_id="ABO34596.1"
FT                   /translation="MGVQFGDLIPKTEISLKFLKNKTVAIDAMNVIYQFLSSIRLRDGS
FT                   PLKNKNGEITSTYNGIFYKTIYMLENEMTPIWVFDGKSHDLKEKTKEERRKSRNGALDS
FT                   YLEAKEQNNLEEMQKYAKRANFLDKKTIDNSKKLLELMGIPYINAPSEGEAQCAELVKS
FT                   NDAFCVISQDYDSILYGAENVVKNITSSNKDIELIELEKTLSELNVSLDQLIDVAILIG
FT                   TDYNPGGLKGFGPKKAIDTVKKGKMENYISEIENYSEIRKIFDEPNVTSEYDTKLKTPK
FT                   KEELAEFLIEENDFSKDRILPNIEKISNLLGNKKSQKSLEAWF"
FT   gene            242555..243181
FT                   /locus_tag="MmarC5_0281"
FT   CDS_pept        242555..243181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34597"
FT                   /db_xref="GOA:A4FWM2"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWM2"
FT                   /protein_id="ABO34597.1"
FT                   /translation="MMKIYSLNKISPIFWIFLIPLIIIGLILIIPIIFLAIVLGAIYLC
FT                   YKKLKSGINGIIRKLKTKKIKVTGSSDNGEVQINFSKKVEIEEETIEENIPVISEDTGE
FT                   KWEHKQFINYLMNNGLSENDGKLYYFDKSVYPIYKKTYPVNEVVKLYDEIPEEDMIVLG
FT                   LKGDYDDPKLLYLIPKEKCKSRMGISELKEYEINLKNQEINNLSL"
FT   sig_peptide     242555..242677
FT                   /locus_tag="MmarC5_0281"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.617) with cleavage site probability 0.588 at
FT                   residue 41"
FT   gene            243200..243358
FT                   /locus_tag="MmarC5_0282"
FT   CDS_pept        243200..243358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0282"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1311 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34598"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWM3"
FT                   /protein_id="ABO34598.1"
FT                   /translation="MEILDKCVGCAGCVPFCPVGAISAFGKAEIDNEICTNCAVCKDYC
FT                   PLDAISE"
FT   gene            243384..243989
FT                   /locus_tag="MmarC5_0283"
FT   CDS_pept        243384..243989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0283"
FT                   /product="IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="PFAM: IMP cyclohydrolase; KEGG: mmp:MMP1310 IMP
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34599"
FT                   /db_xref="GOA:A4FWM4"
FT                   /db_xref="InterPro:IPR010191"
FT                   /db_xref="InterPro:IPR020600"
FT                   /db_xref="InterPro:IPR036795"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWM4"
FT                   /protein_id="ABO34599.1"
FT                   /translation="MYIGRFLVFGKTEEGYPFVTYRVSSRSFPNRLAKVMDDDTVSILP
FT                   KELEEMFKNPYITYNCVKLVGDVAVATNGSHTDIIADKIKLGLPIRDALSYSLLTMDYE
FT                   KDDYNTPRIAVVITKDEAYMGYVTDSDVRIKKVELEAGKAYYLGVYDACKITEHQVISV
FT                   TGKTAEDLTKFVMDYEEFEKPVTAATVLVKDGFKLATL"
FT   gene            244023..244634
FT                   /locus_tag="MmarC5_0284"
FT   CDS_pept        244023..244634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34600"
FT                   /db_xref="InterPro:IPR019218"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWM5"
FT                   /protein_id="ABO34600.1"
FT                   /translation="MKIYNNFENKCPKKLFLAGIHGNESKYTSQILENLQKNISKLKVS
FT                   GNIIIIPELVNDSKYYSTLTPKYYETEEGISLLKLIEEYTPEFYFEIHSYSEKSYSNLT
FT                   ELKRVDLKGIPPFVDLDNGVLMASISPILREKFKETNFCMALEVPNGKVLEVEKIVLEI
FT                   LEFGITSKDRNELIEKIFNKYPKSAKTAKWLAEEFNLTFL"
FT   gene            244709..245356
FT                   /locus_tag="MmarC5_0285"
FT   CDS_pept        244709..245356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0285"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: mmp:MMP1308 transaldolase; TIGRFAM: putative
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34601"
FT                   /db_xref="GOA:A4FWM6"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWM6"
FT                   /protein_id="ABO34601.1"
FT                   /translation="MKFFLDTANVEKIKEFNALGLVDGVTTNPSLIKKEGRDFYEVIKE
FT                   ICSIVDGPVSAEVIALDAEGMVKEARELVKIAENVVVKIPMTKEGMKAVNTLSNEGIKT
FT                   NVTLIFSANQALLAAKAGASYVSPFVGRLDDVGQDGMFLISEVMQVFGAYGIETEVIVA
FT                   SVRHPIHVLESAKMGADIATIPFDVLDKLFNHPLTDNGIAKFLADWEAHTNR"
FT   gene            245408..246550
FT                   /locus_tag="MmarC5_0286"
FT   CDS_pept        245408..246550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0286"
FT                   /product="SAM-dependent methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: protein of unknown function Met10;
FT                   methyltransferase small; SMART: PUA domain containing
FT                   protein; KEGG: mmp:MMP1307 methyltransferase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34602"
FT                   /db_xref="GOA:A4FWM7"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWM7"
FT                   /protein_id="ABO34602.1"
FT                   /translation="MSFQIDKRAYQSLKNFSNIIYKNAIVNKDDFSKTEEIVDITYNGN
FT                   FVAKALYDPKFPLIKILTRENEEIDKDFFFKRINNANRYRTDILNYKDTYRMIYAEADY
FT                   LPSIILDKYNKIASIQISSNIMDNYSDLIFECISEITDVETMYVQSGKKGSDVKTKIFG
FT                   DKSQIETVISEGNAKFNVNMNGHKTGFFLDQRDNRIDLENYVKPGDKVLDICSYTGGFA
FT                   VHAGIKGGEVTAVDLSDKALAVAEENMELNGVKNYNCIVSNAFDAMKEMIKNNEKFDVV
FT                   VLDPPAFTDSSKDIKNALNAYNSMNYLGLKLAKRILVTCSCSHHIDRESFKHTIVSSSL
FT                   RAKKEIRQIGSYRTQAPDHIITMANKDLEYLKCLFFNVVN"
FT   gene            246614..247375
FT                   /locus_tag="MmarC5_0287"
FT   CDS_pept        246614..247375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0287"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="PFAM: Protein of unknown function DUF137; KEGG:
FT                   mmp:MMP1306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34603"
FT                   /db_xref="GOA:A4FWM8"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWM8"
FT                   /protein_id="ABO34603.1"
FT                   /translation="MMVPESHPRYKSLLNRDRIVEAFESGVLAKGGMIAHGRGETFDYL
FT                   IGENTTDVALNSIKVSAALLVLAENPVISVNGNSVALAKDEFVELAKELNGKIEVNLFY
FT                   RTTEREEKIKDVFENDIKNGIVLLGIDNADKQIPGVDHLRGKVSESGIYTSDVILVPLE
FT                   DGDRAEALVKMGKTVIAIDLNPLSRTARKSTISIIDELTRCIPLITEYVTEYKKMDRNE
FT                   LLKIVESYNNEENLRNILNLISKRLTSVDLI"
FT   gene            complement(247401..248804)
FT                   /locus_tag="MmarC5_0288"
FT   CDS_pept        complement(247401..248804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0288"
FT                   /product="domain of unknown function DUF1745"
FT                   /note="PFAM: domain of unknown function DUF1745; KEGG:
FT                   mmp:MMP1305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34604"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWM9"
FT                   /protein_id="ABO34604.1"
FT                   /translation="MEFIEFGYGTSTDKNSLKAGAHAASDALKMMKKYSEKPNIVFLYS
FT                   SPDYDPEEVLNGVKLILGNTVQIVGGSSKFQVCGNKFLENGVSIGILGSKYFSTGMGVG
FT                   LGISINPKESGKKAVKDAVENLGMLPKLLYVIMDFCKCEEQVLKGVVEELGVTIPVFGG
FT                   VSSDNFEFEHTYQYGNDVYLDSIVCVAFGGDIVPKISYNNYEYNENQGKLENLITKSEK
FT                   RSIEEIGKVSAVKRYIEISGYEGSEKELEKDPEFYLSHPLGILDTAGDIHFKGPIAIKN
FT                   KKLITGSNISNSNELKIENIDKNELKHIFETNTNVLKNTQPHYDPAFTFCNISSFLSEI
FT                   DPEKIGKLIENSDVNPFFGSSTFGEISFRKYGNYSMSMCSFAPDLVTISAKEGIHMFTK
FT                   HPATKETLLKIHELGGSVKVEELAKALGIHRRSAYDRIDPLLKYGFIEKDQAVITITDF
FT                   GKLLLKFEF"
FT   gene            249028..249387
FT                   /locus_tag="MmarC5_0289"
FT   CDS_pept        249028..249387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0289"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: mmp:MMP1304
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34605"
FT                   /db_xref="GOA:A4FWN0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWN0"
FT                   /protein_id="ABO34605.1"
FT                   /translation="MKKILVVEDEEDILNLVKIILEINNYDVIVAHDGYQGLEQIKENP
FT                   DLIILDIMMPGMTGWEFLDKIRQDGFDIPVIVLTANAQMSTLETAIDKKVDDCIVKPFD
FT                   REDLMEKVSTILNKN"
FT   gene            249412..251331
FT                   /locus_tag="MmarC5_0290"
FT   CDS_pept        249412..251331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0290"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: mmp:MMP1303 sensory transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34606"
FT                   /db_xref="GOA:A4FWN1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWN1"
FT                   /protein_id="ABO34606.1"
FT                   /translation="MNTIPPIKRLGTKLIIYSIITALIPIVMLGAVSTDTINTEMTKQA
FT                   QEKINDDLNTAESVVNLKLDKISAMNRYIVLNENTVDILKNKDISELKNLALSYKDASD
FT                   PDFVVFFDNTGQVIARSNSDVSGDISYDNLFKKVVNSTGYTSIEVLDKEAIKYEDVDEV
FT                   VNIDIKGTEDSIDSTDSVQDSAMALISMEPIYDEDGTLLGAAMAVDILNKDYSIVDTVK
FT                   DASKDATTIFLDGVRISTNVQDNGGRAIGTLVSEEVYKYVVLGGNTYYGRAFVVNEWYL
FT                   TAYEPIYDSDDKIIGMLFVGTPESKFLALQADVRNQTFAVGLIGLFIALLVSYLINRGI
FT                   IKPLEQLKQGAERLSNGRYDQKVIVDSDDEFGELAKAFNKMATQINISDEKLKKHAEEL
FT                   KASYNELKELDNLKSELIAIVSHELRTPLTSIKGYVELVLDGTMGAINDSQRKCLQVAD
FT                   DNIVRLRRLIESMLDLSKIERGELEMYREKVNICEIVGDVIQYLKPLATEKNIKLNKNV
FT                   EKITLEADKDRITQVLTNLIENAIKFSPANESILVNGTLEDEGLHLKVTDHGAGIPKKD
FT                   MEKVFDRFYQVDSSTKRKKGGSGLGLAVCKSIVEAHGGSIWVESELGKGSTFHIILPIS
FT                   VEGQ"
FT   sig_peptide     249412..249513
FT                   /locus_tag="MmarC5_0290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.751) with cleavage site probability 0.408 at
FT                   residue 34"
FT   gene            251544..251789
FT                   /locus_tag="MmarC5_0291"
FT   CDS_pept        251544..251789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34607"
FT                   /db_xref="InterPro:IPR021603"
FT                   /db_xref="InterPro:IPR038549"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWN2"
FT                   /protein_id="ABO34607.1"
FT                   /translation="MVFEGKFIITTADDIPGLGLYYMGIVSAVSDNVDAIVKDLEEQVL
FT                   AKGGMGLIAFRITCADGKYLGYGTAVKADEAQFTMA"
FT   gene            252025..252849
FT                   /locus_tag="MmarC5_0292"
FT   CDS_pept        252025..252849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0292"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG: mmp:MMP1301
FT                   formate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34608"
FT                   /db_xref="GOA:A4FWN3"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWN3"
FT                   /protein_id="ABO34608.1"
FT                   /translation="MDVNPPDKMVELAGNAGQVKGNLSPSQLLVRGVMGGAYIAMGGGL
FT                   ATVVGTGIGAAMGAGLGKFMAAAVFPVGLILIVLTGMELVTGDMMLLPVAVFQKKASYA
FT                   QLIKVWIYVYIGNLIGSLIYASMMAFGPLRSFDSATGAASVNAFGQTAIGTAQAKVLPY
FT                   MAAGSAGWLAALVKGIGCNWLVNLAVIGSMASTSILGKFFMIWFPIMAFVATGFEHCVA
FT                   NMYFIPAGMMLGATVTVVDWWIWNIIPVTIGNIIGAVVFVSMIYQFAYGKKI"
FT   gene            252887..253420
FT                   /locus_tag="MmarC5_0293"
FT   CDS_pept        252887..253420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34609"
FT                   /db_xref="GOA:A4FWN4"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWN4"
FT                   /protein_id="ABO34609.1"
FT                   /translation="MQLNVSLSDLKRHAKTTPSAFISLIICLVFTAWSLYVSRNIWILI
FT                   MAIPFILGLTLIPIKISQMNKELSDQLLPEYVHYAEEYKISEITKDNLNQRVKVIGKLD
FT                   KVVYGISTKPTIRIKDDTGEIFSNLISPVPEGIKKGDIIELYGVVAKHYKFFGIMGIPN
FT                   LWKPKIYGIGIRKI"
FT   gene            253441..253893
FT                   /locus_tag="MmarC5_0294"
FT   CDS_pept        253441..253893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0294"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: mmp:MMP1299 carbonic
FT                   anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34610"
FT                   /db_xref="GOA:A4FWN5"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWN5"
FT                   /protein_id="ABO34610.1"
FT                   /translation="MGENAKPKKKLAIVTCMDTRLVNFLSEKLGIAQGDAKVIKNAGNI
FT                   ITEDVIRSLVVAVYLLDVEDIMIVGHTDCGMAAADFEIVKKKMVERGANPNFTPDFEAW
FT                   LGRMHCEETNVVEGVELLKNHPAFPKDINIDGYIMDIETGDLVKIA"
FT   gene            254197..256221
FT                   /locus_tag="MmarC5_0295"
FT   CDS_pept        254197..256221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:254590..254592,aa:Sec)
FT                   /locus_tag="MmarC5_0295"
FT                   /product="formate dehydrogenase, alpha subunit (F420)"
FT                   /EC_number="1.2.99.-"
FT                   /note="KEGG: mmp:MMP1298 formate dehydrogenase alpha
FT                   subunit; TIGRFAM: formate dehydrogenase, alpha subunit;
FT                   PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34611"
FT                   /db_xref="GOA:A4FWN6"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="InterPro:IPR041925"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWN6"
FT                   /protein_id="ABO34611.1"
FT                   /translation="MELNFIHTICPYCGTGCGVDLVVKDGTLVGTNPFKRHPVNEGKTC
FT                   IKGSYCHEFVHRDDRLTTPLIRKNGELVEASWDEALDLISGKLQNYSPEEIGFFSSARC
FT                   TNEDNYVFQKFARTVMKTNNVDHCARLUHSATVVGLGQAFGSGAMTNSISDIEDADCIF
FT                   IIGSNTFEQHPLIARRVVRAKEKGTKIIVIDPRYTPTAKQADLYLQLLPGTNIAVLNAI
FT                   MNVIVKENLIDEEFIKNRTKGYEELKKTLETYTPEYASKLSGVAPELIVEAAKMYGSAG
FT                   AASILYCMGITQFTTGVNNVKSCCNLAMITGNIGKPGTGVNPLRGQNNVQGACDMGALP
FT                   NVFPGYQAVPANHEKYAEAWNTTVDPNVGLSIPDMLAKAGEQVKCVYVMGENPMVSDPD
FT                   IHHVEHALKSLDLLIVQDIFLTETAQVADVVLPGASWAEKDGTFSNTERRIQKINKAVD
FT                   SPGEAIADWKIVKMIAEKMGQGELFNFETPEEVFQEIAKVTPQYAGVTYDRLGVDGLHW
FT                   PCKTCEDPGTPILHCQKCLTPDGLGNIFAIDYADPDEMADSEYPMVLTTGRIIFHYHTG
FT                   TMTRRSKHMADEINEGFVEIHPDDAKNMGIKNKQKVKVSTRRGEVVVNAKVTPNIKQGV
FT                   VFMPFHFAETAANILTNPAQDPNCKIPEYKVCAAKVEKI"
FT   gene            256257..257420
FT                   /locus_tag="MmarC5_0296"
FT   CDS_pept        256257..257420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0296"
FT                   /product="formate dehydrogenase, beta subunit (F420)"
FT                   /EC_number="1.2.99.-"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; KEGG: mmp:MMP1297 formate
FT                   dehydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34612"
FT                   /db_xref="GOA:A4FWN7"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWN7"
FT                   /protein_id="ABO34612.1"
FT                   /translation="MSNEMYYVQASDPAILEKGECGGAVTALFKYLLDKGIVDGVLALK
FT                   KGVDVYDAIPTFVTSSEDLLSTAGSLHCAPTMWGGIIKEYLQDAKIAVPVKPCDMRAIV
FT                   ELAKRAQINLDNVYMIGLNCGGTVPPKTAMEMIKLFYEVDPKDVVKEEIDKGKFIIVMN
FT                   DGSHKEVKMHDLEDNGYGRRVNCQRCDEKIPRKADIAAGNWGVIGEDAGKYTFMEVCTE
FT                   KGKQLLEDAEKDGYIKKKSPNPKGIEIRAKVESSMLKMGEDYKNKWLEEEYPTIEEWNR
FT                   QWNKCIKCYGCRDVCPVCFCRECALNADYLDSGSIPPNPIMFQGVRMSHMAFSCVNCGQ
FT                   CEDVCPMEIPVARIFHKVQEKTRKELGYRPGVDDEAPPALGGSCPTQ"
FT   gene            complement(257426..258814)
FT                   /locus_tag="MmarC5_0297"
FT   CDS_pept        complement(257426..258814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0297"
FT                   /product="ADP-dependent glucokinase"
FT                   /EC_number="2.7.1.147"
FT                   /note="KEGG: mmp:MMP1296 ADP-dependent phosphofructokinase;
FT                   TIGRFAM: ADP-specific phosphofructokinase; PFAM:
FT                   ADP-specific phosphofructokinase/glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34613"
FT                   /db_xref="GOA:A4FWN8"
FT                   /db_xref="InterPro:IPR007666"
FT                   /db_xref="InterPro:IPR011790"
FT                   /db_xref="InterPro:IPR015990"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWN8"
FT                   /protein_id="ABO34613.1"
FT                   /translation="MELINHVKDFSNVSIFLAYNVNVDALKYLADSSDIEKLKENFSDS
FT                   EIITKIEEYPRTIEKPIDFVARLIHAMKSGKPAEVPLKNNLEIDTFLNSLTYNEERMGG
FT                   QVGIISNLLSILDLKKIIFYSPILAKKQAEMFENNENLVFPNIIDGKLVLKKPIDSFKN
FT                   DELKINRIFEYKEDIEFYLQNEKIITPQSNRFIVASRPENLRIEIKEELKSHLPEVGKL
FT                   VDCAIISGVQAIKEEYSDGKTAEYYLNRVKEDIKSLKKENKDLKVHFEFASIQNTEMRK
FT                   KIAESILPEVDCVGMDETEIANIIHVLGYEDLSEGILKHSKIEDVVKASKILFEKYNLE
FT                   GMQVHTMYYIMYLCKKGGILSDESLEKTLEFATILASTKAALGQISNIDDLKTGLEIPH
FT                   NKHGKVLKEIVEKLSKEKELEDYRIILVPSRIVENPKSTVGLGDTISAGAFVGYVSELK
FT                   KLKK"
FT   gene            complement(258834..260150)
FT                   /locus_tag="MmarC5_0298"
FT   CDS_pept        complement(258834..260150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0298"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   mmp:MMP1295 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34614"
FT                   /db_xref="GOA:A4FWN9"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWN9"
FT                   /protein_id="ABO34614.1"
FT                   /translation="MDGELSFKYDNVMEETLGTFGISVNELEYFKNESSKTIEILKEKE
FT                   INGNLGFLDVLTDNLDRYHELKEHSQNFENMLIIGIGGSNLGLRATEAGILGNFSSRYE
FT                   IPRIFYMDNSDPEKTHDILSNIDLEKTLVFVISKSGNTVETLANFFIIRNLMKKKNIDL
FT                   GKHVVSITSGGELKKITEKENYIHFEVPENVGGRFSVLSSVGIAPLSCTSVDIEKLIEG
FT                   AKSMEKACKKEDVFKNPALINAVIHKIMYNRGKTVSVMMPYIERLRSFGMWYGQLWAES
FT                   LGKKGFGQTPVIAVGATSQHSQLQLYMDGPKDKIATFLKVNKYKNDLKIEYEYEHHLSG
FT                   HNLSEIIGSELVGTENSMTHNNVPNVKISLSKLNEITMGKLFLMYEMQTAISGELYGIN
FT                   AFDQPAVEYGKKIAHECLTGSNVNSENKSLTGKYTITSK"
FT   gene            complement(260178..261749)
FT                   /locus_tag="MmarC5_0299"
FT   CDS_pept        complement(260178..261749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0299"
FT                   /product="Starch synthase"
FT                   /EC_number="2.4.1.21"
FT                   /note="PFAM: glycosyl transferase, group 1; Starch synthase
FT                   catalytic domain protein; KEGG: mmp:MMP1294 glycosyl
FT                   transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34615"
FT                   /db_xref="GOA:A4FWP0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWP0"
FT                   /protein_id="ABO34615.1"
FT                   /translation="MKIAILTPTIAPLTSIGGLGDILEDLPKFLKNLGNEVFVITYDHQ
FT                   NKISKRPHEVIKKIEIKYQGSKFFFDVIKAVHPGSNFEIFAFSNPKINSLDSWDPIKYE
FT                   IFAELVVSFLSDIENIECVSGHDWPCGLAIAKCHEKLNLPTALTIHNEAFKGPIIEYKG
FT                   HIFSFLEHGIYFSDAFSTVSPHHAEEIRNLDFLKNLSKDKPFHGIINGIDSESYAPEFI
FT                   VERMKILSNGQLNPQDYCYIENYNISNATKVKPRIKESWFCKCENLKKYINDWNEMDKS
FT                   NISGSNIEIHGNIKGELKTPLIGFVGRATYQKGFDLIFETMPEVLEENNANFILLSKGE
FT                   KSIEEKIKDFAESYPNKIIALVGHCPPIVPIIYAGCDWTVVPSLWEPCGLTQMESMAYG
FT                   TPVIARNTGGLSDTVISIHPDPHKNPNFDIATGVLFNDYDKYGFKWGIEHGLYWTFYNL
FT                   DEACLFINYKHVHCPESPYEENSPLSLIIKNCYNHVQKNLSWQNNDSAERYRALFGGAM
FT                   YKHYFK"
FT   gene            261854..263050
FT                   /locus_tag="MmarC5_0300"
FT   CDS_pept        261854..263050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0300"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; Starch synthase
FT                   catalytic domain protein; KEGG: mmp:MMP1293 glycosyl
FT                   transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34616"
FT                   /db_xref="GOA:A4FWP1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWP1"
FT                   /protein_id="ABO34616.1"
FT                   /translation="MRVSIVTWEYHPIMVGGLAVHCKGLSEALVRAGNEVDVITVGYDL
FT                   PEYEEINGVNVYRVKPISHNNFLTWAMFMANSLEKKIGSLGVENYDVIHCHDWMTSFVG
FT                   SNLKHTAKKPYVQSVHSTERGRCGGINSEDSRAINDAEWWGSYESNQLIAVSHSTKDEM
FT                   CYGFNTPWEKVNVIYNGVNPWEFDIDGNDDEKYNFRRSFGVADHENMILFVGRLAYQKG
FT                   VEHLIRGFQKFLIGHPNSKLVVAGEGHMQGHLEHVAWTLGCRDRVIFLGFKNGNFLKKL
FT                   YKYADACVIPSVYEPFGIVALEAMAAGTPVVASDVGGLSEIINHEYNGVKVYPRDADSI
FT                   AWGLDRVISDWGFREWITKNAKHDAYTKYSWDAIANQTVQVYKRAIEMMKQYIIIKLD"
FT   gene            263125..264990
FT                   /locus_tag="MmarC5_0301"
FT   CDS_pept        263125..264990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0301"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   mmp:MMP1292 glucan 1,4-alpha-glucosidase (glucoamylase)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34617"
FT                   /db_xref="GOA:A4FWP2"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWP2"
FT                   /protein_id="ABO34617.1"
FT                   /translation="MVGIIGNGNILAKIDDSGSIEYMFYPSLGYEKHIFDASFAIFNHG
FT                   LKWAWDNDWDINQSYVKDTNILRTTYECSEFLMESRDYIPISHNIIIKQISISNKTDET
FT                   QDLKLFFYENLRMGEIPKENTVQFIKDSQTILKYDGTYSTCIASDKKIDSYQCGVRSSD
FT                   RSALIDISNGILKEYSTSSGLITDSAISWDLKLLPGQKQSVSVYIIMNQYNGDYQKLME
FT                   TMASIKVVIDNHEDFYQLTNSYWKNLLETTISKLSANELNRVMMCEDLCKRSFLTLLLL
FT                   CDRGGGIMASPSLYPDYRHVWCRDGGYIAVALSLCGQSSILEKYFEWCRKTQNEDGSWV
FT                   QSYYINGIPRLTAMQIDQVGTTLWAALIHYRKSDNGKFLKKNWAMIKKAADYLSNAAIA
FT                   LYPSYDLWEEKYGVFTYTLGSVYGGLKSAIEIAKILEETDESIEKWQNASDFLKEEVVE
FT                   KIYLNDKNRFLKALHPKDEALDSSILGIAFPFNLVNPDDPKMVATADQIESAFNYKVGG
FT                   IGRYPEDVYFGGNPWIINTLWLYMYYEMLVYSLSKNKAIKKEILENYREKCSELFDWVC
FT                   KYTFSGLMPEQIHKDLGVPISAMPLGWSHAMFIIAIHGDFDLLIP"
FT   gene            265057..266280
FT                   /locus_tag="MmarC5_0302"
FT   CDS_pept        265057..266280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0302"
FT                   /product="Alpha-amylase"
FT                   /EC_number="3.2.1.1"
FT                   /note="PFAM: glycoside hydrolase, family 57; KEGG:
FT                   mmp:MMP1291 glycoside hydrolase, family 57"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34618"
FT                   /db_xref="GOA:A4FWP3"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWP3"
FT                   /protein_id="ABO34618.1"
FT                   /translation="MLLSLNFEVHQPNRLRKSVNLNSGDLWGRYVDVELNKEIFNKVAD
FT                   KCYIPSNMIMLELIDNYDIEISYSITGVFLEQALEFNEEVVELFRDLAKTGNVEFLGET
FT                   YHHSLSSLFEEHEEFKEDILEHKNLIKDLFGYKTTTFRNTELIFNNKIAETIKDMGFNG
FT                   MFTEGANRILDWRSPNYVYSSLCGLNVLLRNYNLSDDIGFRFSSRNWKEYPLMADKYAK
FT                   WVSNTPGDCINLYMDYETFGEHQWYDTGIFEFLRHLPKELDNHNHIEYATPSEILELCK
FT                   PKDTIDVFEFSTLSWADSERDISAWLGSKMQQLSFQKLKEIRGYLNQYLQQFDEKERKE
FT                   LIEYKIYKNMQTSDNFYYMCTKGFNDMDVHSYFSHFSTPFDAYAAYLDTYYDFKNHLVL
FT                   KLLSTYFK"
FT   gene            266293..266976
FT                   /locus_tag="MmarC5_0303"
FT   CDS_pept        266293..266976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0303"
FT                   /product="GTP-binding protein, HSR1-related protein"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; KEGG:
FT                   mmp:MMP1290 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34619"
FT                   /db_xref="GOA:A4FWP4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWP4"
FT                   /protein_id="ABO34619.1"
FT                   /translation="MQYENTNNENNNIGTQDIQKFKKYIRTEKKADERPKVIVMGRSNV
FT                   GKSTFVKIVTGKNVRVGKKPGVTLKITEYDMGTYILVDLPGFGFMEGIEKKAQEKIKDQ
FT                   IIDYVEDNKNTIAASIHILDAKSFMDIVERWDNKGEVPIDLEMADFLEELELNPIFVVN
FT                   KMDKIKNSEWDNHLDRVSETLGFLPPWRQWLDNFVPAITRDNYGIDGIKHRINKRINGF
FT                   KKSKK"
FT   gene            267103..267624
FT                   /locus_tag="MmarC5_0304"
FT   CDS_pept        267103..267624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0304"
FT                   /product="LSU ribosomal protein L10AE"
FT                   /note="TIGRFAM: ribosomal protein L10.e; PFAM: Ribosomal
FT                   protein L10E; KEGG: mmp:MMP1289 ribosomal protein L10E"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34620"
FT                   /db_xref="GOA:A4FWP5"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWP5"
FT                   /protein_id="ABO34620.1"
FT                   /translation="MALRPARCYRTTERRSYTRKEYVRAVPQPKVVHYVMGNSSVEFPV
FT                   EVQLVSKSDILIRHNALESSRIAGNKYIMGECGRTGYLFNIRVYPHEILRENKMAAGAG
FT                   ADRISDGMRLSFGKAVGTAAKVKKGQEIITIGVNPERFYAAKEALRRCSMKLPTACKIV
FT                   VTKGKELIKD"
FT   gene            complement(267695..268972)
FT                   /locus_tag="MmarC5_0305"
FT   CDS_pept        complement(267695..268972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0305"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylases; PFAM:
FT                   Carboxylyase-related protein; KEGG: mmp:MMP1288
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34621"
FT                   /db_xref="GOA:A4FWP6"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWP6"
FT                   /protein_id="ABO34621.1"
FT                   /translation="MVKNLVNSIEKLVFEKSTKKFGVSRILKENDDKPVFIEDVNGYPV
FT                   IGNLCTRDVIANSLGIKKEDLMKHMVESINNEKKGELIVDENLEKLYIDDDLEKIHEYP
FT                   IPTYYGKDAGPYLTSGVVIVKDNDEGINASIHRILVRSDGNLAIRMVEQRHLHYIYNKN
FT                   IGDGEVDCAIVIGVHPAVLLAASTSGDVSFNELKYASALMKKPLNLVKCKTVDLEVPEA
FT                   EFIIEAKITAEMVDEGPFVDITGTYDVIRKQPLIKITALRRKEGAIFHALLPGGSEHKI
FT                   LMGLPQEPRMYKGIRNTVPSLKNVALTQGGCCWLNAVVSIDKKTEGDGKNAILAALAAH
FT                   PSLKHVTVVDGDINIYDANDVEYAVATRVQSDKDIVIISGAKGSSLDPSADHKNKLTAK
FT                   MGIDATMSLLKGKEEFIRAEVPEDDE"
FT   gene            complement(269012..269305)
FT                   /locus_tag="MmarC5_0306"
FT   CDS_pept        complement(269012..269305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0306"
FT                   /product="Protein of unknown function UPF0058"
FT                   /note="PFAM: Protein of unknown function UPF0058; KEGG:
FT                   mmp:MMP1287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34622"
FT                   /db_xref="InterPro:IPR002753"
FT                   /db_xref="InterPro:IPR036519"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWP7"
FT                   /protein_id="ABO34622.1"
FT                   /translation="MHKDELIQLHQLLVYMRKDLARKFGIELEESFKEYDELNIRPHHI
FT                   HRTKSEHTFAIFLLSGTIGKILSEKGNVPRSVASRLSDTGEKLSKEIARKKR"
FT   gene            complement(269339..270655)
FT                   /locus_tag="MmarC5_0307"
FT   CDS_pept        complement(269339..270655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0307"
FT                   /product="TOPRIM domain protein"
FT                   /note="PFAM: TOPRIM domain protein; SMART: Toprim sub
FT                   domain protein; KEGG: mmp:MMP1286 DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34623"
FT                   /db_xref="GOA:A4FWP8"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR020607"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWP8"
FT                   /protein_id="ABO34623.1"
FT                   /translation="MDLGTTKYIIYTELIADGYVEKHDVIGAIFGQTEGLLSNELDLRD
FT                   LQKSGRIGRIDVDLENINGKSFAKITLPSSLDKVETSILAATLETIDRVGPCFATVKIT
FT                   EVEDIRVSKRQYITNRARSILRKLMDEMIDTYEITEEIKESLRTEEIMEYGPENLPCGP
FT                   NVVHSDSIIVVEGRADVLNLLRCGIKNTVAVEGTSVPKSIMELTKKKTTTAFTDGDRGG
FT                   ELILKELLQTCDIDYVARAPYGKEVEGTSKKEIMKCLRSKVPVEQIVGNTCNDACNVSK
FT                   VIEDTPKEIFEPVTHKYYEKVETPVIEPVFEGPVVEEEIVVVEPVKKTETEIIDVDATN
FT                   EIQADRKFSGVKEIVDSIKNTGNVKFVVDGTEKTNTFKEFLTNIHEIKKMDFFAADMPI
FT                   SQKIVDLLYDKTPIIVGKEINVTKKPVNLRLFSFDEIVA"
FT   gene            270889..270961
FT                   /locus_tag="MmarC5_R0009"
FT                   /note="tRNA-Gly1"
FT   tRNA            270889..270961
FT                   /locus_tag="MmarC5_R0009"
FT                   /product="tRNA-Gly"
FT   gene            270980..271052
FT                   /locus_tag="MmarC5_R0010"
FT                   /note="tRNA-Gly2"
FT   tRNA            270980..271052
FT                   /locus_tag="MmarC5_R0010"
FT                   /product="tRNA-Gly"
FT   gene            271167..271973
FT                   /locus_tag="MmarC5_0308"
FT   CDS_pept        271167..271973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34624"
FT                   /db_xref="GOA:A4FWP9"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWP9"
FT                   /protein_id="ABO34624.1"
FT                   /translation="MKRKTLIFFTLILILSANFARYSLEDNSNEIEKNRFEPIILIHDV
FT                   SPVYLDDLKEIDEVISKYGYPERTYLFLIVNHANEYPLEENQDFVKYIRYLRTKGYNIE
FT                   LHGYDHIECEFDCNCTLATEKIEKSLEILNYYKIDGISYILPPRYGISEDSKKAMLDNG
FT                   FSVIIGQYAFEMNNSTVYKYNITNKEYTWYLEENNAENQLEMAKKEYFESEDKYFLSIH
FT                   PRAVNYGGGIEFLEEFLNFTKEENRFNSEDPIDIYSYFGIKKIDFS"
FT   sig_peptide     271167..271238
FT                   /locus_tag="MmarC5_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.475 at
FT                   residue 24"
FT   gene            complement(271970..274405)
FT                   /locus_tag="MmarC5_0309"
FT   CDS_pept        complement(271970..274405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0309"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: mmp:MMP1284
FT                   DEAD/DEAH box helicase:helicase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34625"
FT                   /db_xref="GOA:A4FWQ0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWQ0"
FT                   /protein_id="ABO34625.1"
FT                   /translation="MIIVRKLKKKKEEIQFVDLTDERAYYGIIRPANNRITLYKCREEK
FT                   AGNVNPVQPSKLLNFVRSNKVLLSTDEESLKLEEFLKQNNIKYGYIDLCPFCIIKGKFS
FT                   EITDKYKIYNSETCLECAIDEVKHEVAVNEEFIEKLLRRFKDANKVIELFKSKNPLKNP
FT                   ELTKYDVLTGNVDDEIKNYSIDELEVPDFLKEIIKNRGIDELLPVQTLSVKAGLLKNDN
FT                   LLITSATSSGKTLIGELAGIKNISEKKGKFLFLVPLVALANQKYVEFKDRYEKEGYLVS
FT                   LRVGTGRLSENKGGNINSSIDSDIIIGTYEGIDYLIRSGKLKDVGTVVIDEVHSINMDE
FT                   RGARLDGLIGRLRYLFTCQMIYLSATVGNPEELASKLGSKLVLYNGRPVPLERHLIFTK
FT                   NDYGKLNLVKDIVKQEFGSKSKYGFRGQSLIFTFSRKRAEYISNYLNTKGIKSDYYHGG
FT                   MEYSKRRTVEDNFLKQKTMCVVTTAALAAGVDFAASTVVLESLAMGGDWLNPSEFQQMC
FT                   GRAGRKGMHDKGKVYSLVEIGKKYHAKMENSEDEISFKLLNSEPEEVSLEYNEDEEFEQ
FT                   VLANICSIKNYKNKVTIPDVSKVPVLGKNLGLNYVLESLSSFQMLDLQNKNINTTRYGY
FT                   ATSISFLYPKDAEKIRKNLHKNPIDLVVSISPFENVYIPANLKNKITKTTNTNIPTRFI
FT                   DAFEVIKENFEKIKDKTLRDEILPWLIEFDGMIEEDIINYNSKKVLNLRINKKTPLQIS
FT                   KIIHDILKLQTYSGDIYSYLETAINTLDAVERIGNIYNKNIAKESGKLKKKMENPYKN"
FT   gene            274518..274721
FT                   /locus_tag="MmarC5_0310"
FT   CDS_pept        274518..274721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34626"
FT                   /db_xref="GOA:A4FWQ1"
FT                   /db_xref="InterPro:IPR007166"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWQ1"
FT                   /protein_id="ABO34626.1"
FT                   /translation="MSVALKKFFSNKGQLSLEFSVLILAVITAAILLGYHLIVSSKAVQ
FT                   ESNIDTINNTHNTAMDALSEVS"
FT   gene            274759..275310
FT                   /locus_tag="MmarC5_0311"
FT   CDS_pept        274759..275310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34627"
FT                   /db_xref="GOA:A4FWQ2"
FT                   /db_xref="InterPro:IPR022970"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWQ2"
FT                   /protein_id="ABO34627.1"
FT                   /translation="MKLIGITGMPGSGKSAITKLAEKYKIIVVSMGDVVRHETSKQGLT
FT                   LNPENVGNTAVKLREIHGNEAIAVPCLNYVNEKYKNEDFVIIEGIRSIYEVNYLGKNAK
FT                   LDIIAIHSSPKTRFERLSGRNREDDSNDWNTFVERDERELNFSIGNVISLADYMVVNEG
FT                   NYMDFINNLENTLKKIIKAD"
FT   gene            complement(275333..275839)
FT                   /locus_tag="MmarC5_0312"
FT   CDS_pept        complement(275333..275839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0312"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmp:MMP1281 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34628"
FT                   /db_xref="GOA:A4FWQ3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWQ3"
FT                   /protein_id="ABO34628.1"
FT                   /translation="MNTNLKINIRPTTVLDVSLIFNFIKELARYENLEDHVLATEDIIK
FT                   ESLFEKKKYAEALIVEADSKAVGLVLFFHNFSTFLGKSGIYIEDLYIKEEFRGIGIGRK
FT                   IFEYLSNLAKERNCGKIEWTVLDGNPARKFYEKMGGVPVEDWLIYRLTGDKLDELSEKY
FT                   QSNSK"
FT   gene            complement(276057..276134)
FT                   /locus_tag="MmarC5_R0011"
FT                   /note="tRNA-Arg2"
FT   tRNA            complement(276057..276134)
FT                   /locus_tag="MmarC5_R0011"
FT                   /product="tRNA-Arg"
FT   gene            276239..276607
FT                   /locus_tag="MmarC5_0313"
FT   CDS_pept        276239..276607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0313"
FT                   /product="camphor resistance protein CrcB"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: mmp:MMP1279 camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34629"
FT                   /db_xref="GOA:A4FWQ4"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWQ4"
FT                   /protein_id="ABO34629.1"
FT                   /translation="MREILLIGLGGFFGAILRYLVSGIIPVKFGIPTGTLIVNLLGSFI
FT                   VGFLIYSSLFGSLSPEYRLFIITGFCGALTTFSTFSYESFAMLEHNYYLKAGLNILLNV
FT                   FGCLGMVYLGRLASMFFW"
FT   gene            276612..276941
FT                   /locus_tag="MmarC5_0314"
FT   CDS_pept        276612..276941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0314"
FT                   /product="protein of unknown function DUF190"
FT                   /note="PFAM: protein of unknown function DUF190; KEGG:
FT                   mmp:MMP1278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34630"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWQ5"
FT                   /protein_id="ABO34630.1"
FT                   /translation="MKKISAKLLRIYLKEDDKYGKELLINSITKTLKNNGIAGATVFKG
FT                   YCGYGTRGISRIDIIRLSRNLPAVIECVDYEEKLNDIMPKLVEMVAENGLITMQDIEVF
FT                   KELKK"
FT   gene            276964..278583
FT                   /locus_tag="MmarC5_0315"
FT   CDS_pept        276964..278583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0315"
FT                   /product="thiol-driven fumarate reductase, flavoprotein
FT                   subunit"
FT                   /EC_number="1.3.99.-"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: mmp:MMP1277
FT                   fumarate reductase/succinate dehydrogenase, flavoprotein
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34631"
FT                   /db_xref="GOA:A4FWQ6"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWQ6"
FT                   /protein_id="ABO34631.1"
FT                   /translation="MITDVLIIGGGGAAARAAIECGQKNVVIASKGLFGKSGCTVMAEG
FT                   GYNAVLNPEDSFEKHYSDTMKGGGYINNKKLVEVLIKNAPKEFKNLEKFGCIFDRSENA
FT                   EFAQRPFGGQSFNRTCYSGDSTGHEMIAGLMEYLNKFERIKILEDTMAIKLIVNEVFEN
FT                   EKKLKKCFGAVFLDLLNGDIYPIYAKSTILATGGAGQIYPITSNPKQKVGDGFAIAYRE
FT                   GAELIDMEMVQFHPTGMLGTGILVTEAVRGEGGILYNKNKERFMKNYDPERMELSTRDV
FT                   VAKAIYNEIQEGRGIDGAVYLDVTHLDPEIIKEKLETMLSQFMLVGVDIKKEPMKVAPT
FT                   AHHFMGGIKINENCETSISGLYACGEVAGGIHGANRLGGNALADTQVFGAIAGKNAFDN
FT                   AENEIDISKVYNSVEKCIEDLKNAFNDSNSGDNVYSLIDELKKTMWDFVSILRDEKGLT
FT                   SALEKIVEIKEKSVSINGIVDFSKKLELENMILVSEIVINSALLRKESRGAHFRNDYPK
FT                   INEECIGNFVASLDGISFVKLE"
FT   gene            278825..279379
FT                   /locus_tag="MmarC5_0316"
FT   CDS_pept        278825..279379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0316"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2,
FT                   conserved barrel domain protein; KEGG: mmp:MMP1275
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34632"
FT                   /db_xref="GOA:A4FWQ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWQ7"
FT                   /protein_id="ABO34632.1"
FT                   /translation="MKEKMKEIAARVRELRELSDISIEEMADHLKISPEIYQHYEEGTC
FT                   DVPASVLYEIAHKFEVDMGLLLTGEETRMHIFTVTRKGKGISVERRKQYKYENLAEKFV
FT                   HKKAEPFIVTVEPRTDGKKPSKNSHPGQEFNYILEGTIKLYIHNNEVILEEGDSIFFDS
FT                   GYDHAMEALNGKNAKFLAIIM"
FT   gene            279418..281097
FT                   /locus_tag="MmarC5_0317"
FT   CDS_pept        279418..281097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0317"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmp:MMP1274 acetyl-CoA synthetase, AMP-forming-related"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34633"
FT                   /db_xref="GOA:A4FWQ8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWQ8"
FT                   /protein_id="ABO34633.1"
FT                   /translation="MVSLVNKYVKKTDFESYEDFVENFKIDVPENFNFAYDIVDEYAKI
FT                   APEKTAIIWCDDNNDEKIFTFKDMKKYSDKAANFFLKHGIKKGDTVMLTLKSRYEFWFC
FT                   MLGLHKIGAVAIPATHMLTTKDIVYRIEKAGLKMIVCIGENGVPEYVDEAVSEINSNVL
FT                   KACVVNLNNKNWIDFSKELEESSEEFTRPVGEMDTKNEDVLVAYFSSGTTGYPKLIQHD
FT                   HEYPLGHITTAKYWQNVEDDGLHYTVADSGWAKCIWGKLYGQWIAGTAVFVYDYDRFDA
FT                   GNMLEKIAKYKITTFCAPPTIYRFMIKQDISKVDFSSLHYAVTAGEPLNPEVYNKFLEF
FT                   TSLRLMEGFGQTETVVSVANFPWMDPKPGSMGKPVPIFDLMIKGSDGKECDVGEEGELV
FT                   FKTKDGKPLGLFSGYFKDPERTKKSWYDGYYHTGDTAWKDEDGFLWFVGRNDDLIKSSG
FT                   YRIGPFEVESALISHPAVLECAITGVPDPVRGQIVKATIVLTGDYEASEELKKELQDHV
FT                   KHNTAPYKYPRAIDFVKELPKTISGKIRRVEIREQDEEKSNN"
FT   gene            281176..281415
FT                   /locus_tag="MmarC5_0318"
FT   CDS_pept        281176..281415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0318"
FT                   /product="ketoisovalerate ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /EC_number="1.2.7.7"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1273 2-oxoisovalerate oxidoreductase
FT                   subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34634"
FT                   /db_xref="GOA:A4FWQ9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWQ9"
FT                   /protein_id="ABO34634.1"
FT                   /translation="MECSTKKPYPVINTLECKACERCIIACSKDVLKMSKDWNERGYHY
FT                   VIYTGEGCTGCGNCYYTCPEPLAIEVHIPLKKCE"
FT   gene            281426..282481
FT                   /locus_tag="MmarC5_0319"
FT   CDS_pept        281426..282481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0319"
FT                   /product="ketoisovalerate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.7"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: mmp:MMP1272 2-oxoisovalerate
FT                   oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34635"
FT                   /db_xref="GOA:A4FWR0"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWR0"
FT                   /protein_id="ABO34635.1"
FT                   /translation="MATQLVKGNTAVIIGAMYAGCDCYFGYPITPASEILHEASKYFPM
FT                   VGRKFVQAESEEAAINMVYGAASTGKRVLCATSGPGMSLKQEGISFLAGSELPCVLVNV
FT                   QRAGPGLGNIGPEQADYNQAVKGGGHGNYKNIVLAPNSVQEMCDCTAKAFELATKYKNP
FT                   VIVLSDGVLGQMVEPLKFPEQAIKPEIDESWAVRGTKETRKNLVTSIFLDFKQLEEFNY
FT                   ALQEKYEIIKENEQDFEGYQLDDAEIILVSYGISSRISKTAVDVARKEGIKAGLFRPKT
FT                   LFPFPEKELNKLAEKKCTFISVEMSNGQMAEDIKLATCCKRPIELVNRLGGNLIEVDQI
FT                   LAKIKEIAGGN"
FT   gene            282483..283922
FT                   /locus_tag="MmarC5_0320"
FT   CDS_pept        282483..283922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0320"
FT                   /product="ketoisovalerate ferredoxin oxidoreductase, gamma
FT                   subunit / ketoisovalerate ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.2.7.7"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   thiamine pyrophosphate enzyme domain protein TPP-binding;
FT                   KEGG: mmp:MMP1271 2-oxoisovalerate oxidoreductase subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34636"
FT                   /db_xref="GOA:A4FWR1"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWR1"
FT                   /protein_id="ABO34636.1"
FT                   /translation="MAEITEKVLKKPNAIPDVFERKGGSAPTATHYCAGCGHGIIHKLM
FT                   AEAIDELEIQDRCVLISPVGCAVFAYYYFDCGNIQVAHGRAPAVGTGVSRAEDNAIVMS
FT                   YQGDGDLASIGLNETIQAANRGEKMAVFFVNNTVYGMTGGQMAPTTLIGEKTVTCQTGR
FT                   DPRFAGYPIHMCELLSSLKAPVFIERVSVSDIAHIRKAKRAIKKALEIQRDGKGYAFVE
FT                   ILSPCPTNLRQDANAAQKFINEEMEKEFPLQNFRDRSAEVETLNRGESDFSKECLDNIF
FT                   EVNSKGAEDPSEDLSFEEKLVKIAGFGGQGVLSMGLTLAEAACRDQKYVSWYPSYGPEQ
FT                   RGGTSNCSVIISGHEIGSPVVYSPGVLIALNKPSLENFAKDVKTGGTIIYDENIGDFEI
FT                   PNGVTAIKVPASKIATEMGVSRAANTVMLGVLSALGYTGLSESVFVGAIEQTFSKKPKL
FT                   IPINVEILNAGISWAKENLAL"
FT   gene            284008..285324
FT                   /locus_tag="MmarC5_0321"
FT   CDS_pept        284008..285324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0321"
FT                   /product="3-hexulose-6-phosphate synthase"
FT                   /EC_number="4.1.2.43"
FT                   /note="PFAM: Orotidine 5'-phosphate decarboxylase;
FT                   Dimethylmenaquinone methyltransferase; KEGG: mmp:MMP1270
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34637"
FT                   /db_xref="GOA:A4FWR2"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017120"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWR2"
FT                   /protein_id="ABO34637.1"
FT                   /translation="MQVKSELPPVQVALDLVDLPRAIEIAKEAVAGGVTWVEAGTPLIK
FT                   SEGMNAIRELRKNFPTLTIVADMKTMDAGSTEVEMAAKAGANVILILGVGPDSMIIDAV
FT                   KAGKKYGVLVGTDLIATEDPIKRAVELEEMGVDIINIHVGLDQQVLNVDPVELVKRVSE
FT                   NCKKAKIAAAGGLNSETAVKAYEAGADIIIAGGTLYKSADPEQTARDIIKGLKTGKPVK
FT                   TDKFKKFNESELVSAFNVVSTSNISDAMHRTGEMKGLKPVWNSEKPLKFAGPAVTVRTY
FT                   SGDWSKPVSAIDDCEAGNVLVIDNCSSEIACWGGLATLSCETKGVVAIVIDGAVRDVEE
FT                   ILKIGIPVFARSITPTAGEPKGFGEINAVIDCAGRTVEPGDWIVGDENGIIVVPKNEAM
FT                   EIANRAIDVKEREDRVKEEITRGTTLAKTIRLKDWELKK"
FT   gene            complement(285347..286363)
FT                   /locus_tag="MmarC5_0322"
FT   CDS_pept        complement(285347..286363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34638"
FT                   /db_xref="InterPro:IPR014846"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWR3"
FT                   /protein_id="ABO34638.1"
FT                   /translation="MNILCIDIGKGTQDILYFDTEKNVENAIKLILPSPTTIISRKIMK
FT                   LKEDLRIDGKLMGGGPVSFAIMQKLKKGYNVEISEQCVRTIRDDLDEVREKGIVIKENI
FT                   QNPNVNLEDLDFEMLKTIFSSMGQDFSPDVVCVACQDHGFVKGQSDRITRFKYFEKKLN
FT                   ETKDPYEFYFDNKNYKTDNFSRFESILRTLDENKYKGFVMDSKMASVCGILNYANENKI
FT                   NEFIGLDIGNGHTLGVSMQNQKINGLFEHHTRLIDARKLKDIVERTCNGTLKNEDIYND
FT                   NGHGACVTCKTEPESILIAGPNRELFKSYGNYAYPGGDVMITGCIGLLDVYNKIKKI"
FT   gene            286500..287210
FT                   /locus_tag="MmarC5_0323"
FT   CDS_pept        286500..287210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34639"
FT                   /db_xref="InterPro:IPR024131"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWR4"
FT                   /protein_id="ABO34639.1"
FT                   /translation="MRILDIDLDFFLNKIAFWKKGNKRLDEKEYVVWKKDKFIEFLENN
FT                   CNLSKNNTIKGRIVKKHHEAFYFWRELIEKNELEVPFEVIHIDAHADLGLGDFSYKYIM
FT                   EELLHKPVEKRNDPEMMYEGNYLAFAIANQWINNITYVTHPKGGNDLLNFHFRDYDVKS
FT                   EIIQLKKTEKIETEIKNVKILDVEPEIPFKLISGKDYVEKGTFDYVVFSISPKYTPKTI
FT                   DRLIPIVKEYIEEI"
FT   gene            287306..288562
FT                   /locus_tag="MmarC5_0324"
FT   CDS_pept        287306..288562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0324"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit D"
FT                   /EC_number="6.3.5.7"
FT                   /note="TIGRFAM: L-asparaginases, type I; glutamyl-tRNA(Gln)
FT                   amidotransferase, subunit D; PFAM:
FT                   Asparaginase/glutaminase; KEGG: mmp:MMP1266
FT                   glutamyl-tRNA(Gln) amidotransferase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34640"
FT                   /db_xref="GOA:A4FWR5"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR011878"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR037222"
FT                   /db_xref="InterPro:IPR040918"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWR5"
FT                   /protein_id="ABO34640.1"
FT                   /translation="MDIGDFVKLELENTTYSGTVMPSLNEDTVVIKMKSGYNVGLDKKK
FT                   IKNIEILESGDKPKYGLPPLNLEKNPKLKNISILSTGGTVASRVDYKTGAVHPAFTADD
FT                   LIRAVPELMDIANIKGKVILNILSENMLPAYWKMTADAIKEEIENGAEGIVIAHGTDTM
FT                   HYTASALSFMVTSEVPIILVGAQRSSDRPSSDAALNIIAAVKAATEPIKGVYVLMHGET
FT                   GDTVCHLHEGTKVRKLHSSRRDAFKSVNETPIAEINPFIKKVTYLRDVKSQDKSKIKEV
FT                   VLNTDLEEKVALIKVYPGIDSEILKFYVDNGYKGIILEGTGLGHTPETFFEGIDYANEN
FT                   NVLVAMTTQTINGRVNMNVYSNGRELQAKGVIPCEDMLPEVAFVKLMHLLGNYGFEESK
FT                   ELMSKNIVGEINESINLEC"
FT   gene            288611..290506
FT                   /locus_tag="MmarC5_0325"
FT   CDS_pept        288611..290506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0325"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit E"
FT                   /EC_number="6.3.5.7"
FT                   /note="TIGRFAM: putative aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit; PFAM: GatB/Yqey domain
FT                   protein; GAD domain protein; GatB N-terminal region; GatB,
FT                   central domain protein; KEGG: mmp:MMP1265
FT                   glutamyl-tRNA(Gln) amidotransferase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34641"
FT                   /db_xref="GOA:A4FWR6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004414"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWR6"
FT                   /protein_id="ABO34641.1"
FT                   /translation="MDHDYEKLGLKVGLEIHQQLNTKRKLFCNCPTKIRDDEPHGEIER
FT                   VLRPSQSEMGHVDKAALLESKKEKKFIYQYYNDSTCLVELDDEPPHDVSPEAVDTALEV
FT                   STLMNMKMADEVQIMRKMVIDGSNTSGFQRTMFVSQEGFIETEYGNIGVTSLCLEEDAC
FT                   KKIEDGKDYTKYCVDRLGIPLLEITTEPDITSPKMGKEAARRIGTILRATGKVKRGLGT
FT                   IRQDVNISIREGARIEVKGVQNLDLIEKIIENEVTRQISLNEIKEELLKRNAEVVDEIK
FT                   DITELLKDTESKVLKSALKNKGVIRAILLKGFSGMIGREVQPGRRLGTEFSDRGKVLGG
FT                   VGGLFHTDELPKYGITEEEVTKLKEYMNCGENDAVILVADKKNKVERALNAVIERAKES
FT                   MIGIPEETRKALDDGNTSYLRPLPGAARMYPETDVPTITITEEKLEAIRNNLPEMPEEK
FT                   LVRFVKEYELNEDLAKQMVMSYHVDLFESLSKKYSKIKPTLIATTLEATLKEIKREGLD
FT                   TDLLTEEHLEELFKGLSEDKMSKEAVPDVIKGFIENPSKKLDEILEIKGMSSMSVDEVE
FT                   SIIEDIINQNISQVNEKGMGAMGLLMGRCMAQLRGKADGKLINTTLQKKLKEKVQ"
FT   gene            290584..292077
FT                   /locus_tag="MmarC5_0326"
FT   CDS_pept        290584..292077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0326"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   mmp:MMP1264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34642"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWR7"
FT                   /protein_id="ABO34642.1"
FT                   /translation="MDNLMGYVIGETSNTELNFLAKQLPEIGSYVSINYCDLEILGMVE
FT                   SVNQGCKIFEDVYNIKDFEKLKDFENNDSYYTIGKIKILGDVKNMQIPRIPPKPGTEVY
FT                   NASEKILEEIFSKGTIEIGNLISADSKVKLDVNKLCSRHLAILAITGMGKSNTVSVLLE
FT                   ELNNIHATVLVFDMHREYVEIEAKSGTIRRNIIKPKINVYNMSYDALMSLAGVDPQATV
FT                   QRAMGRRAMKKIKESKKEVDFNTVDEYINSIINELNYYMGMDEFKSKVDSILTLIMRFE
FT                   DLMTFKDKITAINYNPIQDIKENYVNIVDISELDESSTDLIISYFTGEILNDRKKVLWD
FT                   TKVAKPIFLIYEEAHLIVPQNRPTKSKVPISKIAREGRKFGVGICLVSQRPKTLDQESL
FT                   SQCNNFIISKLIEPSDQKHVQHASENLSEDLLNQLPGLNVGEAVIIGPCLKIPAMVKIK
FT                   RFEGEYGGEDVKFDELWTSEKEKNIPEFIESNEFFNDEL"
FT   gene            292094..292903
FT                   /locus_tag="MmarC5_0327"
FT   CDS_pept        292094..292903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0327"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   mmp:MMP1263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34643"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWR8"
FT                   /protein_id="ABO34643.1"
FT                   /translation="MSFEVTFDGVKYSCVNCTYCCSCKSWRVYLSYFDRMRLEGYENYI
FT                   EKSNSEYGHVLSLRDGKCGLIENNLCKLQIERNYDSKPAMCKLFPFSFMVKWNGEMLLI
FT                   LKHYCSGVQVGKTSKRTIKHAVECCEELYHDQLSELSINGTETAEKTNLDEKNKIYWEE
FT                   REKLGKYFFKTKKFDNFSEKYFEIFSEDIGDFIDKIKSKNNFDTKTKKFREKEILRYMQ
FT                   ELNKREHFRKMSFKKELNNLINVGLTISDYEDPLKGEGVIDSKLLLN"
FT   gene            292921..293448
FT                   /locus_tag="MmarC5_0328"
FT   CDS_pept        292921..293448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34644"
FT                   /db_xref="GOA:A4FVU6"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVU6"
FT                   /protein_id="ABO34644.1"
FT                   /translation="MSLKEYLIILVMVLLFAMAPLIILQEKKNNLSEMEELEKYGVYEV
FT                   KKISSEEGDTLRLFQVRNTMGQRLRNELDKPAKVDLCYILGYSYNNFEDIKTVEVISYY
FT                   NNSGNLVIYYVYEIETREIEISELSNVSEAGIMADMEYYYRKIIKLGDLKVMDDNIPYW
FT                   KEADNGYNSSDK"
FT   gene            293423..293995
FT                   /locus_tag="MmarC5_0329"
FT   CDS_pept        293423..293995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34645"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVU7"
FT                   /protein_id="ABO34645.1"
FT                   /translation="MVTIVPINEEERASILNGLKSSVPATKLITLKKIVDLTVLRPESL
FT                   QYMEMTDKMSIQRIISGIERIMEYDIDEILKREAAIALEKVKLTLGSKFVQNLLHCQNC
FT                   NSVVDIGWENCANCGSNLTEMTYPETKPCPNCNKHTSENWNNCAHCGFQLIKEEDKIQK
FT                   CTGCKREVDPTWMVCPYCGARLKGSKK"
FT   gene            294105..295250
FT                   /locus_tag="MmarC5_0330"
FT   CDS_pept        294105..295250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34646"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVU8"
FT                   /protein_id="ABO34646.1"
FT                   /translation="MLIIKRFAIIASLLLALLFAGCIDSTSSDAEVADLKVAYLPSDHD
FT                   APLFVAAEYPELFQNGYGVYLKEVENKDTYELYENDKLVANVEFIKVIEGGAKIMTLMA
FT                   QGQVDVGLNGVPPAVFSIDQGTAAKIVSPAQSEGSAIVIKSDIAAENWEEFVVYIKEQA
FT                   ESGVQVKIGHPLPTSIQYVMIKSALDAEGITYTENPNEDAMVQLINCKGQGTMPQLLST
FT                   NELDAVIAWEPTPEQLTLSGIGKSVIYSGDIPPEGMWENHPCCVFVASNNALENKREGL
FT                   KSFLKLMALSNNEIMANPEFAVNASSEWLGTDLEVEELSIPNIKFTNEIGSLEAIGPAF
FT                   VNVMDEQGAMTGQLAGLEDIEEINSILYDFTLYNEIMDEIQ"
FT   sig_peptide     294105..294197
FT                   /locus_tag="MmarC5_0330"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.793 at
FT                   residue 31"
FT   gene            295614..296252
FT                   /locus_tag="MmarC5_0331"
FT   CDS_pept        295614..296252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0331"
FT                   /product="nitrogenase reductase related protein"
FT                   /note="KEGG: mth:MTH571 nitrogenase reductase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34647"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVU9"
FT                   /protein_id="ABO34647.1"
FT                   /translation="MAGTGPAEKTLMDYLGGRPFVMEKLMASMRKNWEEKVELFQECGL
FT                   DELSSDFVSRNGNKGFMQIGKIEHSHEGCACPMGVIAKDFLNHVIVNDDEWVLVDTEAG
FT                   VEHFGRGIVEGVDSVVMVIDPSNDAVLLSEKVSQLSKEAGKPFGVVLNRVDDETKKILE
FT                   DAILEKNISIIGDIPYSKTMARENLKGNRLDNNMIEGDIGEILKKVESQ"
FT   gene            296532..297860
FT                   /locus_tag="MmarC5_0332"
FT   CDS_pept        296532..297860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0332"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: mmp:MMP1259
FT                   NAD(P)H: rubredoxin oxidoreductase (NPOR)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34648"
FT                   /db_xref="GOA:A4FWR9"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWR9"
FT                   /protein_id="ABO34648.1"
FT                   /translation="MDIIIVGSGAGGLTTASNIKKHDKNAKVTVITSDNYIAYSPCAIP
FT                   YVIGEEIADFESIIMHTPEDYKAKGIDVIVEAEVLDVVSDENKIIYKKDATETELKYDN
FT                   LVLATGGTPFVPPIEGVTLGGVFKVRTIEDGRKITEWAKDTKNAVVAGAGAIGIEIAFG
FT                   LKELGLDVTVVEMVPQVFPRALDPDMAETVQKYLEEQGIKVILEKPVGKIIGNDKVESV
FT                   LVGEETIPAEMVIMSTGVRSNIELAKRAGCEIGRWAVLTNEKMQTSIPNIYAVGDCVEV
FT                   IDAITMQNTLSPFGTTAVRQGKVAAKTIANIEAEIKPVLNSMVSKIGKLEIGGTGMTET
FT                   AAKMNGIEIVLGYSKALTRARYYPGGKPIYIKMVADKNTKKIIGCQIISEERVAERVDA
FT                   MSVAIFNGMTVEELANQEFCYAPPVSMVIDPIVFAAEDTLDKF"
FT   gene            298003..298971
FT                   /locus_tag="MmarC5_0333"
FT   CDS_pept        298003..298971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0333"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   mmp:MMP1258 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34649"
FT                   /db_xref="GOA:A4FWS0"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWS0"
FT                   /protein_id="ABO34649.1"
FT                   /translation="MLIRPRRLRTNQKIRDMVRETVLTKNDLVMPIFVDENLKDDEKTP
FT                   IRSMPGQFRYGIDAAVNECVEISELGVPAVILFGIPVEKDEFATSAINEQGGVQKVISK
FT                   VKSKLGDDLLVIADVCMCEYTSHGHCGIIKGEEILNDETLEVLGNIALSYAKAGVDIVA
FT                   PSDMMDGRVLKIRNVLDQNGFKNVSIMSYAAKYASAFYGPFRDAAESTPQFGDRKSYQM
FT                   DIGNSKEALKEIGLDINEGADLILVKPALPYLDIVKMAKEVSNIPVGGYCVSGEYSMIE
FT                   AAAQNGWIDREKAVFETLLGIKRAGADFIITYWAKEVANWL"
FT   gene            298990..299667
FT                   /locus_tag="MmarC5_0334"
FT   CDS_pept        298990..299667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0334"
FT                   /product="NERD domain protein"
FT                   /note="PFAM: NERD domain protein; KEGG: mmp:MMP1257
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34650"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWS1"
FT                   /protein_id="ABO34650.1"
FT                   /translation="MGFLTSLSKHSLSPITGKLKYFPISLFLRNLDKNEYSILKDYNLE
FT                   YNGDSAVIDYLIVSKYGIFVINSKNISGIISNSKEGNWIQKINGCKNLIENPLLELDKT
FT                   KNMLKEMFSSKNIEIILITVFNATSKIDVNFDNVVNSPELVRKIKEYGNPVIDQKEVEN
FT                   IIYSLLHANTSKHGLNVGEYPIVKIINGDKTYFCPKCGSKLKCSEIEKSLVCPNNLKCG
FT                   LKL"
FT   gene            complement(299668..300165)
FT                   /locus_tag="MmarC5_0335"
FT   CDS_pept        complement(299668..300165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34651"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWS2"
FT                   /protein_id="ABO34651.1"
FT                   /translation="MQLFILDADPEKAAKMHCDKHVVKMPLEAAQILSTVQHIHNSIYK
FT                   EKCYKKTHEKHPCVLWASKTRKNYEWALHLLKALLSEYSYRYKKMHKSSELLKYLEYNP
FT                   VKSDLNELTPFAQAIPEEYVSDDAVSSYRKYYIAEKSSFCKWTKRKAPEWYLKGLKKDN
FT                   EI"
FT   gene            complement(300228..301892)
FT                   /locus_tag="MmarC5_0336"
FT   CDS_pept        complement(300228..301892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0336"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   PFAM: tRNA synthetase, B5; KEGG: mmp:MMP1255
FT                   phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34652"
FT                   /db_xref="GOA:A4FWS3"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR022918"
FT                   /db_xref="InterPro:IPR040659"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWS3"
FT                   /protein_id="ABO34652.1"
FT                   /translation="MPTINVNKVDLERLSNISLSDKIIEDRFPMMGVEVEEIFEEVDKN
FT                   GKKQKMVQFSINPDRPDYLSVEGLARGFRGFMGITTGIQEFEVLNSDIKVIVEENETRP
FT                   YVAFALVKNVLMDEFVLESMINLQEKLHWAIGRDRKKLAIGIHDFDKVKAPFTYKEIKG
FT                   DEIKFVPLGYEDEKMTPREIIEKHEKGIKYAHLIQNDKFPIIVDANGEVLSMPPIINGT
FT                   LTKVTPTSKNLLIDITGTEKEAVEETLNIIVCALAERRGTIVSVDVNGKKYPDLSLKSR
FT                   MISVESINKKLGLELNPGEMIQAVKKSGMDALYEDGNLIVKIPAYRNDILHNVDLKEEI
FT                   AINYGYEKFEGKLPSVATTGSKDPVEKKCNAMSDLMIGLGFYEVMNLTLSNQDTLFEKM
FT                   NLKVEEKDYIEVLKPASIEHRVLRTSILPLLLETLYINKHHSLPQKIFEIGDCVVIDEN
FT                   DTETDTKCKNIKKIAGAITHPLTNFNEIKSSTEALLREFFEDFEFENYEHPAFIPGRCA
FT                   KIIKDGKEVGFFGEIHPEVILNFELEHPIVGFEITIE"
FT   gene            complement(301932..302981)
FT                   /locus_tag="MmarC5_0337"
FT   CDS_pept        complement(301932..302981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0337"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein; KEGG: mmp:MMP1254
FT                   phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34653"
FT                   /db_xref="GOA:A4FWS4"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWS4"
FT                   /protein_id="ABO34653.1"
FT                   /translation="MVTYKDAGVDIYKEDKVIRALASQIKFERNDAIKPADLKGHYAGA
FT                   IEFGDYYLVLCTDGVGSKMVVAEMANKFDTVPIDMIAMNVNDAICIGAEPVALVDYMAV
FT                   EDITEDIASQIGKGLNDGIKESNINLIGGETASLPNMIKGVDLAGTVLAVVKKDEIVSG
FT                   KEVKPGDLIVGLRSSGIHSNGLSLARKVFFDIANLDVNSKLSHGKTVAEELLTPTKIYV
FT                   KPVLEMIKQVNVKGLAHITGGGFRKLKRLNKEVCYKIDELPEILPIFKEIQNLGSVADE
FT                   EMFKTFNMGIGFCVIVDKEDAEKIIEISNHHNIPAFVIGKIEDSVELNGETKRETVLVE
FT                   YNNKKMIME"
FT   gene            complement(303043..303939)
FT                   /locus_tag="MmarC5_0338"
FT   CDS_pept        complement(303043..303939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0338"
FT                   /product="protein of unknown function DUF89"
FT                   /note="PFAM: protein of unknown function DUF89; KEGG:
FT                   mmp:MMP1253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34654"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR014444"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWS5"
FT                   /protein_id="ABO34654.1"
FT                   /translation="MKIKPECALCITRQVVDVAKELTDDKSEQFKIIAWGLKKISEMYS
FT                   ESSVPSFMGTELHRHLKLKTQNSDPYKNLKDVANEFALKYLNDVEHLLESDDELERLQK
FT                   KVKLAIAGNVIDFGPFSTDVNIENMVKTTLDGKLDLDFSEELLNELKNSKKVFYTCDNA
FT                   GEIVFDLPLIKELKNYVEVVVSVKGSPILNDATLEDVETAGIDKVTKVITSGTDTIGIR
FT                   FEESSEEFLSELNSSDFIIAKGMGNYESLTEYEEKRENSEKIPVYYILKAKCEPVAEHV
FT                   GVCEGDNVLLRKEISKV"
FT   gene            complement(304049..304888)
FT                   /locus_tag="MmarC5_0339"
FT   CDS_pept        complement(304049..304888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0339"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmp:MMP1252 CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34655"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWS6"
FT                   /protein_id="ABO34655.1"
FT                   /translation="MKIKTIVGEKKVEKVYPTTKIIEALVMMDKENIRRICVVDPGTGR
FT                   VEGILTNMDIVNMLGGGSKYNLVKFKHNHNMLSAINEPVKEIMTDNVVLIKENAELNEV
FT                   IDLFVEKKIGGMPVVDKSGVLITTINERDVIKYLKDQVDEKLLVKDCMTENVVSATPGE
FT                   RLKDVARTMLRNGFRRLPIVSEEKLVGIITSTDFVRLFGSDWAFNHMKTGNIREITNVR
FT                   MQDIMKTDIVSVKSEIKLIDAVKKMNELNIGVLPVVDGEKLVGLITEKDIVKCIYKK"
FT   gene            complement(304912..305472)
FT                   /locus_tag="MmarC5_0340"
FT   CDS_pept        complement(304912..305472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0340"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmp:MMP1251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34656"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWS7"
FT                   /protein_id="ABO34656.1"
FT                   /translation="MNLELSVTEAMSTPVATVTLDTTAYDVANILKDKGIGCLVVLNDA
FT                   GKPVGIITERDLALGVVSRNLKSKEVIVEEISSPKLIAIAPKSTIMDAARKMDSENVKR
FT                   LPVVEGDELLGIVTVSDITKLSPELFNIMVETNEIHNSEYPYPKTEEIEGICEICGSTD
FT                   SVNYINGRYICKNCNEDSEDEEE"
FT   gene            complement(305563..306066)
FT                   /locus_tag="MmarC5_0341"
FT   CDS_pept        complement(305563..306066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0341"
FT                   /product="6-pyruvoyl tetrahydropterin synthase"
FT                   /note="KEGG: mmp:MMP1250 6-pyruvoyl tetrahydropterin
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34657"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWS8"
FT                   /protein_id="ABO34657.1"
FT                   /translation="MILELNGIYAGLRFSSAHIVFGHDSCGVIHGHSYYVDVKLSGEPS
FT                   GEFGFVCDFKILKQIVKELCGELDHKLLVPRDHENMEYSLEGDSIYLEYVEKSGKVKKY
FT                   MFPVEDINLLPLKSTTAEDLSIYFAKFIEDKLQKMGLEKSIEWIETTVNEGIGQGARYI
FT                   LNLK"
FT   gene            complement(306159..306977)
FT                   /locus_tag="MmarC5_0342"
FT   CDS_pept        complement(306159..306977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0342"
FT                   /product="formylmethanofuran dehydrogenase, subunit C"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: glutamate synthase, alpha subunit domain
FT                   protein; KEGG: mmp:MMP1249 tungsten containing
FT                   formylmethanofuran dehydrogenase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34658"
FT                   /db_xref="GOA:A4FWS9"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR017550"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWS9"
FT                   /protein_id="ABO34658.1"
FT                   /translation="MNELILNLKGDVSVPIEMDKILPEKLQEMSLEEISGIELIQGNKT
FT                   VKLSEMFDVELKESPVAKVTINNCCKKVKRIGEKMTSGEIVVNGDAGMYIGVEMKGGKI
FT                   TVNGDAESWVGQNLKGGDITINGNAENYVGSAYRGDWRGMSGGKITITGNAGSELGEYM
FT                   KGGTILIKGNSKILPGIHQNGGMIIIEGDIEGRAGGEMMKGAIVVYGKILEPLPSFKFE
FT                   GIVEDPLVKLSKKDAGTQLKGTFIKFSGDYVNAKPKGELYAAIENNQNLL"
FT   gene            complement(307012..308715)
FT                   /locus_tag="MmarC5_0343"
FT   CDS_pept        complement(307012..308715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0343"
FT                   /product="formylmethanofuran dehydrogenase, subunit A"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: mmp:MMP1248 tungsten
FT                   containing formylmethanofuran dehydrogenase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34659"
FT                   /db_xref="GOA:A4FWT0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012027"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWT0"
FT                   /protein_id="ABO34659.1"
FT                   /translation="MEYIIRNGTVYDPKNKVNGEKMDICVKDGKIVESVSKNALEIDAN
FT                   KKVVMAGGVDSHSHIAGAKVNTGRTLRPEDSKKDLFSKEGLRQGSGFSIPSTFKTGYQY
FT                   SGMGYTTVIEAAMPPLVARHTHEEFMDLPQIDKAAMPLFGNSWMVLEYLKNGDLSMCAA
FT                   YVAWLLKVTKGYAIKIVNPGGTEAWGWGKNVHGLDDEVPYFGITPREIVTGLAKVNEML
FT                   GLPHSIHVHPNNLGHPGNWETTIDTMDCVKDIKAKPKFGDRDTVYYNTHLQFHSYGGTS
FT                   WKDCVSKGVETADYVNKNKHVMIDVGQVTLDETTTMTADGPMEYDLHMTNGLKWANCDV
FT                   ELETGSGVVPFIYSPKGPVYSLQWAIGLDIFLYTQPEKLILTTDHPNAGPFVRYPRVIA
FT                   WLLSKEYRNDWIQNRVHKWAAEKSHITETDREYSMYEIAQITRANSSKVLGLSGDRGHL
FT                   GAGAKADISIYDIDPEEKSGKKIEKAFLEAAYVLKDGEIVVKNGNVVKEVYGDTIFVNA
FT                   EINENLEAELMKDLSMKFRKLYSVNMENYPVQDAYANSWMPINIDATEIQ"
FT   gene            complement(308736..309122)
FT                   /locus_tag="MmarC5_0344"
FT   CDS_pept        complement(308736..309122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0344"
FT                   /product="formylmethanofuran dehydrogenase, subunit D"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: molydopterin dinucleotide-binding region;
FT                   KEGG: mmp:MMP1247 tungsten containing formylmethanofuran
FT                   dehydrogenase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34660"
FT                   /db_xref="GOA:A4FWT1"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR012040"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWT1"
FT                   /protein_id="ABO34660.1"
FT                   /translation="MKFMLNTGRTIWQGEAIEAGKNLEMYRKAAAVCYMNPEDMDALGV
FT                   KDGDAIKVTSEYGDVAVNAITTDQPAPIGMIFIPMGPWANRVVLPDTESTAMPSFKGPL
FT                   EVEVEKTDDEVLLMSDLMRKAYIE"
FT   gene            complement(309163..309405)
FT                   /locus_tag="MmarC5_0345"
FT   CDS_pept        complement(309163..309405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0345"
FT                   /product="formylmethanofuran dehydrogenase, subunit G"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1246 tungsten containing
FT                   formylmethanofuran dehydrogenase, subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34661"
FT                   /db_xref="GOA:A4FWT2"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWT2"
FT                   /protein_id="ABO34661.1"
FT                   /translation="MYKLEVYPEKCHGCGNCVVACPVNAQDPDVYGGKGPSSDEKLVMR
FT                   VENGVVSIVNGDLCGGCGACIEACPVDAIKVVIVK"
FT   gene            complement(309428..310486)
FT                   /locus_tag="MmarC5_0346"
FT   CDS_pept        complement(309428..310486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0346"
FT                   /product="formylmethanofuran dehydrogenase, subunit F"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1245 tungsten containing
FT                   formylmethanofuran dehydrogenase, subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34662"
FT                   /db_xref="GOA:A4FWT3"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWT3"
FT                   /protein_id="ABO34662.1"
FT                   /translation="MKNFKKDENDGVIEISRSGVEKRVLKWDDCTCVGCGICSEICPTS
FT                   AIEMGPLGAIFKGELDAPKLDISEKCVLCGMCACACPFDAVKLSINDKPITEMPQYPKI
FT                   KRGIELNQSKCVLCEQCELVCPQCAIDVEREVPERKSLVLGEITIKKDDCVLCGICAEY
FT                   CPAEAIELIPNDMNALSLNPIADIKIDLDACVYCKVCEKACPHNAIEAICYKCPLASKI
FT                   KEPELYKEIKGQTNIDKDLCVSCGWCANICPADAIEVEKPFEGELIIDEPACNACGACI
FT                   SVCPCNALVFPKPEKQGDKVPNVMVNQDVCILCGACTHSCPVDALTVKRTNINMTEANA
FT                   PAWKKAFSKLIK"
FT   gene            complement(310509..310955)
FT                   /locus_tag="MmarC5_0347"
FT   CDS_pept        complement(310509..310955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0347"
FT                   /product="formylmethanofuran dehydrogenase, subunit H"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1244 tungsten containing
FT                   formylmethanofuran dehydrogenase, subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34663"
FT                   /db_xref="GOA:A4FWT4"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWT4"
FT                   /protein_id="ABO34663.1"
FT                   /translation="MPEHILSGIKAVVAIKMRKEGKLQREIAEFLEMDRSIISHYLHGR
FT                   YPSDKVMRVSEEIINLPREYGIPLITSLGDNKQITKKLIERIYNIKIDIDMEKCIACGK
FT                   CLECEYGAISVYSEDIGISIDREKCILCCKCVSECPVGALKIVK"
FT   gene            311160..311774
FT                   /locus_tag="MmarC5_0348"
FT   CDS_pept        311160..311774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0348"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   mmp:MMP1243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34664"
FT                   /db_xref="GOA:A4FWT5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWT5"
FT                   /protein_id="ABO34664.1"
FT                   /translation="MDIKALEDKLKPNGTVSIIGCGRLGIRIAMNILEVHRGGFEKLQI
FT                   FDAAKIDQNDVVHRKHGAKIGEYKVNFLKEFFPERIEAFFEDITEKNIEKITGEVVLIV
FT                   FAGGDTLPIRKKIVEYCKNTGKVAIGTNGVFGFNPLIKIGDAKTEKGPVEFLEMGTKGH
FT                   LVVGTGKFIKDMEPITPYTLDEMAKYIVIESLKIKKELLKN"
FT   gene            311832..312749
FT                   /locus_tag="MmarC5_0349"
FT   CDS_pept        311832..312749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0349"
FT                   /product="quinolinate synthetase A"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: mmp:MMP1242
FT                   quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34665"
FT                   /db_xref="GOA:A4FWT6"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWT6"
FT                   /protein_id="ABO34665.1"
FT                   /translation="MDIIERINKLKNEKNAVILAHNYQPEEIQRIADIIGDSLELCIAA
FT                   RDTDADIIVFCGVDFMAETAKVLNSGKKVLIPEIVETDCPMAHQLPPEVIIDTKKKHPN
FT                   AKVVIYVNTLASAKALADATCTSANADLVVNSFEEDEILFGPDNNLGYFVSRRSDKKII
FT                   PMPEGGHCYVHKMFTLDDARAVKENYPNAELLIHPESNPKLQDIADHVMSTGGMVKHVL
FT                   NSECNEFIIGTECDMISRLKIDLEKAGKSKKLIPLRKDALCTSMKNITLEKIEKCLLEE
FT                   KYEIMLDNKIIENARNAIERMLSI"
FT   gene            complement(312760..313119)
FT                   /locus_tag="MmarC5_0350"
FT   CDS_pept        complement(312760..313119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34666"
FT                   /db_xref="GOA:A4FWT7"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWT7"
FT                   /protein_id="ABO34666.1"
FT                   /translation="MSSKYILPVIMLLILVGAIYFSFAPDNSEKYVFLAVTFNMGGLDY
FT                   QGYIVEGRNIIFEYAREGNSFSQSVTPSFTKTDEQYKNIEHVYVKIDTNGDVKYYEAEI
FT                   FDETEEMVKYYAKEE"
FT   gene            complement(313124..314266)
FT                   /locus_tag="MmarC5_0351"
FT   CDS_pept        complement(313124..314266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0351"
FT                   /product="Sep-tRNA:Cys-tRNA synthase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: Sep-tRNA; PFAM: aminotransferase, class V;
FT                   Soluble liver antigen/liver pancreas antigen; KEGG:
FT                   mmp:MMP1240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34667"
FT                   /db_xref="GOA:A4FWT8"
FT                   /db_xref="InterPro:IPR008829"
FT                   /db_xref="InterPro:IPR013375"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWT8"
FT                   /protein_id="ABO34667.1"
FT                   /translation="MEINTDKYKNITRNLEREMINLNPIQRGGILPTESKKIIYEYWDG
FT                   YSVCDYCSGRLDRIETPPINEFLEDMSKFLGMDITRPTHGARESKYAVMNSICKEGDYV
FT                   VLDGNAHYTSYVAIERAKLNYEKTDIGEYPTFRVIPESYAEKIDMLEDSKKNIGLILLT
FT                   HVDGNYGNVADVEKVGKIAKSKGYPFLLNCAYSAGRMPIDGKKLNVDFIAASGHKSMAA
FT                   SGPCGLLSINKKYEDEVLETSKVNVVKELQMLGCTSRGIPILSLMASFERLIERVKKWD
FT                   LELEKTRKVVNELEPLGFKQIGEKPRNHDIIRFETPILDEIAEKDKRRGFFFYEELKRR
FT                   GLGGIRRGVTKEFKMSVYGLTNTQVDYVINSMKTIINELR"
FT   gene            complement(314294..315070)
FT                   /locus_tag="MmarC5_0352"
FT   CDS_pept        complement(314294..315070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0352"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: mmp:MMP1239
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34668"
FT                   /db_xref="GOA:A4FWT9"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWT9"
FT                   /protein_id="ABO34668.1"
FT                   /translation="MINMEKCLLEKYNSLLEFFKNKKVIVAYSGGVDSTLISKIASDAT
FT                   KTLAVTVDNGFFSENVIKKAEDCAKKYNIPQKTEKIDYLNEITSKNLENRCYNCKKRIA
FT                   EELKKIKNELNYDIIVDGTIYDDIFEDRPGIKAFHEENIISPLSDLKFNKNDVFEISKY
FT                   LKIDIPKKDTCMATRILSAPISKENMAKSNLAEEFIKSNFHIESYLRVRYIENIAIIEL
FT                   TKNESEKIFDNDSIERINTELKKIGFEKVVIDLNFK"
FT   gene            complement(315067..316050)
FT                   /locus_tag="MmarC5_0353"
FT   CDS_pept        complement(315067..316050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0353"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: mmp:MMP1238 TonB-dependent receptor
FT                   protein:biotin synthase; TIGRFAM: biotin synthase; PFAM:
FT                   Radical SAM domain protein; biotin and thiamin synthesis
FT                   associated; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34669"
FT                   /db_xref="GOA:A4FWU0"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWU0"
FT                   /protein_id="ABO34669.1"
FT                   /translation="MKEIKLNSDSLEIYEKSASKKLNRNDLIDLWNLDLNDLLDISYAL
FT                   KKLFNKDKIDLCSIMNAKSGICPENCIFCSQSKHNSSKIDTYELKSKEEILKNAKSVEK
FT                   YSNRFSIVVSGKTVTDLEFEKIIESIEEIQNKTKLKVCVSLGLLNKDQLKALNEKNVRI
FT                   HNNLETSENYFKNICTTHDYNDKIKVILEAKKIGLEMCSGGIFGMGESIDDRINLFLDL
FT                   KKLGVDSIALNLLNPIYGTKIYDRINSGDISPINSIGALKSLCIARITLPNKVIRLCGG
FT                   REHVLKDMQKYSLLAIDGLMIGNYLTTNGQNIQSDLKMIEEMGFER"
FT   gene            complement(316128..316328)
FT                   /locus_tag="MmarC5_0354"
FT   CDS_pept        complement(316128..316328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34670"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWU1"
FT                   /protein_id="ABO34670.1"
FT                   /translation="MNSKAIKGIVLISAIIFCVILTGCADYTDPSNETVQAAVLNEEYE
FT                   EENEEKYDTSNDESYGSEENR"
FT   sig_peptide     complement(316251..316328)
FT                   /locus_tag="MmarC5_0354"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.817) with cleavage site probability 0.561 at
FT                   residue 26"
FT   gene            complement(316359..317102)
FT                   /locus_tag="MmarC5_0355"
FT   CDS_pept        complement(316359..317102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0355"
FT                   /product="protein of unknown function DUF375"
FT                   /note="PFAM: protein of unknown function DUF375; KEGG:
FT                   mmp:MMP1236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34671"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR007183"
FT                   /db_xref="InterPro:IPR037456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWU2"
FT                   /protein_id="ABO34671.1"
FT                   /translation="MKFFQEQIAIKETNILLKVDNPKFFKMAKNAVINERLNLENYILR
FT                   NPIFLTSYSPLEVPDNAPKIVKLMAEAGFNADVGPMAAVAGTFSQLIVENLIENDCKNA
FT                   ISENGGDICLKCEMDTTVGLYAGNSSLSGNLGFKLKKEKMKNGYGICTSSGTVGHSVSF
FT                   GNADSVTVFSKSAIIADAAATSIGNFAVGNAVDAMNNCLEKAETISKIDGVFVCMGEHA
FT                   GKIGKIPQLIKTDKKEVLGNVFEMV"
FT   gene            complement(317131..317556)
FT                   /locus_tag="MmarC5_0356"
FT   CDS_pept        complement(317131..317556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0356"
FT                   /product="molybdopterin synthase subunit MoaE"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE; KEGG:
FT                   mmp:MMP1235 molybdopterin biosynthesis MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34672"
FT                   /db_xref="GOA:A4FWU3"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWU3"
FT                   /protein_id="ABO34672.1"
FT                   /translation="MIRVSNEDFNVDVETKALLKEHPEIGGLVNFVGVVRNVGYDKGVE
FT                   KEAEFIEFECYEQMASKKLEELKNRAIEKFNIINATLIHRIGTLNVGENIVLIVVGAKH
FT                   RKEAFLACEYLIDSLKEEVPIWKKEFSKDGSYWVEQH"
FT   gene            complement(317549..318268)
FT                   /locus_tag="MmarC5_0357"
FT   CDS_pept        complement(317549..318268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0357"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: mmp:MMP1234 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34673"
FT                   /db_xref="GOA:A4FWU4"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWU4"
FT                   /protein_id="ABO34673.1"
FT                   /translation="MNLERYKRQILMDDFGETGQKKLLDATVTVVGVGGLGTVVSQYLA
FT                   AAGVGKLKLVDYQEVELSNLNRQILHFEKDIGIKKVISAKEKLKSINSEINIEIYPEKV
FT                   NESHIKNSDVIVDCLDNFEARYLLNKFSNKYKIPLVHGAIEDLRGQVTTIVPDETPCIE
FT                   CIFKLKDEEKNKSFPVLGVTPGVIGSIQASEAIKLITGIGTPLKNKLLSIDMRTNDYFT
FT                   FNIKKNPECKICGGLND"
FT   gene            318345..319046
FT                   /locus_tag="MmarC5_0358"
FT   CDS_pept        318345..319046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0358"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase, subunit FdhD;
FT                   KEGG: mmp:MMP1233 TonB-dependent receptor protein:formate
FT                   dehydrogenase, subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34674"
FT                   /db_xref="GOA:A4FWU5"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWU5"
FT                   /protein_id="ABO34674.1"
FT                   /translation="MSKMVTKVKTYSWSAEKGLLEKEDTIVTEDFYELYLDGKLIETMV
FT                   VSPENIEELGIGYTISEGYITPENFSKIKIEDKKIYVDSKELEKEDTKKENVNLKLSTI
FT                   KKIMETMPTLSDTWKITGGVHWAALFDFSGNKIIYFEDIGRHNAVDKVVGYAVLNNIDL
FT                   NNCVLASSGRQPTAMVKKAVNSKIPVIITKSPSTDKGVILAKENDILLIGFARIDRFTV
FT                   YNGVENIDFKA"
FT   gene            319097..319987
FT                   /locus_tag="MmarC5_0359"
FT   CDS_pept        319097..319987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0359"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: mmp:MMP1232
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34675"
FT                   /db_xref="GOA:A4FWU6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR012122"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWU6"
FT                   /protein_id="ABO34675.1"
FT                   /translation="MDNNLEFRPWTQNKRNLKHLNQLKEDILNNFEDLKLKDEKIIVML
FT                   SGGKDSAVSLAVAKELGLNVHLCVHFVHKWSWDISTNEAKKLADRFNIPIIFPNVTEEL
FT                   AKKTQGAKGKSICRICKTIMKARMIDIAKEENAKIIMTGETALEKIAGPVFQYIRENNT
FT                   NVKRKDEFELYKKMEITKVPKRYKIHFFRPLIRVGHFDVFNLQKYYNIDIKRVSEAGNK
FT                   IGYWREGCCLQYCSPDCELTTELFDDLYKINKKATEIARENGFRASITLPAKEITVIPE
FT                   EEKYFKKIEEILKEI"
FT   gene            complement(320007..320390)
FT                   /locus_tag="MmarC5_0360"
FT   CDS_pept        complement(320007..320390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1231 putative HAD family hydrolase, a
FT                   fragment"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34676"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWU7"
FT                   /protein_id="ABO34676.1"
FT                   /translation="MAVDGLVSEKIKELLKELGKTYKLVVLTADTYGTLEKEFNGLPIT
FT                   VDKIKNEIEKEKAAEKYSPYIGIGNGNNDCLMLEKSELGILIIGEEGASTNALLKSDIV
FT                   INNIKDAINLLLNEKRIIATLRK"
FT   gene            complement(320484..321542)
FT                   /locus_tag="MmarC5_0361"
FT   CDS_pept        complement(320484..321542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0361"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: mmp:MMP1230 DNA polymerase, beta-like region"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34677"
FT                   /db_xref="GOA:A4FWU8"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWU8"
FT                   /protein_id="ABO34677.1"
FT                   /translation="MDTRIRDFVKTDEGYFAVNTYYHPENSVISFLRYINIDKIGNHIL
FT                   KDYDLNENDIRILNGQKYIKIADSAKAYAILKEYYPEYLFYDDINDVLLHAIPKNNVKE
FT                   ILSPQKRLEEVLNEQNTEAEIKCAKLADTLHDYGIEYKNMGVSGSTVLKLNNENSDIDF
FT                   VIYGMKNHKNARDILSETFKDGTLEPLSEDFWKKAYAKRIKDGTLTYDEFVWHEKRKLN
FT                   RGVVDGVMFDLLATRGWDEINEKYGDKKYKNLGFIQIKAKVKDDTFVFDNPAVYKVENV
FT                   EILNNENNAKVSAFEIEEVVSFTHTYAGSTYNGEKIIVRGKLEEVYGKETYKRVVVGTT
FT                   REAFNEYVKLDK"
FT   gene            complement(321599..321901)
FT                   /locus_tag="MmarC5_0362"
FT   CDS_pept        complement(321599..321901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0362"
FT                   /product="FUN14 family protein"
FT                   /note="PFAM: FUN14 family protein; KEGG: mmp:MMP1229
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34678"
FT                   /db_xref="GOA:A4FWU9"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWU9"
FT                   /protein_id="ABO34678.1"
FT                   /translation="MDIMQFVPDLGTGFITGFVVGWGIKMAMKVVIALMGLYVFSLIYL
FT                   SNLGVISINVDALFGLVGSVEGAVMSYGSLAIGLIHSVSLGGGFAAGATVGLKQG"
FT   gene            complement(321999..322637)
FT                   /locus_tag="MmarC5_0363"
FT   CDS_pept        complement(321999..322637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34679"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWV0"
FT                   /protein_id="ABO34679.1"
FT                   /translation="MILKKIIALLSVLTLFSGCIGNDYSSVELVENSPYPEFIYLNKDM
FT                   LKIVANKTSEEPVSDYFFVIFDGTYIDKNNYSKLAVKTPLWRFGSLFVNNDIKTKNGLI
FT                   LLNSDYVGSPDLKYNTPLNYNDIIIYNKNYGIFIEIGQEYTSAEIITENLPVNKYFMEN
FT                   IKNISGKYIINREIIEKEDILIGNYVLEGGIPIGDMNNSVFDMNITPKS"
FT   sig_peptide     complement(322572..322637)
FT                   /locus_tag="MmarC5_0363"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.817 at
FT                   residue 22"
FT   gene            complement(322645..323271)
FT                   /locus_tag="MmarC5_0364"
FT   CDS_pept        complement(322645..323271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0364"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating)"
FT                   /EC_number="2.1.1.132"
FT                   /note="TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   mmp:MMP1227 uroporphyrin-III C/tetrapyrrole
FT                   (corrin/porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34680"
FT                   /db_xref="GOA:A4FWV1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWV1"
FT                   /protein_id="ABO34680.1"
FT                   /translation="MIYIVGIGPGSRDYVTEKAFDTVETSDFVLGSKRSLEIFEINGER
FT                   VELTVNLKNELYEFLKNYKNSDSKKKVSILSTGDPCFSGLLKTIFSFDFIEQDDFEVVP
FT                   GISSIQMAAAKAKISWEDYTILTLHGKEENLKKLLDFVKNDEKVIFLPNNLKNDLNYLV
FT                   ENRISTEKEITVLENLSYDNERIITDKISNLLGNNYSYLLVCIIN"
FT   gene            323383..324543
FT                   /locus_tag="MmarC5_0365"
FT   CDS_pept        323383..324543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0365"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; KEGG: mmp:MMP1226
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34681"
FT                   /db_xref="GOA:A4FWV2"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWV2"
FT                   /protein_id="ABO34681.1"
FT                   /translation="MDFEKYDVVIVGGGPCGFITGENIKNKKVLVLEEHQEIGVPLQCA
FT                   GLLSKKCINELGNPKGSVNKIGGAHIYSRNSSVTVGNEEIRAEVFERKVMDKDIATRAS
FT                   KNVDVLLKSYGKIKSSNNSSTIWDKTKHKLQIMHMDETFEVSPEVIIGADGIRSTIGRS
FT                   LNMLDKKREIISGVQIEFVNAEIDDDFVNVFYDKRYSEKFFTWIIPLGNDRVRVGMCDS
FT                   NNSYKKLMDFLETNKIAKEILKNATPVEFICGAIPIGYSKTVKDNIMLVGDSAGQVKPL
FT                   SGGGLYYGAKCGKICADTINQYFEGNCDIDFLKNYEKNWKSEIASEIDKNIKIRKILNM
FT                   LNNDKMDRIFDFINKNNLVDFINENGDMDNPSTVVRPILDRVLFGK"
FT   gene            complement(324572..325333)
FT                   /locus_tag="MmarC5_0366"
FT   CDS_pept        complement(324572..325333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0366"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: mmp:MMP1224 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component-related; TC
FT                   3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34682"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWV3"
FT                   /protein_id="ABO34682.1"
FT                   /translation="MKIPPILIIIASILIITSFSGCISSYGAECDTVKPGVLTIGITPI
FT                   LPPLQYYEEGELKGYDIDLMKEIANKMGLEPEFKVYSYKGAEEALLNGEIDCIPSTTVS
FT                   PERKERMEFSRAYLQTYMIVAVFENSPYTELKDLNGKKIAVFKDTYSEDWSYSYLGSID
FT                   AELISYESIDKLMSDIYSGNLDAVVTDQIHMDYYSEQNNFESRMISEKMTIVYWAVALK
FT                   KDNGLQDRINDALFELEQDEALYELKNKWYD"
FT   sig_peptide     complement(325250..325333)
FT                   /locus_tag="MmarC5_0366"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.894 at
FT                   residue 28"
FT   gene            325624..327102
FT                   /locus_tag="MmarC5_0367"
FT   CDS_pept        325624..327102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34683"
FT                   /db_xref="InterPro:IPR008303"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWV4"
FT                   /protein_id="ABO34683.1"
FT                   /translation="MGFLDSIKGIFSKSPKIHYAKSQSIDVMDLNPRRVGPNQNILPYY
FT                   TVASVELGNTTTKAIICATEMGSGKTYVVSKEVRMTRDVRPPKKGEEVFGRTIWDVELT
FT                   KEAVSEMVRDVLKGAMDKAHLNVNDLHFVVRSTGVTAGFASPEEVGVMIVSLAEGCRMA
FT                   GIPNGKMTPIMTKKQLPEILQDYTLIEKLIFDGAVTGVVPPTGKEVVANEMEGELVTAG
FT                   LKIGGKWTGVDYRNPCISIDFGTTLAGRITNNGEPYAKVIGNLCGLAGAVSDAVVRGTD
FT                   LVSKRGGAVLDIHAEKGSPNKELAEKYAKEIHEHVIIKEVPMGMERFGTVPVNPESAEK
FT                   AGTFLTGCDVGENGSDIPELEKIGAKILKESNLPTLMYTLDIVSAKITQRLIKIAHEEG
FT                   IISGDTAIGITGRAGITGQKPKLIIEMLSELEIWDNVSENIIFVEDGLALGASVMARCM
FT                   NCLGTPNVPIGGKRNGPCILAQRIKRQKEMGMIK"
FT   gene            complement(327181..328149)
FT                   /locus_tag="MmarC5_0368"
FT   CDS_pept        complement(327181..328149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0368"
FT                   /product="DNA repair and recombination protein RadA"
FT                   /note="KEGG: mmp:MMP1222 DNA repair and recombination
FT                   protein radA; TIGRFAM: DNA repair and recombination protein
FT                   RadA; PFAM: Rad51-like; SMART: Helix-hairpin-helix
FT                   DNA-binding, class 1; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34684"
FT                   /db_xref="GOA:A4FWV5"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011938"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWV5"
FT                   /protein_id="ABO34684.1"
FT                   /translation="MADVLTELPGVGPSTAEKLIEAGYLDFMKIATSTIGELTDIEGIS
FT                   EKAAAKMIMAARDLCDLGFKSGVELLKQRQSVWRLSTGSKELDTVLAGGLESQSVTEFA
FT                   GMYGSGKTQIMHQTCVNLQMAEKIFADLEGVVEEEMENPKAVYIDTEGTFRPERVVQMA
FT                   EGAGIDGQTVLDNTFVARAYNSDMQMLFAEKIEDLIKGGNNIKLVIIDSLTSTFRNEFT
FT                   GRGKLAERQQKLGRHMATLNKLADLYNCIVLVTNQVAAKPDAFFGVAEQAIGGHVVGHA
FT                   ATFRFFLRKSKGDKRVAKLYDSPHLPDSEAVFRITEKGIQD"
FT   gene            328297..328842
FT                   /locus_tag="MmarC5_0369"
FT   CDS_pept        328297..328842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0369"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /note="TIGRFAM: precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; PFAM: conserved
FT                   hypothetical protein 95; KEGG: mmp:MMP1221 SAM (and some
FT                   other nucleotide) binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34685"
FT                   /db_xref="GOA:A4FWV6"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR023475"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWV6"
FT                   /protein_id="ABO34685.1"
FT                   /translation="MIQDSEFFRMEGVPITKEEIRAVSIGKLNLDPEDIVLDIGCGSGG
FT                   MSVEIAKRSKFVYSIDNSEDAKNTTSINLKKFKIENCEVFHGDAKDLISKFDFNKVFIG
FT                   GTQNIEQTLEILKEKKIEKVVANTIVLENSVKIITKFEELGYNVDFVNLSVSYGKKISS
FT                   GHIMLSKNPITIITATLK"
FT   gene            328939..330501
FT                   /locus_tag="MmarC5_0370"
FT   CDS_pept        328939..330501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0370"
FT                   /product="alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="TIGRFAM: alpha-glucan phosphorylases; KEGG:
FT                   mmp:MMP1220 glycogen phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34686"
FT                   /db_xref="GOA:A4FWV7"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWV7"
FT                   /protein_id="ABO34686.1"
FT                   /translation="MKNTAYFSMEFAIDQSLKTYAGGLGFLAGSHFRAAKRLNVPLVGV
FT                   SMLWSYGYYDQVRDREGRMKVENIRKYYDFLTDIDLKVPVVINGTTIWIKAYKLEESTF
FT                   NTCPIYFLTTDIPENDHLSRTISYGLYDGNNLTHIAQEIVLGVGGYKVIRECENVKLFH
FT                   INEAHSLPIAFKMLEDYGIDYVKEHLLFTTHTPIPAGNETQDINLLKSMGFFGSIDTKT
FT                   AEKYGGNPFNLTVAALRMCKRANAVSELHRETSEKMWAWVTNREPIINITNAQDKYYWQ
FT                   DKQIKEAAEKKDIKMLRERKMELKKQLFEEVADQTGSLFDPNILTVVWARRFADYKRPS
FT                   FLLRDEKRFKNLLKTGKIQVLWAGKPHPADSNAQITFNWIVSKTRELKNVSVLTGYELK
FT                   LSKLLKQGSDVWLNTPRRPNEASGTSGMTASMNASMHMSTMDGWHVEWAKAYPEDSFTI
FT                   GDGVNLEEDYEANEMYKYLEEAIKIYDTDKWWEKAVNAVNHVVEYFDAERMIIEYDKKI
FT                   YSD"
FT   gene            330628..332637
FT                   /locus_tag="MmarC5_0371"
FT   CDS_pept        330628..332637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0371"
FT                   /product="DNA repair helicase RAD3"
FT                   /note="SMART: DEXDc2; helicase c2; DEAD-like
FT                   helicases-like; KEGG: mmp:MMP1219 putative DinG
FT                   ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34687"
FT                   /db_xref="GOA:A4FWV8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWV8"
FT                   /protein_id="ABO34687.1"
FT                   /translation="MDFYEFKEYSKEKFPYHGMRSQQEVLMGKIFECVTNKKNLVVEAP
FT                   TGVGKTLSYLIPALYFAERGKRVMILTETIDQQERIVEDLTSLKHNLKVSFMMGKGNFF
FT                   CKSKGDKANTLYCQLNKGCIYRPNKKPVCVCGTKKEKIEFDGNTTFYCPLCLCDYQKAK
FT                   IECFDANIIVMNNSIYYYLKDEIDKKKQTDIVICDEAHKLEGSIRNAATIVINPKYALR
FT                   RLRFMAYHYSNSRLRVHFDRVSEEDDDTFWTIVEDYIVKNAAGKDCKNSLVFDGFKITS
FT                   FGLKEDVAILGTLLEGYNEIVKIKERIEDLTENEELDKKDMKFKIDNKALIPLELQFIA
FT                   DRRISDVPLVEFLENLGNLRHITGNFVVYKNNGSILCEPVLVSTYLSKLYGDASVVHCS
FT                   ATLGDLNIHAIKTGMGKSETLLLDSPFSKDRRNIISLSDGEDMKFNSIDFQSNNKKRNN
FT                   ANENLFKMVKAAKGNTLILFKSFGDLKTAHEYFLDAGYRGNMYCYESGMDGKAAKKLKE
FT                   DFQKYGGLLLATGRFAEGVDIPGDALTCVIIDSLPFPVPTPLLKREQTLLEERLKSRKV
FT                   KDASWSAFLMTSFHIMARTVIQMIGRLIRTETDYGVVVIQDKRFNEWVGSEMLKRKYLK
FT                   DKFIPMSVDTAEEYIPKFMKKMKKDNLKNSSFFK"
FT   gene            332726..333973
FT                   /locus_tag="MmarC5_0372"
FT   CDS_pept        332726..333973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0372"
FT                   /product="LOR/SDH bifunctional enzyme conserved domain
FT                   protein"
FT                   /note="PFAM: LOR/SDH bifunctional enzyme conserved domain
FT                   protein; KEGG: mmp:MMP1218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34688"
FT                   /db_xref="InterPro:IPR005239"
FT                   /db_xref="InterPro:IPR007545"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWV9"
FT                   /protein_id="ABO34688.1"
FT                   /translation="MFMREIELKGHIIDSFILAKVFDRTLELGGDYNVLEFDIGKKKTD
FT                   VSYAKLLISGTSEQHLDQILEELQNVGANIPEIENANLKPALKDSVLPDGFYSTTNHPT
FT                   HVKVNDEWIEVANPKMDAVIVVYPEEKRAETKVMRKVKKGDFVVIGHNGIRVMPPEKSR
FT                   EAGQLFEFMNSEVSSEKPKEAIIKRIAQEMYEIRENYKKTGTGGIAIVGGPAIIHTGGG
FT                   PALAKMVELGYIQAILAGNALATHDIESALFGTSLGVDIKTAKPVTGGHKHHIYAINTI
FT                   IDAGNIKNAVESGVLKEGIMYQCVKNDIPYVLAGSIRDDGPLPDVITDAMVAQDQMRTM
FT                   VMDKKMVIMLSTLLHSVATGNLMPSYIKTVCVDIQPSTVTKLMDRGTSQAIGVVTDVGV
FT                   FLVLLLKELERLELQE"
FT   gene            333991..334650
FT                   /locus_tag="MmarC5_0373"
FT   CDS_pept        333991..334650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34689"
FT                   /db_xref="InterPro:IPR016736"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWW0"
FT                   /protein_id="ABO34689.1"
FT                   /translation="MSETQYSKELIKKAVETISKTKAVATTQNPSQNNDKKTFTDAKAG
FT                   KIDSSEFKKAVHSLIEADEYLYKYAPNHDLDEEKAKEFSKLLFEAQKHINNVLGGFGFE
FT                   FETVSLDGQALYIVSNKKVLKSLKEINPDLNIISTEGVLEIEDMKVVNPKIPEKALLGI
FT                   EKKCKITKEQISKVISNISPSKVVVLVKDGDVADELIYKRAKELYNAEKLNADEIL"
FT   gene            334684..335799
FT                   /locus_tag="MmarC5_0374"
FT   CDS_pept        334684..335799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0374"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase, class V; aminotransferase, class I
FT                   and II; KEGG: mmp:MMP1216 histidinol-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34690"
FT                   /db_xref="GOA:A4FWW1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWW1"
FT                   /protein_id="ABO34690.1"
FT                   /translation="MSIDDKVRAIVKEFKAYVPGKSKEEIARNYGIDPEKIIKLGSNEN
FT                   PWGCSPKIAEKLMNEVSNLHQYPQPINPELMDEISKFTKMPTENIIVGGDGADEVIDNI
FT                   MRILIDEGDEVIIPIPTFTQYAISAKIHGANIKWAKFDEENGFKLDVESVLNNITEKTK
FT                   VIFLCTPNNPTGNVIPTEDIKKIVESTDALVMIDHAYIEYSKGEYDLTNWALKYDNVLV
FT                   LRTFSKVFGLAGQRVGFGVTSKKIVDYMMRIKPIFSLTRASQVSAITALQDKEFFDRCL
FT                   KEGIESREQIYNGLKKFKQLEVYPTEANYMLVKVKNGMNSSEFCEALLKKGVIVRDCYS
FT                   FEGLEPYYFRISIGTFEENERFLKIMSEIVE"
FT   gene            335935..337413
FT                   /locus_tag="MmarC5_0375"
FT   CDS_pept        335935..337413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0375"
FT                   /product="adenosylcobyric acid synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.10"
FT                   /note="TIGRFAM: cobyric acid synthase CobQ; PFAM: Cobyrinic
FT                   acid a,c-diamide synthase; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: mmp:MMP1215 cobyrinic
FT                   acid a,c-diamide synthase:cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34691"
FT                   /db_xref="GOA:A4FWW2"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWW2"
FT                   /protein_id="ABO34691.1"
FT                   /translation="MAKFIMVVGTSSNSGKTVLVSGICRMLSNKGYKVAPFKSQNMSLN
FT                   SRVSIEDGEIAVAQYTQAMAARSEPSVHFNPILLKPKGNFVSQVIVHGIPYEDRDYNEY
FT                   RSKKDDFLDKIKQSINYLDKNYDYVVIEGAGSCCEINLLKDDIANLRVAEIAGADAILV
FT                   SDIDRGGVFASIYGTVQLLPENWRNLLKGFVINKFRGNIDVLKDGFEKIEELTKIPVIG
FT                   TILYDETLILPEEDSQALEGKRVFGNVKSPIEVNIVKFSKIANFTDVDPLSSDCLMKYI
FT                   DFNDDITGDILILPGTRCSTVEMDLMKKHGLDKKILEFVENGGIVLGICGGYQTLGKML
FT                   IDEDFSEGDIGTISGLGLFDMETTFGNEKAIKNSTGTISIFDQNFNVTGYELHEGHSVS
FT                   NETPLISLSRGFGNCGDSYDGSFKIIGNSYIFGTYFHGILENFEFRNYLVNFVRHKKNL
FT                   SKIENDNYAEIFNENMDKLSKLVEESLDLSKIIK"
FT   gene            337506..338180
FT                   /locus_tag="MmarC5_0376"
FT   CDS_pept        337506..338180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34692"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWW3"
FT                   /protein_id="ABO34692.1"
FT                   /translation="MIDEKIRSELEYYIRYELRGVYKSRMKGDIYEIEFENTSYLKYFK
FT                   KLLEKEGIKTKDADISKIEIFRDQYIGGIIDLLKKERMEELIESMNFHNSVIEFISRNF
FT                   NPIITSGRESGIIRFKMMDDGEAFAYNELKELGFNVSLENESIIVDISDTVKEMFKRVS
FT                   TVFDLENMTPYYAFSVTEDEAIEKCKKLDELSVPYKYSDVHREIYLDFDSLKHVISKFK
FT                   ND"
FT   gene            complement(338195..338587)
FT                   /locus_tag="MmarC5_0377"
FT   CDS_pept        complement(338195..338587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0377"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   mmp:MMP1213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34693"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWW4"
FT                   /protein_id="ABO34693.1"
FT                   /translation="MVVRTWRSMQERYNLIGSKCKTCGTVYFPARSVCPECRRKGELED
FT                   FKLGGKGKVYTYSVVYAAPKDFEKQSPYVIGIVELEEGTKVTAQIDCEPEEIKIGMPVE
FT                   TVFRKIREDGCDGVISYGYKFVPTEQ"
FT   gene            complement(338622..339800)
FT                   /locus_tag="MmarC5_0378"
FT   CDS_pept        complement(338622..339800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0378"
FT                   /product="Thiolase"
FT                   /note="PFAM: Thiolase; KEGG: mmp:MMP1212 acetyl-CoA
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34694"
FT                   /db_xref="GOA:A4FWW5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWW5"
FT                   /protein_id="ABO34694.1"
FT                   /translation="MKDVAIIGYGQTKFGELWEESFRSLIVEAGTKAIIDANVDGDDID
FT                   AMYVGTMSGGLFVGQEHTASLIADYAGLNPIPCTRVEAACASGSLALRSAFLSIASGAH
FT                   DVVLVGGVEKMTDVSDATSAIATASDQEWEAFVGATFPSLYAMMAKRYMKEYGLTLEQL
FT                   SSWSAIAHENAVHNNYAQFRSKITIDQIMRASPVADPLTLLHCSPVSDGASALIVCDAE
FT                   KATDYAPKDEIIYIKASTQASDTIALQDRNDMTTLNAAKVASKKAYEIAGINASQVDVA
FT                   EVHDCFAINGLVLTEDLGFCKKGEAGKVVEAGKTRIDDDSFVTVNPSGGLKAAGHALGA
FT                   TGIRQVGELYWQLKQDKECKDRQVTIENGYAISANVGGTGGTVCTHILSNKR"
FT   gene            complement(339819..340868)
FT                   /locus_tag="MmarC5_0379"
FT   CDS_pept        complement(339819..340868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0379"
FT                   /product="putative hydroxymethylglutaryl-CoA synthase"
FT                   /note="TIGRFAM: putative hydroxymethylglutaryl-CoA
FT                   synthase; PFAM: Hydroxymethylglutaryl-coenzyme A synthase,
FT                   N-terminal domain; 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III C terminal domain protein; KEGG: mmp:MMP1211
FT                   3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34695"
FT                   /db_xref="GOA:A4FWW6"
FT                   /db_xref="InterPro:IPR004656"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWW6"
FT                   /protein_id="ABO34695.1"
FT                   /translation="MKEVGIVGYGSDLPKYRIKAEDIAGAWGKDAQAIKRGLVVNEKSV
FT                   PGPDEDTATISVQAARRALSRAGINPKDIGAVYVGSESHPYAVKPTSGIVAEACGVSPD
FT                   FTAADLEFACKAGTAGMQMCMGLVGSEMMEYAMAVGADTAQGAPGDALEYTAAAGGAAY
FT                   IIGAKKEEFIAKFNGTYSYTTDTPDFWRREHEHYPKHGGRFTGEPAYFKHVLNGAKGMM
FT                   AKMDTTAKDYDYCVFHQPNGKFYISAAKQLGFTEEQYKYGLLTPYLGNTYSGAVPLGLS
FT                   NILDHAKADDRIFVVSYGSGAGSDAFDITVSDRISEVVDKEITTEKLLESKKYVDYAVY
FT                   LKYRGKIRM"
FT   gene            complement(340930..341619)
FT                   /locus_tag="MmarC5_0380"
FT   CDS_pept        complement(340930..341619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0380"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   mmp:MMP1210 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34696"
FT                   /db_xref="GOA:A4FWW7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017271"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWW7"
FT                   /protein_id="ABO34696.1"
FT                   /translation="MEKIAIHIMGEIVLSEDIGKAMKKWREMFGIPQIETARYLDVSPS
FT                   VISDYEVGRRKNPGVNIVKKYVYALLEIDKERGGHTIKALSKVLNPTSMKAILQIKEYQ
FT                   NPVGVRELLSTIEGKVICGENSLNNQLFGHTVVDSVKAILEMNGQDFLNLYGWTTERAL
FT                   IFTEVSAGRSPMVAIRVSNIKPRVVIFNGVSELDKLAVKLAELEGICLIVTELSTDELL
FT                   KRLKEMK"
FT   gene            complement(341750..342814)
FT                   /locus_tag="MmarC5_0381"
FT   CDS_pept        complement(341750..342814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34697"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWW8"
FT                   /protein_id="ABO34697.1"
FT                   /translation="MDYSKLLSKKENICSKIKNIDFNFDYESYWNNCDFSSTSDAIFAG
FT                   GDGSFNKIDYINYCLYISGAVSYVQKTDGKVEESISAWDSNIILPYRYVQSRLSLYMLN
FT                   MELKVALWNLKNRNIDYYLYDGSLYSLLVQTNNKFSINGENVENTISKYYEHYGIELKN
FT                   KIFEEIDSKNINSSVELSNDLKFSEEEKIILEQLEYLILLSEILKYREKIVGVAKTSKM
FT                   NIYFKDALIPDLAIFSKCKNSGYSKPLDLVDEKINKNFYKNVEYFKKFGIDLKKLNYQF
FT                   VKLDKNSGTLCITSFEELDETFFSNLQRISVSDYPYILKKSHENVKIEKKEIEKFVKLL
FT                   GIYEKSDRDSNLEY"
FT   gene            complement(342851..344083)
FT                   /locus_tag="MmarC5_0382"
FT   CDS_pept        complement(342851..344083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0382"
FT                   /product="translation initiation factor 2 subunit gamma
FT                   (aeIF-2g)"
FT                   /note="PFAM: protein synthesis factor, GTP-binding;
FT                   elongation factor Tu, domain 2 protein; KEGG: mmp:MMP1208
FT                   translation initiation factor aIF-2, subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34698"
FT                   /db_xref="GOA:A4FWW9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWW9"
FT                   /protein_id="ABO34698.1"
FT                   /translation="MAASNQSEVNIGMVGHVDHGKTSLTRKLTGVWTDTHSEELKRGIS
FT                   IRLGYADCEIKKCETCDEPECYTVGKKCDSCGGKLVTLRKISFVDAPGHETLMATMLSG
FT                   ASLMDGAILVIAASEECPQPQTKEHLMALDALGVENILIVQNKIDLVTEEAAIENYNQI
FT                   KEFTKGTVAENAPIIPVSAHHGANLDVLLKAIQEFIPTPERDETLTPKLYVARSFDVNK
FT                   PGSEIKDLKGGVIGGSIIQGALKVGDELEIKPGIKVTEGNKTHWVPIVTKIISLGVGGK
FT                   KLKSAVPGGLIGVGTELDPNLTKSDALSGSLAGLPGTLPETLEKMVIKPQLLERVVGSQ
FT                   DELVIEPLKTNEVLMLNVGTSTTVGVTASARADKAEIKLKLPVCADKGDRVAISRKIGS
FT                   RWRLIGYGIIL"
FT   gene            complement(344245..344619)
FT                   /locus_tag="MmarC5_0383"
FT   CDS_pept        complement(344245..344619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0383"
FT                   /product="SSU ribosomal protein S6E"
FT                   /note="PFAM: ribosomal protein S6e; KEGG: mmp:MMP1207
FT                   ribosomal protein S6e"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34699"
FT                   /db_xref="GOA:A4FWX0"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR020924"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWX0"
FT                   /protein_id="ABO34699.1"
FT                   /translation="MAFKVVVSDSKTGKSYQFETESTALIGKKIGDEISGSVVELEGYK
FT                   LKITGGSDKCGFAMRHDIHGAMKMRVLLKSGPGYNVKEKGLRRRKSLRGNTISKDITLI
FT                   NTKVVEYGSAPLGGEPESIE"
FT   gene            complement(344828..346168)
FT                   /locus_tag="MmarC5_0384"
FT   CDS_pept        complement(344828..346168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0384"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: mmp:MMP1206 glutamine synthetase; TIGRFAM:
FT                   glutamine synthetase, type I; PFAM: glutamine synthetase,
FT                   catalytic region; glutamine synthetase, beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34700"
FT                   /db_xref="GOA:A4FWX1"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWX1"
FT                   /protein_id="ABO34700.1"
FT                   /translation="MNSVEQAMDYIKTNNVKFIRFQFVDIHGEPKNIAYPVKAGAAGEE
FT                   ELYDVLEKGLYFDGSSIEGFVSIESSDMMLKPDLKTLSVLPWRPTEKSVARVICDVYTT
FT                   TGKPFEGDPRGCLKRVLAKFDEELGGEFFVGPEPEFFILKEDACGSWVPADDAGYFDLE
FT                   PLDGGCDIRRKIVFALENLGFHVEASHHEVAEGQHEVDFKFADAVKTADSVVTFKTTIK
FT                   TLAAQEGLKATFMPKPFFGINGSGMHCHQSIWLNGEPSFYDESAQYQLSETCMSYVAGI
FT                   LDHAKSIVAVTNPTVNSYKRLVPGYEAPVNIAWANANRSAIVRVPAPRGKGTRIEFRAP
FT                   DPSCNPYLAFTVMLAAGLDGVKRKLSAIDPVEKNIFAMSEAQKKAEGIESVPANLKAAL
FT                   DELENNSVLKDALGKHIFENFIEIKNAEWDSFRTSVTDWETKQYLKI"
FT   gene            346337..347626
FT                   /locus_tag="MmarC5_0385"
FT   CDS_pept        346337..347626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0385"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   mmp:MMP1205 3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34701"
FT                   /db_xref="GOA:A4FWX2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWX2"
FT                   /protein_id="ABO34701.1"
FT                   /translation="MLVVKKTPKIKGILSAPPSKSYTHRAVICASLANGISNLKNPLNG
FT                   ADCLSSAHACEMFGAEIELSNETWVVRGSELKTPDNIVDIGNSGTTLRILTGISSQISN
FT                   GYTVLTGDDSIRKRPMQPLLDALNQLGLTCFSTKNNGTAPIVVKSGKISNNVVEIRGDV
FT                   SSQFITSIMMTLPFSENDSEIVLTTPLKSEPYLNITIDVLDKFGVKIEKNEEKNKSGYK
FT                   IKGNQKYLPCDYTIEGDYSSASYLVAAGVLLNSDIVIKNVFKDSKQGDREIIEIVKKMG
FT                   ANVEINEDHVKITGPYKLKGIEIDVTDIPDLVPTIAVLGCFADGKTVVYNGEHVRLKEC
FT                   DRLAACTTELSKMGAEIEEKKDGLIITGVHKLNGAKLKTYHDHRLVMAFTIAGMLADGE
FT                   TIIEGEDSVKISFPDFVDNMKSIGSNIEVI"
FT   gene            347692..348711
FT                   /locus_tag="MmarC5_0386"
FT   CDS_pept        347692..348711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0386"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: mmp:MMP1204
FT                   metallopeptidase family M24:Xaa-Pro dipeptidase/Xaa-Pro
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34702"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWX3"
FT                   /protein_id="ABO34702.1"
FT                   /translation="MDKFGEFLEYLKENDIEKAVITKKETINYFLEKYPPNFSMLIFDS
FT                   KKGTTALQVSKLDFEMAKEYKNKNLDIELYENFESTFKGCKGIEDTLPIRFLKFVKDYK
FT                   LISKKIEEMREIKSKTEIENIKKAAKISDDAIEYATNFALENDNLTENQVAAEIEYFMK
FT                   KNGSIRPSFDTISISDKKTRLPHGMPSNDIVKNILLMDIGALYEGYCSDITRTVILNEN
FT                   IKNYSEIYNIVNSVKKEAEKNLKAVISVKELDLIAREHMGEFKEYFIHSLGHGVGVEIH
FT                   ENPAISSKIKEDIILKEGMVITIEPGIYMDDFGVRIEDLYLVKKNGFEKLSNAKILEY"
FT   gene            348752..349849
FT                   /locus_tag="MmarC5_0387"
FT   CDS_pept        348752..349849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0387"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiD; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiD protein; KEGG:
FT                   mmp:MMP1203 cobalamin (vitamin B12) biosynthesis CbiD
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34703"
FT                   /db_xref="GOA:A4FWX4"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWX4"
FT                   /protein_id="ABO34703.1"
FT                   /translation="MNKIDFRLEKTFGYTTGACAAAGSYSALYFLKNNKKLDFVEILNL
FT                   KGDSLIIPIKNIEKQGNTAISTVEKFSGEDIDITNGMDIKIKVTLENMDNNCSKSSNVK
FT                   IIGGTGVGFITKSGLQVKPGKPAINPKPREMIETNLKSLLKDNECVTVKISVPNGDEIA
FT                   KKTLNPKLGIIGGISILGTTGIVRPMSNDAYKESLAPQIDVALANNFKNLIFVPGNIGT
FT                   KHAKILLNAEEDQIIEVSNFWDHMLDKAKEKGVKDITVFGHAGKIVKLAGGIFDTHSRV
FT                   ADARNEILCAYTSLATQDVKILQKILQSNTTEDIVEILIEKGILTEVFEKVSKRVVERL
FT                   SLRWEGINFSCIIIDMEGNILGKYV"
FT   gene            349862..350245
FT                   /locus_tag="MmarC5_0388"
FT   CDS_pept        349862..350245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0388"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   mmp:MMP1202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34704"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWX5"
FT                   /protein_id="ABO34704.1"
FT                   /translation="MKGHEYKIFEIGLFKKEGENSYLEIYDEFLDGIDGLTKNSKILIF
FT                   LWFNRSDNEDKRTILKVHPRGNINNPIRGVFSTRSPMRPNPIALYTVNIEKISGNKIYI
FT                   EEIDAFSETPIIDIKNYSKELDL"
FT   gene            350253..350804
FT                   /locus_tag="MmarC5_0389"
FT   CDS_pept        350253..350804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0389"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   mmp:MMP1201 Staphylococcus nuclease
FT                   (SNase-like):thermonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34705"
FT                   /db_xref="GOA:A4FWX6"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWX6"
FT                   /protein_id="ABO34705.1"
FT                   /translation="MKRIIFLAPILVLMFSGCISNNDIDSGDFIDSHEHLFGTVTRVVD
FT                   GDTVHVDSNGVDYNIRLLGVDTPETYQKNSISEYYITYETPITDTEYLDYWGHLATNYT
FT                   RDTLENKSVYVVFDKNSDKKDKYGRYLAYIYLDNENFNENLIEYGFARVYVSDFELKDN
FT                   FLETEKTAKSDRIGLWNYNN"
FT   sig_peptide     350253..350318
FT                   /locus_tag="MmarC5_0389"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.940) with cleavage site probability 0.470 at
FT                   residue 22"
FT   gene            complement(351054..352364)
FT                   /locus_tag="MmarC5_0390"
FT   CDS_pept        complement(351054..352364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0390"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: mmp:MMP1200
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34706"
FT                   /db_xref="GOA:A4FWX7"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWX7"
FT                   /protein_id="ABO34706.1"
FT                   /translation="MEFLGNEMLTVEGKNLKIDGYNANELAKAYGTPLYVMSETQTVKN
FT                   FTRYVESFKEYSEKTGKEFIISFAYKANTNLAVTKLLSKLGCGADIVSAGELYIAKLSD
FT                   VPSEKIVFNGNCKLKDEIKMGIEAEIRAFNVDSISELILINETAKEMGKVANVAFRVNP
FT                   NVDAKTHPKISTGMKKNKFGLDIESGIALETIKMAEKMDNVKIVGIHCHIGSQLTYISP
FT                   FVEEARKIMDFVVLLKNEGIEIKDVNLGGGLGIPYDKNTKIPVQEDLSKAILDVIYEYE
FT                   GKIELPNLILEPGRSLVATAGVLLGTVEHVKDTPVAKWIMIDAGMNDMMRPAIYESYHE
FT                   IVPCTVRDEKEVVSIAGGLCESSDVFGKDRELSKMEIKDTVAILDVGAYGISMANNYNS
FT                   RGKPAMILTNEKEVSLIRARETLADLISKDIVPNHLL"
FT   gene            complement(352518..353372)
FT                   /locus_tag="MmarC5_0391"
FT   CDS_pept        complement(352518..353372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0391"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="PFAM: PhoU family protein; KEGG: mmp:MMP1199
FT                   phosphate transport system regulatory protein-related"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34707"
FT                   /db_xref="GOA:A4FWX8"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWX8"
FT                   /protein_id="ABO34707.1"
FT                   /translation="MLRGKDATLAAIINIILDEEPETQDDIADRLNVSRRYVAKLLKPL
FT                   VDGGAIMHPYVVNLEKLKEFEDYIETDRYFKEIYETFDRMGNNVIQNIDKAFDSLKTHD
FT                   LDIAKNIILEDYALNRMEDEVNLVIKLKASKYMDMNSLMQISDIAGNIERCGDYLSNIA
FT                   EEIVNGLFVDPAIKKEVFEIQDIISKMFNHAMNMVKHKTNDTEIYELEGNLHKKLDIMM
FT                   EKLSENPDENLKDINQFIQFGMFLKDVERFGDRSLKIFEFGREFHYNIPKNVKTPEYVR
FT                   NLK"
FT   gene            complement(353478..354242)
FT                   /locus_tag="MmarC5_0392"
FT   CDS_pept        complement(353478..354242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0392"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmp:MMP1198 nitrate/sulfonate/bicarbonate ABC
FT                   transporter ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34708"
FT                   /db_xref="GOA:A4FWX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWX9"
FT                   /protein_id="ABO34708.1"
FT                   /translation="MSVLELKNLIKKFGNSKKDLVAVDNVDLSVQHNEFVSIVGPSGCG
FT                   KSTILRMIAGLENPTSGGIYLDKKDVLGPDADRGMVFQQYTLLPWKTVLQNVTFGLEIK
FT                   NVPKEERIEIAKKFIKMVGLEEFCDSYPYELSGGMQQRVAIARTLANDPKIVLMDEPFG
FT                   ALDTQTRAVLQDHLLKIWESEKKTVVFVTHSVDEAVYLSDRVVVMTARPGKIKCIIDID
FT                   LGRPRKRTSVEFLEYKKKIIDELKSEVLKTYV"
FT   gene            complement(354277..355038)
FT                   /locus_tag="MmarC5_0393"
FT   CDS_pept        complement(354277..355038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0393"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mmp:MMP1197 transport
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34709"
FT                   /db_xref="GOA:A4FWY0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWY0"
FT                   /protein_id="ABO34709.1"
FT                   /translation="MKLLKNLILPVIGILTWEILAIYLNNPVILPKVESVISILLNPGV
FT                   GILGTGNLIENTIVSIKRVLIGFFIAGAFAIPLGLLMGYYSLINDLLDMSVELFRPIPP
FT                   LAWVPLALAWFGIGESSMHFIIFIGAFFPILINTISGVKSVPVIMVEAAKTLGGSTKDI
FT                   LKSVVVPASSPDILTGLRVGAGIAWMCVVAAEMLPGSDAGLGYLIMYAYSLSKMNVVVA
FT                   SMIIIGIIGIILDKGLRYIETKYFCWKKMIK"
FT   gene            complement(355215..355763)
FT                   /locus_tag="MmarC5_0394"
FT   CDS_pept        complement(355215..355763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34710"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWY1"
FT                   /protein_id="ABO34710.1"
FT                   /translation="MKKIVLILSLVLLSSFCLCTDKTDGGSEDLSDYSSTLVVQFGDTM
FT                   VNVPLRAVINDSMTTSLINTNDSDIKSDYTSGNYKIMYFEYDPTISNEEGGIVLTDLVS
FT                   KVSVFTTTYPYEIADQTLFNNTEDIEKVKNSNLTLIIQIERTNNSATITKYNNTYVIEG
FT                   NSLEELDKAESRFVIAMLS"
FT   sig_peptide     complement(355701..355763)
FT                   /locus_tag="MmarC5_0394"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.896 at
FT                   residue 21"
FT   gene            complement(355841..356178)
FT                   /pseudo
FT                   /locus_tag="MmarC5_0395"
FT   gene            complement(356322..358376)
FT                   /locus_tag="MmarC5_0396"
FT   CDS_pept        complement(356322..358376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0396"
FT                   /product="Collagen triple helix repeat"
FT                   /note="PFAM: Collagen triple helix repeat; KEGG:
FT                   mmp:MMP1194 collagen triple helix repeat:surface protein
FT                   from Gram-positive cocci, anchor region"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34711"
FT                   /db_xref="GOA:A4FWY2"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWY2"
FT                   /protein_id="ABO34711.1"
FT                   /translation="MKKICTLLLVFALVSGLNIAYADSAPSLPHTIYGDVSINGLPATG
FT                   TLKVLVNGVESEQVQVNDGEFGKGLFDPKLVVSGASGDELTFSFEAESYTINPAYNIYL
FT                   VDSAQYVSEIDFASGGYTQVLLEFTGTGDTGDTGDTGDTGDTGDTGDTGDTGDTGDTGD
FT                   TGDTGDTGDTGDTGDTGDTGDTGDSGSMPLNPELFYGIATIGETSASGTLNVYVDDVLQ
FT                   DSIEVQNGLFGGSGPLSEKLVATGYVGESNEVKFTLVSGEETYSSFIAEIGEETYTDEL
FT                   PYVEGVQNIDIEFSEVTGDAGDTGDTGDTGDTGDSGSMPLNPELFYGIATIGETSASGT
FT                   LNVYVDDVLQESIEVQNGLFGGPCPLAEKLVATGYVGESNEVKFTLVSGEETYSSFIAE
FT                   IGEETYTDELPYVEGEAYYMEISFSESANTEDSNSNSNTNETNNSSMPLYPELFYGLVY
FT                   LDDTLPSSTLNVYVDDVLQDSIEIENGVFGGEGPLDDKLTATGYESSSNVVTFSLVSGE
FT                   ETYSSFTAELSNATYENEVPYDEGVHYVIITFSSKATETGDSGSTGGGGSSGSSSDDSS
FT                   STVIISSDSSETSATTKNSDSGTLMKTTSSANPGETSEDTEQTTAKNSQDVTSDSETYD
FT                   NETGVVLQQESPLGGINIYLAMAAILLILIALAAAWYQSREKPEVLPQP"
FT   sig_peptide     complement(358308..358376)
FT                   /locus_tag="MmarC5_0396"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 23"
FT   gene            complement(358435..362949)
FT                   /locus_tag="MmarC5_0397"
FT   CDS_pept        complement(358435..362949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34712"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWY3"
FT                   /protein_id="ABO34712.1"
FT                   /translation="MNKKSGQALFLVLVMVLSNMGGVIALEPTTLDTCTCNGDSGSGTI
FT                   IMDCNCTDDRCFNISIISPECASTWCDEVPINGTIVPCVDDELGCADYIKVYYKKLSDY
FT                   CCDCECGNPEAYEECGWSVVGTDDSLEGECPALWSLDWPICCETDGCYVLRAVLYDGCD
FT                   MQVGCPSEPVYICFDKGVAVCLDLPASLSCGGTIEGCLNESCDCVDYILITANYTGEGS
FT                   CLRCPQEDCMPTMTYIVDREDFGNAMCCDYTFDVLFNNLYCGGCYEITATPYADCTDDC
FT                   MYNGVQIGEKYVGYLEIIREDVCFEIECPAPVTPECGMTLCGPITFSGILNDPCNAAQC
FT                   IEFYAVKTGNFTLCDGACCAPTCNACDGEIVTLDLELQDLPENICPNCGAEMDPIICGA
FT                   CGGIVTGYSCPNCGYPSNEDIGTGVPECICGIPEDHDNYICKCALYDMEYLGCTYATMP
FT                   NWTFTTNEFCDFDSGCYEVYAVVIDKCECYYEYRYDTVEFAYCNERNLTIELEDCVYED
FT                   CWMGDNCYKVYDIQSGTVTAYGDITVPTCWIDYPDYVALEYDFGEKVYDKCSWHIEWDD
FT                   KWKDASCTDGSITWTYEGACLKSGTWETDWCTPEDIQNEEGKYVRIRGVATGGCGEFES
FT                   EPIGTSIYNEFDVNIIDPCEGNTIYNGKVIRGFVWVDTDCCGWWCWPGCNNWPDEDEVC
FT                   LPDHVDLYWREYGTENWLPMDSAFLSWKNSEQYIDFTDYGIDPLYPNLPDFRWCDNYAY
FT                   WDVTWTSCMVNCIDNGHYEIKAVVEPCENDECGDFERAEYIIDIYVDDTSGVTISKPID
FT                   GQTVCDNFWVYGTAVGAGVSNVDFYVSEDNSSWTLYKEDIDVNVEDGRWKAALNTCCFE
FT                   DGPLYLKAVVTGPCDQSESNVMVNVNNAIEIDITCPDCCVYYVTGTKAPIRGTLTGCLV
FT                   DERVGGVKIYTPSGELIGDVSNETFRYIGDGTWEWGLCFNPCELNNASTQIRAEADYYC
FT                   GNTITTITTEYECMQYDPDLVVLDITSPGVEPTVAGTITIEGTVQCMCLDYLEFEYREI
FT                   CEPTGEPIGDWTNFPDVSTIYLPITCDCEGMIWTIDLNTCGMDGLYEIKASAYGWPCEG
FT                   AIASDMSMIDVDNTFGITLTTPAINSGVKNGTIEVGGTVENCPVIDTIELWYIDQGIPN
FT                   MITDEITCSDGLWNYMWDTTTMEDGCYCIVAYAYDDDCGSMEATKTRAVCINNSGIPAE
FT                   INETNTTIDRECVSILTACYLPCTTLYVTFNDTVSINDSYEPYADPLAGFDISGGSFGT
FT                   GAWMEEDGTNDHRIIVHLGTGHTIASGTSGISIKINQTAILGPHGFPIVDCSALLKGIS
FT                   IPESSGTSESSGTIELENMKMFSVPGKVDTEQMIIDAGIAEGSFVKYTNGRWEQVTEFQ
FT                   PLEGYVYIGTFEGSMPIYIEDLLPTDTPPEIQLASGWNLVGVNTYGGSLDHVACEDFIG
FT                   TAPISKLLEFSSSGWLKLSGSDPLEPTNAYWAYADSSCSFAGQ"
FT   sig_peptide     complement(362872..362949)
FT                   /locus_tag="MmarC5_0397"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.989 at
FT                   residue 26"
FT   gene            complement(363586..364701)
FT                   /locus_tag="MmarC5_0398"
FT   CDS_pept        complement(363586..364701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0398"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mmp:MMP1192 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34713"
FT                   /db_xref="GOA:A4FWY4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040087"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWY4"
FT                   /protein_id="ABO34713.1"
FT                   /translation="MDLSNLNEKDLALGCKYCIKGEKLVLYITGLCEESCYYCPLSEKR
FT                   KKKDVIFANEKQIDSIEEAIEEAYLCGSKGVGITGGNPLLRIERTVEYLKALKEEFGKN
FT                   FHAHLYTTPKFVNEENLRLLKEADLDEIRLHSTKLFNDFENFDKMEFLEKLKLCKKYVK
FT                   DVGVEIPGIPNFEKEILDLAFEIDKIGVKFLNINELEYSETNYQALIDRGFSEKDDTTS
FT                   RISGSFETAKYVRDNFKGKMIIHFCPSSLKDSVQMKNRLINRAMNVAKPYEEITEEGLL
FT                   LKGIINFKNIEDVSEVIDILKENEVDFELLKDRLYLNPEILEDLIEQLKENEFNFKFSA
FT                   YISEYYPTSDKLEVERIPIVTKKPNLKLKKK"
FT   gene            complement(364810..365781)
FT                   /locus_tag="MmarC5_0399"
FT   CDS_pept        complement(364810..365781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0399"
FT                   /product="methenyltetrahydromethanopterin cyclohydrolase"
FT                   /EC_number="3.5.4.27"
FT                   /note="PFAM: Methenyltetrahydromethanopterin
FT                   cyclohydrolase; KEGG: mmp:MMP1191
FT                   N(5),N(10)-methenyltetrahydromethanopterin cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34714"
FT                   /db_xref="GOA:A4FWY5"
FT                   /db_xref="InterPro:IPR003209"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWY5"
FT                   /protein_id="ABO34714.1"
FT                   /translation="MISVNLASLPIVEDMINRKEDLNIEVIKLENGATVLDCGVNVMGS
FT                   FEAGKLFTKICLGGLAHVGISISGSLDNKLVLPCVKIKTSHPAIATLGAQKAGWSVSVG
FT                   KYFAMGSGPARALAMMPKATYEEIDYKDEADVAILCLESSQLPDENVADHVAEKCGVDV
FT                   SKVYLLVAPTASMVGAVQISGRVVENGTYKMLEALHFDVRKVKFAAGIAPVAPVIGDDL
FT                   KMMGATNDMVLYGGRTYYYVKSDEGDDIENLCKSLPSCSAETYGKPFLDVFKEANYDFY
FT                   KIDKGIFAPAVVTINDLRTGKLMSYGETNVDVIKKSLKFSQL"
FT   gene            365972..366424
FT                   /locus_tag="MmarC5_0400"
FT   CDS_pept        365972..366424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0400"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase, FKBP-type; KEGG:
FT                   mmp:MMP1190 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34715"
FT                   /db_xref="GOA:A4FWY6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWY6"
FT                   /protein_id="ABO34715.1"
FT                   /translation="MITKGDTIKVDYTGRFEEGEVFDTSVEAVAKEEGIYEEGRPYMPL
FT                   EFTVGEGQLIQGFEEAVLGLKVGEEVTVTIPPEKGYGFRDESLIERVPIEAFDEADFEP
FT                   EEGMVIVAGEEPAVILEVTDADVALDFNHELAGETLQFTIKLIEKL"
FT   gene            366500..367219
FT                   /locus_tag="MmarC5_0401"
FT   CDS_pept        366500..367219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0401"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="KEGG: mmp:MMP1189 ribose 5-phosphate isomerase;
FT                   TIGRFAM: ribose 5-phosphate isomerase; PFAM: Ribose
FT                   5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34716"
FT                   /db_xref="GOA:A4FWY7"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWY7"
FT                   /protein_id="ABO34716.1"
FT                   /translation="MARTKKANDEVPTNSDSLKLKVAKQAAKLVKDEMVVGLGSGSTAN
FT                   LFIQELGKRIVEEELYIYGVPTSFDSRMVASTAGIPLISLDQCGEIDIAVDGADEVCKS
FT                   TLSLIKGGGGCHTMEKIVDYHAKEFIVLADEGKLVDSLGDKTPVPLEVIPFAYSTVLNK
FT                   LLKMNTAPAIRTGSGKMGPVITDSGNMIIDVFISIDDAEETENMLNNIPGVLENGVFSK
FT                   CDKVLVGTSKKVEILKK"
FT   gene            367365..367640
FT                   /locus_tag="MmarC5_0402"
FT   CDS_pept        367365..367640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0402"
FT                   /product="Protein of unknown function UPF0147"
FT                   /note="PFAM: Protein of unknown function UPF0147; KEGG:
FT                   mmp:MMP1188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34717"
FT                   /db_xref="InterPro:IPR005354"
FT                   /db_xref="InterPro:IPR023130"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWY8"
FT                   /protein_id="ABO34717.1"
FT                   /translation="MFSAKKLSPTDKLRNISSMLEEIVEDTTVPRNIRAAADNAKNALH
FT                   NEEQELIVRSATAIQYLDDISEDPNMPIHTRTQIWGIVSELETIKN"
FT   gene            complement(367699..368244)
FT                   /locus_tag="MmarC5_0403"
FT   CDS_pept        complement(367699..368244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0403"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: mmp:MMP1187 class II aldolase/adducin, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34718"
FT                   /db_xref="GOA:A4FWY9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWY9"
FT                   /protein_id="ABO34718.1"
FT                   /translation="MNLSNFIKICHLLYDRKYVVGSGGNVSIKNKNLIYITPTGSILGF
FT                   LNEEDICVADIEGNILKGKPTSELNMHLKIYQNKESINAIVHTHSMYCTAFSALDKKLE
FT                   LLTPEAEIFIKKIAYVDYFPCGSLELAENVSACVEDSIILKNHGIVTLGKDITEAYVKT
FT                   EVLEEIAQLNYIMNNLGE"
FT   gene            complement(368284..370362)
FT                   /locus_tag="MmarC5_0404"
FT   CDS_pept        complement(368284..370362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0404"
FT                   /product="Lon-B peptidase, Serine peptidase, MEROPS family
FT                   S16"
FT                   /note="TIGRFAM: peptidase S16, Lon-like protease; PFAM:
FT                   peptidase S16, lon domain protein; KEGG: mmp:MMP1186
FT                   eukaryotic thiol (cysteine) protease, active
FT                   site:ATP/GTP-binding site motif A (P-loop):sigma-54 factor
FT                   interaction domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34719"
FT                   /db_xref="GOA:A4FWZ0"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR004663"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWZ0"
FT                   /protein_id="ABO34719.1"
FT                   /translation="MFSVQFNTTDELPEPSPNLINQVIGQDEAVKIVLSAVKNKRHALL
FT                   LGDPGVGKSMMVKAFGQLLEHSSEFKPYSLIARPNMKNSEKPIVDLIEGRMIEETIQTQ
FT                   NPKLMRQPPSIFTLLLGIIVSSLVLSYILNGLSDPSSKFAVIAAISVIGSLLVFLILFL
FT                   NIFGATKASMPNTVSPADVKPVVLYECKKRPLVRASAYNTTKLLGDIKHCPLGGKPPIG
FT                   TPPHKRVILGAIHEAHKGILYVDEIKTMPVDVQDYILTALQDKQLAISGRNPNSSGASV
FT                   ETNPIPCDLTLIMSGNMDDASNLRAPLLDRIDYKVVLKNKMDNNQENRDKLLQFIVQEL
FT                   KNNNLRPMTYEACCEIVKMAQLLSGSKNKLTLRLRQVSNIIKMANDIATGKELAESIEE
FT                   MSEETGPELTVKPVEKPGEKKKTKKIMKVVGKFKPKKSEDTSHKKIVSKAPVIEKEDET
FT                   VISLEHINEIVNTGIYSMTKQVAIDYLKNFKRYKNIVSNDVPKTGVIHGLAVLGADGLG
FT                   DVTKIITKIVKSKHPRTNLLNISGDIAKHSITLASALSKKLVSDGTLSIAKAKGGLSKE
FT                   DLDLAEHEIYIQFSQSYSKIDGDSATAAACLSIISSLLNIPLKQDFCITGSLDLNGDIL
FT                   AIGGVNEKINAAKEYGFKRVIIPQSNLEDVIDPEGIDVIAVTRLEELIPLVFELDNL"
FT   gene            complement(370376..370915)
FT                   /locus_tag="MmarC5_0405"
FT   CDS_pept        complement(370376..370915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0405"
FT                   /product="Hydrogenase 3 maturation peptidase Hycl, Aspartic
FT                   peptidase, MEROPS family A31"
FT                   /note="TIGRFAM: hydrogenase maturation protease;
FT                   hydrogenase maturation protease HycI; PFAM: peptidase M52,
FT                   hydrogen uptake protein; KEGG: mmp:MMP1185 hydrogen uptake
FT                   protein:hydrogenase maturation protease HycI"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34720"
FT                   /db_xref="GOA:A4FWZ1"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004420"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWZ1"
FT                   /protein_id="ABO34720.1"
FT                   /translation="MESIQSTIKSFINNSNKIAILGIGNYLKSDDGFGVYVVESLVKNY
FT                   SKTYETLYLEKEVNSVNDKLVLMNCGVVPENFTDVIKKENPDKIMMIDAALMHQEPGTL
FT                   RIVESDEISETGFSTHSLPLSIIIKYINIHIDTEILIIGIEPTDLEFGEPLSGLIKEKA
FT                   DEFSKLLIEEIDSVLL"
FT   gene            371031..371558
FT                   /locus_tag="MmarC5_0406"
FT   CDS_pept        371031..371558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0406"
FT                   /product="[SSU ribosomal protein S18P]-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmp:MMP1184 N-acetyltransferase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34721"
FT                   /db_xref="GOA:A4FWZ2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWZ2"
FT                   /protein_id="ABO34721.1"
FT                   /translation="MEKVVIRNVRKNDINEIMNIENDSFVEGISESRDAFLNRINTFSD
FT                   GFLVLEVDSEVLGYISSEIWEYFENIDEKMFNLNHDIKKVHNINGSELYISSIGVLKKH
FT                   RKKGYGNLLFNELIERITKKYKISSMILTVSAKWNAAIKLYEKNGFKKIGILKEFFEDD
FT                   ECSDGILMRKYI"
FT   gene            complement(371559..372341)
FT                   /locus_tag="MmarC5_0407"
FT   CDS_pept        complement(371559..372341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0407"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmp:MMP1183 iron ABC transporter ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34722"
FT                   /db_xref="GOA:A4FWZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWZ3"
FT                   /protein_id="ABO34722.1"
FT                   /translation="MISLGENMIVSVDGVEFKYKSTEILKDVKFEVKKGEVVSILGING
FT                   AGKSTLIKCINKILPPKKGTITIENLDVNKMDRLDLAKKVGYVPQRSNGNYMTVFDALL
FT                   LGRKPHIKWEISQKDIEITENVLKLLDLDKYALRNTNELSGGELQKVIIGRVLVQEPKL
FT                   ILLDEPTNNLDLKNQLEVMRILKDVSVSENITSIIVMHDINLALRYSDKFLMLKDGKIF
FT                   AEGGKEIINTQNIVEVYGVNTQIHDLNGQLTVVPGEGY"
FT   gene            complement(372338..373384)
FT                   /locus_tag="MmarC5_0408"
FT   CDS_pept        complement(372338..373384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0408"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   mmp:MMP1182 iron(III) dicitrate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34723"
FT                   /db_xref="GOA:A4FWZ4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWZ4"
FT                   /protein_id="ABO34723.1"
FT                   /translation="MESSVNDYKKYTLKKLIFGFLLIIALIVIAVYALCTGDFHLSINQ
FT                   IINALLGSGDAASNLVIWNIRLPRIFAAVLCGIGLSVSGAVMQCVLRNPLASPFTMGIS
FT                   HGAMFGACVAIITLGIGGAESTGHIAINNPYSITVFAFFGSLLGVCAVLLLARLKGLSP
FT                   EAMILAGVAISSLFTAATTLIQYFADDMQLAAMVYWSFGDLGRPLWPEVKIMAFVAAVS
FT                   LIYFIHKRWDYNALESGEETAKSLGVNTDKIRLSGMLVASLVTSVCVAFLGIIGFVGLI
FT                   CPHIVRITVGGDYRYLIPLCSIFGAVLVLLADTIARTIISPIILPVGILTSFLGAPMFL
FT                   YLLMKMYK"
FT   gene            complement(373495..374622)
FT                   /locus_tag="MmarC5_0409"
FT   CDS_pept        complement(373495..374622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0409"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: mmp:MMP1178
FT                   iron transport Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34724"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWZ5"
FT                   /protein_id="ABO34724.1"
FT                   /translation="MYKKIGTLIIASLMILTIAICGCTESTGGTTVTNEEITTITVVDA
FT                   AGRTVEVPQNPEKIIALSCALREVVYLQSQDKVVGIEFREAAKKTDGTFPSGLELPYLA
FT                   AYPELMNLTVVNAGNTVNVEEIAKLQPDVIFVGTSGAGSAEDIQAKTGIPVVIVYVATV
FT                   GTEAQNEKYYETLELMGKVLGKEDRAEELISIFEEYETDLANRVADISNEEKPTVYVAG
FT                   RPYMGVHGLDGTDPHWPAFELLNANNVASEVSDVSEGISVNKEQVLEWDPEYIFVSESS
FT                   MNLINEDLNDPAYRGLSAVQNGNVYGVLPYCWYSFNKETGIANAYFVGKTIYPEQFSDI
FT                   NVEEKADEIYEKFLGKPVYSIMESQFPGYTELTNN"
FT   sig_peptide     complement(374536..374622)
FT                   /locus_tag="MmarC5_0409"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.952) with cleavage site probability 0.516 at
FT                   residue 29"
FT   gene            complement(374768..375889)
FT                   /locus_tag="MmarC5_0410"
FT   CDS_pept        complement(374768..375889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0410"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: mmp:MMP1178
FT                   iron transport Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34725"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWZ6"
FT                   /protein_id="ABO34725.1"
FT                   /translation="MSKKIISVILALMMSLVVAFSGCIGSSESSASEVSDTIEIVDLLG
FT                   RTVEVPADVQKIVCSGPGCLRLICYLDATEYLVGIEGFENTNLIGRPYRLAHDEFSELT
FT                   VIGNGGPQDINVGPDPEKVLNVMPDVIFITYMDADKADELQEKTGVPVVVLSYGALGNF
FT                   KNDAIFDSLTLSGEILGKEERAQDVISFMTGIQDDLDKRTADIPDEEKPTIYVGAIGNK
FT                   GVHGIDSTEGAYPPFEALNTENVAKVASTEHLFLSKEQILEWDPEFIFIDEGGLSLVYE
FT                   DYEKSPEYYESLDAFETGNVYGILPFNYYTTNLDTAMADSYYIGSILYPEAFSDVDPAA
FT                   KADEIYEFLDGEGVYSEMAEMFGGFEKLNFSNQ"
FT   sig_peptide     complement(375794..375889)
FT                   /locus_tag="MmarC5_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.784 at
FT                   residue 32"
FT   gene            complement(376005..377129)
FT                   /locus_tag="MmarC5_0411"
FT   CDS_pept        complement(376005..377129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0411"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: mmp:MMP1178
FT                   iron transport Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34726"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWZ7"
FT                   /protein_id="ABO34726.1"
FT                   /translation="MKKLGVLSALISLMIALSFSGCVDNTAESSVEVAKTVEIVDMVGR
FT                   TVEVPADIQRIVCSGPGCLRLVTYLQAQDKVVGVESIEQDNSTGRPYHLANVEFFQSLP
FT                   MTGAGGGKEIGVGPYPEQVISAAPEVIFITYMDADRADDLQEQYGIPVVILNYGDVNSF
FT                   HDENLVSCLNLLGTLLQKEERAQEVIDFFADAENDLLTRTENIADEDKPSVYIGGLCNK
FT                   GAHGIDSTSSNYAPFAALNADNIASSLGVEKSVFISKEQLLEWNPDIIFIDTGSYELIK
FT                   EDYDKNAEYYESPGAFKNGNVYTQFPYNYYTTNYGTALADAYYIGKVVYPEQFSDINME
FT                   EKADEIYEFLVGEAVYDKMAEGYCGFENLDFSNQ"
FT   sig_peptide     complement(377058..377129)
FT                   /locus_tag="MmarC5_0411"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.599 at
FT                   residue 24"
FT   gene            complement(377274..378359)
FT                   /locus_tag="MmarC5_0412"
FT   CDS_pept        complement(377274..378359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34727"
FT                   /db_xref="GOA:A4FWZ8"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4FWZ8"
FT                   /protein_id="ABO34727.1"
FT                   /translation="MNSEKYQNSFPLPDESPEKIDKIMSETYFGAQKFYLLKTALELKI
FT                   FDYLSDSKTSEELSSILDLDPVLTELMLKSLYELGIISIASKNGETHYINTTGSDNYLK
FT                   TDSIHSKSPSISASFNSMDRWTKLSEIMNGSKSEITETVFFPEIIKRMANDTKCWELQK
FT                   TVEYVAKFSEFKSAKKLLDIAGGHGLYGISLGMLNENLDAFVFDLPEVTLETKKFIEKY
FT                   DAKNVDTIPGNFFTDEFGENYDVIFSSYNPGGKNPKVAEKVHRALNVGGIFVTKQAFPK
FT                   LSAQSTSDNLNNMEWNFNSFENTGKGLVRYTFDTDLTFEEYVSYLEGLGFEILDTKPVY
FT                   ELIEFSEEMFPNNIIVAKKIK"
FT   gene            complement(378504..379157)
FT                   /locus_tag="MmarC5_0413"
FT   CDS_pept        complement(378504..379157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0413"
FT                   /product="1-Cys peroxiredoxin / 3-Cys thioredoxin
FT                   peroxidase"
FT                   /EC_number="1.11.1.15"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mmp:MMP1174 alkyl hydroperoxide reductase/ thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34728"
FT                   /db_xref="GOA:A4FWZ9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FWZ9"
FT                   /protein_id="ABO34728.1"
FT                   /translation="MVVIGEKFPEVEVITTHGKLKLPEHYIEAGKWFVLFSHPGDFTPV
FT                   CTTEFVAFQKRYDQFRSLNTELIGLSIDQVFSHIKWVEWIKEKLDVDIEFPIIADDRGE
FT                   LAVKLGMISPYKGNNTVRAVFVVDATGTIRAIIYYPQEVGRNMDEVVRLVKALQTADKG
FT                   YATPANWPENDFLNEKVIVPPANNMDARKNRLEACKSGELEGYDWWFCYTDLKE"
FT   gene            379382..380191
FT                   /locus_tag="MmarC5_0414"
FT   CDS_pept        379382..380191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0414"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: mmp:MMP1173 zinc
FT                   transporter, ZIP family"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34729"
FT                   /db_xref="GOA:A4FX00"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX00"
FT                   /protein_id="ABO34729.1"
FT                   /translation="MVLLTSYNPVVLALLATIFTWLVTALGASLVYLTKTVNRKLLDIS
FT                   LGFAAGIMIAASFWSLLAPAIELSNSMGNLTWFPASFGFLIGAFFLAGVDKIVPHLHRG
FT                   QPLKEAEGPKTTWHKNRLLLLAVTIHNIPEGLAVGIAFGALALNMSIDSLMAAIVLALG
FT                   IGIQNFPEGIAVSFPLRGEGLSKNKSFFYGQLSAIVEPIAGVLGAFLITIFTPILPYAL
FT                   SFAAGAMMFVVIEDIIPECQREGNIDSATIAAIFGFIVMMILDVALG"
FT   sig_peptide     379382..379465
FT                   /locus_tag="MmarC5_0414"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.969) with cleavage site probability 0.774 at
FT                   residue 28"
FT   gene            380314..380865
FT                   /locus_tag="MmarC5_0415"
FT   CDS_pept        380314..380865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0415"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG:
FT                   mmp:MMP1172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34730"
FT                   /db_xref="GOA:A4FX01"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="InterPro:IPR033921"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX01"
FT                   /protein_id="ABO34730.1"
FT                   /translation="MAQVSREMVENSGINVDELVELLVKNAAAELTTFYYYTILRINLI
FT                   GLEGEGLKEIAETARIEDRNHFEALVPRIYELGGSLPKDMKDFHDISGCPPAYLPDDIT
FT                   DINKLMKVLLQAEQCAVKQYTKICNMTAGKDHRTYDLALAILNEEIQHESWFSEFLGDG
FT                   PSGHFLRKGKTSPFVSKFLE"
FT   gene            complement(380991..381605)
FT                   /locus_tag="MmarC5_0416"
FT   CDS_pept        complement(380991..381605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0416"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /note="TIGRFAM: CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: mmp:MMP1171
FT                   archaetidylserine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34731"
FT                   /db_xref="GOA:A4FX02"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX02"
FT                   /protein_id="ABO34731.1"
FT                   /translation="MFKIRNIITISDYVTVINIIFGMLAILLHDFRFVYISIVFDALDG
FT                   IVARKTNTVSDFGAELDSICDVVSFGVAPAYLIYYYFDSTAVIFASIVFLIGGALRLAR
FT                   FGILDVKHFIGLPIPAAALFLCVLSQVFLKYNFGSEYIVSIIAIIAGILMISDITYPKY
FT                   PKKPLLAIFGISIILSMFGFIEPLALCALLYVLYGIFKIRF"
FT   gene            complement(381617..382309)
FT                   /locus_tag="MmarC5_0417"
FT   CDS_pept        complement(381617..382309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0417"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   mmp:MMP1170 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34732"
FT                   /db_xref="GOA:A4FX03"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX03"
FT                   /protein_id="ABO34732.1"
FT                   /translation="MEKNDIFVVIPAYNEEKMIKNTLINLKSHGYENIIVVDDGSRDKT
FT                   EKLAISEDVIVCKHIINRGLGGALKTGLKCAIKYNPKAIVTFDADGQHDPNDIIKVSEP
FT                   IIEDNFDVVVGSRLIDENELKNMPFIKKIGNWGLNFITYLMGGQMVTDSQGGLRAFSYN
FT                   AAEIVSKQLKSNRYEVSSEFIVLFKKNNLKFKEVPIKTIYTEYSMARGTNVITGFKILF
FT                   KLLIQKLI"
FT   gene            complement(382450..383640)
FT                   /locus_tag="MmarC5_0418"
FT   CDS_pept        complement(382450..383640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0418"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: mmp:MMP1169 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34733"
FT                   /db_xref="GOA:A4FX04"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX04"
FT                   /protein_id="ABO34733.1"
FT                   /translation="MAQKYKDVSAKFGEDIDLSMYPTPKENLLKVDSLKELSDDHKKAL
FT                   ANVGVDIEEKNTIGSYVQVNSDAVYSKMYSDIIIMPITEALEKFELDDYYWSAVKMSDK
FT                   YGARVANELTEGYFIRAPKGVKKTIPLQTCLLIGSEEVSQNVHNIIIVEDGAELNLITG
FT                   CTTSPHVKSGLHLGVSEIYIGKNAKLTFTMIHNWGENVHVRPRTAVKMDDDSIFINNYV
FT                   TMMPVKSIQSYPTAYCEGKNAKATFQTIVYGKGDSKLDMGSRVILSGENSAADMISRVI
FT                   VVDDAEVISRGHLVGAESHVKGHLECRGLILSNEGHILAVPELEAEKTDLELSHEAAVG
FT                   KIAEDQIMYLMSRGLSEDEAASLIIKGFLSVDISGLPPELAKSVKEMMDMTLENAM"
FT   gene            complement(383646..384392)
FT                   /locus_tag="MmarC5_0419"
FT   CDS_pept        complement(383646..384392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0419"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmp:MMP1168 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34734"
FT                   /db_xref="GOA:A4FX05"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX05"
FT                   /protein_id="ABO34734.1"
FT                   /translation="MLQIEDLSVKVGEKEILKDIHLYIDKGETHVLFGPNGAGKSTLLN
FT                   TILGNPKYEVVRGNIYFKGKEITDMPMHERALLGIGISYQSPPAISGVRLETMINAISN
FT                   RSDEEMEEMAEKLNIRHFYSRDLNVGFSGGEVKRSELLQIFAQNPDLVMFDEPDSGVDV
FT                   ENVEILGGIINHLLDKNKKPSERNKSGLIITHLGYILNFMEVDKAHVLLDGVIACSGTP
FT                   DEILNEIIKNGYQRCVSCCQKKSCNK"
FT   gene            complement(384393..384947)
FT                   /locus_tag="MmarC5_0420"
FT   CDS_pept        complement(384393..384947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0420"
FT                   /product="flavoprotein"
FT                   /note="PFAM: flavoprotein; KEGG: mmp:MMP1167 flavoprotein
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34735"
FT                   /db_xref="GOA:A4FX06"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR014072"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX06"
FT                   /protein_id="ABO34735.1"
FT                   /translation="MVKVAWGITGCGDKIEEIVEMIIELKKEHEELDVDIYYSKSAEMV
FT                   LNWYKLMGKLKDTFYNIRKEVNSNAPFLPGMLQTGKYDLFLVAPVTANSVAKIAHGVAD
FT                   TLITNSVAQGTKAMVPTYIYPPDNKKEEIETILPGGKTLKLYIRDTDVENVNVLKKMQS
FT                   ITVLENVDEIREALLKHIKGD"
FT   gene            complement(384950..385543)
FT                   /locus_tag="MmarC5_0421"
FT   CDS_pept        complement(384950..385543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0421"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mmp:MMP1166 related to iron-sulfur flavoprotein of
FT                   Methanosarcina thermophila"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34736"
FT                   /db_xref="GOA:A4FX07"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX07"
FT                   /protein_id="ABO34736.1"
FT                   /translation="MKILGISGSPRKEGTHFAVNYALDYLKDKGFETRYISVFQKKIEF
FT                   CIHCDYCLRTKKGCVHKDGMQEIYDGLKWADAVILGSPCYNGTVSGQLKTIMDRCRAIF
FT                   AEDIDVLRNKHGIGLSVGGDRNGGQEVVLKTIHDFYILNGVIPISGGSFGSNLGATFWS
FT                   QDQGRKGVEEDSEGIRTLKRTLKKFQNCLIEKGE"
FT   gene            complement(385706..387877)
FT                   /locus_tag="MmarC5_0422"
FT   CDS_pept        complement(385706..387877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0422"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: mmp:MMP1165 haloacid
FT                   dehalogenase/epoxide hydrolase:ATPase, E1-E2 type:heavy
FT                   metal transport/detoxification protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34737"
FT                   /db_xref="GOA:A4FX08"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX08"
FT                   /protein_id="ABO34737.1"
FT                   /translation="MEVKLKISGMTCAVCVKTIEKSVSKMDGVESITVNLLDESAVINF
FT                   DEKIVSIEDIGIKIESLGYEVLGIAEEVEELPDKDVELKEKLKKIIVGAIFSIALFSMM
FT                   YLEIPYKPYLAFLVSLPPLIYIALPIFKVGFNSLKVKSLNMDVMYSLGMGVAYVSALLV
FT                   TFGLLPMNFMFYDTTIMLATLLTLGRYLEERAKGRTSEAIKKLMGLQVKTAKVIRNDEE
FT                   LEIPIEDVIVGDIIFIRPGEKIAVDGTVFDGDSYVDESMITGEPIPNPKKKGDSVIGGT
FT                   INKNGILKITAEKIGKDTVLSQIIQLVKNAQISKSGIQNLADKAVSYFIPLVFTIAIVS
FT                   SLYWFFNGGILLAVTTFISVMVIACPCALGLATPTAITVGVGRGAELGILIKDSKVFDV
FT                   AGNLKCMIFDKTGTITKGEPEVDEIITDYTKEELLVIAGSFEKNSEHPLAIAIVKKADE
FT                   LNISLQEPEKFESITGMGVIGVLKDQRVFIGNRRLMEENNLSINEDYNKKISRLEENAK
FT                   TVIIVALENKIIGIIAISDKIKENAKITIQNLREMGIESYMITGDNEKTAKVIGKEVGI
FT                   LEDHVFSNVLPEKKAEIVKSIQETAGGYVEFIGDGINDAPALSTADVGIAVGSGTDIAI
FT                   ETGEVVLMNDDLKYVTGFVKLSKRVLKQIKLNLFWAFAYNSILIPVAAGALYSYNIRFE
FT                   PELAAFAMTLSSITIIGLSLLLKRYDPWK"
FT   gene            complement(387896..388111)
FT                   /locus_tag="MmarC5_0423"
FT   CDS_pept        complement(387896..388111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0423"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: mmp:MMP1164 heavy-metal transport ATPase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34738"
FT                   /db_xref="GOA:A4FX09"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX09"
FT                   /protein_id="ABO34738.1"
FT                   /translation="MKELKLKISGMSCQMCVKTIKNLLSELEGIITVDIDLENGKGIIT
FT                   YDENILNEEKILKNEAFELYPAEKLI"
FT   gene            complement(388237..388551)
FT                   /locus_tag="MmarC5_0424"
FT   CDS_pept        complement(388237..388551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0424"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   mmp:MMP1163 CutA1 divalent ion tolerance protein related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34739"
FT                   /db_xref="GOA:A4FX10"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX10"
FT                   /protein_id="ABO34739.1"
FT                   /translation="MGKPTLVYTTFPSLENAKSIVGYLLEKKMIACANLREHEAHYFEY
FT                   GDIVIKTEVGAFLKTAENKWDVLKDMINEIHPFETPVILKITIDDSNEEFKTWICDTTK
FT                   "
FT   gene            complement(388570..389733)
FT                   /locus_tag="MmarC5_0425"
FT   CDS_pept        complement(388570..389733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0425"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: mmp:MMP1162
FT                   flavodoxin:beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34740"
FT                   /db_xref="GOA:A4FX11"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX11"
FT                   /protein_id="ABO34740.1"
FT                   /translation="MAVVLKEDVYWVGAIDWNIREFHGYETKDGSSYNSYLIVDENIVL
FT                   IDTVKKYMFDEFYSRIKKIVDPEKIDYIVVNHVEMDHSSSLEKIMEISKATIITNAKAK
FT                   EHLELHYTTKDWEYIIVDSGDSTNIGNRNLTFVKTPMLHWPDNMVTYCPEDKILFSNDA
FT                   FGQHIASSERFDFEIDYAIDSAKEYFANILLPYRTLIPNAVKTVDTLETDLICPSHGII
FT                   WKDDISKIKEKYLEFASNDVSEKAIIVYDTMYKSTEKIGLSIAEGLMEGNVEVKVYKIS
FT                   ETPISKIIAEILDAKYVLVGSPTLNINLYPEVARFLKYMEGLKPNKKIAVAFGSYGWAE
FT                   SATKHIKNTFNILSFDPVEDECLTCRFVPDEEHLKKCYEFGKKLAKM"
FT   gene            complement(389762..390112)
FT                   /locus_tag="MmarC5_0426"
FT   CDS_pept        complement(389762..390112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34741"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX12"
FT                   /protein_id="ABO34741.1"
FT                   /translation="MKACFLIFTYDKGGKPYVPIIFHALLFAKEMKEKGDEVKIVFEGE
FT                   AVKWFNELLKADHPLKDHVEALKDDFVACEACSHMFDVFTSIKGKIALENELHGHVSLK
FT                   KYLDNSYTVVEF"
FT   gene            complement(390144..390332)
FT                   /locus_tag="MmarC5_0427"
FT   CDS_pept        complement(390144..390332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34742"
FT                   /db_xref="GOA:A4FX13"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX13"
FT                   /protein_id="ABO34742.1"
FT                   /translation="MVWWKCSNCGYMFEGDAGKVPEKCPNCGEICTFYDVSCYTPECGF
FT                   EGYDPKIAGKRNEESRL"
FT   gene            complement(390342..390869)
FT                   /locus_tag="MmarC5_0428"
FT   CDS_pept        complement(390342..390869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0428"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG:
FT                   mmp:MMP1159 ferritin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34743"
FT                   /db_xref="GOA:A4FX14"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX14"
FT                   /protein_id="ABO34743.1"
FT                   /translation="MDSKLRYEIEEQINKEFYSAYLYLAMSNYAETEGFKGISNWFIVQ
FT                   AQEEMGHAMKFYKYLHDMGETLQLNAIDKPEPDWNSITDVFENGLNHEKYVTGRIHKLM
FT                   DIAHEVKDYAAISMLQWFVNEQIEEESSFRDILDRLKLTGGDINYVMILDGDLGQRVRT
FT                   PPQSEKTTTKTA"
FT   gene            complement(390896..391162)
FT                   /locus_tag="MmarC5_0429"
FT   CDS_pept        complement(390896..391162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0429"
FT                   /product="MTH865-like protein"
FT                   /note="PFAM: MTH865-like; KEGG: mmp:MMP1158 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34744"
FT                   /db_xref="InterPro:IPR024093"
FT                   /db_xref="InterPro:IPR036825"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX15"
FT                   /protein_id="ABO34744.1"
FT                   /translation="MITTNHPLSEALKDIENFKLGLADYFKDKNVFPIKNKVELGSALP
FT                   CGISMPCGELEAGELVKFLNDSDFPIKNAEDLAMKLSKSCSIQ"
FT   gene            complement(391185..391541)
FT                   /locus_tag="MmarC5_0430"
FT   CDS_pept        complement(391185..391541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0430"
FT                   /product="Desulfoferrodoxin, ferrous iron-binding region"
FT                   /note="PFAM: Desulfoferrodoxin, ferrous iron-binding
FT                   region; KEGG: mmp:MMP1157 desulfoferrodoxin, ferrous
FT                   iron-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34745"
FT                   /db_xref="GOA:A4FX16"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX16"
FT                   /protein_id="ABO34745.1"
FT                   /translation="MGCVSAQTLKEGTDFEKKHVPMIECKSSVKPDEIYEVKIHTAGVE
FT                   HPMEDGHFIQFIELNVEEYPLLRVQLTQHSKPDVVVKIKAPNEEHNGNTLKLIAYMFCN
FT                   LHGLWKYEKEVKIE"
FT   gene            complement(391556..391870)
FT                   /locus_tag="MmarC5_0431"
FT   CDS_pept        complement(391556..391870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0431"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mmp:MMP1156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34746"
FT                   /db_xref="GOA:A4FX17"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX17"
FT                   /protein_id="ABO34746.1"
FT                   /translation="MKEGVFFGEGMKIVKEDYPDIYEAVVGLNKAAFTGKVLDYKTQKL
FT                   IAIGIVASTGDETATEKQMRSGMTELNITKEEIIDALRVVLLTSGMPAFTKAMKMVSKL
FT                   "
FT   gene            complement(391916..392815)
FT                   /locus_tag="MmarC5_0432"
FT   CDS_pept        complement(391916..392815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0432"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region domain protein; KEGG: mmp:MMP1155
FT                   heterosulfide reductase, subunit B1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34747"
FT                   /db_xref="GOA:A4FX18"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017678"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX18"
FT                   /protein_id="ABO34747.1"
FT                   /translation="MSESDFEYMFFLGCIAPNRYPGIESATYKALDKLGITLHPFEQAS
FT                   CCPAPGVFGSFDLMTWLTIAARNIVMAEQADLDILTICNGCYGSLFEANHILQENEKAR
FT                   NKVNEVLSKHGLEFTGKSEVRHLTEVLYFDYGPEKIAERVEEPLDLNIAVHYGCHYLKP
FT                   TDVKHIESSEVPKSLDGLVEAIGAKSIYYKDKNMCCGAGGGVRARNPEVALEMAETKVK
FT                   NILSVGGDCVTEVCPFCHLQFDRGQIEMKETFGREYQLPVIHYAQLLGMAMGMTPKEVA
FT                   LDLHFISADPVTEKLGLK"
FT   gene            complement(392828..393406)
FT                   /locus_tag="MmarC5_0433"
FT   CDS_pept        complement(392828..393406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0433"
FT                   /product="CoB--CoM heterodisulfide reductase subunit C"
FT                   /EC_number="1.8.98.1"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1154 heterosulfide reductase, subunit
FT                   C1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34748"
FT                   /db_xref="GOA:A4FX19"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR017680"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX19"
FT                   /protein_id="ABO34748.1"
FT                   /translation="MVLKSSEFNPDFPKQIIEAGEWIFGKNASSFQKCYQCGTCTGACP
FT                   SGRITPLRTRKLIRSALAGIDSILSSDDLWMCTTCYECYEKCPREVKITDIIKIVRNVA
FT                   AEKGYIAEPHRKTSLLVFKTGHAVPVNDEIKKARLAIGLTEIPPTTHKYPEALEMVRDI
FT                   MDELNFCKKVGICRETMDLEPLNVQKTGE"
FT   gene            393639..394766
FT                   /locus_tag="MmarC5_0434"
FT   CDS_pept        393639..394766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0434"
FT                   /product="membrane-bound hydrogenase subunit ehbN"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 49kDa;
FT                   KEGG: mmp:MMP1153 energy conserving hydrogenase B large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34749"
FT                   /db_xref="GOA:A4FX20"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX20"
FT                   /protein_id="ABO34749.1"
FT                   /translation="MYEGEIAIGPVHSTMLEPHRLRLFIEDEIVKDAELTIGVNHRGVE
FT                   RLMEGLPVEKACILCEKICGICSHIHLWSAARVAEIGCNIEVPERANHIRIIVEELERL
FT                   HSHTLLFGHAFEILGHETMSMRCFMLREPIMQVFFEISGSRVHYSCPIIGGIRPRCNIS
FT                   ETQISHIHDKISQYEEGLTKFIERMLNDPMIISRVKDVGVMDRKTAAKFHAVGPTARGS
FT                   NVKSDMRKWGWVPEYDPYDFDEILFDSGDVFARLAVRFYECLESVKIIRQALDALKDTS
FT                   DKRIYNPNYELNEFKPINCYTEAQRGEQYYSYGLDDEGLVRQAKIRTPTATNLGAMEDI
FT                   VKGYHVSDAELIIASCDPCFTCTDRLMVLKEPFKK"
FT   gene            394815..395177
FT                   /locus_tag="MmarC5_0435"
FT   CDS_pept        394815..395177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0435"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmp:MMP1152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34750"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX21"
FT                   /protein_id="ABO34750.1"
FT                   /translation="MIVKDVMNENFLRVSPNDIVGEVVQSLYKNKKSYAPVIEDEEIVG
FT                   WVTALDLLTGCKHVKTEEAMLFLDEIKTINPNDELSDELISEMITNEVFAYPVVENDKI
FT                   VGTLSSFDILKKLTSK"
FT   gene            complement(395242..396516)
FT                   /locus_tag="MmarC5_0436"
FT   CDS_pept        complement(395242..396516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0436"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: mmp:MMP1149 3-isopropylmalate dehydratase;
FT                   TIGRFAM: homoaconitate hydratase family protein;
FT                   3-isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34751"
FT                   /db_xref="GOA:A4FX22"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX22"
FT                   /protein_id="ABO34751.1"
FT                   /translation="MAMTLAEKILAKASGNTQVSPGDIVMAKVETAMVHDITGPLSVNT
FT                   LKKEGISKVWDNEKIVIPFDHQIPADSINAAENHILMRNFVKEQNIKHFYDIREGVCHQ
FT                   VLPEKGHIVPGTVVVGADSHTCTYGAFGAFATGIGSTDMAAAFATGELWFKVPETLYFN
FT                   ITGELKPEVMSKDVILSIIGMVGADGATYKAAQFAGNTVDNMTIASRMTMSNMAIEMGG
FT                   KAGLIAPDDKTINYVKNAMEMNNTAKPFEFILGDKDAEFEKKFEIDVSNLEPVMACPHN
FT                   VDNVKAVREVAGTPIDQVFIGSCTNGRLEDLRAALEVIEKHGGISKDIRVVVTPASRSI
FT                   MLEAIDEGLIKKFYQYGCVVTNPSCSACMGALYGLLGPGEVGIATSNRNFRGREGSLES
FT                   DVYLASPITAAACAVKGEIVDPRDL"
FT   gene            396648..396866
FT                   /locus_tag="MmarC5_0437"
FT   CDS_pept        396648..396866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0437"
FT                   /product="Small nuclear ribonucleoprotein, LSM family"
FT                   /note="PFAM: Like-Sm ribonucleoprotein, core; SMART:
FT                   Like-Sm ribonucleoprotein, eukaryotic and archaea-type,
FT                   core; KEGG: mmp:MMP1148 small nuclear ribonucleoprotein (Sm
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34752"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR022901"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX23"
FT                   /protein_id="ABO34752.1"
FT                   /translation="MMDTQRPLDALGKSINTNVTVFLKDGKVVKGRLKAYDLHMNVALE
FT                   NAKIENDEEKEFPMLVVRGDNVLYVSL"
FT   gene            396944..397138
FT                   /locus_tag="MmarC5_0438"
FT   CDS_pept        396944..397138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0438"
FT                   /product="LSU ribosomal protein L37E"
FT                   /note="PFAM: Ribosomal protein L37e; KEGG: mmp:MMP1147
FT                   ribosomal protein L37e"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34753"
FT                   /db_xref="GOA:A4FX24"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FX24"
FT                   /protein_id="ABO34753.1"
FT                   /translation="MTKGTPSQGKHNKGSNHIVCRRCGRRSFHVRKKVCAACGFGKSSK
FT                   IKRFAWQWKKVTGKGNRVK"
FT   gene            397273..398652
FT                   /locus_tag="MmarC5_0439"
FT   CDS_pept        397273..398652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0439"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="KEGG: mmp:MMP1146 amidophosphoribosyltransferase;
FT                   TIGRFAM: amidophosphoribosyltransferase; PFAM: glutamine
FT                   amidotransferase, class-II; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34754"
FT                   /db_xref="GOA:A4FX25"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX25"
FT                   /protein_id="ABO34754.1"
FT                   /translation="MCGIFGIYSHEKSNIVKKVYYGLYALQHRGQEGAGIAVGNGKEIG
FT                   HYKGLGLVPEVFSNKELQNLYGHIGVGHVRYSTTGRNTIENCQPFVVNSTFGKIAITHN
FT                   GDIVNSKELKNELEKKGHIFVSTTDSEVIAQLLVRELLKNDDIISAVTNVTKKLNGAYS
FT                   LLIIYDDTLIAIRDPNGFKPLCIGKDDGAYYFSSESCALDIVDVEFERDVAPGEMVVVN
FT                   KDGLKTYKLPNAKEKASTCMFEYVYFARPDSVIDGVSVYEVRRNIGKILAREAPEEVDI
FT                   VSPVPDSGIIFSQGYTEEAESPYYEALIKNRYIGRTFILPTQEERDLAVRLKLNPVKHL
FT                   LKDKKVLLIDDSIVRGTTSGKIMKMVKKAGAKVVHLRIGSPRIVSPCFYGIDMATTKEL
FT                   IANSKTNEEIAEMIGANSVAYLSVEGLVEAIGRDDLCLACLNGEYPTDVSCKFERGSCK
FT                   K"
FT   gene            complement(398704..399492)
FT                   /locus_tag="MmarC5_0440"
FT   CDS_pept        complement(398704..399492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0440"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: cell division ATPase MinD; PFAM: Cobyrinic
FT                   acid a,c-diamide synthase; KEGG: mmp:MMP1145 septum
FT                   formation inhibitor-activating ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34755"
FT                   /db_xref="GOA:A4FX26"
FT                   /db_xref="InterPro:IPR010224"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX26"
FT                   /protein_id="ABO34755.1"
FT                   /translation="MIITVASGKGGVGKTTTSANLAVALSKLGKKTIVIDGDISMANLG
FT                   LIFDFEKNRPSIHEVLAEECSVRDAIYEHKTGAFVLPASLSIAGYKKSDLDLFPDVINE
FT                   IADEYDYVIIDAPAGLNKDMAIHLAIADKILLVVTPELFSIADAMKIKESSEMAGTNVM
FT                   GIVLNRTGKDFGEMGPDEIEMILEERIVGLIPEDGNIRNATLKKMDVIQYSPRSPASKA
FT                   YTELALKVTGSYVDMDKIEEMYNESFFEKLKRNIFSKFKK"
FT   gene            399644..400393
FT                   /locus_tag="MmarC5_0441"
FT   CDS_pept        399644..400393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0441"
FT                   /product="Bacitracin resistance protein BacA"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   mmp:MMP1144 undecaprenyl-diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34756"
FT                   /db_xref="GOA:A4FX27"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FX27"
FT                   /protein_id="ABO34756.1"
FT                   /translation="MEELILGIVQGLTEFLPISSSGHLAIFTAIFNSTPDVGYFAFLHL
FT                   ATFLAVLIFVKSEVFEIVNGISKKDNEYINLASKLVLSTIPAVIVGLCFGDFIESVFSS
FT                   TFLIGVFLSITGILMLLSDKLNQNLKTIKSIPYLDAMIVGIFQAFSVLPGISRSGTTLF
FT                   AALFLGMKKEDAVKYSFLMGLPVTFGAGILELQKVSFSAEQLFGFVISFLTGLLGLYLV
FT                   KKMVIGGKLKIFGYYCFLASFFVLMFL"
FT   gene            400407..400787
FT                   /locus_tag="MmarC5_0442"
FT   CDS_pept        400407..400787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0442"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: mmp:MMP1143 TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34757"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX28"
FT                   /protein_id="ABO34757.1"
FT                   /translation="MRDILKIRLIILSIMISIIFAGCADQNPEEYYSEGIMQYNAGNYT
FT                   ESIDLFEKAIQLNPEESKYWLMKGEALYNLERYEESVDCYNYVINVIEDEYNKEIWAAK
FT                   AEALRHIDGKEVESEIAEARAK"
FT   sig_peptide     400407..400481
FT                   /locus_tag="MmarC5_0442"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.888 at
FT                   residue 25"
FT   gene            complement(400809..401519)
FT                   /locus_tag="MmarC5_0443"
FT   CDS_pept        complement(400809..401519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0443"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mmp:MMP1142
FT                   metallo-phosphoesterase:serine/threonine-specific protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34758"
FT                   /db_xref="InterPro:IPR004376"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX29"
FT                   /protein_id="ABO34758.1"
FT                   /translation="MEINGHELQFKDNAVFLEETKTLILADVHVGMEEFIRRTGVLFPL
FT                   NEKKELLERLKNLIVEFKPEKLVFLGDFLHHFQKVPYKVYETVRELNSLLKNYEVIIIR
FT                   GNHDIMLEYILKENTNFKILDYLLEDKILMVHGDKTFDVDFNFDLLIMGHEHPVLEINK
FT                   QRFPSYLEIVQNNFEILVTPAFSNIASGVKINELEKNFMSPYLKKVKKEDIFPIVIGEE
FT                   VLKFPDLSKIEKFL"
FT   gene            complement(401522..404146)
FT                   /locus_tag="MmarC5_0444"
FT   CDS_pept        complement(401522..404146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0444"
FT                   /product="ATP dependent helicase, Lhr family"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: mmp:MMP1141 Lhr-like
FT                   RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34759"
FT                   /db_xref="GOA:A4FX30"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX30"
FT                   /protein_id="ABO34759.1"
FT                   /translation="MKNDGEILDLFEPAVKKWWVNKFEPYKSINNGYFTPPQRLAIPKI
FT                   HFGRNTLICSPTGSGKTLSSFIAIINELFRIEKEEGLKNSIYCLYISPLKSLANDIHVN
FT                   LDEPLTEIKEILKEDGNEITGIKHAIRHGDTSNYEKSKMLKNTPHILNTTPETLAIILN
FT                   SPKFKEKLKTVQWVIIDEIHALADNKRGVHLSLSLERLRELTNQEFLRIGCSATVEPLE
FT                   MVADYLGGYYDDGYNRPVEIVDTRFVRGYDLKLLCPVDDLINKTPKEISEKLYEKLDRL
FT                   IQTHENTLIFTNTRGGAERVLYNLRKRYPEKYDETNSGCHHGSLSKEKRLELEEKLKTG
FT                   NLKFATTSSSLELGIDMPYIDLVVQVGSPKSVKTMLQRIGRAGHGIGKVAKGRIIALDR
FT                   DELLECAVMLKKALDGFIDKVHIPKGPLDVLIQHIYGIAINGYIELERVKNIVRRSYNY
FT                   HDITDEDFKILLNYMTASYAGMDEKRIYSKIWYDPDTQMIGKTGRTARAIYYMNIGTIP
FT                   DDFSCDVYLRGTTVWIGKLDEQYLDRLEKGDVFTLGGEHLKFQYRRGSKVYVDKTSERP
FT                   NIPSWYSERLPLSYDLGRNILLFKKEAVSKYNAGRLLELLNEYPLDSNATKSLYGLFNQ
FT                   QILYKGNDSVSTLNKMVVEGHIFDKKMHYYFHSNYGRKFNDGFSRAVAYALSKQYKLGV
FT                   LVSISDTGFSLEFAKNQKVDIESVIRSLTPENIKDILKQALDGTNLLKRMFRINATRSL
FT                   MILRNYIGNKKSAKKQQVSADLLINYAKSLDRFAPLEETLREIIEDSLELDNIREVLGE
FT                   IRSGKLKIKVIDVPIPTPMSFGIATLTASDSVLAENKNQLLKDFHQMVIKMIEYEKGIS
FT                   LEE"
FT   gene            complement(404354..404599)
FT                   /locus_tag="MmarC5_0445"
FT   CDS_pept        complement(404354..404599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0445"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1140 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34760"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX31"
FT                   /protein_id="ABO34760.1"
FT                   /translation="MTVEIIVDKEKCTGCGKCYDKCPKGPRIYKQDADGKYYAFDVSDC
FT                   HNCKICVAACPVGAIQVNLKKRIIEKQVQKLKEKFH"
FT   gene            complement(404774..405397)
FT                   /locus_tag="MmarC5_0446"
FT   CDS_pept        complement(404774..405397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0446"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: mmp:MMP1139 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34761"
FT                   /db_xref="GOA:A4FX32"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FX32"
FT                   /protein_id="ABO34761.1"
FT                   /translation="MKFKDKLKFYVITDSNYSDEVSSVEKALKGGASSIQLRMKTSSTR
FT                   KMIEVGNKLRTLTSEYDALFFVNDRLDVAQAVNADGIHVGIDDMPVSKIKEIAPNLIIG
FT                   ASAYNIDEMKTAEYEGADYLGVGAVYSTNTKLDARNLGLDGLKDISKIANLPIVAIGGI
FT                   NHSNVENVLECGVSGVAVVSAIVGAENILKSAENMHELIKKYIK"
FT   gene            complement(405387..406187)
FT                   /locus_tag="MmarC5_0447"
FT   CDS_pept        complement(405387..406187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0447"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="PFAM: hydroxyethylthiazole kinase; KEGG: mmp:MMP1138
FT                   hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34762"
FT                   /db_xref="GOA:A4FX33"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FX33"
FT                   /protein_id="ABO34762.1"
FT                   /translation="MDFVAKNLTKLRETNPLVQNITNYVVMNSTANSLLALGASPVMAH
FT                   AMDELEEMVSIASALVVNIGTLDEYWIPSMEKAAKIASDLKKPIILDPVGAGATKLRTK
FT                   TALKILDFADISVLRGNFGEIAAVLGEHGKTRGVDSAAYDSNEAIELSKNAAKEFNTVS
FT                   AVTGPVDYVSNGKEIYAISNGHPMLSKVTGTGCASTSIIGAFSAVDEPLKAAVSGLTVY
FT                   GISAEMAFSEAPYPGTFQAKVYDWLYRIDEKLVFEKAKVNKFEI"
FT   sig_peptide     complement(406047..406187)
FT                   /locus_tag="MmarC5_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.921) with cleavage site probability 0.506 at
FT                   residue 47"
FT   gene            406395..406817
FT                   /locus_tag="MmarC5_0448"
FT   CDS_pept        406395..406817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0448"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family;
FT                   Helix-turn-helix, type 11 domain protein; KEGG: mmp:MMP1137
FT                   Lrp-like transcriptional regulatory proteins, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34763"
FT                   /db_xref="GOA:A4FX34"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX34"
FT                   /protein_id="ABO34763.1"
FT                   /translation="MDEKDMKILDFLITDGRKPFTEIAKELKTSESSVRKRVKKMEEEG
FT                   VIKGYSVMVDTPKMGYNVVAQTGFDTNPEDFLSVAQELCTFEEVKKVFTSTGDHMIMTE
FT                   IWAKDGKELSEIIFNKLGKIKGIKKVCPAIILEQLK"
FT   gene            complement(406826..407245)
FT                   /locus_tag="MmarC5_0449"
FT   CDS_pept        complement(406826..407245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0449"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: mmp:MMP1136 rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34764"
FT                   /db_xref="GOA:A4FX35"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX35"
FT                   /protein_id="ABO34764.1"
FT                   /translation="MELVNEHKIGISKGTALEKEVGGNVKGECMEVGMYLAMARQAQRE
FT                   GLPEIAEVLKTIAFEEAEHASKFVEMNGVIKATLKENLEMMYEGETMANNEKKAAADLA
FT                   EKEGLEHIHDFFEESSRDEARHAKMLKGILDRYFK"
FT   gene            complement(407618..408841)
FT                   /locus_tag="MmarC5_0450"
FT   CDS_pept        complement(407618..408841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0450"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: mmp:MMP1134 type A
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34765"
FT                   /db_xref="GOA:A4FX36"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX36"
FT                   /protein_id="ABO34765.1"
FT                   /translation="MKADAVKISDGVYWVGTYDWDIRSYHGYTLKGTTYNAYLVFGDEK
FT                   AALIDNVYPGTSAQMWGRIKDAFEKEGKEFNIDVVVQNHVEKDHSGALVEVTKKFPNAP
FT                   IYCTEVAVEGLKKHYARLKDAPFKVVKSLESIDLGGKTLTFLEAPLLHWPDSMFTLYAE
FT                   EGILFSNDAFGQHLCLTKRFDYEIPENILMDANQKFYANLITPLSKLVLKKFEQVISLG
FT                   LLEKIKMIAPSHGQIWTDPVKVISAYQNFATGQCKNKATIVYDTMHYSTQKMAHAFAEG
FT                   LMSEGIEVVIYNLHADERSEIVKDILDSKAVLFGIPTINDQPFPSIGDLMYYLRGLRFD
FT                   RTGFKKLALTFGSMGGRGGAIEKIANELSSSGFDVVNEYELYYIPNEEELEKCYSLGNE
FT                   LGKNINAI"
FT   gene            complement(408964..410007)
FT                   /locus_tag="MmarC5_0451"
FT   CDS_pept        complement(408964..410007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0451"
FT                   /product="L-sulfolactate dehydrogenase"
FT                   /EC_number="1.1.1.272"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   mmp:MMP1133 L-sulfolactate
FT                   dehydrogenase/(S)-hydroxyglutaric acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34766"
FT                   /db_xref="GOA:A4FX37"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX37"
FT                   /protein_id="ABO34766.1"
FT                   /translation="MVHIITPEGEKKLLSDILMAYGVQEEHAKITAEIYTEADLKGFTS
FT                   HGIGRFPQTIIGLETQNIKIDPNIKIEKESPATATINGDLALGYVTAAMAMDLAVEKAK
FT                   NVGIGAVATYNSNHFGITGHYSERASKNGMIGIAITNTEPAMAPYGGKDKILGTNPIAI
FT                   AVEGKKHKYSLDMATASVARGKIFEAKRLGKILPENAAVDINGNITTDPDQALAGSILP
FT                   FGGIKGYGIAMAVEILSAIGGAELGTKVKGTARADEKCTKGDFFIAINPEFFGEKSEFL
FT                   DKTDYLVDEIKNSNLSEGASEILIPGDVEARNCEGKKNGFEIDEILYKKLKNICDKKGI
FT                   IIENYLK"
FT   gene            complement(410026..410556)
FT                   /locus_tag="MmarC5_0452"
FT   CDS_pept        complement(410026..410556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0452"
FT                   /product="tRNA splicing endonuclease"
FT                   /note="KEGG: mmp:MMP1132 tRNA splicing endonuclease;
FT                   TIGRFAM: tRNA intron endonuclease; PFAM: tRNA intron
FT                   endonuclease, catalytic-like; tRNA intron endonuclease
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34767"
FT                   /db_xref="GOA:A4FX38"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR006678"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016442"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="InterPro:IPR036740"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX38"
FT                   /protein_id="ABO34767.1"
FT                   /translation="MAKPKKTIPAKLSDERIVIYDKDGISRLNEKRYGELHENFLSLSF
FT                   VEGLYLVSKNWISLKDKKNKLLSFEEVYDVAQNIDRKLCIRYLAYKDLRNRGYTVRTGL
FT                   KYGSDFRLYERSNIDEIHSRYLVKVFSEEIPCEISEITGFVRVAHSVRKELIIAIVDAD
FT                   GSVVYYNMGYLKL"
FT   gene            410746..412005
FT                   /locus_tag="MmarC5_0453"
FT   CDS_pept        410746..412005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0453"
FT                   /product="peptide chain release factor subunit 1 (aeRF-1)"
FT                   /note="TIGRFAM: peptide chain release factor eRF/aRF,
FT                   subunit 1; PFAM: eRF1 domain 1; eRF1 domain 2 protein; eRF1
FT                   domain 3 protein; KEGG: mmp:MMP1131 peptide chain release
FT                   factor aRF, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34768"
FT                   /db_xref="GOA:A4FX39"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FX39"
FT                   /protein_id="ABO34768.1"
FT                   /translation="MSGNSSTDMYLFKKSLKELKGKKGKGTELISVYVPAGRRLSDISQ
FT                   YLRQELSQSSNIKSKTTMKNVQSAIEVILQRLKLLKEPLEMGVIIFAGMIPRGGPGTEK
FT                   MEVYVLEPPEPVKTFVYRCDSLFYTDPLEDFIQDTEVYGVILVDRNEATIGTVKGKTIT
FT                   VLKKLTSGVPGKFKAGGQSARRLERLIDDAAHQFMVRIGEYATESFMPILEEKKLKGLL
FT                   LGGPGNTKNEFAEKDYLHHELKKKIIDTFDLCYTEEFGIRELLDKASDLLRDLDLMKEK
FT                   NLIQKFFKELIKDDGGLSAYGEAQVMKYLEMGAIDTLIVTEDIGITRVTVKCNNCDYAQ
FT                   EVNVKTNEMFKFEEQLKTKACPTCGGAMYIDEEKDIIEHLSDLCHMHNTDIIVVSTDTE
FT                   EGSQISRAFKGMAAILRYKL"
FT   gene            412068..412466
FT                   /locus_tag="MmarC5_0454"
FT   CDS_pept        412068..412466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0454"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   mmp:MMP1130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34769"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX40"
FT                   /protein_id="ABO34769.1"
FT                   /translation="MFFEYSIKTDKRESLVDISNNILNAVTKSNIKNGIAIVFTPHTTS
FT                   AITINENADPAVKKDIVKFLHEKIPENYGFSHYEGNSDAHLKSSFFGPSLTLIINDGEV
FT                   ILGTWQGVYFCEFDGPRSRKFYVKIMKD"
FT   gene            412575..413066
FT                   /locus_tag="MmarC5_0455"
FT   CDS_pept        412575..413066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0455"
FT                   /product="peptidyl-prolyl cis-trans isomerase, cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: mmp:MMP1129 peptidyl-prolyl
FT                   cis-trans isomerase, cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34770"
FT                   /db_xref="GOA:A4FX41"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX41"
FT                   /protein_id="ABO34770.1"
FT                   /translation="MIATIQTTLGTIKIELFKEKAPITVENFKKYAETGFYEGTIFHRV
FT                   IQSFMVQGGGFTKDGVQKETMPEIKNEAKNGLSNKRGTIAMARTNVVDSATSQFFINTV
FT                   ENMFLNYKNDANYGYAVFGEMTEGFEVLDKIAAVKTGNKGYFADWPVEDVIIEKVTIEE
FT                   "
FT   gene            413131..413706
FT                   /locus_tag="MmarC5_0456"
FT   CDS_pept        413131..413706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0456"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: mmp:MMP1128 peptidyl-prolyl
FT                   cis-trans isomerase, cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34771"
FT                   /db_xref="GOA:A4FX42"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX42"
FT                   /protein_id="ABO34771.1"
FT                   /translation="MSVASIVLLTSFAGCTKDSSNTDETGEIVHATIQTNYGNMNFELD
FT                   LDKAPITVENFKTYVESGFYEGTIFHRVISDFMIQGGGFTVNGTKKETLDPIKNEADNG
FT                   LSNKRGTIAMARTSVVDSATSQFFINTVDNSFLDYQNNQNYGYAVFGEMTEGFDVLEKI
FT                   ENVATANNGQYQNWPVEDVIIEKVIIEE"
FT   gene            complement(413749..415890)
FT                   /locus_tag="MmarC5_0457"
FT   CDS_pept        complement(413749..415890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0457"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase, RNase H domain protein fold; KEGG: mmp:MMP1127
FT                   RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34772"
FT                   /db_xref="GOA:A4FX43"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX43"
FT                   /protein_id="ABO34772.1"
FT                   /translation="MDIFQKLQKEFNLKTFQVENTVNLIDEGNTIPFIARYRKEATGSL
FT                   DDVVLRKFFDRLIYLRNLEDKKAQIIKLIDEQGKLTEELKQKIEKSELLTELEDIYRPF
FT                   RPKRKTRATIAEIKGLKPLSELILKQILEKPIKELAKEFINPELEVNSIEDAISGAKDI
FT                   IAEEISDNADYRKFIRETTFSKGIIAVKAKNVDEKSVYEMYYEYSEAVNKIPGHRILAI
FT                   NRGESEKLLQVKIDAPVEFIQDWIFKNILLENSDTSEILKDTVIDSYKRLIAPSIEREI
FT                   RNNITEKAENGAIEVFSKNLKQLLLQPPIKNKTVLGWDPAFRTGCKIAVVDETGKVLDK
FT                   TVVYPTEPHNKVAETKKQVKELIIKHDIDVVAIGNGTASRESEHIVSEILKEVVKDVYY
FT                   VIVNEAGASVYSASELGSEEFPEYDVGIRSAISIARRLQDPLAELVKIDPKSIGVGQYQ
FT                   HDMNQKKLSESLSAVVESSVNSVGVDLNTASVSLLNYVSGINIGIAKNIVIYRSENGKF
FT                   ESRKELLKVSKLGKKAFEQCAGFLRIPEGKNLFDNTGVHPESYKIAENLLNELNISIKD
FT                   IKEKKIDKISEKIDIEKLAEKLDCGIPTLEDIIKELEKPGRDPREDLPKPVLRSDVLEL
FT                   EDLKEGMILKGTVRNIVDFGAFIDIGVHHDGLAHISEIADRFIKHPLDVISVGDIVDVM
FT                   VMDIDFDKKRVSLSIKRAK"
FT   gene            complement(415941..416774)
FT                   /locus_tag="MmarC5_0458"
FT   CDS_pept        complement(415941..416774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0458"
FT                   /product="ribosomal RNA methyltransferase NOP2"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: putative RNA methylase, NOL1/NOP2/sun
FT                   family; PFAM: Fmu (Sun) domain protein; KEGG: mmp:MMP1126
FT                   putative proliferating-cell nucleolar antigen"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34773"
FT                   /db_xref="GOA:A4FX44"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX44"
FT                   /protein_id="ABO34773.1"
FT                   /translation="MNIIILYTTVVFLENLQFIRINTLKISSEDLKKRLEEKGVELEDT
FT                   FLDYVFRVVKSPFSMGSTPEYLLGYYFLQSISSIIPSITLNPTKDDDLLDMCAAPGGKT
FT                   THLAQLMENEGSILAVEINKNRLKSLRSNINRMGFKNTLMINTNAVNIDKKLKFDKILL
FT                   DAPCTGNEIKDCNRVKTKRDILFCAKRQVELFRTAIEVLKDGGELVYSTCSPEIEEDED
FT                   IVRYILKNNKNMELIELSVDDFPGINMIEGEVKGTLKVIPPNEPFFIAKFRKVKN"
FT   gene            complement(416783..417274)
FT                   /locus_tag="MmarC5_0459"
FT   CDS_pept        complement(416783..417274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34774"
FT                   /db_xref="GOA:A4FX45"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="InterPro:IPR026485"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX45"
FT                   /protein_id="ABO34774.1"
FT                   /translation="MVNGKIMNKKAKDLILKISKFFIYSILIYISLCHFETYLTSIIAY
FT                   QSYLFLKFLLKDVILFTHIIYLPNIAISIIEPCTGILLISILLAYISTVENKLKHQVFG
FT                   SVFCTLLIYFGNIIRIVIIGVLANTFENGEYIHNVISFVFGPSITVFTILLWSKLRKRL
FT                   "
FT   gene            complement(417268..418215)
FT                   /locus_tag="MmarC5_0460"
FT   CDS_pept        complement(417268..418215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0460"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; KEGG:
FT                   mmp:MMP1124 AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34775"
FT                   /db_xref="GOA:A4FX46"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX46"
FT                   /protein_id="ABO34775.1"
FT                   /translation="MNELDIIKIILKNLSYSNGVEKGIGDDCAVFKSENQHLVVTTDMM
FT                   FKSTHFPSILTPFQIGMRVVTANVSDIAAMCAKPLGMVISMGFDSPDKNFIDEMSKGIN
FT                   FISKEYECPIAGGDTNKAPELTLSGTAFGITDNPIYRGGIIGEDICITGDVGKVACALK
FT                   LLEMKDKGILGNIEFEKTMSEFPEILKKLAEPKARVKDGLLLNNTITSCCDISDGLSKD
FT                   LNYTGNFEINSKKLLNSVSKDVVEFCEKFNMDLLNTVLNSGEEFELLFTTTNFKMAEEK
FT                   LKDVNSVTKIGKVVESGKTVDGKSMELEGYVHKW"
FT   gene            418549..419865
FT                   /locus_tag="MmarC5_0461"
FT   CDS_pept        418549..419865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0461"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mmp:MMP1123 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34776"
FT                   /db_xref="GOA:A4FX47"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX47"
FT                   /protein_id="ABO34776.1"
FT                   /translation="MAIKNVSIVYPNKFGGGIACLAVHVLTNHLNKYHDISANAYLIEN
FT                   YSKIKNSDAILITLQYENDYFNVVKIVKELKTQNPNAIFIAGGPCAISNPLPLHEFFDV
FT                   FVVGEIEGTDTMYQLINGNFEIPGVYVPKTYNNEKIKRIYPKKLGIKDYPIAQVTHESG
FT                   AYGKAYLLEIGRGCIRNCKFCMAKCIYAPPRYRKIEDLKYLVDEGLKNTDADKVSLIAP
FT                   SVSDYRYVLDLCAHISEKNVSISPSSLRADTITDELLDYLNLKTLTIAPEAGSEVLRKK
FT                   IDKGITEENILNAVDIAKNHGISTVKLYYMVGFPEETEEDIEEIITLTKKIKENVRKVD
FT                   VSINPMVPKPHTPFEDFEFDMDSKMKIKYIEKSLRKIKVSVDFEKFNSMVAQTVLARGG
FT                   VELSKVLNESKNTMQLIKNVDLDNYINKIEEKPWDFIEI"
FT   gene            419893..421071
FT                   /locus_tag="MmarC5_0462"
FT   CDS_pept        419893..421071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0462"
FT                   /product="GTP-binding conserved hypothetical protein
FT                   TIGR00650"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; TGS domain
FT                   protein; GTPase of unknown function-like; KEGG: mmp:MMP1122
FT                   GTP1/OBG family:ATP/GTP-binding site motif A (P-loop):TGS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34777"
FT                   /db_xref="GOA:A4FX48"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX48"
FT                   /protein_id="ABO34777.1"
FT                   /translation="MAILGLVGKPNVGKSTTFNAMTEKIADIGNYPFTTINPNIGTSFV
FT                   TKPCPCDTLNLNCTPNNSKCFSGLRYIPVEVIDVAGLVPDAHKGKGMGNKFLDDLRQAD
FT                   AFILVVDASGKTDLEGNPSENNDPVNDVKFLLNELDMWIHSILTKNWERLSRKAQQEKN
FT                   ILKALSEQLSGLNISENQVFAVIRGFDESPMKWSEDDLMKISTNLRKASKPMIISANKA
FT                   DHPDAEKNIKKLKEEFKDFLVIPTSAEIELALKKAQKAGLIKYDGKSMEISDESSLNDA
FT                   QKNALNYMKSYLDKFGGTGIQDLINVAYFDLLDMIVVYPVEDEGKFCDKKGNVLPDAYL
FT                   VKKGATAKDLAFKIHTEIGQKFIYAVDAKKKLRISADQELNDGDIIKIVSAA"
FT   gene            421107..421670
FT                   /locus_tag="MmarC5_0463"
FT   CDS_pept        421107..421670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0463"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; KEGG:
FT                   mmp:MMP1121 metal-dependent phophohydrolase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34778"
FT                   /db_xref="GOA:A4FX49"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX49"
FT                   /protein_id="ABO34778.1"
FT                   /translation="MIPDGSKALDLLNCYVKEQPNLDHNLIVGYGMLGIAKYLEKDENE
FT                   QNYWFVTGILHDIDIEDYGDYLEKHCIIGEEILKNEGISESLIEDIKSHNEVLNVERNS
FT                   EIRHSLWAVDALSGIIRAYVLMRPDKDVKKAELKSIKKKLKDKSFAQNVSREQIKSCEE
FT                   NLKMTLDDFVNSVLKEVKENISFN"
FT   gene            complement(421720..423564)
FT                   /locus_tag="MmarC5_0464"
FT   CDS_pept        complement(421720..423564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0464"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: mmp:MMP1120 ATP-binding protein,
FT                   ATPase-like:histidine kinase, HAMP region:histidine kinase
FT                   A, N-terminal:bacterial sensor protein C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34779"
FT                   /db_xref="GOA:A4FX50"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX50"
FT                   /protein_id="ABO34779.1"
FT                   /translation="MKKSKIGMIGTKLLIFSIIIVLIPITMLSYVSSDTISELMISNQN
FT                   SELNTNIGILNERLDNVFVEFDTMTAYTAQLPIVIDAVKNKDEETLQNFANGLEDQSWV
FT                   DLATFTDADGNVICASYGNTDAKISTYVKKLIEKDTIYAYDVISNEEASKYSDYELDGY
FT                   DALAIFTVAPVYDGESLIGTVTYVDIMNKDDYWVDRVKEVTGDEASIYLNNVRISTTCQ
FT                   KNGVDLVGEIASETAYESVLKNQDYVGKVIVDGNSYFGKYSPIYDIDGEVIGMICVGTP
FT                   EMPFVILMNSVIRKIFFIAFSSLIVAVLVAFILNRKIVVPIKKLKNSAEIFGHGKYDER
FT                   VSLKTGDELEELAESFNKMADEISRADKKLKKDADELKNSYDELKEVDNLKSELLSIVS
FT                   HELRTPLTSIRGYVDLLKDETAGKLNDKQHEFILIISENSDRLKRLIDNMLDLVKVENE
FT                   VLDFKFNKLNIKNTVGEIISSLKYFADSKNIILLEDVDEVYIKGDKSKINQVLANLIEN
FT                   AIKFSKNQTKVTVIGFEDKENLHLEITDQGPGIPKENLEKIFEKFYQIDSSSKREIGGS
FT                   GLGLAVCKKIVESHGGSIWVESKVGKGTSVHILLPIAK"
FT   sig_peptide     complement(423463..423564)
FT                   /locus_tag="MmarC5_0464"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.634 at
FT                   residue 34"
FT   gene            complement(423682..424624)
FT                   /pseudo
FT                   /locus_tag="MmarC5_0465"
FT   gene            424766..425062
FT                   /locus_tag="MmarC5_0466"
FT   CDS_pept        424766..425062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34780"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX51"
FT                   /protein_id="ABO34780.1"
FT                   /translation="MECPICGGEKCIRKSAVEIYKDLIELFFKYQDKESDVTFKKHPTV
FT                   GEIGECEKTSKKIWYCPYCDKPFTENYELDKITVECPNCKKTLCIPVSNRTFC"
FT   gene            complement(425064..425555)
FT                   /locus_tag="MmarC5_0467"
FT   CDS_pept        complement(425064..425555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0467"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   mmp:MMP1117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34781"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX52"
FT                   /protein_id="ABO34781.1"
FT                   /translation="MKLDIKKDLKNIAWHCRMCGGCCDSPSVSKKDVANIAGFLKIPFD
FT                   EVVKKYLVNFDGMTGRLKTSKEKCIFLDENNKCKIYRVRPIICRLRPYSVQIKDKSLVL
FT                   TYDGWFLENCKGQFVGDLDPAEEYYKHAETVLKYLGEEKNTPEELFEKAKKRLKKSKKQ
FT                   "
FT   gene            complement(425637..426689)
FT                   /locus_tag="MmarC5_0468"
FT   CDS_pept        complement(425637..426689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0468"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: peptidase M18, aminopeptidase I; peptidase
FT                   M20; peptidase M42 family protein; KEGG: mmp:MMP1116
FT                   endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34782"
FT                   /db_xref="GOA:A4FX53"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX53"
FT                   /protein_id="ABO34782.1"
FT                   /translation="MSTLDYLKILATEKGISGREDKVREYMEKELEKYCDSIETDKFGN
FT                   LIAKKGSTGPKIMIASHMDEIGLMVKFIDDKGFLKFTKIGGINDQMLLNQKVIVHSNEG
FT                   DIVGVLGSKPPHKMKESERNKLISAEHMFIDIGAKNKEDAEKMGVEIGTAISFKSEFDN
FT                   LGGNVVSCKSFDNRAGCAVVLKTMELLKDMDLKCQVYAVGTVQEEVGLKGAKTSAFGIN
FT                   PDIAFALDVTICGDHPGIKLEDAPVELGKGPVATIVDASGRGIITHPTVLRMVRDVAKA
FT                   DEIPVQYEVGEGGTTDATAIHLTRDGIPTGVISVPSRYIHTPVEVIDTEDLEKTTELVV
FT                   ACIKKVHEYF"
FT   gene            427020..427847
FT                   /locus_tag="MmarC5_0469"
FT   CDS_pept        427020..427847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0469"
FT                   /product="transketolase subunit A"
FT                   /EC_number="2.2.1.1"
FT                   /note="PFAM: Transketolase domain protein; KEGG:
FT                   mmp:MMP1115 transketolase, N terminal half"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34783"
FT                   /db_xref="GOA:A4FX54"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX54"
FT                   /protein_id="ABO34783.1"
FT                   /translation="MKNTKNLTFEELAAKSKSLRYNIVKMIGLAESGHPGGSLSAIDII
FT                   TALYYNVMSYDPKNPELESRDRFILSKGHACPALYATLADLGYFKEEELWNLRQIGALL
FT                   QGHPTIEIPGIEVNTGSLGQGFSSSVGVAIGCKLNKYENNVFVLLGDGECQEGQVWEAA
FT                   MAAAHYKLDKLIGFVDRNKLQIDGCTEDVMCLADLKAKFSGFGFDVFEIEGHNYEEIIK
FT                   TVELAKTMKNGKPKMIIANTIKGKGVSFMENNVGFHGKAPNNEELEKALTELQ"
FT   gene            427863..428522
FT                   /locus_tag="MmarC5_0470"
FT   CDS_pept        427863..428522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0470"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   mmp:MMP1114 pentose-5-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34784"
FT                   /db_xref="GOA:A4FX55"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX55"
FT                   /protein_id="ABO34784.1"
FT                   /translation="MVMIGASILSADYGHMEQEVKKAEEGNIDFFHVDIMDGHFVPNLS
FT                   MGLRVPHYLKSITDVPIDVHLMVENPELFIPKLADAADIIAFHAESSKYLFRTVDMIKE
FT                   HDAKPIVALNPSTPIGNVEYVLENLYGVLVMTVEPGFSGQSFINPMLKKIDNLKNKILT
FT                   EGYNTKIFVDGGINLETAPKAVEAGADALIAASAIYGKEDVKKAVNDLRNSANFKI"
FT   gene            428575..429513
FT                   /locus_tag="MmarC5_0471"
FT   CDS_pept        428575..429513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0471"
FT                   /product="transketolase subunit B"
FT                   /EC_number="2.2.1.1"
FT                   /note="PFAM: Transketolase, central region; Transketolase
FT                   domain protein; KEGG: mmp:MMP1113 transketoloase, C
FT                   terminal half"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34785"
FT                   /db_xref="GOA:A4FX56"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX56"
FT                   /protein_id="ABO34785.1"
FT                   /translation="MNGKKKGMREAYGETLAELGEVNENIVVLDADLSGSTKTGIFAKK
FT                   YPERFFNAGIAEQNMMGMAAGLSRTGKTVFASTFAMFATGRAWEQIRNSIAYPGLNVKI
FT                   CATHSGVTVGEDGASHEMTEDIAIMRAIPKMIVISPSDYLETKSAVRWAATYEGPVYVR
FT                   MPRGNTEIIFENEEEAKFEFGKARILKEGTDITLIATGELVPEAINASKILSEKGISAE
FT                   VIAIATIKPIDKDAIKNSKDFIVSIEDHSIVAGLGGAISEVIAEEGLNKKLLRIGINDE
FT                   FGKSGKAGDLLKYYKLDSESIAETVLNAYKK"
FT   gene            429575..430330
FT                   /locus_tag="MmarC5_0472"
FT   CDS_pept        429575..430330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34786"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX57"
FT                   /protein_id="ABO34786.1"
FT                   /translation="MKKIGILEFLVLISVLVTALAIGYNFLSPTSAEYTFDGEEMYKCA
FT                   WISENIMLKGFPLYADIDGTWTADSLEFSDRVQILAASGGTLTVAYDNKEMTIGGKLAS
FT                   KEDIAASKIYLVPLGNTIIRYNLESINGTSFSEICDIVYADIGDDLTVLEVDIDGSFAI
FT                   DADTFSPTEQLEVINYFKYETALPKMSFVDGGLILKGTFNLDDLKNLDSLINPQKIVTS
FT                   KMEVNIIVEESSNEINTENYNNAKLITWM"
FT   sig_peptide     429575..429673
FT                   /locus_tag="MmarC5_0472"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.827) with cleavage site probability 0.275 at
FT                   residue 33"
FT   gene            430335..431408
FT                   /locus_tag="MmarC5_0473"
FT   CDS_pept        430335..431408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0473"
FT                   /product="Protein of unknown function DUF70"
FT                   /note="PFAM: Protein of unknown function DUF70; KEGG:
FT                   mmp:MMP1111 periplasmic ModA molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34787"
FT                   /db_xref="GOA:A4FX58"
FT                   /db_xref="InterPro:IPR002760"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX58"
FT                   /protein_id="ABO34787.1"
FT                   /translation="MKKFLELNSQKIGPHHIFVGLSCLFVLLSNVSAMSACIVLFSSVF
FT                   FYISFIAGQNIFKKLDFKPYEVNYKLHEKIGLFLMLFGIFFTIMDLLWVRGVPLFDPAS
FT                   RKFLSVIYTGFSHTLPLGWAILVSSSKLSNKKIFLYSGVFSALIVLLGYRTQVVVLLLS
FT                   TIFAMYYSEKIKNKLMIYSLIGLAFVIFGLSFLRHYILNIGGNPLISRIDLTMSIFDLI
FT                   VKNFNGNFQGVIHNAIFSSYGLIAGSNYGPRTLIANSIGVTGVTITPTIFGAVLMDFGM
FT                   IGLVPYFGIFGLLMGLSNNLSSKLKGLYLGFYSIMVSYLIVGIETGILDLDVVVMYALG
FT                   IIMTFYGIFRGILNAKK"
FT   sig_peptide     430335..430442
FT                   /locus_tag="MmarC5_0473"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.930) with cleavage site probability 0.590 at
FT                   residue 36"
FT   gene            431395..432549
FT                   /locus_tag="MmarC5_0474"
FT   CDS_pept        431395..432549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34788"
FT                   /db_xref="GOA:A4FX59"
FT                   /db_xref="InterPro:IPR002760"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX59"
FT                   /protein_id="ABO34788.1"
FT                   /translation="MLKNNFERFKDYFREKYGLGLDNPIVIIFLGHMLIFLLAIPYFDK
FT                   FGIDSLLKMILVVFGNLAIFSIPFFINFEKTLKLGKLNLKLISGILLGFSMFFGVFVLS
FT                   ASVINAILFSGLVFLILHVFMKYYYSEKISKIMFLIGVISFIAIILIHGSVPITDYTVR
FT                   MAISNDPLRLISSGALTFASLFNFGYFMVSFAILAVTGYKANVLVLIVAYLLYNYKRNK
FT                   INAKKIFLIGIFTIPFLGIMAKSILSSSGQSWSLNFLEIMSYRAYFDLMTLEKIILYPT
FT                   ALCGKIAFTPGGESLIGEIIHGYTHNITSTMFGPIYLDLGYYSLIFSLIFGIISKLIYK
FT                   KSDTKIYSIYGAVLLSMCEIGINYGFLVTMLTFLYVSENLQKKP"
FT   gene            432599..433708
FT                   /locus_tag="MmarC5_0475"
FT   CDS_pept        432599..433708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0475"
FT                   /product="Protein of unknown function DUF373"
FT                   /note="PFAM: Protein of unknown function DUF373; KEGG:
FT                   mmp:MMP1109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34789"
FT                   /db_xref="GOA:A4FX60"
FT                   /db_xref="InterPro:IPR007254"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX60"
FT                   /protein_id="ABO34789.1"
FT                   /translation="MVSIKDIGKDYNVPEDKKYLVIVVDMDDDVGRKANIRTPILSRED
FT                   NINAAVKLGLTDPGDSDVNSMLGGIQHYDHLKKEGKDVEIATISGDIDIESEVCAIKIK
FT                   EQIDFLIYLYEPNFIYLVSDGKEDEMVLKYLELKDIFVWKKRIVIKQNESLESTYYLVQ
FT                   EFIKKTMSQYIPLIFTSIGFAMILYAIFSDLGWRIIAGLIGIYILSEGVGLVESLKKTL
FT                   TESKKGLEVGKLSPFGNILGFLILLVGILYSYRVSVDPELTIFFGKFLLNIANPLTLGF
FT                   VLLVLVHFIDDLIHTEKSILRLLKRLFFNVILAFMLRQMLIVSSGYLNGYAVEFTGLVM
FT                   YILAYVSVLIVLSVVLFHEPKNKEKLNTE"
FT   gene            433720..434670
FT                   /locus_tag="MmarC5_0476"
FT   CDS_pept        433720..434670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0476"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2+ transporter protein, CorA family protein;
FT                   KEGG: mmp:MMP1108 magnesium, nickel and cobalt transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34790"
FT                   /db_xref="GOA:A4FX61"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX61"
FT                   /protein_id="ABO34790.1"
FT                   /translation="MLEILGYNKGSFEVLNLDQMDREHDLIWIDCYDPSDVELIELSKT
FT                   MGIEIDELSLGLDEQEVPRVEEEDNYYTIIFKAPLFEEDITTTSFGIYVKDNIILTIHA
FT                   DKIKSIGRLYNLVKTKKPKTLLDKGKGFFIYTILNQITISYSRILVNLEDQLDVLEDRI
FT                   VQEQNKNMTEEILQLRKMLVYFHKALISNKDVISVLKRKYISITTQEDRWEFEDLYYDI
FT                   LQLIDMETTYRELLSSMMDMSLSIENIRMNQVMKILTMVTALFAVPMWITGIYGMNFKY
FT                   MPLSEHPYGFWIISAISIVVIMIIIHTFVKEKWIK"
FT   gene            434685..434954
FT                   /locus_tag="MmarC5_0477"
FT   CDS_pept        434685..434954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0477"
FT                   /product="signal recognition particle, subunit SRP19
FT                   (srp19)"
FT                   /note="PFAM: Ribonucleoprotein complex SRP, Srp19
FT                   component; KEGG: mmp:MMP1107 signal recognition particle
FT                   protein SRP19"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34791"
FT                   /db_xref="GOA:A4FX62"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR022938"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FX62"
FT                   /protein_id="ABO34791.1"
FT                   /translation="MKEMIIWPAYIDLKRTKNEGRKVPKEFAVQNPKLKDIAGKLKKMG
FT                   LEYSIEHKKSYPKDPWEICGYIKVKADKRTSKLQILKEICKNMG"
FT   gene            complement(434955..435269)
FT                   /locus_tag="MmarC5_0478"
FT   CDS_pept        complement(434955..435269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34792"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX63"
FT                   /protein_id="ABO34792.1"
FT                   /translation="MFNIRRKKQETVSRDKYEDIKKIYLESKKSYLELEAKYKHELYTN
FT                   GQLKSELSRKNVELEYLNHKLNELYEKYRDLSKNYEKLENRIKFLLSELEKKHEQDSEK
FT                   "
FT   gene            complement(435282..436370)
FT                   /locus_tag="MmarC5_0479"
FT   CDS_pept        complement(435282..436370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0479"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: mmp:MMP1105 succinate-CoA ligase
FT                   (ADP-forming), beta chain; TIGRFAM: succinyl-CoA
FT                   synthetase, beta subunit; PFAM: ATP-citrate
FT                   lyase/succinyl-CoA ligase; ATP-grasp domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34793"
FT                   /db_xref="GOA:A4FX64"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX64"
FT                   /protein_id="ABO34793.1"
FT                   /translation="MKLHEYEAKEIFKENGIPVPKNKLTCGKVDSIEYPVVIKAQVLVG
FT                   GRGKAGGILFADNLDDANKKIESLIGNTVKGELVEKVLLDEQIKIAKEYYVGVVVNRNE
FT                   KNNVVIFSTEGGVDIEEVASKTPEKIIKLPLESGKEFLPYLAREMLKKAGIPSAEIPKV
FT                   ADVLCKVYKAFKNMDGILAEINPLVFTEDGKIIAADAVLNIDDDAYFRHKYDKFEEFKK
FT                   QEKSEFAYVELDGDIAVIGNGAGLTLASMDIVKEFGGEPACFLDVGGGSNRETVKKALL
FT                   KATSRKNVKGAFINILGGITRCDEVSLGIVDVLKENPNLKFAVRMMGTNEEKGRKILSE
FT                   NGVSFENSMEGAARALTELINS"
FT   gene            complement(436423..436869)
FT                   /locus_tag="MmarC5_0480"
FT   CDS_pept        complement(436423..436869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0480"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase, regulatory
FT                   subunit; PFAM: aspartate transcarbamylase regulatory
FT                   subunit; KEGG: mmp:MMP1104 aspartate carbamoyltransferase,
FT                   regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34794"
FT                   /db_xref="GOA:A4FX65"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FX65"
FT                   /protein_id="ABO34794.1"
FT                   /translation="MKMELKVKPIENGTVIDHISGSKALKVYKILNIEEKLPITLALNV
FT                   PSKKGVMKDILKIEGLELTKDDVNKIALISPDATINIIKEGKVIKKFKVDLPKRIDGII
FT                   KCTNPNCITNKENIEGKFSIEQKNTLKIRCEYCEKFINSIIISK"
FT   gene            complement(436919..437563)
FT                   /locus_tag="MmarC5_0481"
FT   CDS_pept        complement(436919..437563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0481"
FT                   /product="TfuA domain protein, core"
FT                   /note="PFAM: TfuA domain protein, core; KEGG: mmp:MMP1103
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34795"
FT                   /db_xref="InterPro:IPR012924"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX66"
FT                   /protein_id="ABO34795.1"
FT                   /translation="MKIAIFSKLTIKEDQIRKKMDGLDVDIYPPIKRGDLTSKKIFDYD
FT                   IIGIIDGCFLQNTAVAHREILKVIQNNTTVFGAGSMGALRASELDTCGMIGVGSVYSLY
FT                   KHGIITDDDEVAVTFDDNLNQITFSMISFREMINNALKDKIIDEDDSKRLINSGKKLYY
FT                   PLRTFENVIEKSGISGEKKEILEKYLKNQPDIKRNDALEMLEEIIKYVEKQ"
FT   gene            complement(437560..438135)
FT                   /locus_tag="MmarC5_0482"
FT   CDS_pept        complement(437560..438135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0482"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="SMART: phospholipase D/Transphosphatidylase; KEGG:
FT                   mmp:MMP1102 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34796"
FT                   /db_xref="GOA:A4FX67"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX67"
FT                   /protein_id="ABO34796.1"
FT                   /translation="MTFDLTSMFEYLAIINTIILVILGYILIMLLKLVKSNFEYSRSLT
FT                   CPEDRIEVLNDEKYYYYVLNRIKYAKKEIDVIMFSIYLNPKISELIDELVNARKRGVMV
FT                   RVILEEEVGSNILAQSKLSSQHIMVKFHDSKKTHNKLIILDDTVIVGSHNWTDKALFEN
FT                   KESGIAISNESVLKEEKEYFESLWRSVE"
FT   gene            438287..439474
FT                   /locus_tag="MmarC5_0483"
FT   CDS_pept        438287..439474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0483"
FT                   /product="acetylornithine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.11"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferases; PFAM: aminotransferase class-III; KEGG:
FT                   mmp:MMP1101 aminotransferase (subgroup II) similar to
FT                   acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34797"
FT                   /db_xref="GOA:A4FX68"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX68"
FT                   /protein_id="ABO34797.1"
FT                   /translation="MSTLEKEQIILDEKKYVINTYGRVPVVLVKGKGMSVFDTEGKEYF
FT                   DFLAGIGVNNVGHCHPKVVETIKNQAQTLIHISNIYYNVPQIELAKKLVNLSGLDKAFF
FT                   CNSGAEANEAAIKLARKYGKKKGKEGEIITMEHAFHGRTLTTVTATPKAKYQEGFEPLP
FT                   QGFNYIPFNDIEALNAGISEKTAAIMIEPVQGEGGIHPADKEYLKAVRKLCDENNIVLI
FT                   FDEVQCGMGRTGTMFSYEQYGVVPDIVTLAKGLGGGFPIGAMVAKSEIADAFTPGSHGT
FT                   TFGGNPLACASSNAAIDVISGLLENTLEMGEYFRSELKKLEEKYDFIKEVRSLGLMVGV
FT                   ELTFNGSDIVSKMFEKGFLINCTSDTVLRFLPPLIVEKEHIDSIISALDEVFSEI"
FT   gene            439693..440100
FT                   /locus_tag="MmarC5_0484"
FT   CDS_pept        439693..440100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0484"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   mmp:MMP1100 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34798"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX69"
FT                   /protein_id="ABO34798.1"
FT                   /translation="MNSIENVDRKLIENLANLMSSEVRAKIYIYLRKYNKSTVDEIADG
FT                   TGIYPSTVRESILDMYNTGYVSREKMDKEGLGKKPYLYTAAAPSEIVRKISKSIQEKLN
FT                   DLIMVDKRLESKELKIPFVPVKIVVDEKYKD"
FT   gene            complement(440097..440798)
FT                   /locus_tag="MmarC5_0485"
FT   CDS_pept        complement(440097..440798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0485"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG: mmp:MMP1099
FT                   phosphate ABC transporter, regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34799"
FT                   /db_xref="GOA:A4FX70"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX70"
FT                   /protein_id="ABO34799.1"
FT                   /translation="MARTAFSNQMKEVEDMIYEMSEMCAIALENSITAFINNDIELAKV
FT                   IKAGDDAIDLKEMEIEEKCISFMATQQPVASDLREMITMIKIISKLEKVGDMASRIAKI
FT                   TIKSEHDTLRSKNGSMLTIMGEILDKMLKNSISSFRNRDLTVAKETYLEDGKIDELYKV
FT                   LCRDMTINMIENPKVISEAGDFIVVGTYLERVGNLCGSIGDRVAFMITGERLKEEEFEK
FT                   ILKKTTKKLEN"
FT   gene            complement(440823..441578)
FT                   /locus_tag="MmarC5_0486"
FT   CDS_pept        complement(440823..441578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0486"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /note="KEGG: mmp:MMP1098 phosphate ABC transporter,
FT                   ATP-binding protein; TIGRFAM: phosphate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34800"
FT                   /db_xref="GOA:A4FX71"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX71"
FT                   /protein_id="ABO34800.1"
FT                   /translation="MKIKMESKDVNLWYGEKKALNDINLPVYENNITALIGPSGCGKST
FT                   FLRCLNRMNDLISGVKINGKITLDEKNIYDKDVDVVELRKRVGMVFQKPNPFPMSIYDN
FT                   IAYGPKIHGIKDRNELDEIVEWTLKKSALWDDVKDDLKKSALKLSGGQQQRLCIGRTIA
FT                   VKPDVILMDEPCSALDPISTLKIEDLMVELKNEYSIVIVTHNMQQASRVSDYTGFFMLG
FT                   NLVEFNKTDKLFVEPENKKTEDYISGRFG"
FT   gene            complement(441597..442463)
FT                   /locus_tag="MmarC5_0487"
FT   CDS_pept        complement(441597..442463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0487"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: mmp:MMP1097
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34801"
FT                   /db_xref="GOA:A4FX72"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX72"
FT                   /protein_id="ABO34801.1"
FT                   /translation="MNNSKKAKIEENIVFGIFYLFAFIVIGILFTIVGYVFINGIGAIN
FT                   MEFFFGDSNPINVILGSERCFDGIWNSILGTLALVLLSILLSIPFGVFGAIYLHEYASD
FT                   NKLTRAIRFSSDSLAGLPSIVFGIFGYALAIKTVGPSLLIGGLTLSFMVLPIIMRATEE
FT                   GLKAVAPGLREGSLAIGATKWQTITKVVIPSALPQMITGIILAMGRSAEETAAIMFTAA
FT                   TAFSFGIGLFNRVETLSFSLYVLATEYSTTEELQMAYGIALVLIAIMFILFTIANIVKN
FT                   RFKLMQS"
FT   gene            complement(442476..443351)
FT                   /locus_tag="MmarC5_0488"
FT   CDS_pept        complement(442476..443351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0488"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: mmp:MMP1096
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34802"
FT                   /db_xref="GOA:A4FX73"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX73"
FT                   /protein_id="ABO34802.1"
FT                   /translation="MHKKNIGESVLENILKLSALLSSVVIFSMVLFLIISSLPVFSVVS
FT                   PFDFVFGLDWSPNYDSYGIFPMVVGSFLVTVLALVFSVPLGVGCAIFLAELAPKKVQNI
FT                   LRPSIEILTAIPSVVYGFVGMVLLVPLIRDVFNTNPGYSWLAASIILGIMIVPTITVLS
FT                   EDAINSVPSQLKEGSLAMGATRWQTIKKVILPASLSGILSGVILGMGRAIGETMAVLMV
FT                   AGNWPLIPTSIFNPVRPLTSHIILNIKEAASGSPIYYAMFATGLVLFIMVLSLNLISQY
FT                   IDKKYKIKWD"
FT   sig_peptide     complement(443223..443351)
FT                   /locus_tag="MmarC5_0488"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.976 at
FT                   residue 43"
FT   gene            complement(443417..444262)
FT                   /locus_tag="MmarC5_0489"
FT   CDS_pept        complement(443417..444262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0489"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein, family 1; KEGG:
FT                   mmp:MMP1095 phosphate-binding protein; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34803"
FT                   /db_xref="GOA:A4FX74"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX74"
FT                   /protein_id="ABO34803.1"
FT                   /translation="MKKYINVLIGAVFISLIVGFSGCTDNTNGSNDAEEVQQFSLKISG
FT                   STTVLPIAEEAAKQFMIQNKNYMIEVTGGGSGLGVKESGENLNDIGMASRDVKSSEFEE
FT                   YPSLQVFGIAKDGVAIIVHPDNSVSGLTQEQIVAIYAGEITNWNEVGGEDAPITVYTRD
FT                   EESGTREVFFEKALNKGNITKQAVVVASNGAMKSSVKADVNGIGYLSIGYLDSSVKGCE
FT                   YEGVLPTEANVVSGTYKVSRTLNVITNGQPSEEAQAFIDFLLSSEGQQIVVNEGYIPVN
FT                   "
FT   sig_peptide     complement(444188..444262)
FT                   /locus_tag="MmarC5_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.735) with cleavage site probability 0.622 at
FT                   residue 25"
FT   gene            444505..446781
FT                   /locus_tag="MmarC5_0490"
FT   CDS_pept        444505..446781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0490"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="KEGG: mmp:MMP1094 phosphoenolpyruvate synthase;
FT                   TIGRFAM: phosphoenolpyruvate synthase; PFAM: PEP-utilizing
FT                   enzyme; pyruvate phosphate dikinase, PEP/pyruvate-binding;
FT                   PEP-utilising enzyme, mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34804"
FT                   /db_xref="GOA:A4FX75"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX75"
FT                   /protein_id="ABO34804.1"
FT                   /translation="MKLITWLDDLRNDDVDIAGGKGASLGEMWNAKLPVPPAFVVTSEA
FT                   YRYFIKETKLQDEIERILSNIDVNNNEELNKASKEVRKAIESVKIPDDLRLSIIESYSK
FT                   ICEMGGDEETFVAVRSSATAEDLPDASFAGQQETFLNIKGDEQVLQAVQECFSSLFTPR
FT                   AIFYREEKGFDHFEVALAAVVQKMVNADQAGVMFTVNPINHDYNQMVIEGAWGLGEGVV
FT                   SGTVSPDTYIITKDTQEILSVNVARKDTMFIKDTDGVTKEVKTPENLLEKQVLSEKMIK
FT                   KLENVGQTIENHYKRPMDIEWSIENGEIYMLQARPITTLNEKKESKSSNDIDGKILLKG
FT                   IGASPGTEAGKVKIITEIEEIGRIIDGDILVTKMTTPDMVPAMKKAAAIITDDGGLTCH
FT                   AAIISRELGTPCVVGTKEATKMLKDEECVTVDGEKGIVYEGKVGKTEEKAPAQVVYAGA
FT                   PVITATEIKANVSMPEVAERAAATGADGVGLLRAEHMILGTGVHPGKILNDQGEGALTD
FT                   VFAEGIRKVADAFYPRPVTYRTLDAPTDEFVGLKGGEEEPHEHNPMMGWRGIRRGLDQP
FT                   EILKCELKAIKKLREDGYRNINVMIPLVTNVDEIRNVKEIANEVGLKLRLDVEFGVMVE
FT                   TPAAALIIDDIIAEGIDFVSLGTNDLTQYTIAIDRNNENVSKYYLENHPAVLKLIEIVI
FT                   KSCKDAGVKTSICGQAGSRPQIVEKLVEWGITSISANIDAVETIRNVVARTEQKIILEA
FT                   IRRQK"
FT   gene            446846..447292
FT                   /locus_tag="MmarC5_0491"
FT   CDS_pept        446846..447292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0491"
FT                   /product="cytidyltransferase-related domain"
FT                   /note="TIGRFAM: cytidyltransferase-related domain; PFAM:
FT                   cytidylyltransferase; KEGG: mmp:MMP1093
FT                   4'-phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34805"
FT                   /db_xref="GOA:A4FX76"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX76"
FT                   /protein_id="ABO34805.1"
FT                   /translation="MNKVVIGGTFDVLHKGHENLLLHASKFGKLFIGITSDEFIKLYKK
FT                   HDVDPLDIRKIKLKEFLNNYEIDYEIMVINDAYGNSISKDYDIIVVTPETKENAETINK
FT                   IRLKNGLKPLKIEVYNFLMAKDNIPISTTRIRTGEIDKQGNLKR"
FT   gene            447289..448203
FT                   /locus_tag="MmarC5_0492"
FT   CDS_pept        447289..448203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0492"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: mmp:MMP1092
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34806"
FT                   /db_xref="GOA:A4FX77"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX77"
FT                   /protein_id="ABO34806.1"
FT                   /translation="MIFMEIMYIIVFLILIGYISRNFKILDEKDRMVLNKIVIYITMPS
FT                   TIFLQLLTNVTPSDLPEFMKLPLIIFISTAVCALLAYLVGKCLKLDNKSLGGFVLVSSI
FT                   GNTGFLGYPVILGFYGNEGLLRAIFCDMSAIFCSMLLGTYVGVKVSGAKKSILKEVFSF
FT                   PPLFTGIVTLILVLLHVKLSTFPEFFIKSLGYMANATIPLIMLSLGLSLSPKAAKFGIF
FT                   YGIIVSLFRMVISPLVAFPISESILSNQLDKQVAIMQSAMPSAMMPLVYAVIYDLDVKL
FT                   VASACFVSTVLSLLILPIIYTII"
FT   gene            448269..449117
FT                   /locus_tag="MmarC5_0493"
FT   CDS_pept        448269..449117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0493"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   mmp:MMP1091 ADP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34807"
FT                   /db_xref="GOA:A4FX78"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX78"
FT                   /protein_id="ABO34807.1"
FT                   /translation="MVKKAIIPAAGFGTRLLPITKAQPKEMLPVLGKPIIQYVIEDLAE
FT                   AGIENILIITGRGKYAIENHFDKNFELEDRLKKDGKCGALKTIQEINDFAHIYYIRQGK
FT                   QKGLGDAVYCGREFICEDYTIVMVGDTIYSGNVPKKLIEAHEKYKCSVIALERVPKEDV
FT                   FKYGVISGKEIENGIFEVNDLIEKPNVEEAPSNLIITGAYLLSSKIFGHIENIELGKGG
FT                   EIQLTDAMKTLLKEEKIIGVEVDFKRYDIGDIKGWLEANVELGIENIEGFKEYIQDLCE
FT                   E"
FT   gene            449208..450098
FT                   /locus_tag="MmarC5_0494"
FT   CDS_pept        449208..450098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0494"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility C-terminal
FT                   domain; KEGG: mmp:MMP1090 UDP-glucose 4-epimerase related"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34808"
FT                   /db_xref="GOA:A4FX79"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX79"
FT                   /protein_id="ABO34808.1"
FT                   /translation="MKILVTGGAGFIGSHIVDILIENGHDVSILDNLSTGNEKNLNTSA
FT                   KFINGDILDKTLDLSGFECVIHEAAQINVNKSLSAPMFDAEVNILGTVNILEKMKKYGV
FT                   KKIIYSSSGGAVYGEPEYLPVDENHPIKPLSPYGSSKFCAEEYIELYNRLYGIEYCILR
FT                   YSNVYGERQDPLGEAGVISIFIDKIKKGETPVIYGDGNQTRDFINVRDVAKANLLALGW
FT                   RNQIVNIGSGRETSVNELFKLISFELGFNLDAIYEKEREGEVYRTYIDYKKAKSLGWIP
FT                   DVELQDGIKNLVFAF"
FT   gene            450109..451431
FT                   /locus_tag="MmarC5_0495"
FT   CDS_pept        450109..451431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0495"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   mja:MJ1054 UDP-glucose dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34809"
FT                   /db_xref="GOA:A4FX80"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX80"
FT                   /protein_id="ABO34809.1"
FT                   /translation="MKISVIGTGYVGLIQATGLASFGFEVMGIDIDETKVKMLNEGLCP
FT                   LHEEGLEELLRSHVGKNLKFTTSYECLKESEVIFLCVGTPQDRDGNTDLRFLFSATDNL
FT                   KNYVENSKYLVIKSTVPIGTNRMIKERLNNPNIEIISNPEFLREGIALKDFFNPERIVL
FT                   GFEDFNPESRYILEIYGEFMKKNIPFVITNWETSEMIKYASNAFLATKISFINELSKLA
FT                   DLTNSNIKTVAYAMGMDDRIGGKFLNAGIGYGGSCFPKDVKSLIKQFENHDIVPNIIGA
FT                   TDRVNEDQIFWFFNKLKERYGGDIAGKTISVLGLSFKPKTDDLRESASIKLIDLLLKEG
FT                   AIVKGFDYVKKARENAYNMYNLDKSRAFYGYNLYILDSVRDAVVNSDGIIIAVEYEELN
FT                   FENWADISKSVNKKILFDGKNILNKDVIEEIGFEYVGVGIN"
FT   gene            451443..452420
FT                   /locus_tag="MmarC5_0496"
FT   CDS_pept        451443..452420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0496"
FT                   /product="UDP-glucuronate 5'-epimerase"
FT                   /EC_number="5.1.3.12"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility C-terminal domain; KEGG:
FT                   mja:MJ1055 dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34810"
FT                   /db_xref="GOA:A4FX81"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX81"
FT                   /protein_id="ABO34810.1"
FT                   /translation="MKILVTGAAGFIGYSLCKNLLDENIESLVGIDNLNSYYDPILKEK
FT                   RLDMLNKFSKNNFKFYKIDLDNFKELEDIFSKEMPDLIVHLAAQAGVRYSLENPWAYEY
FT                   SNNIGTLNIFEIAKKYNIKKIVFASSSSVYGGNQKIPFSERDNVGKPVSIYAATKKYNE
FT                   LLAHVYHHLYDMEMVGLRFFTVYGEFGRPDMAYWKFTKKILNGEQIDIYNFGDMNRDFT
FT                   YISDIVEGIKNAINTPNLGYNIFNLGGDNPVNLEYMINLIEKELGINAIKNYMPIQPGD
FT                   VPVTMADLEKSKKMINYRPKVSIEEGIQKFVNWYLENKQWLKDI"
FT   gene            452429..454321
FT                   /locus_tag="MmarC5_0497"
FT   CDS_pept        452429..454321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0497"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="KEGG: mja:MJ1056 asparagine synthetase (AsnB);
FT                   TIGRFAM: asparagine synthase (glutamine-hydrolyzing); PFAM:
FT                   glutamine amidotransferase, class-II; asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34811"
FT                   /db_xref="GOA:A4FX82"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX82"
FT                   /protein_id="ABO34811.1"
FT                   /translation="MCGINGFNFSSENYIKLMNNEIKHRGPDDRGFFLDNEQKVSLGHV
FT                   RLSILDLTEKGHQPMFYSKETASCNENFENELIQKCNVAICYNGEIYNYQELKDELIQK
FT                   GYNFNTNSDTEVLLASYLEWGLECVNKFNGMWAFCIYDKEKNILFLSRDRLGVKPVYYY
FT                   FDENYFIFSSELKGILKHDYLNLRSLKNINKDAIDLYFSLGYIPSPYSIYNNVYKIESA
FT                   SNLVFDIHKKEINIQKYWELPDYSPNNDKKKLLEVGKKLLEDSVKLRMRSDVPVGAFLS
FT                   GGIDSSTVVGIMKNFTNLEKLHTFSIGFEGDYDETPYINMVKDDFKTIHHHEYFKENDF
FT                   ENIVDIFSEIYDEPFGDYSGFPTYFLSNMAKKTVIVSLSGDGGDEVFGGYNMHLAAKRL
FT                   EIIRKLPKILRRIGSKIPVKENLNGFFNIYSLKKAFEVSLSDPELFFINSFSDNRLITE
FT                   KYYGWTMEKLKYSLKKGGNDLVEGFRIYDLLYNTLSDNFLVKVDRASMRNSLEVRSPFL
FT                   DYRFAEFAQKIPSKWKVDLFNTKKLMKELVKGVLPLKIITRKKQGFTPPIEKWILDKKY
FT                   EKDFEKGLLILKDINPDIHDYYIEKVMNRNDKLSTHAKIRLFIFSKWWEKWMEY"
FT   gene            454365..455507
FT                   /locus_tag="MmarC5_0498"
FT   CDS_pept        454365..455507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0498"
FT                   /product="1,2-diacylglycerol 3-glucosyltransferase"
FT                   /EC_number="2.4.1.157"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   bha:BH1415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34812"
FT                   /db_xref="GOA:A4FX83"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX83"
FT                   /protein_id="ABO34812.1"
FT                   /translation="MNVLIITPTYLPRDGGIENSILETAKKISEKSGNNVSIVTPFIDP
FT                   NSKNYEKFGNLEIYRFGKFLCFIQNRFLKFSLFNLTALFYLFYLKIFKKFNFDVINTHT
FT                   VALPGIPSVVLSKIFKKPLVFSIHHYGSGMDIVRPEENGYLLNKLIKKLLKYADFITVT
FT                   SETQEKYLDYLFGGKKKDLKYFCVPLGINMPEISNSKNISNNGQFIVFTIGRLVKRKRL
FT                   DIILNIAERLSEDKKIVFAIAGSGPEKENLEKMILEKDLKNVILLGRVTEEEKVEWFSK
FT                   SNLFIQSSEYEGFGITYLEGLSFGIPVLAFKNTAIEEIKRKIGKGVYIFEDVDSAVSQI
FT                   TEIKSSKLDSEIIQNKIRKTYSWKKTSEKFEEIFNNLIRN"
FT   gene            complement(455504..456649)
FT                   /locus_tag="MmarC5_0499"
FT   CDS_pept        complement(455504..456649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tko:TK1724 hypothetical protein, containing
FT                   ATP/GTP-binding site motif A"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34813"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX84"
FT                   /protein_id="ABO34813.1"
FT                   /translation="MLGDTLENTKNTYPIIPELCSLTTDNKMLSGFNYSTLLYNIKNMA
FT                   NNPDYDFTVNYKVNKKVEKEFKKLKNEGKIKNLFSNVYICKDSKNLEFYMFQKSIITFV
FT                   GKICFDEKTKKINVTSNRAWSKIMFPIWNLDSPRKVLNDLLFFILLQNGYLTLHASAVA
FT                   GPNNDDVTIIMGKPNTGKSISTFSLVSEKDYSLIGDDIIVVDINTKKVYSCPYAFTYYH
FT                   NEYLIGEFYKKGLISRLEFFKLRWNEFLKKFPIIYLYSSFKMDYQNIFEKLPYKPVGTL
FT                   KNIMILEKTLDTKAVEKLDTEEKNKTTGIIKFLNNVEFFWWKSDILKSLEYLNESQIFP
FT                   KIEKMETEAVQNMLSNTEVYKIDNTNSVAFYGIIDEINKKS"
FT   gene            456780..458453
FT                   /locus_tag="MmarC5_0500"
FT   CDS_pept        456780..458453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34814"
FT                   /db_xref="GOA:A4FX85"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX85"
FT                   /protein_id="ABO34814.1"
FT                   /translation="MLSNIFKKFNDSKYVIIDKVFFRKLDNEIRYTSNVNESFEILLNY
FT                   LPYVKNIVKSSKRPKFVNKLESKELNDLIYYSYIYYLIHWDNIDSSKQIAWQNWFNFKK
FT                   TVDKNLKNEYVVVLDYIRNIDFYEKYISKKFPNEIKRYNEKNIFLKFFGNFHGFFMVFY
FT                   LLMRKLTCLFITGFSKTSAKYDKNMILAITDYDRYYDSKGFFNSEIFSNAEFKEYLKLN
FT                   FNTDVETENIQVVYTKYSFKNFLKYLITFKNDNKSVFLEDILDFHIGLEIFIHGLLNIK
FT                   KNKNFPIVKTDENIEFIDHMYEDFMKNKFLFSLWFYLSVKKYIENNNVKIVIGDSEKNL
FT                   LYFFFSILRKNSEYFNTIAFSHEVIIPDHSFYLPFTGHYDDSPDLKFVWNEGIKKLLVD
FT                   KYNYSEDKIAVLDDPRFLKWKSKKFEKKSILFISQGYSHFYEDLIDFFKNETEKVNFLK
FT                   SKGFKFYFKPHPAEFLTPTSKKYLEEIMKSYNDISVIDNLDFIPEYGIGVDSTLVYELM
FT                   RNGTKVFFLSLNNIFMIEKEDFQKCSKKSISDVIHSLKIE"
FT   gene            complement(458456..459448)
FT                   /locus_tag="MmarC5_0501"
FT   CDS_pept        complement(458456..459448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0501"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility C-terminal domain; KEGG:
FT                   mja:MJ1061 capsular polysaccharide biosynthesis protein D"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34815"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX86"
FT                   /protein_id="ABO34815.1"
FT                   /translation="MEKTFDELMKFYENKKILVTGGTGSIGSTLVKSLLKLNPDTVRIF
FT                   DINETALFDLEHELNDNRIRCLIGDVRDKERVYRAVEDIDIVFHAAALKHVPLCEYNPF
FT                   EAVKTNVLGTQNLIDAAIDENIEKFITISTDKAVNPVNVMGATKLLSERLTLSANLYKG
FT                   SRTTVFSAVRFGNVLNSRGSIIPLIKGQIRKGGPVTLTDSEMTRFVMKIDQAVHLVLKA
FT                   GLLAQDGEIFVLKMPSVKIIDLIEFLIEKYAPEHNYQKEDIEIKNIGKRAGEKLYEELL
FT                   MDEECSKLEETDEMYIIKPFKSEKSENVKKVYNSENVGYLRKEDLEKLL"
FT   gene            complement(459451..460569)
FT                   /locus_tag="MmarC5_0502"
FT   CDS_pept        complement(459451..460569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0502"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   mth:MTH1188 pleiotropic regulatory protein DegT"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34816"
FT                   /db_xref="GOA:A4FX87"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX87"
FT                   /protein_id="ABO34816.1"
FT                   /translation="MKIPLFKIYWDDEDISSVDTILKSGAFWSSGTQIKTFENNIAKYL
FT                   GSKYCITFNSGGSALHALMLAHGLKPNDEVIVPSFTFIATCMAPKYVGSKPVFADIEEE
FT                   TFGLDPNSVLEKITPDTKAIIPVHYAGISCKIDELREIAEAKDLLLIEDAAEAFGAKYN
FT                   NKFVGTYGDSSIFSFCQNKIFATGEGGCVVTDDEEVYNKLNLICSYGRISKENYFSSNC
FT                   SVDYVDIGYNWRLPTILACLGISQLDKVEKLIKMRRKNAEYLNKNLNEIKGVKTINVEN
FT                   NNYAVYQLYSILLENTELRGELIQFLNKKEISSKIYFDPVHKYSVFKSANVNLPVTEDI
FT                   SSKILTLPMYPHMTIEEMDYVIDCIEEFFRSR"
FT   gene            complement(460579..461643)
FT                   /locus_tag="MmarC5_0503"
FT   CDS_pept        complement(460579..461643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34817"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX88"
FT                   /protein_id="ABO34817.1"
FT                   /translation="MEIIRGEKEWNKLIKSDFENYNDVYFNYGYFNLYKMHYGTDFEGI
FT                   FWEDRNIKIFLSHLIRDICKIKNLENFDGYDLTTPYGYGGPIIVKKTNEPEKIRKSISD
FT                   FEKEYQNYCLDEKYICEFFRFHPIYENHICFSKIFNTQYLSDIRYIDLNQNIDTIKSNF
FT                   KKGLRYNIKKSKNEGCDLKIIENPSSEDIDHFMECYNSMLCRNESSEKYHFSKQFIMDH
FT                   FKFIKTFLILAYYQKKVVGAGIFFKGETIMHYHLSGTLKLKGIYPNDLILWESIKKSKD
FT                   LGLKYFFLGGGVIKDDSLFEYKSGFSKLDMPFYIGKKIYDQNKYNQLVKHLNLVKPLNK
FT                   DYFPEYRTFDSTIV"
FT   gene            complement(461646..462761)
FT                   /locus_tag="MmarC5_0504"
FT   CDS_pept        complement(461646..462761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0504"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   cno:NT01CX_1785 UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34818"
FT                   /db_xref="GOA:A4FX89"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX89"
FT                   /protein_id="ABO34818.1"
FT                   /translation="MCDVAFITESRSEYSLMSKALIELKKYVDIKIIATGMHLSPHFGN
FT                   TVSDIENDGFDVEKVDALFDSNSLGGMLKTMGMEIYGITQVVEKLNPKLIFVEGDRCAA
FT                   LVGALIGAHLNIPVVHHGGGDVSDSIDNKLRNATSIFANYHLVGNLESYINLLKMGIDK
FT                   NKIFVTGEPGIDDIILENYSKKDTIIEKYGIKTDENLLLLIFHPNTNENEEVKTQIKEI
FT                   LDAILELNIPTISVYSNSDAGGTEINKMLDEYSKKSKNISVYAHISRKDFLGLMNLCSA
FT                   MVGNSSSGLVELPSFKKPFVNIGNRQKGRLKTKNVIETNFDKTEIKKAVHKAIYDENFK
FT                   KDLNNLENPYGKGKSYSKINEIILKILNNEM"
FT   gene            complement(462763..463839)
FT                   /locus_tag="MmarC5_0505"
FT   CDS_pept        complement(462763..463839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0505"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP0041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34819"
FT                   /db_xref="GOA:A4FX90"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX90"
FT                   /protein_id="ABO34819.1"
FT                   /translation="MEIGSFFEFPKYDGIDFENSAYHHIKGNISTQQLDSIFVGDGRQA
FT                   IKLLLEELIKKNHSEFYLPAYLCHSIIQPFAELNIEFKFYSCDEKLKPDLRNIPENSVV
FT                   YLIDYFGSDSLSKKEILEISKKNIVILDISHSILNKERLEILDKNVFMIASLRKIFPIP
FT                   DGGILFYKKGILNMEKRVFEKNNNYIEMLEAMVLKKYYMNKSNSETSLKNYFLELYRNY
FT                   EFLKDGLITVKEIPPISMEILKNIDIKKMKTQRTVNLEYIYDNLNNPNVNTIYEKKELK
FT                   SPFFIPLNFENGEIKERIRKKLIENQIYPPIHWEIPKEVPKNFTFEHALSENILSVPID
FT                   HRYCQKDMEKILGILNGE"
FT   gene            complement(463906..464952)
FT                   /locus_tag="MmarC5_0506"
FT   CDS_pept        complement(463906..464952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0506"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.56"
FT                   /note="PFAM: N-acetylneuraminic acid synthase, N-terminal
FT                   domain; SAF domain; KEGG: mta:Moth_0756
FT                   N-acylneuraminate-9-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34820"
FT                   /db_xref="GOA:A4FX91"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX91"
FT                   /protein_id="ABO34820.1"
FT                   /translation="MAIKIGNKEIGLKNAFIIAEAGVNHNGSLELAKKLIDVAFEAGVD
FT                   AVKFQTFKTENVVTENAEKAEYQIQNTGVESESQYEMIKKLELSEKDFERLYNYCQEKG
FT                   ILFLSTPFDFESADFLDDLVPLFKISSTDLNNIPFLKHIAKKKKPVIISTGMGTLCEIE
FT                   EAVTALKNAGNHEIMLLHCVTSYPAKDESLNLNVIHTLRNAFKLDVGFSDHSLGIYASI
FT                   AAVSMGATIIEKHFTLDNELPGPDHKASLNPTQLKELVIGIRSVEKAFGDGIKRLTEEE
FT                   IEIKKVARRSIVTKKDIAENSIITEDMIILKRPGTGIKPKYLQDIIGKKVKKDVKKDSV
FT                   LLWEDLIE"
FT   gene            complement(464930..465652)
FT                   /locus_tag="MmarC5_0507"
FT   CDS_pept        complement(464930..465652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0507"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   gka:GK3120 acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34821"
FT                   /db_xref="GOA:A4FX92"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX92"
FT                   /protein_id="ABO34821.1"
FT                   /translation="MRDNMKILAIIPARGGSKGVPRKNIKNLYGKPLIAWTIECAKNSK
FT                   YLTKIIVSTDDEEIAKISEVCGAEVPFLRPLQFAKDNSPTIDSILHAIEFFEEKGEFFD
FT                   IIVLLQPTSPLKITLDVDKSINQLINNPEAKSLVSVDEPNHPPYWSMSIKNDFLVPAFG
FT                   QELFEKRRQDLPKTYMPNGAIFIAYTDELKKYKTFYTPKTTYYTMTSDRSIDIDTEFDF
FT                   ELAEFYMGRRENGDKNRK"
FT   gene            complement(465649..467166)
FT                   /locus_tag="MmarC5_0508"
FT   CDS_pept        complement(465649..467166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0508"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   polysaccharide biosynthesis protein; virulence factor MVIN
FT                   family protein; KEGG: mja:MJ1068 polysaccharide
FT                   biosynthesis protein (CapF) isolog"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34822"
FT                   /db_xref="GOA:A4FX93"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX93"
FT                   /protein_id="ABO34822.1"
FT                   /translation="MEYKKKILSGISWNVLSFLISAPLAYFVRVYYSHELPKLDVGLYY
FT                   AVWDLFCVFAIFKALGLEQAIIKYIPKYIAKNEYNMVKSSIVITGILQFLISGVFSGIL
FT                   ILLAPLIAKYYINNQGQFSNDIFTVINVLILMTVGLQLLQGCADFFSNIISGFQKQNYA
FT                   SSTRVVKIASVLIFSFIFINFFNLKNAYAPALAYAITPIIMIIIYSSITFKKIYPNFFK
FT                   DEFIFSKKIVKDLFSYSIPVMIGSAGSIILGYLDGICLTYFTGLNTVADYRNVALPTVT
FT                   ILSYISVSVASVLFPMSSELWEKGHKEILNSIFEKISYYSFLLILPFSLLMAYLPETII
FT                   GILFTPEYLSASEPMKILSIGAIFLTLNTIGFSVLNGIGKPALSTKILYIGAFFNLTFN
FT                   LLLIPKFGVFGAAITTVIGYLIMWILQIIYLRKFLHYSLNFNKYVLVSIVGIFSLIPLF
FT                   LMKNIVFSSLIMKLSSFTITYFLMYLTGLFMFKLISINELKNLLNVK"
FT   gene            complement(467177..468346)
FT                   /locus_tag="MmarC5_0509"
FT   CDS_pept        complement(467177..468346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0509"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mja:MJ1069 galactosyltransferase isolog"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34823"
FT                   /db_xref="GOA:A4FX94"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX94"
FT                   /protein_id="ABO34823.1"
FT                   /translation="MKKAKLLIFPGYFVPHLGGLETHTDEFSKYMPSENYDISIFAPNI
FT                   PKSKEFEIRHGFVKVYRYPAFELISNYPVPNIFNLRFWKILSDAYLLKPDIVMTRTRFF
FT                   SNTLLGLIYAKFRSKPKKLIHVEHGSDFVKLENPIKNHLAYFYDISVGKIIFKRSDSVI
FT                   AISKAVHKFIKTNFLEKKDIPIIYRGMEIEEIEKIEKNLELAKKFENKFKICFLGRLYK
FT                   WKGVENIIGAYSKLPEQIQKNTVLLIIGYGEDLERLKNLAGDYLDNGIYFLGKLDFKDA
FT                   ISAMKASDIYIHSSYPGGGLSSSLLQAMCSGKAIIASPHEGADEVIFEDNTGILLPNNN
FT                   EEEIKNGICKLYSNKQLINKYGTAAKLFLKENFTWDSSIKQYIKILDRL"
FT   gene            complement(468350..468616)
FT                   /locus_tag="MmarC5_0510"
FT   CDS_pept        complement(468350..468616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34824"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX95"
FT                   /protein_id="ABO34824.1"
FT                   /translation="MWDKIKGWFFGEINGIHYPALVNIAYNNPKIDYLKPFFILNDNED
FT                   EINVVARVPKLLYLKSGLTLNHIKLNGKNTYFGKWNNLKILKM"
FT   gene            complement(468667..469287)
FT                   /locus_tag="MmarC5_0511"
FT   CDS_pept        complement(468667..469287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34825"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX96"
FT                   /protein_id="ABO34825.1"
FT                   /translation="MLSDLFLEIKRKNNNEKISDFLNILDSIYKNNEPKVDELILKELG
FT                   IEKIENDFAIYGKNYPLFKMLYYFNEIPLFNSEKESIIFLKNNNLNPSKTYFELDISEK
FT                   ERLKELILNYAENKVPDSYKPVLKDVIFGNTYYLSKYDMELKEYVSNLNSLYKLKEYDI
FT                   VKNCILKKELPPKNLILKYKKDLSKSIDLFNKKLNNADIENFQ"
FT   gene            469382..470725
FT                   /locus_tag="MmarC5_0512"
FT   CDS_pept        469382..470725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0512"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase C
FT                   terminal; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III; KEGG: mmp:MMP1077
FT                   phosphoglucomutase/phosphomannomutase:calcium-bin DinG
FT                   EF-hand"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34826"
FT                   /db_xref="GOA:A4FX97"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR023666"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FX97"
FT                   /protein_id="ABO34826.1"
FT                   /translation="MKLFGTSGIRMKNLDPLIAYKVGYAISKNFKKAVIGRDTRTTGNL
FT                   IESAITAGLLNGGCDVTTIGMVPTPVLGYSAKDYDLGIMITASHNPPEYNGIKLFNKNG
FT                   TAFDPKQEKELENIINNDDFNEGTWDNIGCVIEDKTAVKNYSEYILQNLDIKTNFNVVV
FT                   DCANAAGCVVSPNIFTEAGCKVISVNSHCDGRFVGRMPEPNEKNLKETVDIIKGLNSNC
FT                   RNYIGIAHDGDADRMIAIDELGRVTDFDKLLAAFCKYIVQKTGADKIVTTVDASMAIDE
FT                   YLNEFGAEVVRTKIGDVAVAEELEKTGAIFGGEPSGTWIHRDIHLTPDGILSGLRVLEM
FT                   MEFYDKKLHEIIDEVPSYYNMREKILCPDNLKQQVMDYVSKEGEKIFEKKPETLDGVRF
FT                   SFEKGWILIRPSGTESYVRVRVEAKEKDFAEKLMKTGISMVYTGISGN"
FT   gene            470735..471970
FT                   /locus_tag="MmarC5_0513"
FT   CDS_pept        470735..471970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0513"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Nucleotidyl transferase; KEGG: mmp:MMP1076
FT                   bacterial transferase hexapeptide repeat:ADP-glucose
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34827"
FT                   /db_xref="GOA:A4FX98"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023915"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FX98"
FT                   /protein_id="ABO34827.1"
FT                   /translation="MDAIILCAGKGTRLHPITESRPKPMIPIAGKPILEHIIEKIENHV
FT                   EKIYLVVGFEKEKIIEYFNENPKIEYILQEKQLGTGHAVLTAKNFIKDDFLVLNGDVIF
FT                   EDSIDEILDYENAVALSKVDNPENFGVIELGYDNKVINLLEKPKKEELTSNFINAGIYK
FT                   LQNSVFGILENLVPSERGEIELTDALKKLIEIGKLHGVELNGYWNDIGHPWDVLSANSH
FT                   FLNKIISKISGKIENNVSITGNVIIEEGAVIKSNSVIEGPVIIKSGSIVGPLAYIRPNT
FT                   ILMENNFVGNSSEIKGSIIFENTKIPHLSYVGDSIIGANCNFGCNTITANLRFDNKPVI
FT                   VNIKGKPVKSVRKLGAIIGDNVKSGIQVSFMPGVKIGSNSLIGANCLIDSDIEQESFVY
FT                   KKDELVITKKRN"
FT   gene            471972..472442
FT                   /locus_tag="MmarC5_0514"
FT   CDS_pept        471972..472442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0514"
FT                   /product="dUTP diphosphatase"
FT                   /note="KEGG: mmp:MMP1075 dUTP diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34828"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A4FX99"
FT                   /protein_id="ABO34828.1"
FT                   /translation="MIIGPNITKDFLSDLKEGQLQQCGVDLKLDKIYKIEGKGAIDFSN
FT                   EKRVLPEHVLIFDSEKDEKIELECGIYIVKIKEKMNIPENMAGFAYPRSTLLRMGVTLY
FT                   TAVHDPGYEGYASYLMHVMNPVTMYKYAKIAQIVFSEVKDGNGTYSGIYHKK"
FT   gene            complement(472512..472754)
FT                   /locus_tag="MmarC5_0515"
FT   CDS_pept        complement(472512..472754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0515"
FT                   /product="membrane-bound hydrogenase subunit ehbD"
FT                   /note="KEGG: mmp:MMP1074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34829"
FT                   /db_xref="GOA:A4FXA0"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXA0"
FT                   /protein_id="ABO34829.1"
FT                   /translation="MSIYIDFLIMALVLMSYIGALIQKDLIKCVVLTGLGGLGLAYLFS
FT                   SLLAPDVALTEAILGGAVLPAFFAFTVKRTQRLDK"
FT   gene            complement(472764..473018)
FT                   /locus_tag="MmarC5_0516"
FT   CDS_pept        complement(472764..473018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0516"
FT                   /product="membrane-bound hydrogenase subunit ehbC"
FT                   /note="KEGG: mmp:MMP1073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34830"
FT                   /db_xref="GOA:A4FXA1"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXA1"
FT                   /protein_id="ABO34830.1"
FT                   /translation="MFDDIVLIIASIGILLASFRLWVEKDREKMVYARLHITGVIDIAC
FT                   IVILLVFRQYLLALTYLVLVPFSAHAIANADYFDELKKQ"
FT   gene            473217..474344
FT                   /locus_tag="MmarC5_0517"
FT   CDS_pept        473217..474344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0517"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mmp:MMP1072 aminotransferase (subgroup I) similar to
FT                   aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34831"
FT                   /db_xref="GOA:A4FXA2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXA2"
FT                   /protein_id="ABO34831.1"
FT                   /translation="MIAERCLGTEQSEIRKIFNMATENSINLGIGEPDFDTPKHIVEAA
FT                   KSALDAGKTHYVPNAGIPELTSAISEKLKKDNKLDISQKNIVTTCGASEALMLSLFTLV
FT                   NRGEEVLVPDPGFVSYKGLTELCEGKMVPIDLDDKFRIDLESVKNSISEKTKCIVLNSP
FT                   SNPTGSVMTKEEIKGICEIADEKNICVISDEIYEKIIYGKKHYSAMEFTDNCILINGFS
FT                   KAYAMTGWRVGYLAVNENFDNKYEILENMMKIHQYGFACATSFAQFGAVEALTGDQNCV
FT                   SDMVSEFERRRNLIYSGMKEIFSVQKPEGAFYIFPDVIEYGNGMDVATKLIQNGILCVP
FT                   GSAFGKNGENSVRFSYATKYDDIERALSIMKNVLL"
FT   gene            474358..474774
FT                   /locus_tag="MmarC5_0518"
FT   CDS_pept        474358..474774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0518"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="PFAM: Protein of unknown function DUF54; KEGG:
FT                   mmp:MMP1071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34832"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXA3"
FT                   /protein_id="ABO34832.1"
FT                   /translation="MIIKIKTNVKPTEDENKVLKAVTNIFVDAEMEVSENIYTGVSKDI
FT                   SRFKELLRSQAILDAARNVLERNIVGNATKFHINKQAAYSGILNFDKDVHGGIKLEFIC
FT                   EENEDIFGLIKDIAPRTRNGVIINEDEELENKKE"
FT   gene            474872..475489
FT                   /locus_tag="MmarC5_0519"
FT   CDS_pept        474872..475489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34833"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXA4"
FT                   /protein_id="ABO34833.1"
FT                   /translation="MRYVAYKIHPQEFAENEVFEKSLILDGKRIHRVRLLGNVSNVDKS
FT                   NIVSFDLGGISVKDFENKSLDVEENDFLDIIGRIGEYNGERYVALEVYSKKNENKDKWT
FT                   ELRNLEIEKTRNYVKDEETIIYNRDEMSSELSVESEALEDLYGDLDIKDKVLDTIREND
FT                   GITYEDLIDNLGLEDVELDNVLSELKEDGEIYEPNPGSYRIL"
FT   gene            475519..476442
FT                   /locus_tag="MmarC5_0520"
FT   CDS_pept        475519..476442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0520"
FT                   /product="signal peptide peptidase A, Serine peptidase,
FT                   MEROPS family S49"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S49; KEGG: mmp:MMP1069 basic
FT                   helix-loop-helix dimerization domain bHLH:peptidase
FT                   U7:signal peptide peptidase, SppA 36 kDa type"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34834"
FT                   /db_xref="GOA:A4FXA5"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXA5"
FT                   /protein_id="ABO34834.1"
FT                   /translation="MKKIYYYSGAVFLIIILFLVGFILLIPVDGISSKNMAMINLDGTI
FT                   SSQTSESGFFSEFEPSVDDYIEWIDDAEKDSNIKAIIIKINSPGGEVIASEKLSRKIKE
FT                   ASEEKVVIAYIETMGTSAAYQAASSTDYIVAERQALVGNIGVRMEIIHYYGLMEKLGVN
FT                   ATTIKSGIYKDIGSPTRPMTEEEQRMLESIVDESYYEFVSWVAENRNMTINETLRVADG
FT                   KIYSGVQAKRVGLVDMTGTEEDAIEVAAKMANLSNPEVYEYAGSSSVGIFGMTFNDALC
FT                   SFGYGFGKGLSESNIEESFKSYQIYY"
FT   gene            476486..477442
FT                   /locus_tag="MmarC5_0521"
FT   CDS_pept        476486..477442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0521"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG: mmp:MMP1068
FT                   K+-dependent Na+/Ca+ exchanger
FT                   related-protein:sodium/calcium exchanger membrane region"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34835"
FT                   /db_xref="GOA:A4FXA6"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXA6"
FT                   /protein_id="ABO34835.1"
FT                   /translation="MLIESVFFLAVGLFMLSYGSDWFVLGASRVAKQFNISSFVIGATI
FT                   VAFGTSLPEIVTSAYAASTGSVDLAVGNALGSCIANIGLVLGLSLIISSVFIKSRSVLK
FT                   NGYLYMVYTIIFTIIGYNGFSFLDGVFLLLLLALYVIYTIKSGEMDEDEHEKSVTFSGA
FT                   IFYLAIGLSFVILGSSFFVDGAKGLATAFGISEKIIGFTIVAFGTSLPELAVSFAAAKQ
FT                   KLGGIVIGNVIGSNIANMFGALAIASLIHEIPAVKFELSVNILMVFLLLILMNKEKIKA
FT                   VLNLNSTKDYLSEITKIDGLILMLIYLLFVLGLTGIF"
FT   gene            477592..479076
FT                   /locus_tag="MmarC5_0522"
FT   CDS_pept        477592..479076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0522"
FT                   /product="thiol-driven fumarate reductase, iron-sulfur
FT                   protein"
FT                   /EC_number="1.3.99.-"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein; protein of
FT                   unknown function DUF224, cysteine-rich region domain
FT                   protein; KEGG: mmp:MMP1067 succinate dehydrogenase/fumarate
FT                   reductase iron-sulfur subunit // Methanosarcina type
FT                   heterodisulfide reductase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34836"
FT                   /db_xref="GOA:A4FXA7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXA7"
FT                   /protein_id="ABO34836.1"
FT                   /translation="MKTFTITVKKTEGFKKFEVPVGITVLSALEYINKTYGENIQFRSS
FT                   CRAGQCGSCAMMINKKSKLACKTKVEDNAIIEPLDGFDVISDLVVNREPYYKKIGTLRN
FT                   YIQKKTEKITEEDLDKLKLYPDDLKDVKKIRGCIDCLSCIAMCPARKYSDYPGPTLMRQ
FT                   LARFAFDPKDELDREKEAFDENIYNCTTCGRCVEVCPKEIDIVHNAVEKLREKTFKKGY
FT                   NLDSHLEVRKNVLSQNRSIPKEKTSFLEEVAEEYLVKNEKMRVAFFTGCLIDFRLQEIG
FT                   KSAIRVLNAHGVSVIIPKNQVCCGSPFIRTGQTDISDKLKKQNLEIFNKLNVDSVVTLC
FT                   AGCGSTLKNDYTEKEFKVMDITEVLVKVGLLDYKPLDITVTYHDPCHLRRGQKVYLEPR
FT                   KILESIPKLKFVEMEIPDQCCGAGGGVRSGKPEVADTIGKRKANMIYATDADYLITVCP
FT                   FCEYHIRDSLKKYFEEHGLKKDIPVMNIVSLLDKVI"
FT   gene            480038..480604
FT                   /locus_tag="MmarC5_0523"
FT   CDS_pept        480038..480604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0523"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM1861 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34837"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXA8"
FT                   /protein_id="ABO34837.1"
FT                   /translation="MVLGKIRSAVSSTFSKLADAFKPKSRSEKIEEIREEIKNDQTSYE
FT                   KGTAFKLCCLDMFPEKDFDLLEMSHDDPKASNGRFIKSDLKPDLQFNHKKTDSPFSVEC
FT                   KYRSNLFKGAYSWANNKKQADKYREFELESQIPVYIAMGLGGTPEKPEQIYLMPLKEIQ
FT                   YNSLYPSVLNDYEVKNIEDILKIIN"
FT   gene            480624..481715
FT                   /locus_tag="MmarC5_0524"
FT   CDS_pept        480624..481715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM1864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34838"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXA9"
FT                   /protein_id="ABO34838.1"
FT                   /translation="MIKKDITEFVDIPHQKLLKKIYNFEKTIPHDELFKSQKNGFGSTY
FT                   GLSDLKNWGMLKENVKNQYDIKKNEYTITPLGKYVALLLKRINKEDLSDEELEFLNDYT
FT                   IFNELFEIPTLKFILKTLYHNSEFISSKEISNGVYKNLGISNFATNTEIKKLAVIGFLE
FT                   SYVTGSFIFATHSYRLNELGKKVYEHYNSNPEPITPPVKNEEIKKEISDTDQLAHEKGK
FT                   NFESYVMDNFFPKENFDLLHVTPDAETNEKRYVESSRKPDLQFRDKKTGKIFYVECKYR
FT                   SRLFNEKYVWAKNTEQAERYRNIEYLEEIPVYIAMGLMGTSDNPKKVFLMPLCNMENVA
FT                   IFLSVLKDYEIKEAKDVSKILNS"
FT   gene            481870..482130
FT                   /locus_tag="MmarC5_0525"
FT   CDS_pept        481870..482130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34839"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXB0"
FT                   /protein_id="ABO34839.1"
FT                   /translation="MPELEIRKNILKYLHEKGNYVTGGELADKINLQKDELKVHLDFLE
FT                   TGGYLKLNGAVGGISHISAITEKGKKMVENNEFKFQKPFLS"
FT   gene            482258..482623
FT                   /locus_tag="MmarC5_0526"
FT   CDS_pept        482258..482623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34840"
FT                   /db_xref="GOA:A4FXB1"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXB1"
FT                   /protein_id="ABO34840.1"
FT                   /translation="MNLVLIITLVVFAFSFRKVCNNIINDFSGYENSQNNKFIDVVESI
FT                   LLISSVVFYFVLVAFLGKGLSTFEVFQSQIPEVKIVSILILPLIAMYLFSVFASKQAVN
FT                   YSFKKELIKKRDVKKEI"
FT   gene            complement(482714..483121)
FT                   /locus_tag="MmarC5_0527"
FT   CDS_pept        complement(482714..483121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0527"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   dsy:DSY0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34841"
FT                   /db_xref="GOA:A4FXB2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXB2"
FT                   /protein_id="ABO34841.1"
FT                   /translation="MIQIVRDNFPGLETAEQLEDYKKTVIKNIERKTALFTKSDNGNIV
FT                   GVLIFSYYSKCLSCMAVHPDYRKMGIGYAMVKKMIDLFPKDMDISVTTFREGDLKGVAP
FT                   RAPYKKIGFLEDEFVEEFNYPHQKFIFRNRP"
FT   gene            complement(483323..483784)
FT                   /locus_tag="MmarC5_0528"
FT   CDS_pept        complement(483323..483784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0528"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: mmp:MMP1066 molybdopterin cofactor biosynthesis
FT                   protein MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34842"
FT                   /db_xref="GOA:A4FXB3"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR023047"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXB3"
FT                   /protein_id="ABO34842.1"
FT                   /translation="MLTHVDENGVKMVDVSKKKDVERICTAIGFIKLKKSTIEKITKKE
FT                   LIKGDVLTTAQVAGVMAVKNTSNIIPMCHPLPIESIKVNFEIFDDKIKAEARVKATYKT
FT                   GIEMESLTGVSVALLTIWDMVKAIEKDEFGQYPDTQIYGIEVVEKIKKE"
FT   gene            483882..484316
FT                   /locus_tag="MmarC5_0529"
FT   CDS_pept        483882..484316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0529"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="PFAM: protein of unknown function UPF0074;
FT                   Helix-turn-helix, type 11 domain protein; KEGG: mmp:MMP1065
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34843"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXB4"
FT                   /protein_id="ABO34843.1"
FT                   /translation="MKIDGLTERILTLLEKYSTTREIAAAMETHPKNIDRYIRVLRDLG
FT                   FVETKKGKTGGVFLTNEGRYVLKKKNINLITIKVQVVAEDKIGLLASISSRISEINGNI
FT                   LSTTLEKEGNKVRVWLVIENLEFNDLKDNLKDIADKVVLL"
FT   gene            484313..484876
FT                   /locus_tag="MmarC5_0530"
FT   CDS_pept        484313..484876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0530"
FT                   /product="putative adenylyl cyclase CyaB"
FT                   /note="TIGRFAM: putative adenylyl cyclase CyaB; PFAM:
FT                   adenylate cyclase; KEGG: mmp:MMP1064 RNA-binding region
FT                   RNP-1 (RNA recognition motif):adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34844"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXB5"
FT                   /protein_id="ABO34844.1"
FT                   /translation="MIEVEIKVSLMDEDSEKILEKLKSLGFEKNETKEQIDKYFNGIDR
FT                   DFQITDEALRIRKSLNLDTNEGTVYVTYKGKKLDNISKTREEIELEISEMDPMYKIFEK
FT                   LGFKPVDPVRKVREIYRKDDLEVSFDNVDYVGNYLEIEKVVDDDSKREQALEELLNLLK
FT                   SLNISTDKLEKRSYLELRRGNCGK"
FT   gene            complement(484986..486530)
FT                   /locus_tag="MmarC5_0531"
FT   CDS_pept        complement(484986..486530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0531"
FT                   /product="isopropylmalate/citramalate/homocitrate synthase"
FT                   /note="TIGRFAM: isopropylmalate/citramalate/homocitrate
FT                   synthases; PFAM: pyruvate carboxyltransferase; LeuA
FT                   allosteric (dimerisation) domain; KEGG: mmp:MMP1063
FT                   2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34845"
FT                   /db_xref="GOA:A4FXB6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011830"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXB6"
FT                   /protein_id="ABO34845.1"
FT                   /translation="MESYLDSNEIIKNSLKSMKLPEKVRVFDTTLRDGEQTPGVSLMPN
FT                   QKIDIAKHLSEIGVDAIEAGFPVSSEGEQESIKKITSMGLDAEICGLTRAVKKDIDIAI
FT                   DCGVDSIHTFIATSPLHREYKLKMSKEKIIDTAIEAIEYIKERGVIVEFSAEDATRTEL
FT                   DYLKEVYKKAVEAGADRINVPDTVGVMVPNSMNYLISELKKDIKVPLSVHCHNDFGIAV
FT                   SNSVAAVEAGAEQVHCTVNGLGERAGNASLEETVMTLNMVYGIETNVDTKMLTKLSRIV
FT                   SNYTGIKTQPNKAIVGENSFAHESGIHAHGVLAHALTYEPIDPAIVGNKRRIVLGKHSG
FT                   AHAIKSKLSEIGVEIGDNLSKEQFCDIVERVKAIGDKGKIVTDADVMAITEDITQRTLK
FT                   SERIVDLEQFAVITGNNVLPTASVALKVRDKIYKTSELGVGPVDAALKAIQAAVGENVR
FT                   LNEYNISAISGGTDAIAEVTVRLENHEKEVIAKATGDDVVKASVEAVIDGINKLMG"
FT   gene            complement(486599..488443)
FT                   /locus_tag="MmarC5_0532"
FT   CDS_pept        complement(486599..488443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34846"
FT                   /db_xref="GOA:A4FXB7"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXB7"
FT                   /protein_id="ABO34846.1"
FT                   /translation="MKKLITIFTILIAISPTFAFDLENNTEFESYVSITAPAVSITDEG
FT                   YVGTAVDIDVKVSDGEGHAYMDTLPLTDIDMQGSARIASKVAFDTCGKDSDDYDVYYII
FT                   RSDVPTVGGPSAGAVLTVATIAAINNWTLNKNVMMTGMIGPDGTIGPVGGILEKIEVGA
FT                   EKHVDYFLIPYGQRYQIDENNNSIDSIEYGKNLGINVVEVSNIYDAVYYFTNYEIETDY
FT                   KKNPMIDSKYNQIMEELSKITLENAKKNLEDVENLDLSILNSSEKQEFQENIQTASNLV
FT                   YLGNELDSNSNYYAGMSRSFNALVIFETLQSKYLCKNNESVKNYLLAVNESIREKKNYV
FT                   SNVTLTKNNIEYIFSSKSRIYEASELMDESFYQLDERNLTSALEYAAYAKLRAETGIWW
FT                   LELAPEEENPEEIDEKDLKYLSREYLDNSEIVVVYTSTVLSEELIAYPVTQIEDSIDLY
FT                   NEKEYLLAISKSIDAYVYSTTILDYTTDVDYLSALAEKKINRAENCVLNNENNSEYIPV
FT                   SALSYFEYAENLDDKYSKILYFKYSIAYAQMNMDILKEFDSDAFNYRKESVNYEIPGNS
FT                   NNLNLFGNDYKNYFINITYLITGMILGILIGVWYRKNN"
FT   sig_peptide     complement(488384..488443)
FT                   /locus_tag="MmarC5_0532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(488477..489094)
FT                   /locus_tag="MmarC5_0533"
FT   CDS_pept        complement(488477..489094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0533"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; KEGG:
FT                   mmp:MMP1061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34847"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXB8"
FT                   /protein_id="ABO34847.1"
FT                   /translation="MVFLQKEFYRTLKSFSKVELVFKGSLFIGYGKPIKSEIEAKEFIN
FT                   EIKSIHTDANHKVSAYRVDIENNLAMKYDDDGEPQGSAGKPIYKVIELKNLQNTVIVVT
FT                   RYFGGVKLGYGGLVKAYSDTATEVVNSSGILEIFEKVHILAEFDYSEIQKVKQIVENFG
FT                   KIVDENYSDVVKFNMEVKKGLEDELIKKLVNLTKNKIKIDNL"
FT   gene            complement(489136..490566)
FT                   /locus_tag="MmarC5_0534"
FT   CDS_pept        complement(489136..490566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0534"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: mmp:MMP1060 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: cysteinyl-tRNA
FT                   synthetase, class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34848"
FT                   /db_xref="GOA:A4FXB9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXB9"
FT                   /protein_id="ABO34848.1"
FT                   /translation="MLKVYNTLTRKEEEFKPLTEKEVKMYVCGPTVYDHTHFGHGRTYV
FT                   SFDIIRRYLEHIGYTVNLVINFTDIDDKIIKRANEKGKNPQELSEQFINVFLNDMATLK
FT                   VKPADIYPKVTEHIPEIIAFIEKLIEKGFAYKTENGVYFEVKKFENYGKLSNINLEDLY
FT                   SGVRIETSEKKKNPEDFALWKTAKPREPKWESPFGEGRPGWHIECSAMSSKYLGKQFDI
FT                   HGGGRDLSFPHHENEIAQSVAYSGKDWVNYWLHTGFVMVNGEKMSKSLGNFVTIEDISK
FT                   EYDPEILRFFFIQRHYRSPIDYTAESMTHVKNNLEKIYNVIENIRISLEKSKKSGAWGE
FT                   NEFLLYDILKNSKHNFYEAMNSDFNTVEALKSVFEVSNGVNKYLSLVETPSEGLLLKAF
FT                   DFFKIVGEIFGLFENYFKTSSESNDEEFIKFLIELRSDLRLQKNYEMSDKIRDGLKNIG
FT                   YLIEDNPKEGTIFKKINI"
FT   gene            complement(490577..492028)
FT                   /locus_tag="MmarC5_0535"
FT   CDS_pept        complement(490577..492028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0535"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   mmp:MMP1059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34849"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXC0"
FT                   /protein_id="ABO34849.1"
FT                   /translation="MENLENYFDVVIIGAGPAGLFAAYELSKYDKLKTLVIDKGKDVLD
FT                   RYCAADKLKKCIKCEPCQIMYGVGGAGGLSDGTLNLRPDIGGNLFDLTDDENYAWQLIF
FT                   EVDKIFLTHGGPKKLSKGSFEKIKSLQRRSAQNGVRFIPIIQRHIGSDHTKHLINNIKN
FT                   TLQNRGISFLLNTEVLEFEKNKVFVNNFGKGELIKTKYIIVAPGRGNADWFLKISEKIG
FT                   LKANHGPIDVGVRVEVPSIIMESITEINHDPKFHIYTNTYDDFVRTFCTNPYGFVVEEN
FT                   YGDIVGVNGHSMADKKSENTNFSFLTRIELTEPVENTTSYGKSIAKLTTTLGGGKPLLQ
FT                   RLGDLKRGRRSTWDRLKKSSFDPTLKQITPGDIAMALPHRIVTNIIEGLEKLDKVIPGV
FT                   SDDHTLLYAPEIKYYAMKTNVNSDLETSVSDIFVAGDGAGLSRDVTNACATGILAARGI
FT                   LKKEGFEDTFNDESANWQDKIETME"
FT   gene            492159..492235
FT                   /locus_tag="MmarC5_R0012"
FT                   /note="tRNA-Ala1"
FT   tRNA            492159..492235
FT                   /locus_tag="MmarC5_R0012"
FT                   /product="tRNA-Ala"
FT   gene            complement(492254..493222)
FT                   /locus_tag="MmarC5_0536"
FT   CDS_pept        complement(492254..493222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0536"
FT                   /product="Protein of unknown function DUF1722"
FT                   /note="PFAM: protein of unknown function DUF523; Protein of
FT                   unknown function DUF1722; KEGG: mmp:MMP1058 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34850"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="InterPro:IPR017087"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXC1"
FT                   /protein_id="ABO34850.1"
FT                   /translation="MRNFKKPDVLISKCIEHGRCRYDGQMISSYFVKNTKKYFNYVSVC
FT                   PEVEIGLSIPRNSLKIVFENGKFEFVQNITYKNYTSEIMQFSSDFLDSIENIDGAILKH
FT                   KSPSCGIKNVKVYTPKGNPANQKTTGFFGNEVLNRYSNIPIEEESRLRNKRIKDHFLTK
FT                   LYTIKDFKEVKESESIKELVEFHTNNKFLFMAYNQKQKDFLGNTVGNHNKNFDKIIKIY
FT                   EKHLQLLLKRPSSIGSNINVLMHIFGYISNKLSKDEKSLFIDSLQRYHNELDCLCVPII
FT                   LLKSWVIRFNVDYLKKQTYFEPFPSELADNSEIFKRDYWKD"
FT   gene            complement(493287..494489)
FT                   /locus_tag="MmarC5_0537"
FT   CDS_pept        complement(493287..494489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0537"
FT                   /product="protein of unknown function DUF181"
FT                   /note="PFAM: protein of unknown function DUF181; KEGG:
FT                   mmp:MMP1056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34851"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR017667"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXC2"
FT                   /protein_id="ABO34851.1"
FT                   /translation="MEDDINYTLAAYRICTPEETFEKIEPIIKEIGVTRTARIDGLDRI
FT                   GIPVFSSIRPSAKDGAISVYAGKGATEIQAKVSSTMEAIERYSAEFDENSKLELSKEPE
FT                   NPVNLDDLIIPGGKSAEHIDTDGIEWVLGKDIISGKTFDVPINSVVHPHDGKKLFRSNT
FT                   NGLASGNSEEEAVFHGMLEVIERDAWSISELSKNTYRKLNVENAKNPLIFELLEKFKKA
FT                   KINIILKDLTSEVGIPTVAAISDDDVLKDPALLCMGVGCHLHPEIAVLRALTEVAQSRA
FT                   TQIHGAREDTNRGDIVRRISYERLKRAHKKWYTFKNEIHIEDMPNNAKLNLNKDIETVK
FT                   ETLKQHGFDKIITVKLNKTEIDVSRVIIPKMEMYSVDRDRISLWIKDRIRRNLESNLNL
FT                   I"
FT   gene            complement(494512..494817)
FT                   /locus_tag="MmarC5_0538"
FT   CDS_pept        complement(494512..494817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0538"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   mmp:MMP1055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34852"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXC3"
FT                   /protein_id="ABO34852.1"
FT                   /translation="MIEKIVKESEKGILIDIEVTTNAKKNEIGKINEWRKRIEIRIKEQ
FT                   PIEGKANKAIMKFLKGIFKSEILINSGTTSAQKTVLIPDKTKDDIVKILKKEIKSI"
FT   gene            494949..495503
FT                   /locus_tag="MmarC5_0539"
FT   CDS_pept        494949..495503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0539"
FT                   /product="CoB--CoM heterodisulfide reductase subunit C"
FT                   /note="KEGG: mmp:MMP1054 heterodisulfide reductase; subunit
FT                   C2"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34853"
FT                   /db_xref="GOA:A4FXC4"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017680"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXC4"
FT                   /protein_id="ABO34853.1"
FT                   /translation="MMKAEELNKGFVNEIIEAGTPVPGEKEVASLKSCYQCGTCTGSCP
FT                   SGRRTAYRTRKVIRQALLGIDSVLDSDDIWKCTTCYTCYERCPRDVKVTEIIKTIRNLA
FT                   AKKGNMATPHKMTAVYVLKAGHAVPANDDTAKLRKSIGLAEKAPIAQFSQKDMDEIRTI
FT                   AKNLKFDELIGFDWKTMGLKQ"
FT   gene            495538..496419
FT                   /locus_tag="MmarC5_0540"
FT   CDS_pept        495538..496419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0540"
FT                   /product="CoB--CoM heterodisulfide reductase subunit B"
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region domain protein; KEGG: mmp:MMP1053
FT                   heterodisulfide reductase; subunit B2"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34854"
FT                   /db_xref="GOA:A4FXC5"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017678"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXC5"
FT                   /protein_id="ABO34854.1"
FT                   /translation="MKYAFFLGCIMPNRYAGVESATRTVMEKLGVELVDMPGASCCPAP
FT                   GVFGSFDQKTWLTLAARNLVIAEEMGTDIVTVCNGCYGSLYEAAHMLHENKEALAMVNE
FT                   QLKEVGKEYKGTVHVRHFAELIYNDLGVDKIRENVVKPLSVNIGVHYGCHFLKPTSAKG
FT                   LGGAENPTMLDELVEATGAKSVAYKDKMMCCGAGGGVRAKELDLALSMTQEKIENMLAV
FT                   GADATVNVCPFCQLQFDRGQVEIKEKLGKEYGFPVVHLSQLLGLAMGMEPKDVALDVNF
FT                   ISPEPLLQKLGY"
FT   gene            complement(496466..497275)
FT                   /locus_tag="MmarC5_0541"
FT   CDS_pept        complement(496466..497275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0541"
FT                   /product="Helix-turn-helix, type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix, type 11 domain protein;
FT                   SMART: regulatory protein, Crp; KEGG: mmp:MMP1052 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34855"
FT                   /db_xref="GOA:A4FXC6"
FT                   /db_xref="InterPro:IPR012015"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXC6"
FT                   /protein_id="ABO34855.1"
FT                   /translation="MKKRNITEFQILSEVVRKQPHIKQKEIADILGITVQGVSEHMRNL
FT                   IREEQIKNRGRGEYVITEKGMASLKTWISDFKNYLNDVNQNLYRYKDVWPAIASENVNP
FT                   GETVGVYMKKGVIYVSKNIESDATAKVFYGGNSGEDVAIHEIQGHIDVQNGKVIFLKIP
FT                   SEVMGGSRNVDYDIVKSTFEEYPDAVVATAGTVGTVIVNKLEIHPDIRFAVSEGIVSAC
FT                   NRGCDVIAIITGKMAEKIIKTVDKNKISYTLLNASKTTDSYEQPMFS"
FT   gene            497707..498501
FT                   /locus_tag="MmarC5_0542"
FT   CDS_pept        497707..498501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0542"
FT                   /product="3'-nucleotidase"
FT                   /EC_number="3.1.3.6"
FT                   /note="KEGG: mmp:MMP1051 survival protein SurE; TIGRFAM:
FT                   stationary-phase survival protein SurE; PFAM: Survival
FT                   protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34856"
FT                   /db_xref="GOA:A4FXC7"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXC7"
FT                   /protein_id="ABO34856.1"
FT                   /translation="MTMEILLVNDDGIYSNGLLALKNVISEEFDANITVVAPTNQQSGI
FT                   GRAISLFEPLRITKTKLADCSEGYAVSGTPTDCVVLGVHQVLKKVPDYVISGINIGENL
FT                   GTEITTSGTLGAAFEGAHHGAKALACSLQVTTDHLKFKEGESPIDFMNTARIVRNVFKK
FT                   FIDDEFPCDVININVPDNATENTPVEITKLAKKMYSMHVEERIDPRSRSYYWLDGYPIM
FT                   DEEDGTDVYAVRNKRNVSVTPLTLDNTAKNLDEFKEKYAKKF"
FT   gene            498643..499224
FT                   /locus_tag="MmarC5_0543"
FT   CDS_pept        498643..499224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0543"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   mmp:MMP1050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34857"
FT                   /db_xref="InterPro:IPR002790"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXC8"
FT                   /protein_id="ABO34857.1"
FT                   /translation="MALLIDGPNMLRKEFNVDLDKVRDALEQFGDIVVGRVYLNQYASD
FT                   KLIEAIANQGFEPRISAGDVDVEMAVDGTELIFNKNLDTLVYMTRDADFLPAIRKAKER
FT                   GKQIIVVGAEPGFSTAIQNIADHVIRVEEDFELDKEKLEQKKREREHSISSSESASEEN
FT                   TEVQKNSEPKKSSTDSFKDGISNSINWLKK"
FT   gene            complement(499267..499536)
FT                   /locus_tag="MmarC5_0544"
FT   CDS_pept        complement(499267..499536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0544"
FT                   /product="membrane-bound hydrogenase subunit ehbB"
FT                   /note="PFAM: multiple resistance and pH regulation protein
FT                   F; KEGG: mmp:MMP1049 related to EhbB of Methanothermobacter
FT                   thermautotrophicus"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34858"
FT                   /db_xref="GOA:A4FXC9"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXC9"
FT                   /protein_id="ABO34858.1"
FT                   /translation="MNEYVLYFTMISLVFGAFSALKLAFRKETSNVLIGEGLMAVIIAT
FT                   FLVILAEIYSIAYVETVALLLLVCGPIGTIAFSKCMKKETSSDL"
FT   gene            complement(499734..500123)
FT                   /locus_tag="MmarC5_0545"
FT   CDS_pept        complement(499734..500123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0545"
FT                   /product="Protein of unknown function DUF61"
FT                   /note="PFAM: Protein of unknown function DUF61; KEGG:
FT                   mmp:MMP1048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34859"
FT                   /db_xref="InterPro:IPR002746"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXD0"
FT                   /protein_id="ABO34859.1"
FT                   /translation="MDKEVYKFLHNLKSNFKRKTLNELLKEDKPYLIVNGQRHRIKKKE
FT                   LEFIKENISNDIRLPLILEVDSSYDSGTVKIEGIEEVKLISKILGKGVSLFSEESILYI
FT                   YKPELREVRRKLPTTTQYLFRIGLN"
FT   gene            complement(500180..500545)
FT                   /locus_tag="MmarC5_0546"
FT   CDS_pept        complement(500180..500545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0546"
FT                   /product="Protein of unknown function DUF22"
FT                   /note="PFAM: Protein of unknown function DUF22; KEGG:
FT                   mmp:MMP1047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34860"
FT                   /db_xref="InterPro:IPR002572"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXD1"
FT                   /protein_id="ABO34860.1"
FT                   /translation="MFRITGKIKEIEDKIEGKKQEGAKLEIVGQKVPVFAAETVELKAG
FT                   EIKAVNINKICLPKKTVLMPSAYIQHKLGNMVSLGEETPVPFEHERCLEYAIFVAVKEG
FT                   TIKEGELIGTIVVLHAE"
FT   gene            complement(500567..501202)
FT                   /locus_tag="MmarC5_0547"
FT   CDS_pept        complement(500567..501202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0547"
FT                   /product="V-type ATPase, D subunit"
FT                   /note="TIGRFAM: V-type ATPase, D subunit; PFAM:
FT                   H+-transporting two-sector ATPase, D subunit; KEGG:
FT                   mmp:MMP1046 A1A0 ATPase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34861"
FT                   /db_xref="GOA:A4FXD2"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXD2"
FT                   /protein_id="ABO34861.1"
FT                   /translation="MADVNPTRMELLKLKGKIKLAEKGHKLLKQKRDALMMEFFEILDQ
FT                   ASGIRDKVNDALSQAYKDLIMAQAVMGTLSVKEASFAAKNNNIDLDVDMRNIMGIDVPV
FT                   FEISNVKRDISNRGYSPYGVSSKLDEAAKNFEEALELIAELAEIETSIKLLAQEIITTK
FT                   RRVNALEYVVIPKMNETKKYIAMRLEEMERENFFRLKIIKARMDAKEA"
FT   gene            complement(501249..502637)
FT                   /locus_tag="MmarC5_0548"
FT   CDS_pept        complement(501249..502637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0548"
FT                   /product="Sodium-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.15"
FT                   /note="PFAM: H+-transporting two-sector ATPase, alpha/beta
FT                   subunit, central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein; KEGG: mmp:MMP1045 A1A0
FT                   ATPase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34862"
FT                   /db_xref="GOA:A4FXD3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXD3"
FT                   /protein_id="ABO34862.1"
FT                   /translation="MDAMQKTIEYTSVSRIAGPLMVIDGIEGIAYGEIVDITTPNGDKR
FT                   TGQVLEAREEIAVVQVFEGTSELNTSETKVRFTGDTAKIGVSHDMLGRIFNGAGKPLDG
FT                   GPEIIAEKKLDINGYPLNPVSRNPPNAFVQTGVSTIDGTNTLVRGQKIPIFSGSGLPHN
FT                   KLATQIARQAKVRGEGEQFAVVFAAMGITGEESNYFMDEFKKTGALEKAVVFINLADDP
FT                   AIERILTPRIALTTAEYLAYEKGMHVLVILTDLTNYCEALREIAAARNEVPGRRGYPGY
FT                   MYTDLACLYERAGRVKGKEGTVTQIPILTMPDDDITHPIPDLTGYITEGQIVLSRELNR
FT                   KGIYPPVDILPSLSRLAGNGQGEGKTRDDHSKVISQAYAAYAEGRGLRDLVAVVGEEAL
FT                   TERDRSFLKFADAFENSIVTQGVDEDRSIEETLDYIWGLLTILPREELKRVSDELIEKY
FT                   LPKK"
FT   gene            complement(502672..504432)
FT                   /locus_tag="MmarC5_0549"
FT   CDS_pept        complement(502672..504432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0549"
FT                   /product="ATP synthase, A subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: mmp:MMP1044 A1A0 ATPase, subunit A; TIGRFAM:
FT                   ATP synthase, A subunit; PFAM: H+-transporting two-sector
FT                   ATPase, alpha/beta subunit, central region; H+-transporting
FT                   two-sector ATPase, alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34863"
FT                   /db_xref="GOA:A4FXD4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005726"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXD4"
FT                   /protein_id="ABO34863.1"
FT                   /translation="MVVGKIIKISGPVVVAEGMKGSQMFEVVKVGNEGLTGEIIQLTED
FT                   EAIIQVYEETAGIKPGEGVEGTGAPLSVELGPGMLKAMYDGIQRPLNEIENATDSIYIP
FT                   RGVSVPSISRDIKWDFEATAAVGDEVITGDVIGTVQETASIVHKIMIPLGISGKIKEIK
FT                   SGSFTVEETVAVVETAEGEKEVQMMQKWPVRKPRPSKGKQPPVIPLITGQRVEDTFFGV
FT                   AKGGAAAIPGPFGSGKTVTQHQLAKWSDVDVVVYIGCGERGNEMTEVIEEFPHLDDIKT
FT                   GNKLMDRTVLIANTSNMPVAAREASVYTGITIAEYFRDQGLGVLLTADSTSRWAEAMRE
FT                   ISGRLEEMPGEEGYPAYLSSKLAQFYERAGRVQCLGSEDKHGFVCIVGAVSPPGGDFSE
FT                   PVTSNTLRIVKVFWALDANLARRRHFPAINWLTSYSLYIDDIAGWWQENTAADWRSLRD
FT                   EAMTLLQKEAELQEIVQLVGPDALPDRERVILEIARMLREDFLQQDAYHEVDSYCSPLK
FT                   QYNMLKIIMTYYTKALDAVAKGADPAGISAVTVKGDIARMKYLTDDEFINTKVPEIINK
FT                   MESELGALIK"
FT   gene            complement(504448..504747)
FT                   /locus_tag="MmarC5_0550"
FT   CDS_pept        complement(504448..504747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0550"
FT                   /product="Vacuolar H+-transporting two-sector ATPase, F
FT                   subunit"
FT                   /note="PFAM: Vacuolar H+-transporting two-sector ATPase, F
FT                   subunit; KEGG: mmp:MMP1043 A1A0 ATPase, subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34864"
FT                   /db_xref="GOA:A4FXD5"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR022944"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXD5"
FT                   /protein_id="ABO34864.1"
FT                   /translation="MRIGVVGDPDVVVGFRLAGLTDVYEVKSPEQAAKAIEELNSNSEI
FT                   GLIITTERIGEQVRDTISAVKKVVVEVPDKNGPIVRENDPVKVLVRNAVGVDIK"
FT   gene            complement(504769..505944)
FT                   /locus_tag="MmarC5_0551"
FT   CDS_pept        complement(504769..505944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0551"
FT                   /product="H+-transporting two-sector ATPase, C (AC39)
FT                   subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, C (AC39)
FT                   subunit; KEGG: mmp:MMP1042 A1A0 ATPase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34865"
FT                   /db_xref="GOA:A4FXD6"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR014272"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXD6"
FT                   /protein_id="ABO34865.1"
FT                   /translation="MVDALTQLMEIAGMPTDIFMTLFVLAGIAIFLVIMIFLIRYLSET
FT                   APFAYVNARVRSMESRLLKDHKINELIESAGTTELIGFLEDTDYGPYLSEVMGQSEDPV
FT                   VVEKALDIHLAHVYQTLANISPDGARKILKLLEKKFDVKNIKTLLRAKYVGLDAEETFK
FT                   LLIPLGTIPESKLRELSETKAIEEIVSALEGTGYSSVLSEGLTQYEQNGKLTTLEMSLD
FT                   KLILENLWKNVSVDGTEKDLFKEFIGTMIDIENLKIILKGKADGLSSEAISNYTTSKGY
FT                   ELASWKLKELADVESIEGVISSLEGTKYAPLMTENLEEFEKVKSVYVFEKALDSYLVKM
FT                   GKKLSLRQPFGIGPIIGLITSKELEIRNLKIIIKGKIEGLSASEIREILVS"
FT   gene            complement(505955..506566)
FT                   /locus_tag="MmarC5_0552"
FT   CDS_pept        complement(505955..506566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0552"
FT                   /product="H+-transporting two-sector ATPase, E subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, E subunit;
FT                   KEGG: mmp:MMP1041 A1A0 ATPase, subunit IE"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34866"
FT                   /db_xref="GOA:A4FXD7"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXD7"
FT                   /protein_id="ABO34866.1"
FT                   /translation="MGAEKITSKIVEDANKNAEKILAEALNEKEAILTEAKEEASTKEQ
FT                   AIAKKGEKDAEMTKNRILAEARLSAKKKLLEEREKTIQLTLEKLEEDLVKLPQKEEYKD
FT                   ILLKMIISGVYSVGGGELELLLNKKDFEIIDDSTLWALEKEMEDRLKKVTVLKKGEAKS
FT                   IIGGCIIKTADQTKVSDNSLEATFERNLDSVRAKIAEMLF"
FT   gene            complement(506628..507296)
FT                   /locus_tag="MmarC5_0553"
FT   CDS_pept        complement(506628..507296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0553"
FT                   /product="H+-transporting two-sector ATPase, C subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, C subunit;
FT                   KEGG: mmp:MMP1040 A1A0 ATPase, subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34867"
FT                   /db_xref="GOA:A8B1G3"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:A8B1G3"
FT                   /protein_id="ABO34867.1"
FT                   /translation="MVFENPLLLGAIGAGLAVGIAGLGSGIGAGITGASGAGVVAEDPN
FT                   KFGTAIVFQALPQTQGLYGFLVAILILFVFKSAPEWAMLAAGIGTGLAGLSAIGQGIAS
FT                   AAGLGAVAEDDGIFGKAMVFSVLPETQAIYGLLVAILLLVGVFASPGVTTIAALGAGLA
FT                   VGFAGLSGIGQGITAAGAIGATARDPDAMGKGLVLAVMPETFAIFGLLIAILIMLGIMF
FT                   "
FT   sig_peptide     complement(507171..507296)
FT                   /locus_tag="MmarC5_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.883) with cleavage site probability 0.286 at
FT                   residue 42"
FT   gene            complement(507352..509421)
FT                   /locus_tag="MmarC5_0554"
FT   CDS_pept        complement(507352..509421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0554"
FT                   /product="V-type ATPase, 116 kDa subunit"
FT                   /note="PFAM: V-type ATPase, 116 kDa subunit; KEGG:
FT                   mmp:MMP1039 A1A0 ATPase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34868"
FT                   /db_xref="GOA:A4FXD9"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXD9"
FT                   /protein_id="ABO34868.1"
FT                   /translation="MVLLRPARMNKIRAVILDEKVDPVIRQLHESGLVELYDLSTKLED
FT                   PEWNALMLPAPSAEYGRNVASLTIKVSRILDLFSNVSVGEKAGLSGVLNPKVPAKKKLS
FT                   FSSSEEITSYIENVLESVEGEISEPASKLAELENRKTILETLKDSVKYLSGFDLDLKFL
FT                   GEGSYTYIVSGLVSQENMSELESSLEEATEGYVEIVKGNPVNKSEKEQKIPVIVATLKQ
FT                   CADVVGAELRKSGFERLDIANVEGTPSEIFNDTEKELLGIENETKAILEKLNALSQKWT
FT                   DEVLVLHEVLEIEKERAEAYSMTGKTERTHLIEAWTPKKHVKKVQEIIESASEGYAVVE
FT                   VSEPDEPVERIPVMLDNAKAVKPFEMLTEMYAPPKYNEIDPTMMIMPGFLIFYGIMLTD
FT                   AVYGLLLTLAGLVLWTRMGKVSSGAYNLGYILTLSGLSTVFFGILTGGYLGDFMYQFLG
FT                   MDIYTTGFALVNPLGESTYISAAKPLLSLGGIDVNNGPMAILLFSIVAGIIHLFIGLTV
FT                   GLKESLSNGSVLDAFLNQGMWILLILAIVATVVTGNMMIAGGAVIAVIALCMIKGFMNG
FT                   GILDALLGAMDITGFLGNVLSYARLLALCLATGGLAMAVNIMAKLLGDAVPVIGILIAV
FT                   VMLVFGHAFNFVMNGLGSFIHSLRLHYVEFFGQYYEGGGKKFSPFKAKREYTSN"
FT   gene            complement(509446..509754)
FT                   /locus_tag="MmarC5_0555"
FT   CDS_pept        complement(509446..509754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0555"
FT                   /product="A1A0 ATPase, subunit H"
FT                   /note="KEGG: mmp:MMP1038 A1A0 ATPase, subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34869"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXE0"
FT                   /protein_id="ABO34869.1"
FT                   /translation="MSAIDTIREIKHAENNAVNAIEEAKKKAAEIKLAAIEEGKNIISE
FT                   AETTAEASAKELVSKYEKEAKEQADEIMAKEDKAIAEMANIAKVKILNIKLEDVIEF"
FT   gene            complement(510246..510725)
FT                   /locus_tag="MmarC5_0556"
FT   CDS_pept        complement(510246..510725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0556"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   mmp:MMP1037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34870"
FT                   /db_xref="GOA:A4FXE1"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXE1"
FT                   /protein_id="ABO34870.1"
FT                   /translation="MNITIISVGKIKEKYLSDAINEYSKRISRYSKLDIIEVADEKTPE
FT                   SPSDVEKSKILEKEAERILKHLKKDSFVITLEILGKEVTSESLAKKINDLSISGKSDIT
FT                   FIIGGSLGLSKNISEISDFKLSFSKMTFPHQLMRVILLEQIYRSFRIINGEPYHK"
FT   gene            complement(510805..511611)
FT                   /locus_tag="MmarC5_0557"
FT   CDS_pept        complement(510805..511611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0557"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: mmp:MMP1036 band 7
FT                   protein:stomatin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34871"
FT                   /db_xref="GOA:A4FXE2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXE2"
FT                   /protein_id="ABO34871.1"
FT                   /translation="MSFWLNLLFGIFILVLIIKSVIIVNQFELGLVFRLGKVRGRLNPG
FT                   VNFIIPFIDVPIKVDVRTKVIDVPPQEMITRDNAGVRIDAVIYYRVMDVNRAILEVQNF
FT                   QYAIINLAQTSLRAIIGSLELDDALNKREYINSQLLETLDRDTDAWGVKVEKVELREIE
FT                   PPTDIKNAMTQQMKAERLKRAAILEAEGEKQSKILKAQGSAESMKIEAEGQAKAIQIVA
FT                   ESAQTYFKNEAQLYKALDVTTNTLKDNTKFVISENIMDVAKKFIKQ"
FT   gene            complement(511661..512074)
FT                   /locus_tag="MmarC5_0558"
FT   CDS_pept        complement(511661..512074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0558"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   mmp:MMP1035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34872"
FT                   /db_xref="GOA:A4FXE3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXE3"
FT                   /protein_id="ABO34872.1"
FT                   /translation="MELGYITIIIGMGLIVLEAFLPGLNFPVAGVAVLIYGIFLLYAPE
FT                   FALPSAILAGLITAYIMKRFVYKTGLNVKIGAENLIGEHGDLVDEIGENNYGHVIIHGE
FT                   KWQAKSEIPIKKGSKVIVTGIEGVSLLIEELSE"
FT   gene            complement(512148..512747)
FT                   /locus_tag="MmarC5_0559"
FT   CDS_pept        complement(512148..512747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0559"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: mmp:MMP1034
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34873"
FT                   /db_xref="GOA:A4FXE4"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXE4"
FT                   /protein_id="ABO34873.1"
FT                   /translation="MNKFIVFEGIDGCGKTTQAKLIAEKLNAKFTFEPTDGKIGKSIRE
FT                   ILSGSQCQKETLALLFAADRVEHVFNIEEDLKKSHVVSDRYVYSSIIYQISQGISKDFI
FT                   YTINDYAKTPDLVVLLDVDLNEALKRMESREKEIFEKIEIQKKIKEGYYNLINSEDKKF
FT                   MPKYGFIIVNTTSKSIHQVFDEILNAIIDKIPDIIQ"
FT   gene            complement(512771..515701)
FT                   /locus_tag="MmarC5_0560"
FT   CDS_pept        complement(512771..515701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34874"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXE5"
FT                   /protein_id="ABO34874.1"
FT                   /translation="MNIKRIVSDLKKESWYTKLDAVNRLGNITYETQDDADYVLKNLLI
FT                   ELESPKTVMQARTLWAINNIIKQHPQLTYKIIPHLLRLSNCENNAIKEISNELLSKPLI
FT                   KYAVARYSTLLSKSMHSEEYYEKLGAIVNIWKMAPVDPELIDTLLPELIESITDKSHLK
FT                   IGIFSWILMESEDNETIDEIVDLINKVYLHLDFNAQYPPSYIKKLINNPDRVMKLVGTS
FT                   LIEKNPENINNEIMEDLLKLFTSPNTDRYVKARMFYTIGSLSENKPYLKNILLHEANKI
FT                   INNEKDWLLIFSALVGFYCIREKITNSELLNHSNPLIRAIAIQLIDSRSSEQILSCFSD
FT                   SHITTYLSVIDRLIKSDISDDVKLKFLNEISNPDNYPYVTENIDENSATRLKDSVGDIV
FT                   HSWDSEHWISKINLMNDLGNLAKNNPEYIDNSIELIIKSMEDHYGMVRAQGLWIVRAIL
FT                   HNSEDPFHILESLDGHLEPLLKINDPNVFVRLNYVLILRSFSQYLKGIEGCEDKLSELA
FT                   GYLLYIALNDTTKIVSEVAKLILKYDFDTELNKKDITLDNFENYLEAFPYSAVGIIKYL
FT                   LRKNQGSEKVVSMLVDRCRKYYSYGCDIFCILYGIDINVSSEEVYENLKGYTTYINEES
FT                   QNSIKMLIKMHLTENNWKVRMEGISILEKLSILNLEFIEYFLTDLIDIALFDKIFEIRE
FT                   HAGELLKKINYGGPEINKEISLNYFFKKSDELMEIIKNGGSGIDEAFYTLSVRKKEIDN
FT                   IENLMTVVSKFKNDENWHRRVYAYKILENLLEYPRADHYHYEIINWCLECTEDPNPIIS
FT                   KIAKDILEKLGRTVQPSSQKTAYDRIRRIENLLESGDWTVKVEALQSVRDFINEGHYGY
FT                   LDIVMEKLDDPHWKVKNAALGILADIDPDLIKPAIPKIISLLNDGDESVILKTLLTLKK
FT                   FGQKDSKLLEKVMPILEKLENYGTWSIKEEIMRLKLSYYNKLRQKH"
FT   gene            515856..517784
FT                   /locus_tag="MmarC5_0561"
FT   CDS_pept        515856..517784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0561"
FT                   /product="nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; KEGG: mmp:MMP1032 replication protein
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34875"
FT                   /db_xref="GOA:A4FXE6"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXE6"
FT                   /protein_id="ABO34875.1"
FT                   /translation="MNIDKLKQKILSKINQEELEKKVKEKIEENSGLLGEESAVMLVAQ
FT                   ELGIEITYEDDEEEYDFTIKDIADGQKNVEVTGKIIEISPEKEFNRKDGSTGKIASITI
FT                   GDNTGITRLTLWNDKTDLIEGLKKGDVVKIENAFSRKWNDKVELNSGSELSIDKLKKYD
FT                   ESRYPILKESYKISELMPNFSGTINAEVVAAYPKKEFNRKDGTKGQLKSLILKDDSGGI
FT                   RGTLWNELADFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIVEESVKEEKPVEKMNISE
FT                   LTSFDGEYVTISGNITNISGSREVQFSDRNAEVQDMYLNDGTGMVKIAFWGPNRNILND
FT                   LKEGDYLNVSNCKLRTYTDNTGEKRADLTYNYMSELKKDESASEKIVEKITAIGDILSG
FT                   SADSSDVTVIGMVTNAYPVNEFSRSNGGTGKVRNIMLDDSTGSIRMALWDGDAETEISE
FT                   GDVVKLIHGYAKESGEYMDLSTGRFGRIEVNPEGISIKSPRNYIADLEEGISTEISGTV
FT                   VDYRKQDVILSLCPNCRKRVSLVDNKYTCEVCGEVTPNELLVSNLTLDDGTGVINCRIY
FT                   GNNVEKITELSKDKLKEMNLDALSNVLGKDVLFYGTPSFRNDDLEFAVKRVNFADASKE
FT                   LEVLKQL"
FT   gene            517909..518487
FT                   /locus_tag="MmarC5_0562"
FT   CDS_pept        517909..518487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0562"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="KEGG: mmp:MMP1031 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34876"
FT                   /db_xref="GOA:A4FXE7"
FT                   /db_xref="InterPro:IPR023477"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXE7"
FT                   /protein_id="ABO34876.1"
FT                   /translation="MKNKVVVVTGVPGVGGTTVTQKAMDILSEEGLTYKMVNFGSAMFD
FT                   VANEEGIASDRDQMRKLDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVKTPKGYLPG
FT                   LPAWVLTELNPDIVIVVETDGDEILMRRLSDESRKRDLETTASIEEHQFMNRAAAMSYG
FT                   VLTGATVKIVKNKNGLVDNAVEELISVLR"
FT   gene            518551..519147
FT                   /locus_tag="MmarC5_0563"
FT   CDS_pept        518551..519147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0563"
FT                   /product="protein of unknown function DUF106,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF106,
FT                   transmembrane; KEGG: mmp:MMP1030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34877"
FT                   /db_xref="GOA:A4FXE8"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR038978"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXE8"
FT                   /protein_id="ABO34877.1"
FT                   /translation="MFESIYSVFYNALDAIFLPMVQTMQPAIFIFVTAFLVSFIINLAT
FT                   KILVNQDRMAELKDELQEFQVKAKKASKDPELMAELQKEQQKMMTMQMEMMKMSFKPMI
FT                   YTWVPIIIIFAYLRHVYDFGGIYHTMMPAWDGAIVQLPVIISKIIFIGIWHWIGGIFYH
FT                   GGFGVVSNTTLGWLGWYILCSMGTSMVLRKLMGIK"
FT   gene            519316..520047
FT                   /locus_tag="MmarC5_0564"
FT   CDS_pept        519316..520047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0564"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: mmp:MMP0455 probable amino-acid ABC transporter;
FT                   TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34878"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXE9"
FT                   /protein_id="ABO34878.1"
FT                   /translation="MLKFKIPIILTAFLVLISGCLSNSESLEKETLVVGITPEIYPINY
FT                   MNSGVHSGFEIEYITEIVNRMNMKPEFRVYEFMNLLNAVETDRVDCAISLITITPEREE
FT                   LVMFSKSYLNTTSVHVVDKNTGIETLDKCTVGVIKSTVQDECATKLKENYEFTLYKYRT
FT                   TAELERAFDQGKVNAMIVDKLYFEYVLYPKNNNLTSIFECQNSENISIAVNNENTELLN
FT                   DINNVITEMEEDGTYDNLKNK"
FT   sig_peptide     519316..519390
FT                   /locus_tag="MmarC5_0564"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.446 at
FT                   residue 25"
FT   gene            complement(520066..520425)
FT                   /locus_tag="MmarC5_0565"
FT   CDS_pept        complement(520066..520425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0565"
FT                   /product="putative hypothetical protein"
FT                   /note="KEGG: mmp:MMP1029 putative hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34879"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXF0"
FT                   /protein_id="ABO34879.1"
FT                   /translation="MKNTIQRSFEIKDYRIPKTDFGDFWMTFETKEKLKTKITYIPENG
FT                   GKFSAMDVKSAVEEIISKSKYFKENLPKNIKVEVLFKNLSNGCYNPTENNIPDFEFKEM
FT                   DEISVLFYFIVDYYL"
FT   gene            complement(520513..522555)
FT                   /locus_tag="MmarC5_0566"
FT   CDS_pept        complement(520513..522555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0566"
FT                   /product="protein of unknown function DUF814"
FT                   /note="PFAM: protein of unknown function DUF814;
FT                   Fibronectin-binding A domain protein; KEGG: mmp:MMP1028
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34880"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXF1"
FT                   /protein_id="ABO34880.1"
FT                   /translation="MKTEMTNVDISAAVSELQKVINGKLDKAFLVNNQDGKELILKVHI
FT                   PEIGSREIAIGLGKYKYITITEYEREKPRNPHSFVMLLRKHLKNIKITSVAQHNFDRIV
FT                   IFNFEWNELKYKLIIELFGDGNAILLDSEDKIILPLKIERWSTRKIVPKEIYKFPPQKD
FT                   LDPKNLDYSLAKELFIEEFQKEENNDTEVVRIISRTFGLAGVYSEEICLISEIDKNLKN
FT                   PKNEEIEKLFEGSKVFFNRVFNEIKPKSTLKNGEFVDISPIDLKMHENLKENEIKHYES
FT                   FLTALDEYFSRFIMKKEIKQAESKLQKLVKKQERILKSQLETKEKYEKQSLSNHKRGDL
FT                   IYANYSLVDEIVGTIKDAREKMDWNGIKKIIKENKTHPILSKIINVNEKNAELTLKLSA
FT                   DYGNGLIEDTVPVDLRKNAFENADIVYQKSKKFKHKVQGVIEALKISEKKLAELKDKEK
FT                   LDSEILKEKEEKIKKKERKVLKWYEKLKWTVIGGYLIVAGKDATTNEMLIKRYVEKNDI
FT                   VFHTLMEGAPFTIIRTEGSEEIPDENVLFEVAKFASSHSRAWKLGIGSADVYWVRPDQI
FT                   SKTAESGEYLKKGAFVIRGKRNFIRSAALELGIGMLTYDGKLRVTTAPESVAKETFEKC
FT                   ILLKPGKLKKSDLVKELLKEFSDFEIDDEDILRALPPGESEIKLK"
FT   gene            complement(524811..525065)
FT                   /locus_tag="MmarC5_0567"
FT   CDS_pept        complement(524811..525065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34881"
FT                   /db_xref="GOA:A4FXF2"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXF2"
FT                   /protein_id="ABO34881.1"
FT                   /translation="MNLSYAEDEFRKLLLDTIFVSSIVIGVPLLICLFVTRHSIIGIFF
FT                   SVLFSFIIIYWLLFRKSVLLTVGFQNKRHFHIKKLKKDD"
FT   gene            526157..527857
FT                   /locus_tag="MmarC5_0568"
FT   CDS_pept        526157..527857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0568"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: mmp:MMP1026 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34882"
FT                   /db_xref="GOA:A4FXF3"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXF3"
FT                   /protein_id="ABO34882.1"
FT                   /translation="MDVENLIITTLKDKVRELTGNEMDIRLDEPPAINMGDYSTNISFR
FT                   LAKDLKKAPKMIAEDIANSLSILGIEKIEAVNGYINFFMNYSDFSKETVSKISAEKENF
FT                   GKLEKRDEKVILEHTSANPNGPFHIGHGRNMVIGDSLKRILIASGYDVETQYYVNDMGR
FT                   QEAIVVFGNERFELDKSKKADHAIGEVYVETNKLLAENEELEQEILNLMKNYEEACEAG
FT                   IENELTEKFKNAVDYSLGGFKETLSTLNIYHDKFVWESEFVKSGMVRDVIKRLMDTGKV
FT                   VEDEVFRLDLSDYGLEKKLVLARLNGTSLYSTRDIVYHINKMENCDFAVNLLGADHKLT
FT                   AVMVNKTLALLGYNEAEVVFYEFISLPEGSMSTRRGRFISMDELFEEAKSRAAEEVRKR
FT                   GVAENEEEIEEIAKRIAVGAVRYNIVRIAPEKPMVFRWDEALDFEKVGCPVIQYAHARC
FT                   SRILENVETISNDNLFAYEMNENEKTIVKLLSKLPKIVEKAAEVRKPQIVANYVLDVAQ
FT                   GFNKFYANCPVLKEENETIKNSRLAIVNTTKTVLENTLDLLGIEMPGKM"
FT   gene            527978..528481
FT                   /locus_tag="MmarC5_0569"
FT   CDS_pept        527978..528481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34883"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXF4"
FT                   /protein_id="ABO34883.1"
FT                   /translation="MDVYDILFLKCTEYEVVVNERHVPLWMLNEGDEERINFDLPWTNL
FT                   QDLAIYLYELKREQQKSKELLKCNLEEIIVGISYLKSKKSGSLLSDESMAIKACMDYLS
FT                   EFITARINCIYRYHYPMKTPTNKSLFDEVILKFPQKKDIKAKNRQDFEEVISRLKKYDF
FT                   NLQN"
FT   gene            528494..530626
FT                   /locus_tag="MmarC5_0570"
FT   CDS_pept        528494..530626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0570"
FT                   /product="replicative DNA helicase Mcm"
FT                   /EC_number="3.6.1.-"
FT                   /note="PFAM: magnesium chelatase, ChlI subunit; MCM family
FT                   protein; ATPase associated with various cellular
FT                   activities, AAA_5; KEGG: mmp:MMP1024 MCM family related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34884"
FT                   /db_xref="GOA:A4FXF5"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXF5"
FT                   /protein_id="ABO34884.1"
FT                   /translation="MEFDEEVFLTFYGDKLKKYMKDQISQKMVKNNVFEFDICDFLKNY
FT                   SDSCDINDQIIENPKLVEDPLLYIFKDAYMELFGEDEHIKKELEKTQIAFKNPLGCDKK
FT                   IDEITSSEMNRLVKFEGNIIKAAKVCALLKKACFVCRACGEISYKTVHDYFEQPRSYCK
FT                   NQNCRSEMSIDYDSSAYVNIQELEIQQPIDLMRNPDDPPRSIRVFLENSDGIYSGRVDV
FT                   VGTVMKKLTRPNMPVFEIYAKSNYVKLGESFQKIEVKDIINNYDLINTLDELGKKENII
FT                   DILSNYLIPQIKGYDLVKKSIFLQQVKACTKFLPDGSELRKDSHILLITDPGIGKSTML
FT                   RKISRLFPQNSYASVTTATGGGLTANVVREATEIGDGWVVKPGVFVRANEGTACIDELT
FT                   VDKNVMKYILEAMESQTIHVNKGGINVKLPARCAVLAACNPKRGRFDRNMGVVEQIGIP
FT                   APLLSRFDLIFPLKDSPDKRRDAEIAEHILDTHIETATKNYSKVLGSIEIDGITVDENL
FT                   IKNYIIYARTCAYFDENHHLYSGEVDERKIKSPPLSKDAKKLIRDYYVDMRKLGEGDNP
FT                   VPVTARQLEAAIRISEMHAKARLSREVEEKDAKIAIDIIEECLRQVAYDPETGKFDIDK
FT                   GMGEIPKSKLDKMDKIVDIIRELSVLSSSGLADEDDIVEKASEFQISEKEVSDLLSKLK
FT                   KSADVFSPKYGYYRLT"
FT   gene            530738..531340
FT                   /locus_tag="MmarC5_0571"
FT   CDS_pept        530738..531340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0571"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmp:MMP1023
FT                   transcriptional regulator, TetR family member"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34885"
FT                   /db_xref="GOA:A4FXF6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXF6"
FT                   /protein_id="ABO34885.1"
FT                   /translation="MSTKEKIVQNAAKLFLTKGYNQTSLNEIAEKTGITKGGIYHHFKD
FT                   KNELFVEMAEAFKSKFMTLVSKMEQETSLENLLKNYFENSEILIHEMAEYLEFNMEDIK
FT                   YFSEFQSRFTLDAIQYGPKDMDFTMTTKMMYSILKKKIELAKKNGEILEDIDSKELSLE
FT                   IIAIIEGYSNLRRLKLMNDSYDYGNRCLERLWNRIKK"
FT   gene            531422..532579
FT                   /locus_tag="MmarC5_0572"
FT   CDS_pept        531422..532579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34886"
FT                   /db_xref="GOA:A4FXF7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXF7"
FT                   /protein_id="ABO34886.1"
FT                   /translation="MKAEKILQKIAEASEKRPFVVVAVVIVLTIFMAFMATGVESQTDY
FT                   EKMVPQDDPVIVSMNEIRDEFGGTETVMLGIKLVASDSSEKVTDIRDPRVLELVDFLEQ
FT                   DIGSMDMVTSVSSKVDILRAYNNNVIPNDIATVKTIYQNLPESSQDGIFNDDYSMVVVY
FT                   ATTDAGTEDKKKLVKEINARLEESPIPTGVEVVTTGTPALSELIRRMMDESQAVTGAAS
FT                   LLAIFTILLLYFRNFVKSILPLIPVIVAVIWAAGAMAIFGIPMDTATSVMGSLLLGLGI
FT                   DYGVHLYHRYEEELREGKTLEEAINIAVVSTGSAVLVTTVTTMAGFAALTIAPLSMMSN
FT                   MGKVCTLGIFFCMAAVICLLPPLIVIEERYTRPFLNKLTLKLKGE"
FT   sig_peptide     531422..531538
FT                   /locus_tag="MmarC5_0572"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.853) with cleavage site probability 0.582 at
FT                   residue 39"
FT   gene            532581..534146
FT                   /locus_tag="MmarC5_0573"
FT   CDS_pept        532581..534146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34887"
FT                   /db_xref="GOA:A4FXF8"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXF8"
FT                   /protein_id="ABO34887.1"
FT                   /translation="MSKLSKIILAIGLLSILATAVSALEIDEPQYNPNVIHPGDDVDVW
FT                   IDVANDEGSDETIEDLRITVTSKYPFEVKQVNPTKGVYTISSLSEGGSDTAYFKLHINE
FT                   DASSRDYRLDVKVSYDIVEYKNGDRVVTSRSFTKVYYIPVYGLANFEINSDGVTLTPAK
FT                   TESVQLKVMNKGTGTAKDATLTIGSNDLINPVDSTKFYLGSLSPDVTKLLSINLHASGD
FT                   TTEGSYLIPATLSWIDEDGTENSEIINIGFIVEGDINLGISNVITDPTEIKAQETYVKI
FT                   DVDITNNGHGETKNVEIDLLSEDPFTDSWSNSNFKNIGILNSGDTKTAVFYIDVDKDAK
FT                   SGHYAVPLNITYMDVFDEEYSEIEYIDLYIKPKPVLEILPETYTLKAGDENTITLTLQN
FT                   TGSEKAQSVKISAIKNSAQPFEFTQKTDSIGTLDLNETGEGQLIIDVDSDAANKEYLIT
FT                   VEVRSVGDSEKGDDNVYLSQKTVRVNVEGGGNSTVVYLAVLLLVGGLGYYMYLKRKKEK
FT                   EQTE"
FT   sig_peptide     532581..532652
FT                   /locus_tag="MmarC5_0573"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.832 at
FT                   residue 24"
FT   gene            534310..535275
FT                   /locus_tag="MmarC5_0574"
FT   CDS_pept        534310..535275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0574"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mmp:MMP1020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34888"
FT                   /db_xref="GOA:A4FXF9"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXF9"
FT                   /protein_id="ABO34888.1"
FT                   /translation="MIFSFFALSYMLWPFIGIIALAVAVAYMTKPLYDVLKPKLGRSYG
FT                   AIFCLLGIVIPSLLLVTLVAEDVITFLLSLDIDSIMLQVTPILSDMGYLGVPPSDVSQP
FT                   VSDIWGVSKPLLNNLATQISAVPSLLMRLLFLSFMTFYFLKDGDKIKDSFLLYIPKEKK
FT                   RNTLLFVNEIHKALKTLFIGNVVTSLIVGFISIIGYWLIGLPNPITLGALSGILNILPV
FT                   VGGWTIYVPLTVYYLLTGEFTKGILLGFFGIVFLSLAPDFAIRPRVISKDGDLHPALVL
FT                   IAFLIGPLVFGIPGLAIGPIIVALVYAIHKVRKIVESGEN"
FT   sig_peptide     534310..534384
FT                   /locus_tag="MmarC5_0574"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.821) with cleavage site probability 0.325 at
FT                   residue 25"
FT   gene            complement(535281..536090)
FT                   /locus_tag="MmarC5_0575"
FT   CDS_pept        complement(535281..536090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0575"
FT                   /product="PEGA domain protein"
FT                   /note="PFAM: PEGA domain protein; KEGG: mmp:MMP1019
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34889"
FT                   /db_xref="GOA:A4FXG0"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXG0"
FT                   /protein_id="ABO34889.1"
FT                   /translation="MFKKSVFILLLCIILNIISVSAVPYLDAEISDLKIERGTTDRIYV
FT                   EVKEISGTSNAHKITVIPEIYGDNVKISPENIEIPIIGDGTIIKVSFKINTSKDTELGE
FT                   KSGKIIIEYYDYDSENDVYLGPKTIQKEFTCEIIEGYGTYSINSNPENISIYLDGNYIG
FT                   NTPLNASVKEGNHFLRLSSETFGNYSEKITVNAGESGSIFKNFKEAEKIENLDNVSENI
FT                   FISENTSESSSDFSEVSKNIGFEGILVYFGFLLAALFIIFTVTKNKY"
FT   sig_peptide     complement(536022..536090)
FT                   /locus_tag="MmarC5_0575"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.862 at
FT                   residue 23"
FT   gene            complement(536146..537624)
FT                   /locus_tag="MmarC5_0576"
FT   CDS_pept        complement(536146..537624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0576"
FT                   /product="(R)-citramalate synthase"
FT                   /EC_number="2.3.3.-"
FT                   /note="TIGRFAM: isopropylmalate/citramalate/homocitrate
FT                   synthases; PFAM: pyruvate carboxyltransferase; LeuA
FT                   allosteric (dimerisation) domain; KEGG: mmp:MMP1018
FT                   (R)-citramalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34890"
FT                   /db_xref="GOA:A4FXG1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011830"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024890"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXG1"
FT                   /protein_id="ABO34890.1"
FT                   /translation="MVNIFDTTLRDGEQTPGVSLSPSEKLELAIKLDELGANIIEAGSA
FT                   ITSKGEREAIKLVAEQKLNAEISSFVRALPVDIDAALSCNVDSVHLVVPTSDIHMEYKL
FT                   RKTREENLAGAMHAVEYAKDHGLIVELSAEDATRSDVEFLKELFKKGEELKADRICICD
FT                   TVGILTPVKSIELIKTMKNAIKIPISIHCHNDFGMATANTLSAISAGADQCHVTINGIG
FT                   ERAGNASLEEVVMSLKSLYNIDTTIQSEKLYKISRIVSKYMKLSVPANKALVGDNAFAH
FT                   EAGIHVDGLMKSTETYEPIGPEAVGNRRKIILGKHSGKAALKYKLELMNIGLSHEEFEE
FT                   VYSKIKSFGDLGKYISDIDLKTVISQVQGVELERKVILDEITVMSGNKVSPLASINLKF
FT                   ANDCNIKDNIREAAYGLGPVDAAINAVKKALTGVADIELEDYSVRAMTGGTDALIEVVV
FT                   HLRKGNEVVEVKKAHGDVVMASVEAMMDGINLLI"
FT   gene            537777..539183
FT                   /locus_tag="MmarC5_0577"
FT   CDS_pept        537777..539183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0577"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: mmp:MMP1017 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class;
FT                   PFAM: aspartate/glutamate/uridylate kinase; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34891"
FT                   /db_xref="GOA:A4FXG2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXG2"
FT                   /protein_id="ABO34891.1"
FT                   /translation="MVTVMKFGGTSVGNGERIRNVAKIVVNKTNEDKDVVVVTSAMTQV
FT                   TNSLVEISAQALDVRDIAKINNFIEDLRRKHEIAIEQAIENHDIRVEVSKTIQSSINDL
FT                   EKVLVGVSYLGELTPKSKDFILSFGERLSAPILSGAIRDMGKHSLFLAGRDAGIITDDT
FT                   FTCAKILRLDVADKIEPLLKDGFIPVVTGFVAGTEEGHITTLGRGGSDYSAALVGRGLM
FT                   ANMVEIWTDVSGVLSADPRMVENVKKIPKMSYIEAMELAYFGAKVLHPRTMEPVMEKKI
FT                   PLRIKNTFEPENEGTLITDSSETSNGVIKAITTIKDVILINIFGGGMVGVSGTAARIFN
FT                   VLGKSNANVILITQGSSETNISIVIYDGELEAKKCVRELRSEFGECHLIKDISFDKDVC
FT                   VVSVVGSGMKGAKGIAGKLFDAVAESGANIKMIAQGSSETNISFVINEDKLEPCLKNLH
FT                   KTFVEDDINF"
FT   gene            complement(539227..540468)
FT                   /locus_tag="MmarC5_0578"
FT   CDS_pept        complement(539227..540468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0578"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmp:MMP1016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34892"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR014651"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXG3"
FT                   /protein_id="ABO34892.1"
FT                   /translation="MKEQAIDIATKDVVTVNPDTPISKAVGIMENRKFHNLIIEKDDDI
FT                   YLVTMHDLLLGNSVHQQVEDLMFKPFCVRMNTQVIDAAFEMINSGQRVAPVINENDELI
FT                   GIITDYDVMRCASQSELLKDVKIDKIMTKSPVTIDIDESIGKARSLMMKYNIGRLVVLD
FT                   ADGKPIGMVTEDDIVKKVFKPKTKMTVGELTGDKMPRMAQPVSMIINKPLITADEDDSI
FT                   AAVADLMEKQDIRGIPIFKNDILRGIVTRLDILKYLRDLRAESMVEVEIQGDFDEDQRE
FT                   LAERILFNEIKKIAIYSKKIHWIKLAVKKERDKGGVPNYSVKTYVKTPRKLYVAEGKPK
FT                   LSSTKRIDWDGEEMELISEKQRWDFIEVLKDALDSVKKQISIDREKRQSKALNSGKKEI
FT                   MAEEFSETPTENEE"
FT   gene            complement(540675..540974)
FT                   /locus_tag="MmarC5_0579"
FT   CDS_pept        complement(540675..540974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0579"
FT                   /product="archaeal histone HmvA"
FT                   /note="PFAM: Transcription factor CBF/NF-Y/archaeal
FT                   histone; KEGG: mmp:MMP1015 transcription factor
FT                   CBF/NF-Y/archaeal histone:histone-fold/TFIID-TAF/NF-Y
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34893"
FT                   /db_xref="GOA:A4FXG4"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXG4"
FT                   /protein_id="ABO34893.1"
FT                   /translation="MIPKGTVKRIMKENTEMNVSAESVAALVEILQEMVVTTTKIAEEN
FT                   AANDKRKTLKARDIEQCDAERLRKKVVEVSERTEKVNMLTNEILNVIANELERY"
FT   gene            complement(541091..542158)
FT                   /locus_tag="MmarC5_0580"
FT   CDS_pept        complement(541091..542158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0580"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mmp:MMP1014 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34894"
FT                   /db_xref="GOA:A4FXG5"
FT                   /db_xref="InterPro:IPR005909"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXG5"
FT                   /protein_id="ABO34894.1"
FT                   /translation="MSMTDYLKNIREKHLKKRKERNPDYPIAVWIQDDVFRDKTFGKSF
FT                   TIILRTKGCKWAYESGGCTMCSYLMDASPAEITSENLKNQFDSAVEKYKDQLNKNMSIK
FT                   LFTSGSFLDTFEIPLETREYIFKRIEEMGAKEVAIESRAEFVTPENMESIKNILSCNIE
FT                   IGVGIESLNEKIRNVAIHKGAPTKAIENAFSVAKEYDVGIKAYILIKPPFISEKEAVAD
FT                   AIDTANRCIEMGCSRISFCPASIHKGTLIETLWKKNQYRPPFLWSILEILNEVKSKNPN
FT                   ALVMCDTAGVSSKRGAHNAIDCTCNDKIKDIFNEFTITQKIEKLDLDCECKKQWIEYME
FT                   YEQKNIVPLGDEKLI"
FT   gene            complement(542224..545469)
FT                   /locus_tag="MmarC5_0581"
FT   CDS_pept        complement(542224..545469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0581"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: ATP-dependent carboxylate-amine ligase
FT                   domain protein, ATP-grasp; Carbamoyl-phosphate synthase L
FT                   chain, ATP-binding; Carbamoyl-phosphate synthetase large
FT                   chain, oligomerisation; Carbamoyl-phosphate synthetase
FT                   large chain domain protein; MGS domain protein; RimK domain
FT                   protein ATP-grasp; KEGG: mmp:MMP1013 carbamoyl-phosphate
FT                   synthase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34895"
FT                   /db_xref="GOA:A4FXG6"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXG6"
FT                   /protein_id="ABO34895.1"
FT                   /translation="MKREDIKKVMILGSGPIVIGQAAEFDFSGSQACKSLKEEGIYTIL
FT                   VNSNPATIQTDTNIADKVYLEPLTPKILEKIIEKEQPDAILPTMGGQTGLNLAMELSKR
FT                   GILEKHGVELLGSTESVIETSEDRDLFNKAMKEINQPIAKSAAVHSVEEAIEATKELGY
FT                   PAIVRPAFTLGGTGGGVANNEEELIEITKKGLKYSMIKQVLIDQSLLGWKEYEYEVMRD
FT                   KNDTCIVVCNMENIDPMGIHTGESIVTAPSQTLSDEFHQRLRDASLQIIRHLKIEGGCN
FT                   VQFAVNPEMTDYVVIEVNPRVSRSSALASKATGYPIAKIAAKIAIGRTLDEIQNDVTKE
FT                   TPASFEPTIDYVVVKIPRWPFDKFRTVGKKLGTSMKSTGEIMAIGRNLEEALQKAVRSL
FT                   DIGRFGIIADGKDKEYSNSEIVDILEHATDERLFVIAYALDKGWSVDGICERTGINPFF
FT                   IEKIKKIIDCKKELEVISRLPVADEKLKEILLKAKSLGFSDVQVSKIFSKTENEIRDLR
FT                   KRLEVIPVYKMVDTCAAEFEAKTPYYYSAYERYFDEEQNESISSDRKKVIILGSGPIRI
FT                   GQGVEFDYSTVHAIFALKELGIEAIIVNNNPETVSTDYDTSDKLYFEPLVYEEIMNIIE
FT                   NENKNGQLLGVIVQFGGQTAINLAMKLYNSGVNILGTSPQSIDLAEDRDQFIHVLEKLK
FT                   IPQADGATAVSEEQALKVVEKIGYPALVRPSYVLGGRAMQIVYNTEDLKDYMREAVKVS
FT                   SDHPILIDKFLEEAVEVDVDAVCDGESVFIGAIMEHIEEAGIHSGDSACVIPPQTLSKE
FT                   VIEKIAEHTTKLALELGVIGLLNIQYAVKDGVVYIIEANPRASRTIPYVSKSVGVPLAK
FT                   IATNAIMGKKLKEMGYSGLAKAKYVSVKEAVFPFLKLPGVDPVLSPEMKSTGEAIGIDQ
FT                   DFGKAFYKSQLSANMELPTSGTVFISVRNRDKDNITKIAKKYHNLGFEIVATRGTAREL
FT                   RLFDIPVREVRKISESMQNSVLDLMQKGEVDLLINTSSGDKAKTDGYYIRRAAVELNIP
FT                   CMTTLQGAYAAIKAIEAIKSGELGVYSLNELEN"
FT   gene            545748..546497
FT                   /locus_tag="MmarC5_0582"
FT   CDS_pept        545748..546497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0582"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: mmp:MMP1012 exonuclease III; TIGRFAM:
FT                   exodeoxyribonuclease III; exodeoxyribonuclease III Xth;
FT                   PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34896"
FT                   /db_xref="GOA:A4FXG7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXG7"
FT                   /protein_id="ABO34896.1"
FT                   /translation="MKMLSWNVNGIRACLKNGFMDFLKRESPDVMCIQETKVQSGQVQL
FT                   GLDGYFQYWNYAERKGYSGTAVFTKIKPNEVIYGIKNSEHNGEGRVITLKFDEYYLVNV
FT                   YTPNSQRGLTRLKYRQKWDQDFLNYVKTLENKKPVIFCGDLNVAHKEIDLKNPKTNVKN
FT                   AGFTPEERKGFDNIVNSGFLDTFREFNKEPDNYSWWSYRFNARARNIGWRIDYFCISES
FT                   LRNNLKDAFIMSEIMGSDHCPVGIIFD"
FT   gene            546648..548315
FT                   /locus_tag="MmarC5_0583"
FT   CDS_pept        546648..548315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0583"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="KEGG: mmp:MMP1011 glutamyl-tRNA synthetase; TIGRFAM:
FT                   glutamyl-tRNA synthetase; PFAM: glutamyl-tRNA synthetase,
FT                   class Ic"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34897"
FT                   /db_xref="GOA:A4FXG8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXG8"
FT                   /protein_id="ABO34897.1"
FT                   /translation="MKDTVMAYLLENSIKFKGKPNPKAAMGKILGENPDLRSKVKEVNQ
FT                   VISEVVKEIETMSLEEQQAKLDELAPEGLGQKTERKRKEIELKNVKGNVVMRFAPNPSG
FT                   PLHIGHARASVLNDFFTKKYNGKLVLRLEDTDAKRVLPEAYEMIQEDLKWLGVKVDEVI
FT                   VQSERLETYYEYGRKLIEMGQAYVCDCDADEFRTLREQGTLCKCRDTIPEENLKLWEKM
FT                   LAGELDNVAVRLKTDIAHKNPSIRDFPIFRIERTPHPKNGIKYHVYPLMNLSVTVDDHL
FT                   LGMTHVLRGKDHIVNTEKQEYIYNYFGWEIPEYVHYGILKIEGPVLSTSKMHAGILSGE
FT                   YSGWDDARLGTLRALRKRGIRPEALYKLMVEIGIKQADVRFAWENLYAANKDIIDKDAR
FT                   RFFFVESPKKLVISGADSRKIDLRMHPDRSELGNRELLFDGEIYVSDDLEAGKMYRLME
FT                   LFNIVVEKVENDILYAKYDSDDFAIAKSNKASIIHWIPVKDSVPVTVIDENAEKIEGFA
FT                   EKDFAVVKEDDFVQFERFGFVRIDEKVDNGYTCYLTHK"
FT   gene            548429..549325
FT                   /locus_tag="MmarC5_0584"
FT   CDS_pept        548429..549325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0584"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   pseudouridine synthase; KEGG: mmp:MMP1010 pseudouridine
FT                   synthase:pseudouridine synthase, Rlu. related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34898"
FT                   /db_xref="GOA:A4FXG9"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXG9"
FT                   /protein_id="ABO34898.1"
FT                   /translation="MESQKKILKVTIDSKIAGNKLIDVLKDDFELSNKMIKKFDKEKKI
FT                   FVNSKNISLKSKLKENETVSVEIDCGINNIDPEKLLLCVIYEDDDLLIVDKPKNMVVHP
FT                   TKNVLSGTLANAISNHQKINNQNYKIRFVNRLDMDTTGLLIIAKNSYSHQQLAKQMDEG
FT                   ILEKIYIVVVNGHLDSKEGVIEDSIDLNDDGIKRELSTFGKISKTKYKVIEEFNNVSVL
FT                   EIKLLTGRTHQIRVHLSSFGNNIIGDTLYGKTADLIERQALHSHILRFIHPITKENMEI
FT                   RSKLPDDMENLIKNLKN"
FT   gene            549347..550603
FT                   /locus_tag="MmarC5_0585"
FT   CDS_pept        549347..550603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0585"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: mmp:MMP1009 dihydroorotase; TIGRFAM:
FT                   dihydroorotase, multifunctional complex type; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34899"
FT                   /db_xref="GOA:A4FXH0"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXH0"
FT                   /protein_id="ABO34899.1"
FT                   /translation="MVLLKNGKIVSDDNMMESDILIEDGIIQKIEKNIDYSGETIDLKG
FT                   NYVFPGFIDSHVHFRWGNPEKEDFVSGSEAAIAGGVVYAIDMPNNTPPVTTKEIFYKKM
FT                   KEGNEKSKINLYFAYGVTENNYLENVEEAKFYKIFMVKSVGDLFISDYSKLRVILDQNK
FT                   IFAIHAEHKNIISECSEKYELNSFENHCKIRSRESEIEAVKEVLNVLQKIDKESKNKPH
FT                   VHFCHISVKEALELIKNAKKTLKNVKVTVEVSPHHLFLNSKMAEDLKGCGKFNPPLREE
FT                   LDNLALLNGIIDGNVDVVATDHAPHLLNEKLNPVEKCPSGIPGIETLVPLIMDLVNEGK
FT                   ISIFDAYRVLSKNPSEIFKINNKIEIGNSANMTVVDMGKEYKISAKDFKSKAKFTPFEG
FT                   KTVKGKPVATLVNGKIYIL"
FT   gene            550937..551626
FT                   /locus_tag="MmarC5_0586"
FT   CDS_pept        550937..551626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0586"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   mmp:MMP1008 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34900"
FT                   /db_xref="GOA:A4FXH1"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXH1"
FT                   /protein_id="ABO34900.1"
FT                   /translation="MTINFKKQANAIKNFDKNPIIAEIKVHSPKYGDLLKGRSEMDILR
FT                   IYEEAGAVGISYITDKQHFNGNFDVFRKICENTELPVLRKDFLTTKDEIEKTASAGGST
FT                   VLIITRLLKEKTAEFVDFALECGLDTLVEVHNTEEIEIAKSTNTTMIGINNRDISKLEL
FT                   DDGTVSLTEQLADLIPKDRILVSESGIANLTDLKTALKYADAALIGTSFMTAENQKEFV
FT                   KSFVGGK"
FT   gene            551626..552591
FT                   /locus_tag="MmarC5_0587"
FT   CDS_pept        551626..552591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0587"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="KEGG: mmp:MMP1007 anthranilate
FT                   phosphoribosyltransferase; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase; PFAM: glycosyl transferase,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34901"
FT                   /db_xref="GOA:A4FXH2"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXH2"
FT                   /protein_id="ABO34901.1"
FT                   /translation="MLNKLIERENLSFKESYELFNMLLNESEMRIAAYLVALQTKGVTA
FT                   DEIAGFAKAMRDNAVKIDLGEVTDTCGTGGDGSKTINVSTAVSIILACFTKVAKHGNVS
FT                   ITSNSGSANVYEALGCKIPETPEDAKKSMDKTNFVFLFAQKYHPALKKIMPVRNELKVK
FT                   TIFNILGPLANPANPKYQILGVNSAELCENVAFALSKVGGIKKALLVYGNGLDELTPNG
FT                   TSKITEYDGKFDTYEVTPKDFGLDYSKIIPCESPDESAKRLIDVFSGKINEDRNFILMN
FT                   AAAALYTSEIASDFLDGVEIAKEAIESGKVLKKLEEIRNV"
FT   gene            552584..553903
FT                   /locus_tag="MmarC5_0588"
FT   CDS_pept        552584..553903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0588"
FT                   /product="anthranilate synthase, component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: mmp:MMP1006 anthranilate synthase component I;
FT                   TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Anthranilate synthase component I and chorismate binding
FT                   protein; Anthranilate synthase component I domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34902"
FT                   /db_xref="GOA:A4FXH3"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010116"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXH3"
FT                   /protein_id="ABO34902.1"
FT                   /translation="MYKLDYVNPLKLYGVLRDEGKYPVMLESRAKGQINARYTYISSNP
FT                   EYMLRIGNKTKMDNETISKESNPFKALKENFKITQKGDRFTGGYVGYIAYDCIHNYIGG
FT                   KIEEPSVFGYYDHMYVYDHETRNFYYHSETNNSEELRNAEATVEKAKNFKIEEEDGGIE
FT                   VLGCDADLDDYVKMVEKTKEYIYSGDAFQVVPSREYRLKNKFSAFQLYRNLRNVNPSPY
FT                   MFLLEFDKDVVGASPETMASVQNNILKVNPIAGTAPIGKTENETQKLAEMLLKDEKERA
FT                   EHMMLVDLARNDVRKVSKSGSIVLERFFDVVRYSHVQHIESEVLGTLKDNSTIFDAIEA
FT                   AFPAGTLTGAPKFRAMEIIDEVEKSRRKIYGGAVGYFSNSGNADLAIGIRMAEIDSVCR
FT                   VRAGGGVVADSVPENEYYETERKMAAMMKALGVQNDSDNR"
FT   gene            553884..554474
FT                   /locus_tag="MmarC5_0589"
FT   CDS_pept        553884..554474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0589"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   mmp:MMP1005 anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34903"
FT                   /db_xref="GOA:A4FXH4"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXH4"
FT                   /protein_id="ABO34903.1"
FT                   /translation="MIVIIDNKDSFVWNLADYASIYDSVKVVPNTISIGDLKKLNPDGI
FT                   IISPGPGAPENKRDVENCPEIIKTMDVPVLGVCLGHQTIAHIFGGKVGRIPPVHGKSSS
FT                   VTHDSKGIFKDIKNPFTAGRYHSLAVLEVPENFTVTATTEDGTVMGIRHNDMPIEGFQF
FT                   HPESVLTEFEEKEGLKIIENFVKFAKNYKSSKK"
FT   gene            554488..555114
FT                   /locus_tag="MmarC5_0590"
FT   CDS_pept        554488..555114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0590"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI); KEGG: mmp:MMP1004 N-(5'-phosphoribosyl)anthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34904"
FT                   /db_xref="GOA:A4FXH5"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXH5"
FT                   /protein_id="ABO34904.1"
FT                   /translation="MFIKICGIKTPEELEIVENYGNATGVILECVSKRRIGFETAKNLV
FT                   NLANIPVFAVSTTSDVSVWENIIELTGTNYLQMHSDIDQKAIDFIKNEYGCFIMKSFKI
FT                   PEKSESPENDAQKIISDIESYEVDRILLDTGKGCGQTHDHRISQILAKKFDIVLAGGLD
FT                   PDNVLKIVKTVKPFGVDVSSGVENNNSKDEELIKRFCENVKSVKL"
FT   gene            555111..556295
FT                   /locus_tag="MmarC5_0591"
FT   CDS_pept        555111..556295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0591"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: mmp:MMP1003 tryptophan synthase, beta chain;
FT                   TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34905"
FT                   /db_xref="GOA:A4FXH6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXH6"
FT                   /protein_id="ABO34905.1"
FT                   /translation="MKCEGYFGEFGGQFIPEVLMPAIDELKEAYFELKDDEDFQNELSY
FT                   YLKNYAGRETPLYYAENLTNKLGGAKIYLKREDLLHGGAHKTNNTIGQALLAKRMGKTR
FT                   IIAETGAGQHGVGTSMAGALFGLETEIFMGRLDTERQQPNVFRMKLLGAKVTPVDTGSK
FT                   VLKDAVNEAMRNWTATFENTHYLIGTVMGPHPFPTIVRDFQSVIGKEVKKQIMEQEGRL
FT                   PDHLIACIGGGSNALGLFHAFIQYKDVRMVGIEAAGKGLNTSLHGASISKGKKGVLHGM
FT                   LSYFLQDEDGQIEEAYSISAGLDYPGIGPEHAYLHDSGRAEYASATDDQALSAFMELTR
FT                   SEGIIPALESSHAVAYAIENAGNMDKDEIMVINLSGRGDKDLNTVIDIMQKRGM"
FT   gene            556296..557075
FT                   /locus_tag="MmarC5_0592"
FT   CDS_pept        556296..557075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0592"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: mmp:MMP1002 tryptophan synthase, alpha chain;
FT                   TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34906"
FT                   /db_xref="GOA:A4FXH7"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4FXH7"
FT                   /protein_id="ABO34906.1"
FT                   /translation="MNKPVLVSFLVSGDPNPDATLKFMKTLDKYSGVIELGIPFSDPVA
FT                   DGPTIQAADVRALSNGFKIAKSFEVLKEFRKESDTPVILMTYYNPVFKRGIENFVISAK
FT                   EAGAKGLIIVDLPLQEATEYREICKKHEMGTVFLAAPNTPEERLKISDEASTEFLYLIS
FT                   TFGITGARDTFEQMTFDFIKRARTTCKGKICVGFGISKGSHAESLIEQGADGVIVGSAF
FT                   VDIIKNYGDSEEALVKLEEFAKELSEGIDKGYEKRNK"
FT   gene            complement(557097..558317)
FT                   /locus_tag="MmarC5_0593"
FT   CDS_pept        complement(557097..558317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0593"
FT                   /product="Protein of unknown function DUF650, N-terminal
FT                   domain"
FT                   /note="PFAM: Protein of unknown function DUF650, N-terminal
FT                   domain; Protein of unknown function DUF651, archaea-like;
FT                   KEGG: mmp:MMP1001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34907"
FT                   /db_xref="GOA:A4FXH8"
FT                   /db_xref="InterPro:IPR006978"
FT                   /db_xref="InterPro:IPR006979"
FT                   /db_xref="InterPro:IPR033167"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXH8"
FT                   /protein_id="ABO34907.1"
FT                   /translation="MELFRSKTCALCKGRKLLCGRPRCPILEKFRVAKAVESKINKKEI
FT                   FGASPPSVFVGEFGYPNVRIGPMVPPVEGDTSFMDDPSRWDNISIPEIMEFRSMLVMGE
FT                   TNANVQVNKNSNLLNNIQELAMANKPVDSEIELKKAPKLELITGGFTPPVGPRESMLKF
FT                   RLAENPKIPRKSDYIVNDELKANEGMISLYDSGFDEYYIIKLLSTGLLGINKKLVPTKW
FT                   SITAAQDLLGKYVKKKIVENNQINDYEVYYKNFLGNRYAVLLIPDMYAFEMLEVWLKGS
FT                   LFSGENYQILGDFEDITGMKGYADEITGAFYASRLSILEYLKKRKKQAKILVFREITPE
FT                   YYAPVGVWQIRTGVKLAMENRLGKFNNLKSALEEIKKYLDVPMKDYETKSKILKSNQRQ
FT                   VTLDKFF"
FT   gene            558532..558780
FT                   /locus_tag="MmarC5_0594"
FT   CDS_pept        558532..558780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34908"
FT                   /db_xref="GOA:A4FXH9"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXH9"
FT                   /protein_id="ABO34908.1"
FT                   /translation="MNIIYILIVGLIIGYLFKSKIEKIDLSKPINFALLLLIFFMGVEA
FT                   GKVDLNAFSTFVVSMEFSIIVMVTSLLTAVFLGGRFR"
FT   gene            558777..559364
FT                   /locus_tag="MmarC5_0595"
FT   CDS_pept        558777..559364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0595"
FT                   /product="protein of unknown function DUF340, membrane"
FT                   /note="PFAM: protein of unknown function DUF340, membrane;
FT                   KEGG: mmp:MMP0999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34909"
FT                   /db_xref="GOA:A4FXI0"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXI0"
FT                   /protein_id="ABO34909.1"
FT                   /translation="MNFTVLVLIALILGFIVGKIFGIDFGNMYEIMLYIQILLIGIDLG
FT                   KSSGLRGVKKVGKFGILLPLFTIIGSLIGGIISSIVLDIPLKYALAIASGMGWYSLCGP
FT                   ILAEYSAIYGVMGFLVNLAREVLTIVCYSFVVKKFPKDMAITLGGGTSMDSTLPIIVKF
FT                   GGKDIMILSFVHGFILTLLIPFITPFILMLPL"
FT   gene            complement(559430..560344)
FT                   /locus_tag="MmarC5_0596"
FT   CDS_pept        complement(559430..560344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0596"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34910"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXI1"
FT                   /protein_id="ABO34910.1"
FT                   /translation="MTKISYKPLIALALAVFLSMSFAYAAAGGEKGTNTNYINSLPYTI
FT                   NDSGKYLLNVSESGLNGPAIEIIVDNVTLEGNGHYIEGDYIHNGYTQDCGVRALYVSGL
FT                   TIKDMNISGFASGICFMGVSDSTIFKNNIPNSDEDGIGIYEGCENIRVEQNSISECMFP
FT                   LYISTAYPYTIPITNVEIVNNEIIDSGLGITLSGNSANAKITSNDIINNSRGICAYIAT
FT                   DLKITSNDIVDAYQGIYLYMATNAKITSNDIVDAMILGMGIYDSNDCDIHGNKISSYGI
FT                   DLEILNNTDFKESGNKYNDSNII"
FT   sig_peptide     complement(560267..560344)
FT                   /locus_tag="MmarC5_0596"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.936 at
FT                   residue 26"
FT   gene            complement(560605..561090)
FT                   /locus_tag="MmarC5_0597"
FT   CDS_pept        complement(560605..561090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34911"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXI2"
FT                   /protein_id="ABO34911.1"
FT                   /translation="MNDITGPIYITANDVTFDGNRYHISGDGSGVYLINCKGATVKDTT
FT                   ISCQLAGIVLQNATNCMIEKNNVTGCCYGIALMCESDGNKIINNDVCNNNLGFYYGGGI
FT                   VALGYDCDGNKIHANTVLNNSYWYFTSWWPDWEKEFVPNDISLDEEVNDISGNHITE"
FT   gene            complement(561396..562109)
FT                   /locus_tag="MmarC5_0598"
FT   CDS_pept        complement(561396..562109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34912"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR019243"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXI3"
FT                   /protein_id="ABO34912.1"
FT                   /translation="MYQLYDDTQVNHQQEISMYAVEELSPEEIDGLILMREEEKLARDV
FT                   YLELYDIWGQQIFLNIANSESTHTNAVKLLLDKYNLTDPVTGDTRGVFTNQDLNELYAS
FT                   LVETGSTSLLDSLIVGATVEDLDIYDLQRLNEISDNQDITAVYDNLEKGSRNHLRSFTK
FT                   VIETNGGSYEPQYISESEYLEIISGDMETGTGYGAQGNLSTQSGQSNQYQGTSQDTEPQ
FT                   GVLGKFWQGVMNWLR"
FT   gene            complement(562467..563170)
FT                   /pseudo
FT                   /locus_tag="MmarC5_0599"
FT   gene            complement(563258..563545)
FT                   /locus_tag="MmarC5_0600"
FT   CDS_pept        complement(563258..563545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0600"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: mja:MJ1173
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34913"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXI4"
FT                   /protein_id="ABO34913.1"
FT                   /translation="MTYNIEISEDAYKAFKKLQKKNKKQLEIINKKIKEIMENPDHYKP
FT                   LRNDMKGIRRVHIDKSFVLTYKIDGNTIIILDFDHHDKIYLINLILESFE"
FT   gene            complement(563535..563765)
FT                   /locus_tag="MmarC5_0601"
FT   CDS_pept        complement(563535..563765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34914"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXI5"
FT                   /protein_id="ABO34914.1"
FT                   /translation="MAVKSFNVDEEVYSKFSKHCKDRGMSMSKQIEFFMRSIIEEEPEL
FT                   RQEYIEKIERICKGKFRKVNNFSEEFGLNDL"
FT   gene            complement(563889..564569)
FT                   /locus_tag="MmarC5_0602"
FT   CDS_pept        complement(563889..564569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0602"
FT                   /product="putative purine NTPase"
FT                   /note="KEGG: mmp:MMP0740 possible purine NTPase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34915"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXI6"
FT                   /protein_id="ABO34915.1"
FT                   /translation="MRIILDKIRKTIENNNENGRNILDNDKITLELGKLDNKVNGISKE
FT                   LKEHSKYFKDLDEGLPEYFEDIKNNTKKIQELGNTLDKILKYIEQEQKVKEQQDLKIKE
FT                   LEDRIKDLEHVNKNWTVVKTWMDNRKNNEKISSEKIKVMESKFNGIEKYINTERYKKTI
FT                   KRETDNEQVLSILKNGRSQPKDLVKNFKGGTKALYDTLKRLEKTSVIIRKKDGKQVFYE
FT                   LKQK"
FT   gene            complement(565249..565626)
FT                   /locus_tag="MmarC5_0603"
FT   CDS_pept        complement(565249..565626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34916"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVU1"
FT                   /protein_id="ABO34916.1"
FT                   /translation="MIRICPKCLKAVVHYEKEYLTGKVRPVFVDTENKCCGYLQTESVF
FT                   NNAKCSKLQILKTEAGKISKQLNLSEDVKYEFFENLKRFKRTRNEWKDYRVLEEALNYT
FT                   LSTLNIRLQNEQAILKKKVKI"
FT   gene            complement(566255..567163)
FT                   /locus_tag="MmarC5_0604"
FT   CDS_pept        complement(566255..567163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0604"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bha:BH2734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34917"
FT                   /db_xref="GOA:A4FVU2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVU2"
FT                   /protein_id="ABO34917.1"
FT                   /translation="MFKGINGSESWDIIEEVDKGWSEDKKYHIITKNGKQLLLRISDIK
FT                   FYERKQKEYNILCELSKMDFEMSKPVDFGICESGVYMLLTWVEGEDLETAILKKNTMEQ
FT                   YNLGIKSGKILKKIHSVNIPSNMDPWENRFNKKIDLKIKAYLECPLKYENGELFIEHIT
FT                   RNRHLLNDIGSTLQHGDYHIGNMILTYSGDVAIIDFNRYDFGDPFEEFNRIIWDVEVSK
FT                   AFAVGKIDGYFNGNIPEKFFQLLALYISVNTISSLPWAIPFGDEQINIMKEQASKALID
FT                   YDYFNTVIPKWYIDAKCMIDE"
FT   gene            complement(567262..568215)
FT                   /locus_tag="MmarC5_0605"
FT   CDS_pept        complement(567262..568215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0605"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   mja:MJ0871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34918"
FT                   /db_xref="GOA:A4FVU3"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR038880"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVU3"
FT                   /protein_id="ABO34918.1"
FT                   /translation="MNIFDFSVFSISLVSSATYTLEMASVVLLTMFVMNCLINMGVMKK
FT                   VSDFLYPFTKHLKMNQLSMYSILSCFFSPTVGYSILAEGYKDQKVTEKEIIGCSLANSF
FT                   PTIFSHTFTFFIPVAIPLLGMTGVFYILIRSGVALVKTIIGLFYLAIVSKDIDFEPKIE
FT                   EKKNTKNIFNKSLNSTLKISRRIIPIMFITTFIVLYFSNSGVFEYVIVIITPFTGFLDL
FT                   DPSVGILVIADLINIQTAMVMGSGLLENGVLNSKEVIIGLIFANILSISTRYTKHSIPL
FT                   HVSLFGSKLGTKIVMINAFITLLIDIFIIGVLIVFS"
FT   gene            complement(568499..569278)
FT                   /locus_tag="MmarC5_0606"
FT   CDS_pept        complement(568499..569278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0606"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   mth:MTH571 nitrogenase reductase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34919"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVU4"
FT                   /protein_id="ABO34919.1"
FT                   /translation="MPKMVICGRGGCGKSTLITLMAQKIEEQGKKVLIVDSDESNLGLS
FT                   TMVGTGPAEKTLMNYMGGRPVVGAKLRARIKNEGDEKVPLFEKSKLDELSSEFVSWTGN
FT                   KGFMQIGKIEHSHEGCACPMGVIARDFLTNLTVNDNEWVLVDTEAGVEHFGRGIVGGVD
FT                   SVVMVVDPSNDAVLLSEKISGLSKEAGKPFGVILNRVDDETKTILEDALSKKNIPILGV
FT                   IPYSITMARENLKGNRLDNIMIEGDVGEMLKKVESQQ"
FT   gene            complement(569506..570363)
FT                   /locus_tag="MmarC5_0607"
FT   CDS_pept        complement(569506..570363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0607"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: putative methyltransferase; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: mla:Mlab_1686 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34920"
FT                   /db_xref="GOA:A4FVU5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4FVU5"
FT                   /protein_id="ABO34920.1"
FT                   /translation="MENIGKVHNHTTEDNLKMPHLWRQAISGIEITGAEDEIFTDKYSH
FT                   YMVIHDPLKTKFHKNIEELNKRFCNSLGVSVVSYIQKEGDMHYVRGLMAENGARIYSIL
FT                   PYTSFDQIKEAKFPQTSMEPRKMEAFNSLLPSLNGKNILDVGCGIGSLAINMAKAKPES
FT                   IIYGVDIIDGSIEQCKLNAKIEGVTNTHFAVASAYELPFEDEYFDTVTCFFMLHHLDDV
FT                   AKALQDIKRVLKPSGEVFAVEPIDHFHGVQRGPEDWKALFLEAGYSVEAWEKNNVSYIH
FT                   AVLK"
FT   gene            571332..571612
FT                   /pseudo
FT                   /locus_tag="MmarC5_0608"
FT   gene            complement(571653..573437)
FT                   /locus_tag="MmarC5_0609"
FT   CDS_pept        complement(571653..573437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0609"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   PFAM: Radical SAM domain protein; KEGG: mja:MJ0634
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34921"
FT                   /db_xref="GOA:A4FXI7"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXI7"
FT                   /protein_id="ABO34921.1"
FT                   /translation="MQNDHFNSKMEHLFKIDPNFHDILRKSKDVDDLRHNLYEYLNSIE
FT                   KMLYFENTVFPKLEIINMKECIKTFKNVLSPKNEKLAGFSAITALWKLYRGETSGISLG
FT                   FLNEFIYLLKGINGKSGIYMEKFPEFFKFSGRNSAVLRSKDLDKLSNEVEYYIGRYPSG
FT                   LSKKVSEKRKENKKRILNYFGANEENWNDWNWQLENVVINSKTLENLVALSVSEKNAIE
FT                   KARQNNIPFGITPYYVSLMDNTTDRKYDHAVRAQVIPPLNYVEKTAEARNSGESLDFMG
FT                   ETDTSPVDLVTRRYPMIAIMKPYETCAQICVYCQRNWQIKDVFSKNALAKKESVENAIE
FT                   WFRNNESIKEVLLTGGDPGILSEEYLAYLLSEFSEIKHLERIRIGTRTPVVLPQRITDE
FT                   FTEVLGHYNEPGIREVAVSTHIEHVYEVTKDLKDAVSKLKNNGIYVYNQQVFTVENSRR
FT                   FETSALRKALKLVGIEPYYLFNTKGKEETVNYRVPIARALQERKEEARLLPGYCRTDST
FT                   VFNVPKLGKNNLNFYQDHDLIMILKDGSRVYEFHPWEKNIALTKTYIYKDVPIQNYLNE
FT                   LKRRGEKIEDYQSIWYYF"
FT   gene            574300..575262
FT                   /locus_tag="MmarC5_0610"
FT   CDS_pept        574300..575262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0610"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG: mmp:MMP0190
FT                   Ca2+:cation antiporter, CaCA family"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34922"
FT                   /db_xref="GOA:A4FXI8"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXI8"
FT                   /protein_id="ABO34922.1"
FT                   /translation="MLGYLLLYMIFGGILLAYGSDWFIEGSTRVAKHFNVSNFVIGATI
FT                   VAFGTSLPEIVTSSGAALSGSPGLAVGNAIGSCIANIGIILGISVLMYPLIIKKRAIIK
FT                   NGNIYLIATILLVILGYNGFSRFDGLILFLFMIIYVIYTIKTSESDEEEIISDITVKKA
FT                   SIFIVVGLLAVILGSDLFIGGAKGIAEYFNVPESIIGFSLVAFGTSLPELASSVAAAKR
FT                   KLGSIVLGNVIGSNIANTCVALSFSAMIVDIPKYNVELMVNTIMALLIIFTMNREKIKK
FT                   MLNFKNFRTDYFSKIDRIDGISYILIYLIFLAYLLGYIF"
FT   gene            576952..577392
FT                   /locus_tag="MmarC5_0611"
FT   CDS_pept        576952..577392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0611"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   mja:MJECL36 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34923"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXI9"
FT                   /protein_id="ABO34923.1"
FT                   /translation="MNYFLCITTEENAKVILDKKIWGVSKNYKNSISKVSPGDHLIIYE
FT                   MGKSKTKTSEAKPQYIRAVYEVTSELKEDTKKIFEAHPNNPKEVYPLRVKLNEVKIFEK
FT                   PILFKELVPEMEFIKNKKQWSGSLRRAMAQINEGDYKRIIGN"
FT   gene            577422..577946
FT                   /locus_tag="MmarC5_0612"
FT   CDS_pept        577422..577946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0612"
FT                   /product="TATA-box binding protein"
FT                   /note="PFAM: TATA-box binding; KEGG: mja:MJ0507
FT                   transcription initiation factor IID, TATA-box binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34924"
FT                   /db_xref="GOA:A4FXJ0"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXJ0"
FT                   /protein_id="ABO34924.1"
FT                   /translation="MELPEINIVNVVGSCDLKTPMNLEKIYPLIENSEYDPERYHCIYI
FT                   RTPGIKRLVTIFKSGKLNTAGSKSIEEAKSAVLEIVDKLNELGFTDKRPEVKIYNIVAN
FT                   ISFNKKFDLEEISENFGAEYEPEQFPGVVLKINDPKATFLIFKSGKIVINGVKSNEELE
FT                   NAVRWICENLS"
FT   gene            578070..578645
FT                   /locus_tag="MmarC5_0613"
FT   CDS_pept        578070..578645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0613"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Tmden_0941 restriction modification system
FT                   DNA specificity domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34925"
FT                   /db_xref="GOA:A4FXJ1"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXJ1"
FT                   /protein_id="ABO34925.1"
FT                   /translation="MKLKDISSIRSGLLLSRKKSDDRSNANKYPLITLKSVDDSGVLNK
FT                   EFLDEFYTLEEISNEYLTSENDIIVRLREPVFACSIEKENEGLLIPSYFAKLSINEEYS
FT                   KEFLSKYVAHYINSKNAQKEFKKDTEGSVISMIKLKAIENLEIPEVLIEKQEKIIKIAE
FT                   FKQKELKLLKELTILKEKYYSKILENII"
FT   gene            578661..580145
FT                   /locus_tag="MmarC5_0614"
FT   CDS_pept        578661..580145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0614"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="TIGRFAM: type I restriction-modification system, M
FT                   subunit; PFAM: putative RNA methylase; N-6 DNA methylase;
FT                   KEGG: tdn:Tmden_0942 type I restriction-modification system
FT                   M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34926"
FT                   /db_xref="GOA:A4FXJ2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXJ2"
FT                   /protein_id="ABO34926.1"
FT                   /translation="MKTNQATINAILWKACDTFRGTINSDQYKDYILTMLFVKYLSDYY
FT                   KEKLEEYKEKYGDKEDRIQKSLSREKFILDESCTFEYIYKNRNAENLGEIINSALERIE
FT                   EDNKAKLEGVFRNIDFNSEAMLGKTKERNALLKHLLDDFNDPKLDLRPSKLAGNDVIGD
FT                   SYEYMIAYFASDAGKKGGEFFTPSQVSRLVAKLVSPKSGNRIYDPTCGSGSLLIKASKE
FT                   VPDNNFQIYGQEKNGQTYALCRMNMFLHEIDDAKIEWGDTIRNPLHLENDSLMKFDVVV
FT                   ANPPFSLDKWGDDYAENDPYKRFGYGIPPKSKGDYAFVEHMVYSANENGTVGVVLPHGV
FT                   LFRGASEGKIREGLINDNYLDAVIGLPQNLFFGTGIPACILVFKKNKITNDVIFIDASK
FT                   EFESGKNQNVLRDLDIEKIVETYKNRQDIEKYSHVASLEEIRENDYNLNIPRYVDTFEE
FT                   EEPVDLNQVKTDISKIEGELKDIQKEMDKYLDELGL"
FT   gene            580148..581401
FT                   /locus_tag="MmarC5_0615"
FT   CDS_pept        580148..581401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0615"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: yps:YPTB3881 possible restriction
FT                   modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34927"
FT                   /db_xref="GOA:A4FXJ3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXJ3"
FT                   /protein_id="ABO34927.1"
FT                   /translation="MEEVAEGYKETKIGVIPEDWQAVKLSESVNLFGGFAFSSEDSKSE
FT                   GVKWLKIANVGIDKITWENESYLPFEYLEKYSNYALSKNDIVMALTRPILNSKLKISKI
FT                   TDLDIPCLLNQRVGKLDPKQNTFGDYIYHSCKMPMFIHSMNVAMAGTDPPNIGFRDLSK
FT                   IQIPLPPLPEQQKIAEILSTWDNSIENLENLISKKIEIKKGLMQNLLTGNVRFPGFEDE
FT                   WKEVKIGSLLNEVKRKIEWDDSKLYDLVSLKRRSGGIFYRESLYGHQILTKTLQPIKED
FT                   DFLISKMQVLHGALGAVSKEFEDMYVSSSYAIFNSKTPEKFNIKFFDWLSKTPIMYHYA
FT                   YISSYGVHIEKMTFNLKLYLKEKVMVPNSIEEQESIVRVLSTQDKEIELLKQKLELVKT
FT                   QKKGLMQNLLTGKVRVNV"
FT   gene            581563..584637
FT                   /locus_tag="MmarC5_0616"
FT   CDS_pept        581563..584637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0616"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="KEGG: tdn:Tmden_0948 type I site-specific
FT                   deoxyribonuclease HsdR; TIGRFAM: type I site-specific
FT                   deoxyribonuclease, HsdR family; PFAM: type III restriction
FT                   enzyme, res subunit; protein of unknown function DUF450;
FT                   SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34928"
FT                   /db_xref="GOA:A4FXJ4"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXJ4"
FT                   /protein_id="ABO34928.1"
FT                   /translation="MSNPYINTEIKVQKDSIELLKNLGYEFISEDENKLLRNNLKEVIL
FT                   KDILKEQLNKLNSYNYKGKTYKFSEKSIENAIADLDVPLTEGLIKSNEHVYDQLILGNS
FT                   YEETLDDCSKRSFSIKYIDFDNPENNVFHVTEEYTVQKQNLNQTERNKRPDLILFVNGI
FT                   PLGIIELKRTSVSVETGISQVINYQNRDYIPHLFRYIQIAVAGNPGNVYYATTGTEKKF
FT                   WSVWKEDLSDDLLNSIVKNRIPTKLDKDIYSLFNKARFLEIIKEYTIFDANIKKIARYQ
FT                   QYFAIKETLKSIDNFDANGIRSGGLIWHTQGSGKSLTMVMLTRALKRKINNSKIVVVTD
FT                   RVDLDKQIKETFLHARLDVLRATTGQNLVKFLKENKDAVITTVINKFESAMRNDIINDS
FT                   SNVFVLVDESHRTQYGTFHAKMKKTFPHACYIGFTGTPLMKKEKNSFNKFGHMIHKYTM
FT                   DQAVADKAVVPLLYEGREVPQEITDKKWLDKKFELISRDLSDEQKEDLKKKWAIFQKVA
FT                   SSERRLEVIAIDINEHFKKNLLGTGFNAMLATNSKFEAVRYHKIFENYGDIKTAFVISP
FT                   PDLKEGVEELDDENKKLVQNEWGKIIKNYGSEEDYEDRIKSEFKAGEIDLLIVVDKLLT
FT                   GFDSPRTTTLYVDKELKDHRLLQAIARVNRLYDEKDCGFIIDYRGLLGKLDMALTSYTS
FT                   LANFDEEDLGTTMINTEQEIHLFKNYYSHLIDLFKPVKNKNDREEYEVFLANNDLRKEF
FT                   YKYLKHYVKHLGYALSSEQIYDLVDDLKKYKNALKFYVELRKNVSLRYYERIDFGKYEE
FT                   HMQKLLDTYIGASDVEHLTELVNIFDVENFNREIVRVEGGRAKADLIKSAVEKHIKHSF
FT                   DENPVYYQSLSDRIKEVLDKYHEKRISDEEYLKSMQHVLKDVQSKNMDLKTYPTLISES
FT                   QDAKIIFDNIYEYFGEYTGNGFEDDLAELSLKFDSEIKKNLKVNWVESQDVHNSIKQGI
FT                   DDILWNLEDEMDISVDNEKIIEKIMTMAISRYGKL"
FT   gene            584634..585302
FT                   /locus_tag="MmarC5_0617"
FT   CDS_pept        584634..585302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0617"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   mmp:MMP0838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34929"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXJ5"
FT                   /protein_id="ABO34929.1"
FT                   /translation="MIKSVEIVKKDIKNMYLSVNPDCSVILKAPINTPDSFIESFLKKK
FT                   ESWIEKQVTHFKSMGTVTAEKRYVSGESFKYLGKNYRLKVHKSTEERVSLYRGYIHLYV
FT                   ADKEDLDKKKQLIENWYTTKSKEKLFEIFIENYSKVTNNIPKFAVRKMKKRWGSCNSEK
FT                   NKIILNEKLIEKPKYCIEYVVFHELAHLKHPNHSRGFYNYLTYLMPDWEFRRERLNEVN
FT                   "
FT   gene            585360..586340
FT                   /locus_tag="MmarC5_0618"
FT   CDS_pept        585360..586340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC5_0618"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mja:MJECL37 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC5_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABO34930"
FT                   /db_xref="UniProtKB/TrEMBL:A4FXJ6"
FT                   /protein_id="ABO34930.1"
FT                   /translation="MLLLTSFSGCIDFKDDDDVFVAIMLSEQNSKSNLETISENNVQNV
FT                   SNENDSNTYDVQNISEEDRELLKNKMNNFSESLDLWMDSPEFDNFTIKLAKNISKLPRC
FT                   NISIPEGVTEYNSRVSNLTTCLHEYKNLAEGLNKDFNLEMPYADDFQINKFTSAAKTDE
FT                   LDDVLTTILLIDQYNSLIDSAENVVYKNRDSYAKFYTALAVFGVSIILIQENMAYKVSY
FT                   KIVGTVFIKSGLYKLVSNSGVLKFAMSITHWEIRDEIGSIPSNSDGIISNFKDGNISVN
FT                   MDAAKDTYENLKNESIVKDATGIVENVNVSETVETVGGIISGFIK"
FT   gene            complement(587109..590894)
FT                   /locus_tag="MmarC5_0619"
FT   CDS_pept        complement(587109..590894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /loc